(data stored in ACNUC8465 zone)

EMBL: CP001956

ID   CP001956; SV 1; circular; genomic DNA; STD; PRO; 2847757 BP.
XX
AC   CP001956;
XX
PR   Project:PRJNA12524;
XX
DT   25-MAR-2010 (Rel. 104, Created)
DT   18-SEP-2016 (Rel. 130, Last updated, Version 7)
XX
DE   Haloferax volcanii DS2, complete genome.
XX
KW   .
XX
OS   Haloferax volcanii DS2
OC   Archaea; Euryarchaeota; Stenosarchaea group; Halobacteria; Haloferacales;
OC   Haloferacaceae; Haloferax.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-2847757
RA   Hartman A.L., Norais C., Badger J.H., Delmas S., Haldenby S., Madupu R.,
RA   Robinson J., Khouri H., Ren Q., Lowe T.M., Maupin-Furlow J.,
RA   Pohlschroder M., Daniels C., Pfeiffer F., Allers T., Eisen J.A.;
RT   "The Complete Genome Sequence of Haloferax volcanii DS2, a Model Archaeon";
RL   PLoS One 5(3):E9605-E9605(2010).
XX
RN   [2]
RP   1-2847757
RA   Madupu R.M., Hartman A.L., Norais C., Badger J.A., Delma S., Haldenby S.,
RA   Khouri H., Ren Q., Lowe T., Robinson J., Furlow J.M., Pohlschroder M.,
RA   Pfeiffer T., Allers T., Daniels C., Eisen J.A.;
RT   ;
RL   Submitted (04-FEB-2010) to the INSDC.
RL   J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850,
RL   USA
XX
RN   [3]
RC   Protein update by submitter
RP   1-2847757
RA   Pfeiffer F.;
RT   ;
RL   Submitted (15-SEP-2016) to the INSDC.
RL   Computational Biology Group, Max-Planck Institute of Biochemistry, Am
RL   Klopferspitz 18, Martinsreid D-82152, Germany
XX
DR   MD5; fbf989f0da69b0aa3bca00252a16d259.
DR   BioSample; SAMN02604027.
DR   EnsemblGenomes-Gn; EBG00001183477.
DR   EnsemblGenomes-Gn; EBG00001183478.
DR   EnsemblGenomes-Gn; EBG00001183479.
DR   EnsemblGenomes-Gn; EBG00001183480.
DR   EnsemblGenomes-Gn; EBG00001183481.
DR   EnsemblGenomes-Gn; EBG00001183482.
DR   EnsemblGenomes-Gn; EBG00001183483.
DR   EnsemblGenomes-Gn; EBG00001183484.
DR   EnsemblGenomes-Gn; EBG00001183485.
DR   EnsemblGenomes-Gn; EBG00001183486.
DR   EnsemblGenomes-Gn; EBG00001183487.
DR   EnsemblGenomes-Gn; EBG00001183488.
DR   EnsemblGenomes-Gn; EBG00001183489.
DR   EnsemblGenomes-Gn; EBG00001183490.
DR   EnsemblGenomes-Gn; EBG00001183491.
DR   EnsemblGenomes-Gn; EBG00001183492.
DR   EnsemblGenomes-Gn; EBG00001183493.
DR   EnsemblGenomes-Gn; EBG00001183494.
DR   EnsemblGenomes-Gn; EBG00001183495.
DR   EnsemblGenomes-Gn; EBG00001183496.
DR   EnsemblGenomes-Gn; EBG00001183497.
DR   EnsemblGenomes-Gn; EBG00001183498.
DR   EnsemblGenomes-Gn; EBG00001183499.
DR   EnsemblGenomes-Gn; EBG00001183500.
DR   EnsemblGenomes-Gn; EBG00001183501.
DR   EnsemblGenomes-Gn; EBG00001183502.
DR   EnsemblGenomes-Gn; EBG00001183503.
DR   EnsemblGenomes-Gn; EBG00001183505.
DR   EnsemblGenomes-Gn; EBG00001183506.
DR   EnsemblGenomes-Gn; EBG00001183507.
DR   EnsemblGenomes-Gn; EBG00001183508.
DR   EnsemblGenomes-Gn; EBG00001183509.
DR   EnsemblGenomes-Gn; EBG00001183510.
DR   EnsemblGenomes-Gn; EBG00001183511.
DR   EnsemblGenomes-Gn; EBG00001183512.
DR   EnsemblGenomes-Gn; EBG00001183513.
DR   EnsemblGenomes-Gn; EBG00001183514.
DR   EnsemblGenomes-Gn; EBG00001183515.
DR   EnsemblGenomes-Gn; EBG00001183516.
DR   EnsemblGenomes-Gn; EBG00001183517.
DR   EnsemblGenomes-Gn; EBG00001183518.
DR   EnsemblGenomes-Gn; EBG00001183519.
DR   EnsemblGenomes-Gn; EBG00001183520.
DR   EnsemblGenomes-Gn; EBG00001183521.
DR   EnsemblGenomes-Gn; EBG00001183522.
DR   EnsemblGenomes-Gn; EBG00001183523.
DR   EnsemblGenomes-Gn; EBG00001183524.
DR   EnsemblGenomes-Gn; EBG00001183525.
DR   EnsemblGenomes-Gn; EBG00001183526.
DR   EnsemblGenomes-Gn; EBG00001183527.
DR   EnsemblGenomes-Gn; EBG00001183528.
DR   EnsemblGenomes-Gn; EBG00001183529.
DR   EnsemblGenomes-Gn; EBG00001183530.
DR   EnsemblGenomes-Gn; EBG00001183531.
DR   EnsemblGenomes-Gn; EBG00001183532.
DR   EnsemblGenomes-Gn; EBG00001183533.
DR   EnsemblGenomes-Gn; EBG00001183534.
DR   EnsemblGenomes-Gn; EBG00001183536.
DR   EnsemblGenomes-Gn; EBG00001183537.
DR   EnsemblGenomes-Gn; EBG00001183538.
DR   EnsemblGenomes-Gn; EBG00001183539.
DR   EnsemblGenomes-Gn; EBG00001183540.
DR   EnsemblGenomes-Gn; EBG00001183541.
DR   EnsemblGenomes-Gn; EBG00001183542.
DR   EnsemblGenomes-Gn; EBG00001183543.
DR   EnsemblGenomes-Gn; EBG00001183544.
DR   EnsemblGenomes-Gn; EBG00001183545.
DR   EnsemblGenomes-Gn; EBG00001183546.
DR   EnsemblGenomes-Gn; EBG00001183547.
DR   EnsemblGenomes-Gn; EBG00001183548.
DR   EnsemblGenomes-Gn; EBG00001183549.
DR   EnsemblGenomes-Gn; EBG00001183550.
DR   EnsemblGenomes-Gn; EBG00001183551.
DR   EnsemblGenomes-Gn; EBG00001183552.
DR   EnsemblGenomes-Gn; EBG00001183553.
DR   EnsemblGenomes-Gn; EBG00001183554.
DR   EnsemblGenomes-Gn; EBG00001183555.
DR   EnsemblGenomes-Gn; EBG00001183556.
DR   EnsemblGenomes-Gn; EBG00001183557.
DR   EnsemblGenomes-Gn; EBG00001183558.
DR   EnsemblGenomes-Gn; EBG00001183559.
DR   EnsemblGenomes-Gn; EBG00001183560.
DR   EnsemblGenomes-Gn; EBG00001183561.
DR   EnsemblGenomes-Gn; EBG00001183562.
DR   EnsemblGenomes-Gn; EBG00001183563.
DR   EnsemblGenomes-Gn; HVO_3016.
DR   EnsemblGenomes-Gn; HVO_3017.
DR   EnsemblGenomes-Gn; HVO_3018.
DR   EnsemblGenomes-Gn; HVO_3019.
DR   EnsemblGenomes-Gn; HVO_3020.
DR   EnsemblGenomes-Gn; HVO_3021.
DR   EnsemblGenomes-Gn; HVO_3022.
DR   EnsemblGenomes-Gn; HVO_3023.
DR   EnsemblGenomes-Gn; HVO_3024.
DR   EnsemblGenomes-Gn; HVO_3025.
DR   EnsemblGenomes-Gn; HVO_3026.
DR   EnsemblGenomes-Gn; HVO_3027.
DR   EnsemblGenomes-Gn; HVO_3028.
DR   EnsemblGenomes-Gn; HVO_3029.
DR   EnsemblGenomes-Gn; HVO_3030.
DR   EnsemblGenomes-Gn; HVO_3031.
DR   EnsemblGenomes-Gn; HVO_3032.
DR   EnsemblGenomes-Gn; HVO_3033.
DR   EnsemblGenomes-Gn; HVO_3034.
DR   EnsemblGenomes-Gn; HVO_3035.
DR   EnsemblGenomes-Gn; HVO_3036.
DR   EnsemblGenomes-Gn; HVO_3037.
DR   EnsemblGenomes-Gn; HVO_3038.
DR   EnsemblGenomes-Gn; HVO_3039.
DR   EnsemblGenomes-Gn; HVO_3040.
DR   EnsemblGenomes-Gn; HVO_3041.
DR   EnsemblGenomes-Gn; HVO_3042.
DR   EnsemblGenomes-Gn; HVO_3043.
DR   EnsemblGenomes-Gn; HVO_3044.
DR   EnsemblGenomes-Gn; HVO_3045.
DR   EnsemblGenomes-Gn; HVO_3046.
DR   EnsemblGenomes-Gn; HVO_3047.
DR   EnsemblGenomes-Gn; HVO_3048.
DR   EnsemblGenomes-Gn; HVO_3049.
DR   EnsemblGenomes-Gn; HVO_3050.
DR   EnsemblGenomes-Gn; HVO_3051.
DR   EnsemblGenomes-Gn; HVO_3052.
DR   EnsemblGenomes-Gn; HVO_3053.
DR   EnsemblGenomes-Gn; HVO_3054.
DR   EnsemblGenomes-Gn; HVO_3055.
DR   EnsemblGenomes-Gn; HVO_3056.
DR   EnsemblGenomes-Gn; HVO_3057.
DR   EnsemblGenomes-Gn; HVO_3058.
DR   EnsemblGenomes-Gn; HVO_3059.
DR   EnsemblGenomes-Gn; HVO_3060.
DR   EnsemblGenomes-Gn; HVO_3061.
DR   EnsemblGenomes-Gn; HVO_3062.
DR   EnsemblGenomes-Gn; HVO_3063.
DR   EnsemblGenomes-Gn; HVO_3064.
DR   EnsemblGenomes-Tr; EBT00001762139.
DR   EnsemblGenomes-Tr; EBT00001762140.
DR   EnsemblGenomes-Tr; EBT00001762141.
DR   EnsemblGenomes-Tr; EBT00001762142.
DR   EnsemblGenomes-Tr; EBT00001762143.
DR   EnsemblGenomes-Tr; EBT00001762144.
DR   EnsemblGenomes-Tr; EBT00001762145.
DR   EnsemblGenomes-Tr; EBT00001762146.
DR   EnsemblGenomes-Tr; EBT00001762147.
DR   EnsemblGenomes-Tr; EBT00001762148.
DR   EnsemblGenomes-Tr; EBT00001762149.
DR   EnsemblGenomes-Tr; EBT00001762150.
DR   EnsemblGenomes-Tr; EBT00001762151.
DR   EnsemblGenomes-Tr; EBT00001762152.
DR   EnsemblGenomes-Tr; EBT00001762153.
DR   EnsemblGenomes-Tr; EBT00001762154.
DR   EnsemblGenomes-Tr; EBT00001762155.
DR   EnsemblGenomes-Tr; EBT00001762156.
DR   EnsemblGenomes-Tr; EBT00001762157.
DR   EnsemblGenomes-Tr; EBT00001762158.
DR   EnsemblGenomes-Tr; EBT00001762159.
DR   EnsemblGenomes-Tr; EBT00001762160.
DR   EnsemblGenomes-Tr; EBT00001762161.
DR   EnsemblGenomes-Tr; EBT00001762162.
DR   EnsemblGenomes-Tr; EBT00001762163.
DR   EnsemblGenomes-Tr; EBT00001762164.
DR   EnsemblGenomes-Tr; EBT00001762165.
DR   EnsemblGenomes-Tr; EBT00001762166.
DR   EnsemblGenomes-Tr; EBT00001762167.
DR   EnsemblGenomes-Tr; EBT00001762168.
DR   EnsemblGenomes-Tr; EBT00001762169.
DR   EnsemblGenomes-Tr; EBT00001762170.
DR   EnsemblGenomes-Tr; EBT00001762171.
DR   EnsemblGenomes-Tr; EBT00001762172.
DR   EnsemblGenomes-Tr; EBT00001762173.
DR   EnsemblGenomes-Tr; EBT00001762174.
DR   EnsemblGenomes-Tr; EBT00001762175.
DR   EnsemblGenomes-Tr; EBT00001762177.
DR   EnsemblGenomes-Tr; EBT00001762178.
DR   EnsemblGenomes-Tr; EBT00001762179.
DR   EnsemblGenomes-Tr; EBT00001762180.
DR   EnsemblGenomes-Tr; EBT00001762181.
DR   EnsemblGenomes-Tr; EBT00001762182.
DR   EnsemblGenomes-Tr; EBT00001762183.
DR   EnsemblGenomes-Tr; EBT00001762184.
DR   EnsemblGenomes-Tr; EBT00001762185.
DR   EnsemblGenomes-Tr; EBT00001762186.
DR   EnsemblGenomes-Tr; EBT00001762187.
DR   EnsemblGenomes-Tr; EBT00001762188.
DR   EnsemblGenomes-Tr; EBT00001762190.
DR   EnsemblGenomes-Tr; EBT00001762191.
DR   EnsemblGenomes-Tr; EBT00001762194.
DR   EnsemblGenomes-Tr; EBT00001762196.
DR   EnsemblGenomes-Tr; EBT00001762197.
DR   EnsemblGenomes-Tr; EBT00001762198.
DR   EnsemblGenomes-Tr; EBT00001762199.
DR   EnsemblGenomes-Tr; EBT00001762201.
DR   EnsemblGenomes-Tr; EBT00001762203.
DR   EnsemblGenomes-Tr; EBT00001762204.
DR   EnsemblGenomes-Tr; EBT00001762206.
DR   EnsemblGenomes-Tr; EBT00001762208.
DR   EnsemblGenomes-Tr; EBT00001762210.
DR   EnsemblGenomes-Tr; EBT00001762213.
DR   EnsemblGenomes-Tr; EBT00001762215.
DR   EnsemblGenomes-Tr; EBT00001762216.
DR   EnsemblGenomes-Tr; EBT00001762217.
DR   EnsemblGenomes-Tr; EBT00001762219.
DR   EnsemblGenomes-Tr; EBT00001762220.
DR   EnsemblGenomes-Tr; EBT00001762222.
DR   EnsemblGenomes-Tr; EBT00001762224.
DR   EnsemblGenomes-Tr; EBT00001762225.
DR   EnsemblGenomes-Tr; EBT00001762227.
DR   EnsemblGenomes-Tr; EBT00001762228.
DR   EnsemblGenomes-Tr; EBT00001762230.
DR   EnsemblGenomes-Tr; EBT00001762231.
DR   EnsemblGenomes-Tr; EBT00001762232.
DR   EnsemblGenomes-Tr; EBT00001762234.
DR   EnsemblGenomes-Tr; EBT00001762235.
DR   EnsemblGenomes-Tr; EBT00001762239.
DR   EnsemblGenomes-Tr; EBT00001762240.
DR   EnsemblGenomes-Tr; EBT00001762241.
DR   EnsemblGenomes-Tr; EBT00001762242.
DR   EnsemblGenomes-Tr; EBT00001762244.
DR   EnsemblGenomes-Tr; EBT00001762245.
DR   EnsemblGenomes-Tr; EBT00001762246.
DR   EnsemblGenomes-Tr; HVO_3016-1.
DR   EnsemblGenomes-Tr; HVO_3017-1.
DR   EnsemblGenomes-Tr; HVO_3018-1.
DR   EnsemblGenomes-Tr; HVO_3019-1.
DR   EnsemblGenomes-Tr; HVO_3020-1.
DR   EnsemblGenomes-Tr; HVO_3021-1.
DR   EnsemblGenomes-Tr; HVO_3022-1.
DR   EnsemblGenomes-Tr; HVO_3023-1.
DR   EnsemblGenomes-Tr; HVO_3024-1.
DR   EnsemblGenomes-Tr; HVO_3025-1.
DR   EnsemblGenomes-Tr; HVO_3026-1.
DR   EnsemblGenomes-Tr; HVO_3027-1.
DR   EnsemblGenomes-Tr; HVO_3028-1.
DR   EnsemblGenomes-Tr; HVO_3029-1.
DR   EnsemblGenomes-Tr; HVO_3030-1.
DR   EnsemblGenomes-Tr; HVO_3031-1.
DR   EnsemblGenomes-Tr; HVO_3032-1.
DR   EnsemblGenomes-Tr; HVO_3033-1.
DR   EnsemblGenomes-Tr; HVO_3034-1.
DR   EnsemblGenomes-Tr; HVO_3035-1.
DR   EnsemblGenomes-Tr; HVO_3036-1.
DR   EnsemblGenomes-Tr; HVO_3037-1.
DR   EnsemblGenomes-Tr; HVO_3038-1.
DR   EnsemblGenomes-Tr; HVO_3039-1.
DR   EnsemblGenomes-Tr; HVO_3040-1.
DR   EnsemblGenomes-Tr; HVO_3041-1.
DR   EnsemblGenomes-Tr; HVO_3042-1.
DR   EnsemblGenomes-Tr; HVO_3043-1.
DR   EnsemblGenomes-Tr; HVO_3044-1.
DR   EnsemblGenomes-Tr; HVO_3045-1.
DR   EnsemblGenomes-Tr; HVO_3046-1.
DR   EnsemblGenomes-Tr; HVO_3047-1.
DR   EnsemblGenomes-Tr; HVO_3048-1.
DR   EnsemblGenomes-Tr; HVO_3049-1.
DR   EnsemblGenomes-Tr; HVO_3050-1.
DR   EnsemblGenomes-Tr; HVO_3051-1.
DR   EnsemblGenomes-Tr; HVO_3052-1.
DR   EnsemblGenomes-Tr; HVO_3053-1.
DR   EnsemblGenomes-Tr; HVO_3054-1.
DR   EnsemblGenomes-Tr; HVO_3055-1.
DR   EnsemblGenomes-Tr; HVO_3056-1.
DR   EnsemblGenomes-Tr; HVO_3057-1.
DR   EnsemblGenomes-Tr; HVO_3058-1.
DR   EnsemblGenomes-Tr; HVO_3059-1.
DR   EnsemblGenomes-Tr; HVO_3060-1.
DR   EnsemblGenomes-Tr; HVO_3061-1.
DR   EnsemblGenomes-Tr; HVO_3062-1.
DR   EnsemblGenomes-Tr; HVO_3063-1.
DR   EnsemblGenomes-Tr; HVO_3064-1.
DR   EuropePMC; PMC2841640; 20333302.
DR   EuropePMC; PMC3570448; 23374508.
DR   EuropePMC; PMC6088158; 29914986.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00373; RNaseP_arch.
DR   RFAM; RF01337; CRISPR-DR24.
DR   RFAM; RF01857; Archaea_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02163; sR-tMet.
DR   SILVA-LSU; CP001956.
DR   SILVA-SSU; CP001956.
DR   StrainInfo; 107070; 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2847757
FT                   /organism="Haloferax volcanii DS2"
FT                   /strain="DS2"
FT                   /mol_type="genomic DNA"
FT                   /note="type strain of Haloferax volcanii"
FT                   /db_xref="taxon:309800"
FT   gene            258..1952
FT                   /gene="orc1"
FT                   /locus_tag="HVO_0001"
FT   CDS_pept        258..1952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orc1"
FT                   /locus_tag="HVO_0001"
FT                   /product="Orc1-type DNA replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04491"
FT                   /db_xref="GOA:D4GYJ7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014277"
FT                   /db_xref="InterPro:IPR015163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYJ7"
FT                   /protein_id="ADE04491.1"
FT                   /translation="MDEEENPRGGARGEAGNSTPDDGGADADADAGTDTDDTPSNDASG
FT                   GDGSADSSAVEDDVSPEDIDIQASIGPDADAPDASDEDLDQHKDPDVGLDKVVLNDDEG
FT                   SKGLFDDLLAGEPIFENKEVLRPSYTPHELPHRTDQINQMATILVSALRGETPSNILIY
FT                   GKTGTGKTASAKFVSQELESTSQKYDVPCEVEYINCEVTDTQYRVLAQLANKFIEKNVE
FT                   RIEAEQERLDEMRTRATEDPNALEETPYDSIAEIDERAAELDDDADEMETVPMTGWPTD
FT                   RVYTTFFDAVDYKERVVVIMLDEIDKLVEKSGDDTLYNLSRMNSELDNSRISIMGISND
FT                   LKFTDFLDPRVKSSLGEEEIVFPPYDANQLRDILQHRADVAFKPGALTDDVIPLCAAFA
FT                   AQEHGDARRALDLLRTAGELAERGQADTVEEAHVRQAQDKIELDRVVEVVRTLPTQSKI
FT                   VLFAIILLEKNGVRNINTGEVFNIYKRLCEEIDADVLTQRRVTDLISELDMLGIVNAVV
FT                   VSKGRYGRTKEISLSVPIDETEAVLLTDSRLGDIESAQPFVQARFDN"
FT   gene            complement(2000..2863)
FT                   /gene="sec11b"
FT                   /locus_tag="HVO_0002"
FT   CDS_pept        complement(2000..2863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sec11b"
FT                   /locus_tag="HVO_0002"
FT                   /product="signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02701"
FT                   /db_xref="GOA:D4GYJ8"
FT                   /db_xref="InterPro:IPR001733"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYJ8"
FT                   /protein_id="ADE02701.1"
FT                   /translation="MSDDDGRPPSPDSRRGPTSDEGVLTRLRTAEEGPLLFVRELLTSA
FT                   LAVLAVGLLLFALSGVWPPMVAVESGSMEPHMHKGDLVFITGPERYAPDSAVEGTAVVT
FT                   AETGAEVDYRKFGGPGSVIVYDDPGSAGPPIIHRAMFWVDDGENWYDRANPEYMSADNC
FT                   RELANCPAEYSGFITKGDNNPRYDQVSGIADPVRPEWVQGVARIRIPLLGWVRLTLANS
FT                   IATTTPVAPAPVEFVDVPTMETAVPDASTANAPAGDAPGSDAAATTAPLRVEAGNTPMR
FT                   TAALAA"
FT   gene            2942..4543
FT                   /gene="polD1"
FT                   /locus_tag="HVO_0003"
FT   CDS_pept        2942..4543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polD1"
FT                   /locus_tag="HVO_0003"
FT                   /product="DNA-directed DNA polymerase D exonuclease subunit
FT                   DP1"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03232"
FT                   /db_xref="GOA:D4GYJ9"
FT                   /db_xref="InterPro:IPR007185"
FT                   /db_xref="InterPro:IPR011149"
FT                   /db_xref="InterPro:IPR024826"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYJ9"
FT                   /protein_id="ADE03232.1"
FT                   /translation="MPLETPARIVRTLVGRGYNAEREAVTLIAGSDDPGRTLARVVEAA
FT                   PDDALRITADHVREVLASAPAADPSGTEPTPPAAADAANAADADPAASAASDPSVSAAT
FT                   SHDNAAHTDQSAPAEAQGTPGGRNVDPALRSLEIANDMTGQSTGTGEYDDFVKVFRDRY
FT                   EKLSKLLRGRVNHRPAKAISNMSGGEDAELIGLVDDVRSTKSGHWIIDLEDTTGTFPCL
FT                   VMKDKDIAGYVDELLMDECIAVQGTLSGDAGILFVDSMHFPDVPRSHRSNTADRDVQAA
FT                   LISDVHVGSQEFMADAWNRFADWLHTEEAARIEYLLIAGDMVEGVGVYPNQDEELDVID
FT                   IYEQYEAFSEHLKSVPGDLEIVMIPGNHDAVRLAEPQPGFDDELRDIMSAHDARITSNP
FT                   SMVTLEGVNVLMYHGVSLDEVIAELPADKASYDEPHKAMYQLLKKRHVAPQFGGHTRLA
FT                   PEELDYLVMEDVPDIFHTGHVHKLGWGKYHNVLAVNSGCWQAQTDFQKSVNIDPDAGYA
FT                   PIVDLDTLNMTVRKFS"
FT   gene            4686..5813
FT                   /locus_tag="HVO_0004"
FT   CDS_pept        4686..5813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0004"
FT                   /product="NamA family oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04417"
FT                   /db_xref="GOA:D4GYK0"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYK0"
FT                   /protein_id="ADE04417.1"
FT                   /translation="MTDDALFDATSLNDLSLSNRVGLAPMTRISATDEGLATNEMAHYY
FT                   RKFADGGFGFLVTEGVYTDDAYSQGYLNQPGLVTDDHVEAWTNVTDAVHEVDTPIFAQL
FT                   MHAGAQSQGNPHLDGDRTLAPSAVQPDGQKAEAYGGSGEFAVPKAADETDLETAREGFV
FT                   RAATNAVEAGFDGVELHGANGYLLNEFLAANANRRDDEYGGGPESRVKFPAEVLSAVTD
FT                   AVPEEFVVGIRVSQEKVTDGDYEWPEGEDAAAVFFEELSAAGADYVHTTETDATTPTFG
FT                   ADGPTLAEAAAEYVTDDTVVIANGGLGDPDAARAAVDAGADLFTLGTSALANPDWPARV
FT                   AAGDDLDAFDPAKYLAPTAGLSDHEVPSEPPLADD"
FT   gene            complement(5936..6745)
FT                   /gene="gufA1"
FT                   /locus_tag="HVO_0005"
FT   CDS_pept        complement(5936..6745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gufA1"
FT                   /locus_tag="HVO_0005"
FT                   /product="GufA family transport protein (probable substrate
FT                   zinc)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04848"
FT                   /db_xref="GOA:D4GYK1"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYK1"
FT                   /protein_id="ADE04848.1"
FT                   /translation="MTAVEELFVSLAGSNPVMQGLLGGIVIAGMNMLGALLILVWRDPS
FT                   KRSLDTLLGFAAGVMLAASFTSLILPGIEAAGGSPIPVLVGFVIGVVVLDQADLWIPHV
FT                   HILVTGKTRADAPETDKKMASVVLFIVAITIHNMPEGLAVGVGFGSGDLGTAVPLMLAI
FT                   GIQNIPEGLAVSIAAVNAGLRNTTYATFAGIRAGLVEIPLAVFGAWAIQYAAALLPYAM
FT                   GFAAGAMLFVISDEIVPETHSNGHERVATFGTMVGVVVMLYLDVTLG"
FT   gene            complement(6854..7282)
FT                   /locus_tag="HVO_0006"
FT   CDS_pept        complement(6854..7282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0006"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02782"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYK2"
FT                   /protein_id="ADE02782.1"
FT                   /translation="MDVRDAVDTDAEALAAVADAPIRAMRRLIRDRTVRLATAETSSDP
FT                   HADAPADDEPVLGFVGFDVRDGVLHVTRLGGTEAAVRRLLEEPLRFASAEDLPVEVLVL
FT                   ESEAPLCEAVEHVGFDRVGHGPRFEGSPTLRYVLDETG"
FT   gene            7470..8648
FT                   /gene="lysC"
FT                   /locus_tag="HVO_0008"
FT   CDS_pept        7470..8648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysC"
FT                   /locus_tag="HVO_0008"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02361"
FT                   /db_xref="GOA:D4GYK3"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYK3"
FT                   /protein_id="ADE02361.1"
FT                   /translation="MRVVAKFGGTSLGSGDRINRAADSIAAAVEHGHEIAVVASAMGST
FT                   TDDLLDEIKFEADDRDRAEIVSMGERTSVRMLKAALAARGVNALFVEPGTDEWPVITND
FT                   LGEVDVEATRERAAKLAAELDGVVPVITGFLAQNHDGEITTLGRGGSDTSAVMLGNYMD
FT                   ADEVVIVTDVEGVMTGDPRVVEGARNVGRITVDELRNLSFRGAEVVAPSALSYKDAALD
FT                   VRVVHYQHGDLLTGGTLIEGEFHNLIDMQEEPLACLTVAGRAIRNRPGILADLSAALRE
FT                   EDINVDSVASGMDSITFYVLEDDSDRAEAVLHDRVVADDALSSVTVEDDIAVVRVTGGE
FT                   LPNRPGVILDIVEPLSEAGINIHDAITSATSVAIFVAWDDREETLGIIQDEF"
FT   gene            8873..10219
FT                   /gene="tnaA"
FT                   /locus_tag="HVO_0009"
FT   CDS_pept        8873..10219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tnaA"
FT                   /locus_tag="HVO_0009"
FT                   /product="tryptophanase"
FT                   /EC_number="4.1.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05085"
FT                   /db_xref="GOA:D4GYK5"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR011166"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYK5"
FT                   /protein_id="ADE05085.1"
FT                   /translation="MKSYKAKMVEPIELPSREEREAALERAGYNAFNLDARDVYIDLLT
FT                   DSGTGTMSAEQWAAMIRGDEAYAGSESFARLAESVRDVMGFEHVVPTHQGRGAENVLYG
FT                   VLLEDGDVVPNNSHFDTTRAHVVNQGAEPVDCPSPAARDPNSTETFKGNFDIDAGYALV
FT                   EEVGADAIPVVALTITNNSVAGQPVSMANIRATAEFARDIDAMFVIDACRFAENAHFIK
FT                   THEAGYENHSVAEIARAQFEHADAITMSGKKDALVNIGGFAAMRDETVFEHAKQRAILY
FT                   EGFPTYGGLSGRDIEAMAVGLREAVTPPYVTDRVEQVAELGDLLVEAGVPVYQPTGGHA
FT                   VYLDAGEVFPHIPKEEFPGQELVCALYLEGGVRGVELGGFAFPGTDRPDLVRLALPRRT
FT                   YSREHLEHVAETAAKVMASAGEYGGLEIVAEPPMKELRHFSSRLEPVSN"
FT   gene            complement(10248..10907)
FT                   /locus_tag="HVO_0010"
FT   CDS_pept        complement(10248..10907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0010"
FT                   /product="MJ0936 family phosphoesterase"
FT                   /EC_number="3.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04673"
FT                   /db_xref="GOA:D4GYK6"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR011152"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYK6"
FT                   /protein_id="ADE04673.1"
FT                   /translation="MRLGVISDVHGNLPALEAVLESMPSVDRLVCAGDVVGYNPWPEEC
FT                   VSELAERDVPTVSGNHDRAVTSGTGFRFNSMAAAGVDYARDALSPASMDWLSALPKNRT
FT                   LADGRVKLAHGHPNHPDRYTYPDDFSPSLLDDEDLLVLGHTHVQGYRIYDDGIVLNPGS
FT                   VGQPRDGDPRAAYAVVDLDAMEIEAERVNYDIDRVAERVRKAGLPERLASRLYEGK"
FT   gene            complement(10956..11528)
FT                   /gene="purO"
FT                   /locus_tag="HVO_0011"
FT   CDS_pept        complement(10956..11528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purO"
FT                   /locus_tag="HVO_0011"
FT                   /product="inosine-5'-monophosphate cyclohydrolase,
FT                   archaeal-type"
FT                   /EC_number="3.5.4.10"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04942"
FT                   /db_xref="GOA:D4GYK7"
FT                   /db_xref="InterPro:IPR010191"
FT                   /db_xref="InterPro:IPR020600"
FT                   /db_xref="InterPro:IPR036795"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYK7"
FT                   /protein_id="ADE04942.1"
FT                   /translation="MYVGRFVVVSPGIGAYRVSSRSFPNRRVVDRDDALTVGPTPDAPE
FT                   TDNPYIAYNCVREGGDYVVVGNGSQVDPVAEKLDLGYPPRDALAEILLALDYEKDDYDT
FT                   PRIAGVVGDDEAYIGIVRKDALVVEAVTEPTLVATYEEDDPRAFDLDAETAADAARELY
FT                   DHEFEHAVCAAAATVGDAVETSFYNGE"
FT   gene            complement(11897..12391)
FT                   /gene="cgi121"
FT                   /locus_tag="HVO_0013"
FT   CDS_pept        complement(11897..12391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cgi121"
FT                   /locus_tag="HVO_0013"
FT                   /product="KEOPS complex subunit Cgi121"
FT                   /note="similar to Cgi121"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03079"
FT                   /db_xref="InterPro:IPR013926"
FT                   /db_xref="InterPro:IPR016799"
FT                   /db_xref="InterPro:IPR036504"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYK8"
FT                   /protein_id="ADE03079.1"
FT                   /translation="MRLLEAEATVSDLDSFIAAVGDVADETGATVQAFDARYVVDREHL
FT                   ERAVELADRAIARGNEIARDRAVEILLYASGRRQINRAFEIGVSEGTLPVVVLVDGGDE
FT                   AAAEAALFDRLDFEPAETLGDYDESLVRDVFDVGETELHVVDGDLPALVRERVALLAVD
FT                   R"
FT   gene            complement(12388..14871)
FT                   /gene="hel308a"
FT                   /locus_tag="HVO_0014"
FT   CDS_pept        complement(12388..14871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hel308a"
FT                   /locus_tag="HVO_0014"
FT                   /product="ATP-dependent DNA helicase Hel308a"
FT                   /EC_number="3.6.4.12"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04048"
FT                   /db_xref="GOA:D4GYK9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022965"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYK9"
FT                   /protein_id="ADE04048.1"
FT                   /translation="MRTADLTGLPTGIPEALRDEGIEELYPPQAEAVEAGLTDGESLVA
FT                   AVPTASGKTLIAELAMLSSVARGGKALYIVPLRALASEKKAEFERWEEYGIDVGVSTGN
FT                   YESDGEWLSSRDIIVATSEKVDSLVRNNAAWMDQLTCVVADEVHLVDDRHRGPTLEVTL
FT                   AKLRRLNTNLQVVALSATVGNAGVVSDWLDAELVKSDWRPIDLKMGVHYGNAVSFADGS
FT                   QREVPVGRGERQTPALVADALEGDGEGDQGSSLVFVNSRRNAESAARRMADVTERYVTG
FT                   DERSDLAELAAEIRDVSDTETSDDLANAVAKGAAFHHAGLAAEHRTLVEDAFRDRLIKC
FT                   ICATPTLAAGVNTPSRRVVVRDWQRYDGDYGGMKPLDVLEVHQMMGRAGRPGLDPYGEA
FT                   VLLAKDADARDELFERYIWADAEDVRSKLAAEPALRTHLLATVASGFAHTREGLLEFLD
FT                   QTLYATQTDDPERLGQVTDRVLDYLEVNGFVEFEGETIQATPVGHTVSRLYLDPMSAAE
FT                   IIDGLEWAADHRTEKLRALAGETPEKPTRDRSESDESGGFQRASEMVADDGDGGGGEDG
FT                   VGANGDGDSDDADGVETDRTYPTPLGLYHLVCRTPDMYQLYLKSGDRETYTELCYEREP
FT                   EFLGRVPSEYEDVAFEDWLSALKTAKLLEDWVGEVDEDRITERYGVGPGDIRGKVETSE
FT                   WLLGAAERLATELDLDSVYAVREAKKRVEYGVREELLDLAGVRGVGRKRARRLFEAGVE
FT                   TRADLREADKPRVLAALRGRRKTAENILEAAGRKDPSMDAVDEDDAPDDAVPDDAGFET
FT                   AKERADQQASLGDFE"
FT   gene            14980..15225
FT                   /gene="ferC"
FT                   /locus_tag="HVO_0015"
FT   CDS_pept        14980..15225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ferC"
FT                   /locus_tag="HVO_0015"
FT                   /product="ferredoxin (4Fe-4S)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04297"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYL0"
FT                   /protein_id="ADE04297.1"
FT                   /translation="MRVEYDRDTCIGMFQCVDEWEGFEKNVDDGKADLVDGEETDDGVF
FT                   VREVPEDAEFDAKFAARVCPVEAIRILDDDGEQLVP"
FT   gene            15479..16336
FT                   /locus_tag="HVO_0016"
FT   CDS_pept        15479..16336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0016"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04597"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYL1"
FT                   /protein_id="ADE04597.1"
FT                   /translation="MFETRSLPSDLESVRDDYAPGALVLDVAGDFDTIPPEAAENLGLV
FT                   VDSLSPAAYPAEWLPDDAPQQLRRYASSDFTIGMPGDGTVSWSRQTDPPVVLVKYRAKG
FT                   TPDDFLDFLIAEAFVQAGNDEIPEHFLPFFGEQYADLAAATPLGPSETYQVAAALYEGW
FT                   VGLHTREAFASWEGDHDRLHEAWVDAGGRLDNRLENLPRLVALGRLSFAEATEFACSAV
FT                   KHGRDLPAPFSALDTAAYRDHGPSYAVKWAEKTFEQLAADDDGADAESSDDADPTADDA
FT                   ADSA"
FT   gene            complement(16358..16936)
FT                   /locus_tag="HVO_0017"
FT   CDS_pept        complement(16358..16936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0017"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02666"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYL2"
FT                   /protein_id="ADE02666.1"
FT                   /translation="MDYELAIEDAPATIPGGTGILLLHPSIGETDRIDTDFFKVDTDRF
FT                   LVISTRTTAREVEQKLEHYEVDESSATILDTLSIERGYSRRSSENIHYVAAPDDLDAIV
FT                   EKTRQFLERHDGKLRLSVDSVTEMAYYADEDRAFEATKQILELLDEFDAVGLFHLSKEV
FT                   HDQETLDRFRELFDGVVDLNEDGTVTTEF"
FT   gene            complement(17030..17488)
FT                   /locus_tag="HVO_0018"
FT   CDS_pept        complement(17030..17488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0018"
FT                   /product="DUF2391 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03674"
FT                   /db_xref="InterPro:IPR024464"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYL3"
FT                   /protein_id="ADE03674.1"
FT                   /translation="MVGVRRRFALADTAQQVVGGFLLAGPFVVTEEVWVLARSMSFAQA
FT                   LLTLIIVLAVGYGALYKADDRDPDREREVGGIPVRFISLISVSYLSVFILALAFDAPGT
FT                   FLSDVSGEVLVSVLGYELDLAVLRITLKATSVGAVFSVIGAATADSLF"
FT   gene            17615..18295
FT                   /locus_tag="HVO_0019"
FT   CDS_pept        17615..18295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0019"
FT                   /product="putative S-adenosylmethionine-dependent
FT                   methyltransferase (homolog to 24-sterol
FT                   C-methyltransferase)"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04118"
FT                   /db_xref="GOA:D4GYL4"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="PDB:6F5Z"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYL4"
FT                   /protein_id="ADE04118.1"
FT                   /translation="MSVRDEFDAWAADGRDKGMEDRHWHTAKHALARMPVEEGDTVVDL
FT                   GTGSGYALRALRDTKGIGRGFGLDGSPEMVQNARAYTDTDDLSFLVGDFDDLPFDDDSV
FT                   DHVWSMEAFYYAADPHHTLEEIARILKPGGTFYCAVNYYEENVHSHEWQEHISIDMTRW
FT                   SHAEYREAFRDAGLHVAEQDSIADLDIDIPAATEFPTDDWETREAMVERYRTFGTLLTV
FT                   GVAP"
FT   gene            complement(18323..19408)
FT                   /gene="thiQ"
FT                   /locus_tag="HVO_0020"
FT   CDS_pept        complement(18323..19408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiQ"
FT                   /locus_tag="HVO_0020"
FT                   /product="ABC-type transport system ATP-binding protein
FT                   (probable substrate thiamine)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04560"
FT                   /db_xref="GOA:D4GYL5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYL5"
FT                   /protein_id="ADE04560.1"
FT                   /translation="MRLELDAVSKRYGSATALDSVSLSVDDGEFFTLVGPSGCGKTTTL
FT                   RCIAGFESPTEGTVRFDGESMVGVAPESRGVGVVFQNYALFPHLSVGENVAYGLRFTDP
FT                   PGGGSRDDRVAELLDLVDLAGFEDRDPDSLSGGQQQRVALARALAPGPDLLLLDEPMSA
FT                   LDARLRDRLRRQVKRIQSDLGVTTVYVTHDQSEALAVSDRVAVLNGGRVEQVGDPRDLY
FT                   HRPRTRFVAEFLGENNVLDGVVESRPETGGIRVGVGDAVFTLAEGPRVLGEAGSRAGAG
FT                   DELTFCVRPEQLRAGAGTNKIRGTVVDTEFQGATTRVRLDWGGTELVVAVEDGGEQSDA
FT                   GFEVGATLEVGFAPASAHVVE"
FT   gene            complement(19512..21233)
FT                   /gene="thiP"
FT                   /locus_tag="HVO_0021"
FT   CDS_pept        complement(19512..21233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiP"
FT                   /locus_tag="HVO_0021"
FT                   /product="ABC-type transport system permease protein
FT                   (probable substrate thiamine)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05051"
FT                   /db_xref="GOA:D4GYL6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYL6"
FT                   /protein_id="ADE05051.1"
FT                   /translation="MSRASASVRRVARALEQRLLTLVAALTAVVLLVLFYYPVATVFAD
FT                   AVLADGRLTVEPIAAVLTSEFYLVDIIWFTAKQAFYSTLASLALGLPAAWLFARFEFRG
FT                   RETLRSLTILPFVMPSIMVAIGFVATFGRNGTLNRALSLVGLPPVELLFTLEAIVVAHA
FT                   FYNAPLVARVVTAAWESVDARTVETARSLGANPRRAFRDVVLPQLLPSIGVGATLTFIF
FT                   TFASFPIVLALGGFQLATIEVFVYSRVRDLAYAEAASLAVVETAVSITLTAVYLRYEAS
FT                   QRSAGGAANPLPRQSVLPADWTPKSTLRTVGIGGYALVVGLVFVVPVASMVLASVTGGD
FT                   GGLTLANYAFLAERQATGASFQVKPLPAILNSLGFAAGTLVVAVPMGVTMAVLTTRRYR
FT                   GRGLIDVLSMAPFAVSGIVVGLGLLRGLVFGVDVLGTRIRVTGALAIVAAHAVGAYPFV
FT                   TRNVAPLFARLDGRLVESARSLGATRTRALVDIELPLVWTGVVAGAAFAVAISIGEFDS
FT                   TIILAEGAGSYTMPVAVERFLGRRLGPATAMGCLLLLVTSASFLVVDRFGGRWGEL"
FT   gene            complement(21243..22379)
FT                   /gene="thiB"
FT                   /locus_tag="HVO_0022"
FT   CDS_pept        complement(21243..22379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiB"
FT                   /locus_tag="HVO_0022"
FT                   /product="ABC-type transport system periplasmic
FT                   substrate-binding protein (probable substrate thiamine)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04003"
FT                   /db_xref="GOA:D4GYL7"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYL7"
FT                   /protein_id="ADE04003.1"
FT                   /translation="MRRRSFLRAAGAGGVSALLAGCTGTGGEQTTTEASGDATETTATT
FT                   EGTTAGGESRTLTVGTYGSFVDAPSSSPGPWLKETFESEFDATLEWQTPDSGVNYYIER
FT                   GLRGVESGADLYVGLDAQMLVRIDRELDEALFSPAEGLSRIDDVKEGLNFDPQGRAVPY
FT                   DTGYISLVYDETYGDGDFVAPETFDGLLDSEYAGALLAQNPTSSATGQAFLLHTIDAKG
FT                   EDSYLDYWASLKENDVRVLGNWEDTYNAYSNGEAPMVVSYSTDQVFAAESGEDMARHQI
FT                   RFLNDQAYANPEGMAPFADASNPDLAVEFMDFMLRPEVQAEIAVRNVQFPATTTAELPE
FT                   DFAQYAQEPPEAVTFSYDRLQNNLSDWTDAWAREFASK"
FT   gene            22510..23400
FT                   /locus_tag="HVO_0023"
FT   CDS_pept        22510..23400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0023"
FT                   /product="UPF0118 family membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03385"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYL8"
FT                   /protein_id="ADE03385.1"
FT                   /translation="MTASRPYVLGGVFALFALLAAVLLVDVLATVFFAITVAYLLVPLR
FT                   RRLEACGASRWVASLAATVVAAVGVGVVLAPLVVILFLRLSDILELAALLPDVVTIEFL
FT                   GMVETVTLDDVVAVGLGLLRSVGRTAATAAPVVLIKLTLFGFLVFALLLSGDAVGRTLP
FT                   ALVPADYRGAATALNERARETLFAIYVLQAATAVGTFAIGLVVFWALGYDYVVTLATVA
FT                   AVLQFIPIVGPSVLLAAMAAYHAAVGDVVAAALVVALLAESVDLLGAELRVDDVGGDGD
FT                   ERDESADDSVDPSQP"
FT   gene            complement(23410..24186)
FT                   /gene="tssA2"
FT                   /locus_tag="HVO_0024"
FT   CDS_pept        complement(23410..24186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tssA2"
FT                   /locus_tag="HVO_0024"
FT                   /product="thiosulfate sulfurtransferase"
FT                   /EC_number="2.8.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02282"
FT                   /db_xref="GOA:D4GYL9"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYL9"
FT                   /protein_id="ADE02282.1"
FT                   /translation="MVDVVSPTWLADRLDDVRVVDVRDGWEFDGIGHLPGAVSIPFDEF
FT                   RSADGDVGMLPGRDAWTDLLSGAGVAADDDVVAYDDTHGVFAARFLVTALLYGHDPDRL
FT                   HLLDGDFSAWNRERETTTEASEVAGTVYEITEPAETPLVDFEAVEAALDDPETVIVDTR
FT                   DPAEYDEGHLPGAVNLDWRELVDDETRGLKPRDELDAILDAVGVTPDRRVVLYCNTARR
FT                   ISHTYVVLSHLGYDDVAFYEGSLTEWEERDGAVVEG"
FT   gene            24438..25298
FT                   /gene="tssA1"
FT                   /locus_tag="HVO_0025"
FT   CDS_pept        24438..25298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tssA1"
FT                   /locus_tag="HVO_0025"
FT                   /product="thiosulfate sulfurtransferase"
FT                   /EC_number="2.8.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04616"
FT                   /db_xref="GOA:D4GYM0"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:D4GYM0"
FT                   /protein_id="ADE04616.1"
FT                   /translation="MSNSDYAKDVLVSADWVESHLDEFQSDDPAYRLVEVDVDTEAYDE
FT                   SHAPGAIGFNWESQLQDQTTRDVLTKEDFEDLLGSHGISEDSTVVLYGDNSNWFAAYTY
FT                   WQFKYYGHENVHLMNGGRDYWVDNDYPTTDEIPSFPEQDYSAKGPFEDIRAYRDDVEKA
FT                   VDKGLPLVDVRSPEEFSGEILAPPGLQETAQRGGHIPGASNISWAATVNDDGTFKSADE
FT                   LRDLYADQGIEGDESTIAYCRIGERSSIAWFALHELLGYENVTNYDGSWTEWGNLVGAP
FT                   VEKGN"
FT   gene            complement(25352..26794)
FT                   /gene="atoE"
FT                   /locus_tag="HVO_0026"
FT   CDS_pept        complement(25352..26794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atoE"
FT                   /locus_tag="HVO_0026"
FT                   /product="AtoE family transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03654"
FT                   /db_xref="InterPro:IPR006160"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYM1"
FT                   /protein_id="ADE03654.1"
FT                   /translation="MTNAIRQAAERSSKLVEQYLPDAFLFAIILTGVAFVLALVSVAPA
FT                   EGVGMVGHAGNLLLDGWYGGFWNLLSFGMQMTLILMTGYALAQTKPVDWLLTRLAGVPN
FT                   TERGAAAMVPVVAAGASFVHWGLGLVVGALFARKIATEMRGIDFPIVVAGAYSGFVVWH
FT                   GGLAGSIPLLLNTEGNFLIEAGILDTTFGTGGTIFTVANLVLVVAVGFLFLPALFALMY
FT                   PTDDAKKTPIDPAAFETATDGGEQATGGWASTAVPDDASLATRIEHSLGIGVAIGVVGL
FT                   LAVALYFWEGVQNGTMPWNNLNLNIVNFGFLFLGVLFHGTPKAYIEAVVEAVENVWGII
FT                   LQFPFYAGIMGIMAYAPEGSVSLATQIAQGMVAVAPDGTLPAFAFFTAGLVNFFVPSGG
FT                   GEWAVIGETLVTAAKASGESIPRVAVAASWGDAWTNMIQPFWAIPLLSISGLSVRDIMG
FT                   YCVMVLLGAGVLVAVGISVLPM"
FT   gene            26974..27573
FT                   /locus_tag="HVO_0027"
FT   CDS_pept        26974..27573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0027"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02965"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYM2"
FT                   /protein_id="ADE02965.1"
FT                   /translation="MSELLDTLRDDHETPLSRLGSSKALYAVTGGEMDGDAVRAAAAAE
FT                   AAAAADLFDWWADDEPNDEAAALFSDLADTAREHAETVGAESDGSKPNVYDVLAEFETT
FT                   DGRLGGALARALVSLKTVEQMVGFFVGDADPMAANDFRTLKSDLNDQLDTLEAAVSDLV
FT                   DDDAVAREAADAVVEAAYDEYVETLEGMGVKPKNVC"
FT   gene            complement(27832..28101)
FT                   /locus_tag="HVO_0028"
FT   CDS_pept        complement(27832..28101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0028"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04835"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYM3"
FT                   /protein_id="ADE04835.1"
FT                   /translation="MTRAELERASNLLKDAAEATEGDVQERLYEQSDQLATLATREQGP
FT                   DHGRLARHMTVLHDLAEDLDGDAAETVREARSEVLEYRKGVPGV"
FT   gene            28190..30286
FT                   /gene="uvrB"
FT                   /locus_tag="HVO_0029"
FT   CDS_pept        28190..30286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="HVO_0029"
FT                   /product="UvrABC system protein B"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04021"
FT                   /db_xref="GOA:D4GYM4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYM4"
FT                   /protein_id="ADE04021.1"
FT                   /translation="MSESGPLSADRPDADREFRVDAPFDPAGDQPEAIEALARGFREGA
FT                   DVQTLLGVTGSGKTNTVSWVVEEIQKPTLVLAHNKTLAAQLYEEFKGLFPDNAVEYFVS
FT                   YYDYYQPEAYIEQTDTYIDKDMSINEEIDRLRHSATRSLLTRDDVIVVASVSAIYGLGD
FT                   PKNYTDMSLRLEVGQGMDRDELLRALVDLNYERNDVDFRQGTFRVRGDTVEVFPMYGRY
FT                   AVRIEFWGDEIDRMLKLDPLEGEVKSSEPAVLVHPAEHYSIPEEQLEGAISEIEELMEQ
FT                   RVKHFQRQGDLVAAQRIEERTTFDIEMLRETGHCSGIENYSVHLSDREPGDAPYTLLDY
FT                   FPDDFLTVIDESHVTLPQIKGQYAGDKSRKDSLVENGFRLPTAYDNRPLTFEEFEETVG
FT                   QTLFASATPGDYEREHSDQIVEQIVRPTHLVDPKVEVTEATGQVDDLMARIDERIDRDE
FT                   RVLVTTLTKRMAEDLTEYLEEAGVDVAYMHDETDTLERHELIRSLRLGDIDVLVGINLL
FT                   REGLDIPEVSLVAILDADQQGFLRSETTLVQTMGRAARNVNGEVVLYADEMTDAMEAAI
FT                   SETQRRRRIQQEFNEEHGYTPTTIEKEVGETNLPGSKTDTRGVSGDEPADADEAVEQIA
FT                   FLEDRMQEAADNLEFELAADIRDRIQNLRREFDVDALEDGVAPEYPDEHDGEADDGLTP
FT                   PDEF"
FT   gene            30293..30712
FT                   /locus_tag="HVO_0030"
FT   CDS_pept        30293..30712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0030"
FT                   /product="NUDIX family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03234"
FT                   /db_xref="GOA:D4GYM5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYM5"
FT                   /protein_id="ADE03234.1"
FT                   /translation="MSSPPTLTFAAGGLLRRDDGRLCLVHRPRYDDWSLPKGKLEPGET
FT                   LVETAVREVREETRCEVDCGRFAGRYEYRVPDDAGTRSGPKGVFVWHMRVVDEHQFEPD
FT                   AEVDARQWVTPVEALQRLTYETERALVRRAFELNE"
FT   gene            30936..31106
FT                   /locus_tag="HVO_0031"
FT   CDS_pept        30936..31106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0031"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03384"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYM6"
FT                   /protein_id="ADE03384.1"
FT                   /translation="MLDSSGDHRTPAHPACDAVASSGDGEHARVGAADDSANGLFSTCH
FT                   STRVQANATAY"
FT   gene            31121..32206
FT                   /locus_tag="HVO_0032"
FT   CDS_pept        31121..32206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0032"
FT                   /product="UPF0721 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02511"
FT                   /db_xref="GOA:D4GYM7"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYM7"
FT                   /protein_id="ADE02511.1"
FT                   /translation="MSSQSLSHVQKSFLKYQHILVFIAPLLFLASVFTMAPTPSGVGME
FT                   YWLQYWWLFPVFLTGATIVNTVGISGSALFVPFLIFIFPIFAHPLDSSTLVKVGLISEA
FT                   FGLSSSAVAFIQYGLVDRRLALTLVGGSIPFVVGGALLSFVIPDVVFHALLGIALLAAS
FT                   YLLFNADLGHDEPGSSDTDHAAATDGGTVSASLPNDPGKLGPAGVNTADDGTVTRVDRD
FT                   GDDYTYTRGGYLRRFANYSVGGMFQGLAGFGIGELGIISMLGTKVPVRVAIGTNHIVVA
FT                   LTAILASLVHVFGGGLVGGHSLSLATTPWNMVVFTVPATVLGGQIAPYVSNALETSVIK
FT                   NFVGVLFAVISLALFLMALGI"
FT   gene            32276..32716
FT                   /locus_tag="HVO_0033"
FT   CDS_pept        32276..32716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0033"
FT                   /product="UspA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02646"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYM8"
FT                   /protein_id="ADE02646.1"
FT                   /translation="MYDHILLPTDGSDATDATIEHAATFAETYGATVHVLSVADSRNRF
FT                   ESPSAGIAPDVWEKSELDRAESAADAAIEALPEGVETERIVVEGVPHSTIVDYAADGDI
FT                   DLVVMATHGRTGLDHYLVGSVTERVVRQSDAPVLTVRAADEE"
FT   gene            complement(32744..33238)
FT                   /gene="act1"
FT                   /locus_tag="HVO_0034"
FT   CDS_pept        complement(32744..33238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="act1"
FT                   /locus_tag="HVO_0034"
FT                   /product="acyl-CoA thioester hydrolase"
FT                   /EC_number="3.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04904"
FT                   /db_xref="GOA:D4GYM9"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYM9"
FT                   /protein_id="ADE04904.1"
FT                   /translation="MQQQSSVETRSLSASRAEMSEILMPNDTNNLGRALGGRILEWMDV
FT                   CGAIAGRRFAERQVVTASMDHVDFLAPIDVGDVVTVEAYVFDTGRTSMDIKVDVTAERP
FT                   SEGDRRETLTSFFTFVALDDDEKPVPVPDLVCDSQEERELRDAALQKRREHRAALAEEF
FT                   E"
FT   gene            complement(33689..34879)
FT                   /locus_tag="HVO_0035"
FT   CDS_pept        complement(33689..34879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0035"
FT                   /product="stomatin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03997"
FT                   /db_xref="GOA:D4GYN0"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYN0"
FT                   /protein_id="ADE03997.2"
FT                   /translation="MDSLFYQLGKLSASSSSSSSSGAERVDSDPGRLPRWLAPLAVAVV
FT                   VFGLAVVVFPVTPLTLAGYVVLALAVAAVYDAVEIVQAYEKRTLTVFGDYKGILEPGLN
FT                   VVPPFVSKTYRFDMRTQTLDVPSQEAITEDNSPVTADAVVYIRVMDPERAFLQVDNYRR
FT                   AVSLLAQTTLRAALGDMELDDTLARRDHINARIRRELDEPTDEWGVRVESVEVREVKPS
FT                   KDVENAMEQQTSAERRRRAMILEAQGERRSAVEKAEGDKQSNIIRAQGEKQSQILEAQG
FT                   DAISTVLRARAAESMGERAIIDKGMETLANIGTSPSTTYVLPQELTSLLGRYGKGLSGS
FT                   DVQQAAGLESKAFDEETRELLGLDDIGEILGELDGVETADISADAVDIEIEDGGVE"
FT   gene            34980..35174
FT                   /locus_tag="HVO_0036"
FT   CDS_pept        34980..35174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0036"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03536"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYN1"
FT                   /protein_id="ADE03536.1"
FT                   /translation="MRTNRGRIDVEDLLKIILLLVLVWLVLEIIGEVLGLFGALLGPLQ
FT                   PLLGLVVAALIVLWLLDRI"
FT   gene            35225..35722
FT                   /locus_tag="HVO_0037"
FT   CDS_pept        35225..35722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0037"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02299"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYN2"
FT                   /protein_id="ADE02299.1"
FT                   /translation="MYSLNVPVPGRVARLASDLFPYLAPFDRVRDRHTLVCKRFEDADL
FT                   DRLREQLRRALAGQPAFEARVTDVRFFEEPPRGAAPVVYLAVDSPGLLDLHRTLTDDFG
FT                   AIEGIEGDDYVPHVTLARGGSVADARAVASQPLDPIEWTVSQLDIYDSSFRETTASISL
FT                   PA"
FT   gene            complement(35776..37152)
FT                   /gene="cyc1"
FT                   /locus_tag="HVO_0038"
FT   CDS_pept        complement(35776..37152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyc1"
FT                   /locus_tag="HVO_0038"
FT                   /product="cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04788"
FT                   /db_xref="GOA:D4GYN3"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYN3"
FT                   /protein_id="ADE04788.1"
FT                   /translation="MSATPPGPKGLPLFGASRQYARDPFTFLTAVADAYGDVVHFDLGP
FT                   LDTYMLTNPADVETVLVSEASKFRKPQFQDRAIGDLLGDGLLMSEGATWKRQRQLAQPA
FT                   FDVRRISTMAGMMTDRTESMLSSWGDGDVVDVQLEMARLTVEIIVDAMFGTDLDDERIR
FT                   RVQENLEPLGARFEPDPLRFLTPDWAPTRENREYKQALSELESLVWDIVEERRGTEYGE
FT                   TPASSVPADATGEERPMDLLSILLRAYDEGEQTEENLRDELMTMLLAGHDTTALTLTYA
FT                   WYLLSQHPEAEAKLHRELDEVLGGRTPTFEDVRQLEYTERVLNEAMRLYPPVYVMFREP
FT                   KVDVRLGGYRVPAGSAIMLPQWVVHRSERWWDDPLEFDPDRWAPERAGDRPRFAYFPFG
FT                   GGPRHCIGKHLSLLEGRLILGTVAQRYELDYVRDEPFSLRGSLTMHPEEPMGMRLRARD
FT                   "
FT   gene            complement(37234..39438)
FT                   /gene="rad3b"
FT                   /locus_tag="HVO_0039"
FT   CDS_pept        complement(37234..39438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rad3b"
FT                   /locus_tag="HVO_0039"
FT                   /product="DNA repair helicase Rad3"
FT                   /EC_number="3.6.4.12"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05091"
FT                   /db_xref="GOA:D4GYN4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006554"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR010614"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYN4"
FT                   /protein_id="ADE05091.1"
FT                   /translation="MAHANGAPDDGDADGAWRFFPYDEPYPNQEAAMSGIADALDDERN
FT                   VLLEGATGTGKTISALVPALSYAREHDKTVVITTNVHQQMRQFVEDARAITREEAIRAV
FT                   VFRGKSSMCHIDVGFQECQTLRDTTRSIVEKESDKAELSEQTQSLLDGIREGESGAADA
FT                   RSAVTDELDAIDDELAELKEGNYCEHYYNNLTRNTDEFFQWLFDDVRTPDEIFEYAGKQ
FT                   NLCGYELLKEGMEGIDLVVCNYHHLLDPMIREQFFRWLDRDPDDVITVFDEAHNIEGAA
FT                   RDHASRALTENTLESAMTELEDEDDSRAESARNVIGTFLDALRDSYESAFGFGEREQVG
FT                   ENWYDLSIASQGRRDDLTMEFLQSYEGRGIDVEVELALQLGKQLDEQYEDAYKNGEATT
FT                   RKECQTLQAANFIADWTELGDELGRHPVLSVRRDGGTDEIYGRAELYTCIPREVTKELF
FT                   EEVHASILMSATLRPFDVTESTLGLDDPVTMAYGLEYPEENRRTFSVSLPALFSSERDD
FT                   PGTQETVEEVLADAAGFTPGNTLAFFPSYAEAERYHERLRANPNVDAELFLDEPGVRAE
FT                   EMRREFVAEDGAVLLTSLWGTLAEGVSFDGDDARTVVVVGVPYPHLSERLEAVQDAYDR
FT                   VYRRKKDAGWRYAVEIPTIRKTRQALGRVIRAPDDFGVRVLADKRYTRESTSMGKYGVR
FT                   GSFPVEERSEMVDIAPNKLKFAMLNFYTDHDAYDGDPPRP"
FT   gene            39586..40056
FT                   /locus_tag="HVO_0040"
FT   CDS_pept        39586..40056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0040"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03194"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYN5"
FT                   /protein_id="ADE03194.1"
FT                   /translation="MASETATTRLESTTATSWRTGVAAGSLAAVVMGAMMVVQMRPVLE
FT                   VAIPSMYGLTGGAAGFTIHVAHGAILGVAFAGLVSALDFDLDGSLRSLGAGVGYGVVLW
FT                   VVLAVLVMPVWLGAVGSPANPPLPNVNVTSLVGHVVYGAVLGASYPALDGVF"
FT   gene            complement(40093..40992)
FT                   /gene="argF"
FT                   /locus_tag="HVO_0041"
FT   CDS_pept        complement(40093..40992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argF"
FT                   /locus_tag="HVO_0041"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03734"
FT                   /db_xref="GOA:D4GYN6"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYN6"
FT                   /protein_id="ADE03734.1"
FT                   /translation="MLETTHFTDIDDISASELDRVLTRAADIKSGDDETQLTRATLAML
FT                   FEKPSTRTRVSFETGMTELGGHALFLGPEDIQLGHGEPLSDTARVLGRYGDAIMVRLFD
FT                   HEDLLEIAEHSDAPVINGLTDDAHPCQTLADLLTIREHVGDFDEVQAAWVGDGNNVGQS
FT                   FVLGCAMAGIDLTVATPPAYGVDDDVLEKAAELGSTPTITTDPEEAVADADVVYTDVWI
FT                   SMGQEDQRHEKLQAFEGFQLNEDLLSSTDAKVMHCLPAHRGEEITGDVLEDERSLVWDQ
FT                   AENRLHAQKGLIVELLEE"
FT   gene            complement(41076..42221)
FT                   /gene="argE"
FT                   /locus_tag="HVO_0042"
FT   CDS_pept        complement(41076..42221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argE"
FT                   /locus_tag="HVO_0042"
FT                   /product="acetylornithine deacetylase"
FT                   /EC_number="3.5.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02924"
FT                   /db_xref="GOA:D4GYN7"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010175"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYN7"
FT                   /protein_id="ADE02924.1"
FT                   /translation="MNAEIDREGHDESETEAESAAETAADTEVDADADTDALDEGEWVD
FT                   ARHLLYDMVSTPSVSGDEEAAAEVLKAFFEAHDREVWIDEVGNVRAPADDAVLLTSHVD
FT                   TVPGDVPVKVEDGVLWGRGSVDATGPLCTMAAAAVETGVSFVGVVGEETSSRGAWHLVE
FT                   DREEPDAVVNGEPSGWDGVTLGYRGFLSGTYISTSELGHSSRPEENAIQSAVAWWSRVA
FT                   DFFDEDRDGVFDTVTTKPVTFDGGPTEDGLAVEATVDVQFRVPPRLSIDDVREVAESEL
FT                   TRGGVHWNKPIPPVMMSPRTDVARAFRVAIRNVGGVKPRLLRKTGTSDMNIFAGTWDCP
FT                   MATYGPGDSDLDHAPNEHLDLAEFDSAIDVLVDVCERLADD"
FT   gene            complement(42218..43354)
FT                   /gene="argD"
FT                   /locus_tag="HVO_0043"
FT   CDS_pept        complement(42218..43354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argD"
FT                   /locus_tag="HVO_0043"
FT                   /product="acetylornithine aminotransferase"
FT                   /EC_number="2.6.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04533"
FT                   /db_xref="GOA:D4GYN8"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR037537"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYN8"
FT                   /protein_id="ADE04533.1"
FT                   /translation="MSGFVFNEKPIAIESGEGSYLYSDDGTEYLDFGASYAVAALGHSH
FT                   PAVTSAIQEQAAKLTYVQASYPVEVRTELYEKLATLAPGDISNVWLCNSGTEANEAAMK
FT                   FARSATGRQKIVATKRAFHGRTLGSLALTWKQKYKKPYEPVAGGVEFVSYGDEAELAEA
FT                   VDDETAAVFLEPIQGEGGINPAAAEYLQTARDLTDDAGAALVFDEIQTGIGRTGALWAC
FT                   ENAGVVPDILTSAKGIANGLPLGATLCADWIADGAASHGSTFSGGPVVCAAANATLDTI
FT                   VEEDLPGHAAAVGDYLTTELEAAVEEHDLPVREVRGDGLMVGVEVKRGANRTLKHLALS
FT                   EQLLALPAGRTVVRFLPPLVIEEEHADRAVDAMTNVLS"
FT   gene            complement(43351..44334)
FT                   /gene="argB"
FT                   /locus_tag="HVO_0044"
FT   CDS_pept        complement(43351..44334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="HVO_0044"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04117"
FT                   /db_xref="GOA:D4GYN9"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037529"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYN9"
FT                   /protein_id="ADE04117.1"
FT                   /translation="MTGYTREELLAAHEQLVDNEDNLIADGGIGIGDSGTSSALRADGG
FT                   KEPPVVVKIGGAKAVDPKGAVSDVAHLVANGTDVVVVHGGSTAVDETLEELGEEPTYVE
FT                   SPSGVSGRFTDERAMEVFSMVMPGKLNTDLTALFREAGVDALGLSGVDGGLLTGPRKSA
FT                   VRVVEDGKKKIKRGDHSGKITSVNATLLETLLDGGYTPIVTVPMLADDGVPVNADADRA
FT                   AAAVAGALGAKLVVLTDVKGVYADPDDESTLIETADTPEEFSALESAAEGFMTKKVMAA
FT                   KEALDGGAAEVVVADANLNDPIVTALNGGGTHVTPGALVEAEGAEQ"
FT   gene            complement(44389..45432)
FT                   /gene="argC"
FT                   /locus_tag="HVO_0045"
FT   CDS_pept        complement(44389..45432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argC"
FT                   /locus_tag="HVO_0045"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04420"
FT                   /db_xref="GOA:D4GYP0"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037535"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYP0"
FT                   /protein_id="ADE04420.1"
FT                   /translation="MSDQLTAGVVGGSGFTGGELLRLLDGHPNFEVEQATSRSYERKTV
FT                   GHVHPNLRHLDLRFTSPEDLESVDVLFTATPHGVSMEHIDAFQDAADTVVDLSADFRLS
FT                   EAAQYDEWYDGHVCPEYLEKSEYALPELNRENLPGADLIAAGGCNATATILGLKPLFDA
FT                   GILAGDEQVVVDVKVGSSEGGAGASKASSHAERSGIVRPYAPTGHRHEAEIEEYLGLSV
FT                   SFTVHAVDMVRGAAATCHVFPDGPVSKGDMWKAFRGSYGDEPFVRTVAGGGGVYRYPEP
FT                   KSVAGTNYGEVGFEVDPGNRRLVVFSAIDNMMKGSAGQAVHAANIALGLDETAGLDFTG
FT                   FHPVGSP"
FT   gene            complement(45429..46304)
FT                   /gene="argX"
FT                   /locus_tag="HVO_0046"
FT   CDS_pept        complement(45429..46304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argX"
FT                   /locus_tag="HVO_0046"
FT                   /product="putative glutamate--argW ligase"
FT                   /EC_number="6.3.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02434"
FT                   /db_xref="GOA:D4GYP1"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011870"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYP1"
FT                   /protein_id="ADE02434.1"
FT                   /translation="MHVGLLYSRIRRDEKLLLNELRDRGHEVTKIDVRKEQFDLTEPPE
FT                   SFDGLDVVVDRCLATSRSIYITRFLKSYGIPVVNSHETADICADKAKNSLALADAGVPT
FT                   PNTKVAFTVDSAMDIVEEFGYPCVLKPVVGSWGRLMAKIDSESAAEAILEHKSTLGNYE
FT                   HKVFYIQEFVEKPGRDIRVLATDGEPVAAMVRSSDHWLTNAAKGASVDEFELDDRAKEL
FT                   VKQASDAVGGGLLGVDLMETGDDYTVHEVNHTVEFKALNDAVEADVPATVVDWLEAKAD
FT                   GAQSLAEVSA"
FT   gene            complement(46306..46485)
FT                   /gene="argW"
FT                   /locus_tag="HVO_0047"
FT   CDS_pept        complement(46306..46485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argW"
FT                   /locus_tag="HVO_0047"
FT                   /product="putative biosynthetic carrier protein ArgW"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02654"
FT                   /db_xref="InterPro:IPR005906"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYP2"
FT                   /protein_id="ADE02654.1"
FT                   /translation="MSDTITAEDPLSGEEIELPADVEVGEIIDSPATGAELEVVSLDPV
FT                   TLEEAPELEEDWGE"
FT   gene            complement(46806..48272)
FT                   /gene="argH"
FT                   /locus_tag="HVO_0048"
FT   CDS_pept        complement(46806..48272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="HVO_0048"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05194"
FT                   /db_xref="GOA:D4GYP3"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYP3"
FT                   /protein_id="ADE05194.1"
FT                   /translation="MAGEDGDSEGVIRRNRFSGGPARGFMSSLAADERIFEADLAVDRA
FT                   HVVMLASQDIIESEVASEILAALDEVEAAGHDALSGGEDVHEAIEAAVIDIVGPDGGKM
FT                   HTARSRNDEVATCIRYRLREDVLSALDAALALRESLLETAAAHTETVMPGYTHLQPAQP
FT                   TTVAHFLLSYERAVARDCARLMCAYERINQSPLGSAAFAGTPFDVNRELAADLLGFDRV
FT                   MENSMDASATRDFLAETLSALTTHAVTLSGLAADLVIFSNKGLVELSDDYSSTSSIMPQ
FT                   KKNPDTMELVRAVAGDAVGELTGLLTTLKGLPRAYNRDLQRAHKHAFRTVDDVGEAAAV
FT                   AAGAVASATWPEDELAAAAGDGFSTATGVADLLAMAGLPFRTAHEVVAEAAARSEGTPD
FT                   VATLDAVATDVLGESLFTHVTAEAVEAALDPTESVASRDSVGGPAPAAVEATLSTARDE
FT                   LSDDAAAVADARDSLAAAAEGLDEEVSSYV"
FT   gene            complement(48274..49491)
FT                   /gene="argG"
FT                   /locus_tag="HVO_0049"
FT   CDS_pept        complement(48274..49491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="HVO_0049"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03981"
FT                   /db_xref="GOA:D4GYP4"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYP4"
FT                   /protein_id="ADE03981.1"
FT                   /translation="MKKVALAFSGGLDTTVCVPILEEEYGYDEVVGVTVDVGQPEEEFE
FT                   EAYETAEALGLEHYVVDAKQEFAQLCLDSVCANADYQGYPLGTALARPVIAKAILELAE
FT                   EQDCDGIAHGCTGKGNDQLRFEAVWRASDLEVIAPVREMGMTREWEIEYAAEKDLPVQG
FT                   GNEGVWSIDTNLWSRSIEGGNLEDPGYVPPEDIYEWTDQPSDETELIEIAFEDGYPVAV
FT                   DDEEFEPLELISFLNEKAGKHGVGRTDMMEDRMLGLKVRENYEHPAATTLLNAHEALEG
FT                   LVLTKEERDFKATVDNEWSQKAYEGLIDAPLVGALNAFLEKTQERVTGTVTIKFEGGQA
FT                   RPVGRESEYAAYSESAASFNTETVDGIEQADATGVAKYHGFQARLANQSAKKRKPELAA
FT                   DGGSDE"
FT   gene            complement(49766..49882)
FT                   /locus_tag="HVO_0050"
FT   CDS_pept        complement(49766..49882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0050"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03545"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYP5"
FT                   /protein_id="ADE03545.1"
FT                   /translation="MTLIEWLIIAVVVVAVIALVLALVDNELLVELAGELLD"
FT   gene            complement(49976..51190)
FT                   /gene="kef2"
FT                   /locus_tag="HVO_0051"
FT   CDS_pept        complement(49976..51190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kef2"
FT                   /locus_tag="HVO_0051"
FT                   /product="Kef-type transport system (probable substrate
FT                   potassium)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03570"
FT                   /db_xref="GOA:D4GYP6"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYP6"
FT                   /protein_id="ADE03570.1"
FT                   /translation="MAAALLEFGYLFAVLAVVGAVALRLGLSVIPLYVVGGVVAGPYVA
FT                   GRFGLPYVPNGEVVTVLAELGIVLLLFFLGLEFSLDRLRSSGAKIGRAGVIDLAVNLPI
FT                   GVAIGLVLGWSPVEALLLGGIVYISSSAIVTKTLIDLGWIADPESEPILGTLVFEDLAI
FT                   AVYLAVVTSLVLGGDGGVAAIGRSLAIAFGFLGLLFVAVQYGTALFARVLDVENQEAFV
FT                   LRALAVVVPISGAALALGVSEAVAAFFVGMGFSTSGHRERLEHLLVSVRDVFAAVFFFW
FT                   IGLGTDPTLLAAAAVPLAIAVVLSTPSKVLSGYLGGRAYDLSAHRSLRVGVGMVPRGEF
FT                   SLVIAALAAAGTTPVMRDIIPAFAVGYVFVMSALGTVLMQRSDLVERLVFRGGAADGDA
FT                   STESA"
FT   gene            complement(51190..51675)
FT                   /locus_tag="HVO_0052"
FT   CDS_pept        complement(51190..51675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0052"
FT                   /product="TrkA-C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02683"
FT                   /db_xref="GOA:D4GYP7"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR026278"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYP7"
FT                   /protein_id="ADE02683.1"
FT                   /translation="MTVYERDLPGVGKKHEVDLGDGSRLVIVTHNSGKREVFRRASADG
FT                   DSEKLFELTDKLARQVGTLLEGAYFQPVQTETIETLLGDNTLIEWVEVGANSDIAGKTL
FT                   GESDLRQATGASVIAIERGDEVVTSPGGDAMVEAGDTLVVIGPKTACRDFVALVKGA"
FT   gene            complement(51719..52321)
FT                   /locus_tag="HVO_0053"
FT   CDS_pept        complement(51719..52321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0053"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02277"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYP8"
FT                   /protein_id="ADE02277.1"
FT                   /translation="MGRPSTAEVKRRLVHASGSGMPLLYLLGLVEWRTLGYLFVFLAAV
FT                   VSVLELLRLFGGLEWAVYDELTREYEQDNVAGYALYVYSQTAVALVFGPHIAVPGMLML
FT                   TIGDPISGLMGSAPVGELKSARTLAAMFAVCFALAAPFVIPVSGGVAGGLAAAAGAAGA
FT                   TLADGAKPVVAGYVIDDNLSIPPVACTAIAATLWLLT"
FT   gene            complement(52328..54112)
FT                   /gene="glyS"
FT                   /locus_tag="HVO_0054"
FT   CDS_pept        complement(52328..54112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="HVO_0054"
FT                   /product="glycine--tRNA ligase"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04745"
FT                   /db_xref="GOA:D4GYP9"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR027031"
FT                   /db_xref="InterPro:IPR033731"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYP9"
FT                   /protein_id="ADE04745.1"
FT                   /translation="MSEGDESAALTELAKRRGFFFGSSEAYGGVGGFYTYGPQGAALKS
FT                   NVEEAWRERFAVQEGNLEIEAPTIMPEPVFEASGHLDGFDDMLVECAECGESHRADHLI
FT                   EDNSELEDAETLSPEAAAEKIADLGLVCPTCGADLAGQSVEDFNLMFETNIGPGSSTPG
FT                   YLRPETAQGIFVEFPRIKEYARNSLPFGVTQVGRAYRNEISPRKSIVRTREFTQAELEH
FT                   FIDPERDEADLSAVEDVEVLLYPATEQEADDGDYVETTIGEAVDDGIIGNAWLGYFLGI
FT                   AQEWYETVGVDMDRFRFRQHLAGERAHYSSDCWDAESEVDGDWIEIAGFSYRSDYDLSK
FT                   HGEYGDDDFTVFQQYDEPKTVERAVVDPDMATLGPEFGAQAADVAEALETLAERDPDAF
FT                   DADEVTLDVDGEEITVDTDVANFAVETQTEAGEHITPHVVEPSFGIDRTVYTLLAHAYE
FT                   TDEVDGEARSYLSLSPSVAPTNVGVFPLVSNVDGLVDLADDVAEELRAAGFAVVYDDSG
FT                   SIGRRYRRQDEVGTPFCITIDRDGLEGDGADTVTIRERDSGKQVRLPVDDLVGTLVGLR
FT                   AGTASFDDVLDDNEVVEA"
FT   gene            complement(54105..54959)
FT                   /locus_tag="HVO_0055"
FT   CDS_pept        complement(54105..54959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0055"
FT                   /product="CBS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04043"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYQ0"
FT                   /protein_id="ADE04043.1"
FT                   /translation="MKVADAMTRGEEVVTVSLPGTRDDVLEYLQERGFSSVPVVKETDE
FT                   GTKYRGLISREDLIEHPDEDQLAVLVREVPTASADDDLEAVAATMVSEGARRIPVVDGD
FT                   AIEGILTVTDVVRAIARGDIDGETEVGDVAARDVNTTYVDVPLHIVEREIFYANVPYAV
FT                   VLDDEASLAGIVTEVDIIEVARVVEGEAGTGDSVANQDDEWMWEGIKAVGNRYIPTRNV
FT                   EIPAEPVSKFMTDDLVSVATRATAKDAAQTMIREDIEQIPLVSGDELIGVVRDINLLEA
FT                   LYE"
FT   gene            complement(55092..55670)
FT                   /locus_tag="HVO_0056"
FT   CDS_pept        complement(55092..55670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0056"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03587"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYQ1"
FT                   /protein_id="ADE03587.1"
FT                   /translation="MAELGDDETPEAERIASDADRRREAWGATLDDMTAMADEFEDEGW
FT                   ETVRIPAGDSGPFGPSSGKGGEGAFGFAYVIPGDKAETVADLFEATSFPEYEVYRAEND
FT                   GRVYIVTALFSPETETAVFIAGAWDLREALECATVAVEEGRMYSYLQKLDGTVVGVVEH
FT                   DDPEKFFPNLDAIRRYAPNSDGEGEGDEN"
FT   gene            complement(55732..56178)
FT                   /locus_tag="HVO_0057"
FT   CDS_pept        complement(55732..56178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0057"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02703"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYQ2"
FT                   /protein_id="ADE02703.1"
FT                   /translation="MEFDPRRFGVKAIDAVVYAVSLTGVVFVVTAVVSTLAGNGLPGAK
FT                   WLMFFLGFAMFGYASLKVRPKAAWKHGDGNDGDGGSDGGLFSGSDEPVGVEKLVGDALD
FT                   AILPPRLRPANSDERPSSGVKLLLASVCILATSYAMEVVFELNY"
FT   gene            complement(56181..57515)
FT                   /gene="dppF1"
FT                   /locus_tag="HVO_0058"
FT   CDS_pept        complement(56181..57515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppF1"
FT                   /locus_tag="HVO_0058"
FT                   /product="ABC-type transport system ATP-binding protein
FT                   (probable substrate dipeptide/oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05169"
FT                   /db_xref="GOA:D4GYQ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYQ3"
FT                   /protein_id="ADE05169.1"
FT                   /translation="MSTTSTEEERSTEARGDTILEVNDLKTYYEDGGFLGSNPVKAVDG
FT                   VSFDIQRGETLGLVGESGCGKSTLGRTLMRLEEATAGEVKLNGTDITTLSGSDLKQFRK
FT                   DVQMVFQDPDSSLNERMTVGEIVREPLDVHDWKTPSERRERVRELLETVGLQEQHYYRY
FT                   PHQFSGGQRQRIGIARALALEPEFIILDEPVSALDVSVQAKILNLLEDLQNEFGLTYLF
FT                   IAHDLAVVRHICDRVAVMYLGNMMEIGPADEMFDQPANPYTHALLSSIPEPDPTIERDR
FT                   ITLRGTPPSPRDPPAGCPFSTRCPVKIRPEAYRDMDPELWERIEVFREVLRERSRADPS
FT                   LSDRVRKLLGRESHRAGMDEIIPELFGDFDAPSDVMNHIHEAADYAENDDEDAARTYLH
FT                   EEFGSVCDHERPEQLAVGNRGRLSLCHRHEAEYEEPATVFETLVQ"
FT   gene            complement(57512..58591)
FT                   /gene="dppD1"
FT                   /locus_tag="HVO_0059"
FT   CDS_pept        complement(57512..58591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppD1"
FT                   /locus_tag="HVO_0059"
FT                   /product="ABC-type transport system ATP-binding protein
FT                   (probable substrate dipeptide/oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04379"
FT                   /db_xref="GOA:D4GYQ4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYQ4"
FT                   /protein_id="ADE04379.1"
FT                   /translation="MSTEQARSARTEGEPLLSVENLRTSFYTDKEVIRAVDGISFDIFR
FT                   GETVGIVGESGSGKSVTARSIMRLVEKPGRIENGRIMYDGEDLLDKSAKQMRSIRGGSI
FT                   AMVFQDPLTSLNPVYTVGNQIKEALRLHRGLSGSKATKEAIELLEAVGIPDAHRRVREY
FT                   PHQFSGGMRQRAVIAMALACDPELLICDEPTTALDVTIQAQILELLEELQEERDLGIMF
FT                   ITHDMGVIAEIADRVNVMYAGEIVESAPVVELFESPKHPYTQGLLNSIPGQGLDEDERL
FT                   ATIEGDVPTPNEDPTYCRFAPRCPKAFTECDTVHPEPVEVGDGTGRHRASCLLYPDDLP
FT                   TEEAVAVHREGGQRGGDTR"
FT   gene            complement(58588..60027)
FT                   /gene="dppC1"
FT                   /locus_tag="HVO_0060"
FT   CDS_pept        complement(58588..60027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppC1"
FT                   /locus_tag="HVO_0060"
FT                   /product="ABC-type transport system permease protein
FT                   (probable substrate dipeptide/oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03900"
FT                   /db_xref="GOA:D4GYQ5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYQ5"
FT                   /protein_id="ADE03900.1"
FT                   /translation="MSTTTETEIPLRQRVAENPQPALIWAAVGAVLIGAELGAILQVVG
FT                   AVAGVVVNLLPGDPGASAVQSLQAAFDAIPTLVSRDVIPNQGYWDGTSYENTFLGLSPA
FT                   VAWAIRVAVVYAYAFAVLAWAWNGYKRFRRHYRRVDWTPRDDVVNRFRGHSWGKFGLII
FT                   VITFVVMAVFAPALGPTTMERNILQPYDYEVSYWSEDTQSVETVLVGEANLGSGSQGAG
FT                   DENVAPLTYDDFGRFHPFGTATNGKDLFTQVVFGARISLTIAVVAMGIAGLIGLGLAMI
FT                   TAYYKGLADLATVLVSDSIQALPVIMVLILMLVIFQNTWVRELYDGAVLIILIFSIVYW
FT                   PFIWRSIRGPALQVSEQDWIDAAKSFGQSPSQVMRKHMAPYVFSYMLIYASLSLGGIII
FT                   SVAGLSYLGLGITAPTPEWGRLIANGQQYVASPSWHISLLPGLLITLVVTGLNAFGDGI
FT                   RDAIDPQADTGDEAAATGGGA"
FT   gene            complement(60034..61083)
FT                   /gene="dppB1"
FT                   /locus_tag="HVO_0061"
FT   CDS_pept        complement(60034..61083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppB1"
FT                   /locus_tag="HVO_0061"
FT                   /product="ABC-type transport system permease protein
FT                   (probable substrate dipeptide/oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04917"
FT                   /db_xref="GOA:D4GYQ6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYQ6"
FT                   /protein_id="ADE04917.1"
FT                   /translation="MSRWQYFLRRVLMSIPVVIFGTTITFALIRLGPLDPVSAILGTQY
FT                   NPQAAEQIRTNLGLNQPLWSQYLDFMYRLFTFQLGQSWVIAPGTTAYELIEIYAPRTIW
FT                   LGFWSVVIALFVGIPLGFYAGLNPNTPSDYAASFGGIVWRAMPNFWLAIMLVTALSQLG
FT                   TWTNGLFAWQTWIVRTNVVTPPALDFFQSPVEQFLEDPGGWTESFVRATKQIAPAALVL
FT                   GSASMGNEMRIGRTAVLETINSNYVETARAKGVSGRSLVWKHIFRNALIPLVPIITGEA
FT                   FLLLGGSVFVETVFAINGLGWLFFNAAINGDLPLIGTLMFIFILILVGTNILQDFLYTI
FT                   IDPRVGYDG"
FT   gene            complement(61296..63134)
FT                   /gene="dppA1"
FT                   /locus_tag="HVO_0062"
FT   CDS_pept        complement(61296..63134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppA1"
FT                   /locus_tag="HVO_0062"
FT                   /product="ABC-type transport system periplasmic
FT                   substrate-binding protein (probable substrate
FT                   dipeptide/oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04277"
FT                   /db_xref="GOA:D4GYQ7"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYQ7"
FT                   /protein_id="ADE04277.1"
FT                   /translation="MPDTNKLSRRRFLKATGGAATAAALAGCTGGDGEETTTTESGGDE
FT                   TTTATTTEEDTGTELSGSVFNRILSGTITTMDPVAATDTSSGIIIQQVFDCLMSYQNAL
FT                   PTVENELAADYTVSDDFTTYTFQLADATYHNGETVTASDFIYAWERLAASSNSRRAYFI
FT                   LDSIGVEHETDDEGNYVPGSLGVEVGETETELVVNLSEPFHDTLEMFAYTSFAALPEGI
FT                   LGDIEGHDGEMEYTEFASNNPIGAGPFEFAFWEQGTAAAVSKYDDYYGQVAQVDNVRWQ
FT                   IIEDDTARYNYAMNENADYFGLPTAQYDPGLAQVESTDEYGREIGTYGPVRNGKTLNYV
FT                   GVPTLSIYYVGFNMNKVPKAVRQAFAYVLNQDQMVSEVFKGRGSAAEFFTPPTIFPGGA
FT                   QAASDLVSSDYPYSAGETDIEAARQVMEEAGYGPDNQFEVQWTQYNNNAWEEMASILRD
FT                   QLASAHINMQIQKADFSTLLERGRNGQLEAYTLGWIADWPAPDNFLQLLNPPQTDTSEQ
FT                   GPISYVNWTAENGDAAQQATDAYQQVVNNPAPTDEAQQVRDEAYVDIEMANWEDVAMLP
FT                   VYNQKEEMFWYDTVDIEPFGGMGPSRQKLNTVTLNR"
FT   gene            63370..63537
FT                   /locus_tag="HVO_0063"
FT   CDS_pept        63370..63537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0063"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04289"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYQ8"
FT                   /protein_id="ADE04289.1"
FT                   /translation="MTPDATASVDDSGAEVMASVDRSQTGQRLIIADISRDDAWLAADV
FT                   ADALALDEWQ"
FT   gene            63622..64041
FT                   /locus_tag="HVO_0064"
FT   CDS_pept        63622..64041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0064"
FT                   /product="DUF296 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02505"
FT                   /db_xref="InterPro:IPR005175"
FT                   /db_xref="InterPro:IPR025707"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYQ9"
FT                   /protein_id="ADE02505.2"
FT                   /translation="MNARAVTVSEEYLARLEHGADWREEIEEFCARKDIESAWFNAMGA
FT                   VQDAELWFYDQTDQEYQSVTFDEPLEVAACVGNVALLDGEPFAHTHAILSRRSGQALAG
FT                   HLDSATVFAGELNLRAFEEPLERDHDAVTDLDLWL"
FT   gene            64044..67652
FT                   /gene="polD2"
FT                   /locus_tag="HVO_0065"
FT   CDS_pept        64044..67652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polD2"
FT                   /locus_tag="HVO_0065"
FT                   /product="DNA-directed DNA polymerase D large subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04791"
FT                   /db_xref="GOA:D4GYR0"
FT                   /db_xref="InterPro:IPR004475"
FT                   /db_xref="InterPro:IPR016033"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYR0"
FT                   /protein_id="ADE04791.1"
FT                   /translation="MREEETRYFRRIEARLDEAFDLAEAAKATGYDPKTEVEIPVAKDM
FT                   ADRVENILGIDGVAERVRELEGEMSREEAALELVTDFVDGNVGDYDSREGKVEGAVRTA
FT                   VALLTEGVVAAPIEGIDRVEILENDDGTEFVNVYYAGPIRSAGGTAQALSVLVADYARS
FT                   LLDIDEYKARTDEVERYVEEINLYDKETGLQYSPKDKESRFIAENMPIMLDGEATGDEE
FT                   VSGYRDLERVDTNSARGGMCLVMAEGIALKAPKIQRYTRQLDEVDWPWLQDLIDGTIGK
FT                   DDDNAANADDAGDDGDEAEAETDPDAEADDAESDAPDGPTRVEPATKFLRDLIAGRPVF
FT                   GHPSAPGGFRLRYGRARNHGFATAGVHPATMHIVDDFIATGTQIKTERPGKAGGVVPVD
FT                   SIEGPTVRLANGDVRRIDDPEEAKELQNGVEKILDLGEYLVNFGEFVENNHPLAPASYV
FT                   FEWWIQEFEATEANVQALRDDPAVDLEEPSVEQALSWATEFDAPLHPVYTYLWHDISVE
FT                   RFDALADAVAAGEIVAAEADGGTTAALEHDNEPEHGLEGTLVLDNAPEIREALEHLLVA
FT                   HRQTDEALRVPVWRPLARSLGLTDDRERTWELDDLSERARTWDDGDNAVEAVNEVAPFN
FT                   VRERAPTRIGNRMGRPEKSERRDLSPAVHTLFPIGEAGGSQRDVGDAARHRGESGKRGQ
FT                   ISVRLGQRKCPDCGAFGFKSKCPDCGGHTEPHYECDDCGSVIEPDESGRVYCERCEWDV
FT                   ESAEWQDVDLNSEYRDALERVGERESSFQILKGVKGLTSANKTPEPIEKGVLRAKHDVS
FT                   SFKDGTVRYDMTDLPVTAVRPEELDVTADHFRELGYETDIDGEPLRFDDQLVELKVQDI
FT                   VLSNGAAQHMMQTADFVDDLLDQFYGLDRFYEIEERDDLIGELVFGMAPHTSAAVVGRV
FT                   VGFTTAAVGYAHPYFHAAKRRNCDGDEDCVMLLMDGLLNFSKKYLPDKRGGQMDAPLVM
FT                   SSRIDPSEIDDEAHNMDIVRQYPREFYEATLRMEDPDDWEDEVTIAEEYLGTDREYTGF
FT                   DHTHDTTDIAAGPDLSAYKTLGSMMDKMDAQLFLARKLRAVDETDVAERVIEYHFLPDL
FT                   IGNLRAFSRQETRCLDCGEKYRRMPLSGDCRECGGRVNLTVHQGSVNKYMDTAIQVAEE
FT                   FDCRDYTKQRLEVLEKSLESVFENDKNKQSGIADFM"
FT   gene            complement(67810..69072)
FT                   /locus_tag="HVO_0066"
FT   CDS_pept        complement(67810..69072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0066"
FT                   /product="PQQ repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03912"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYR1"
FT                   /protein_id="ADE03912.1"
FT                   /translation="MPRLRSRRRFLQLLGSASFGVAGCLGRDGGSSGPTTTEATTTTAE
FT                   PSTTYGPTSGPDERVTATPPGDPALSPSGAWPQYRFDAGNTGYNPDVSIPTDAEEYWRL
FT                   NAGGSPVLDGDRLYNLHGRGRDERAFVRREPSTMGERAVTPLVGYGVNSPPVVAGDRVV
FT                   VTTFIEVFCLAADRDEVLWRGPEMDGIHGPPAVGDGVAVVSGGGFDGVPTQLRAFDLAD
FT                   GSERWRYDLESDAKGAPAVADGAVFVVTSDVVHAVDLATGERRFRVEVRTSEWTTPVAT
FT                   PEAAYLSTRDGELLSLAPSDGTERWRSPGSGAPVVTDDVLHVAVDGETATLSRDDGKEV
FT                   ATRFVGAPHARAREVVLVSDEQGRLAAYNTDEERQLWTHQTPEVQVSDVVSQGVAAAVP
FT                   VDGAVYVVAADGFHGLGAAQD"
FT   gene            69249..69536
FT                   /locus_tag="HVO_0067"
FT   CDS_pept        69249..69536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0067"
FT                   /product="small CPxCG-related zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02318"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYR2"
FT                   /protein_id="ADE02318.1"
FT                   /translation="MADETQPTVGMTVYAADGTELGSVRGFDDDGFFVTTREGLAGMSV
FT                   EHERAGHEFGEAELMWRCSDCGEMGDLDELPDACPNCGAEREQLYYWTED"
FT   gene            69607..70503
FT                   /gene="panE"
FT                   /locus_tag="HVO_0068"
FT   CDS_pept        69607..70503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panE"
FT                   /locus_tag="HVO_0068"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04775"
FT                   /db_xref="GOA:D4GYR3"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYR3"
FT                   /protein_id="ADE04775.1"
FT                   /translation="MRILVFGAGSLGTLVGGLLASVHDVTLVARDPHAARVSAAGLDII
FT                   GAGSAHISPAATTTDTGHSADLALVTVKSFDTAAAADALADCDVDAVLSLQNGLTEETL
FT                   ASRLDAPVLAGTATYGARLVEPGRVECTGVGRIVLGALDGGPDPLAERVGKAFRDAGLN
FT                   TLVATDMPRRRWEKLAVNAGINAVTALARVENGALAGDDAGELAHRAARETARVARLER
FT                   VSLPNRVAREAVDRVVEKTAANRSSMLQDVAAEKRTEVDAINGAVVDIAADHDFEVPTN
FT                   RTLAALLRAWERGAGLR"
FT   gene            complement(70535..72082)
FT                   /locus_tag="HVO_0069"
FT   CDS_pept        complement(70535..72082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0069"
FT                   /product="sulfatase"
FT                   /EC_number="3.1.6.-"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03965"
FT                   /db_xref="GOA:D4GYR4"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYR4"
FT                   /protein_id="ADE03965.1"
FT                   /translation="MTAESPENVLFVVMDTVRKDHLTPYGYDRPTTPGLDRFADEATVF
FT                   EQAVAPAPWTLPVHASLFTGMYPSQHGANQENPYLEGATTLAETLSAAGYDTACYSSNA
FT                   WITPYTHLTDGFAEQDNFFEVMPGEFLSGPLAKAWKTMNDSDALRTLADKLVSLGNTAH
FT                   EYLAGGEGADSKTPAVVDQTIDFIDDSEEFFAFVNLMDAHLPYHPPEEYKERFAPGVDS
FT                   TEVCQNSKEYNAGAYEIDDDEWDDIRGLYDAEIAHIDDQLTRLFDHLKETDRWDDTMVV
FT                   VCADHGELHGEHGLYGHEFCLYDPLINVPLMVKHPDLDAERRGDQVELVDLYHTVLDSL
FT                   GVEGGEPATPGDDAVGLDRTRSLLSADYREFAQSSNDDPGQRRDGQYAFVEYSRPVVEL
FT                   KQLEEKASSAGITLPEDSRFYSRMRAARRTDAKYVRIDRIPDEAYRIDDDPEETENVVD
FT                   ADTGDEAIAETEAALAEFEDAIGGAWTDALDTDVSDDSVDQMDDEAQDRLRDLGYLE"
FT   gene            complement(72161..72538)
FT                   /locus_tag="HVO_0070"
FT   CDS_pept        complement(72161..72538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0070"
FT                   /product="NifU C-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03647"
FT                   /db_xref="GOA:D4GYR5"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYR5"
FT                   /protein_id="ADE03647.1"
FT                   /translation="MSTETQDGEDDLKERVVNFLRRNFPQIQMHGGSAAIRDLDRETGE
FT                   VTVLLGGACSGCGISPMTIQAIKTRMVKEIPEINEVHADTGMGGDGGMGGDSRGGSPSF
FT                   PGDTSDDTTDIEDDQGPQAPF"
FT   gene            complement(72583..72900)
FT                   /locus_tag="HVO_0071"
FT   CDS_pept        complement(72583..72900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0071"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02745"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYR6"
FT                   /protein_id="ADE02745.1"
FT                   /translation="MTEFDPEKFEDKYANYFPELQRAYKNAFETMNDEFDSSLIHGVDQ
FT                   QILNESEPFYDDGDFSVQLPDDPAERLTAVEIDDDELDAVLDRYVDEIESELRRVFGVE
FT                   A"
FT   gene            complement(73059..73280)
FT                   /locus_tag="HVO_0072"
FT   CDS_pept        complement(73059..73280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0072"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02490"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYR7"
FT                   /protein_id="ADE02490.1"
FT                   /translation="MATANSNEVEYDYPVGYEPEVQTETVELDRRTVERLDALREDDES
FT                   YDELITELASIFAASELSAARVDSPLIE"
FT   gene            73836..74666
FT                   /locus_tag="HVO_0074"
FT   CDS_pept        73836..74666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0074"
FT                   /product="polyphosphate kinase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03366"
FT                   /db_xref="GOA:D4GYR8"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYR8"
FT                   /protein_id="ADE03366.1"
FT                   /translation="MSADEPRYDDEGVLKKQQYKRELHRLQEELVKLQYWIKERDLRVC
FT                   VVFEGRDAAGKGGVIKRITRRLNPRVARVVALGKPTEREQGQWYFQRYVEQLPTEGEMV
FT                   LFDRSWYNRAGVERVMGFCTDEEYEEFLRTCPEFERMLVRSGVILVKYWFSISDEEQER
FT                   RFQKRTDDPKRRWKLSLMDLEARSRWVEYSKAKDRMFEHTDIDEAPWHVVHADVKRHAR
FT                   LNCISHLLDQIDYEDLTPDPIELPPRQDDTGYERPPIDSQNWVPARFGENPVDD"
FT   gene            complement(74663..76093)
FT                   /gene="recJ1"
FT                   /locus_tag="HVO_0073"
FT   CDS_pept        complement(74663..76093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recJ1"
FT                   /locus_tag="HVO_0073"
FT                   /product="single-stranded-DNA-specific exonuclease RecJ1"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03815"
FT                   /db_xref="GOA:D4GYR9"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYR9"
FT                   /protein_id="ADE03815.1"
FT                   /translation="MDGPVPELTEHAAACAARLRDADRVLLASHIDADGLTSAGIASTA
FT                   LERAGIPFETVFCRQLDEAAVADIAATDYDTVLFTDFGSGQLDIIADHEAAGDFHPVIA
FT                   DHHQPAEGVETDHHLNPLRFGLNGASELSGAGASYVLARALEPDAGDNRDLAALAVVGA
FT                   VGDMQDTNGELRGANAGIVDEGVEVGVVEEGTDLRIYGRQTRALPKLLQYATDVRIPGI
FT                   SNNEAGAIEFLTELDVPCRDDDGEWKRWVDLTGDERQTLASALMRRAIASGVPASRIDD
FT                   LVGTTYVLSREREGTELRDVSEFSTLLNATARYDRADVGLAVCLGERDAALDRARRLLR
FT                   NHRKNLSNGLQWVKEHGVRVEDNLQWFDAGDEIRETIVGIVAGMAVGTDATRNGIPVLA
FT                   FAEKEDGEVKVSSRGSYVMVRDGLDLSAVMREASRAVGGDGGGHDVAAGATIPKGEVEA
FT                   FIAEADRIVGEQLAENAD"
FT   gene            complement(76230..77447)
FT                   /locus_tag="HVO_0075"
FT   CDS_pept        complement(76230..77447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0075"
FT                   /product="major facilitator superfamily transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02342"
FT                   /db_xref="GOA:D4GYS0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYS0"
FT                   /protein_id="ADE02342.1"
FT                   /translation="MTGNEAGEEARVETRDDSGDGSWRAVGSVAGWQTAASLCYYAIFA
FT                   ATGFVRDAFSVSESLVGLFLTAGLLGYTVFLFPSGAAVDGYGEKPVMVVGLLALSVALV
FT                   GVTFAPPSYLLLLVTVALLGAAYSTAMPASNRGIVAAAPAGSKNLAMGLKQVGVTVGSG
FT                   ASSLVVTGVAVVAAWQVGFWAIAVFAAGYALVFATRYRGNLGTGRLERPRLAGLGGNRA
FT                   YVALVAAGLFIGASIFSMLGYTVLYVQDVVGTGPALAGGVLAATQVTGSVGRIGAGSLA
FT                   DRLGGPRGAATVALVQLAGAVALFSLLVGTGGSFALTIAVFVTLGLTIHGSTGVFYSCL
FT                   SGVVDDGDIGAATAGGQTALNVGGLVAPPLFGFVVESTGYGAGWALVAGSTVLATVLLF
FT                   VVRRRI"
FT   gene            complement(77449..78192)
FT                   /gene="hemD"
FT                   /locus_tag="HVO_0076"
FT   CDS_pept        complement(77449..78192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemD"
FT                   /locus_tag="HVO_0076"
FT                   /product="uroporphyrinogen-III synthase"
FT                   /EC_number="4.2.1.75"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03178"
FT                   /db_xref="GOA:D4GYS1"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYS1"
FT                   /protein_id="ADE03178.1"
FT                   /translation="MSQQVRAAVFRPDDDRIERAVELLDSLGATPVPDPMLAIEPTGAT
FT                   PEPGAFVVLTSKTGVELLDEAGWNPGDAVLCCIGPATADAARDAGWTVDRVPDEYTSAG
FT                   LVDHLAPDVDGATVEVARSDHGSAVLTDGLRDAGADVHETVLYRLVRPEGAGESAELAA
FT                   AGDLEAALFTSSLTVEHFLDAAAERGIREEAIAGLNDAVVGAIGPPTRDTAESHGIDVT
FT                   VVPDEATFEALAVAAVETAAPTYHE"
FT   gene            complement(78189..79070)
FT                   /gene="sirA"
FT                   /locus_tag="HVO_0077"
FT   CDS_pept        complement(78189..79070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sirA"
FT                   /locus_tag="HVO_0077"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /EC_number="2.1.1.107"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04330"
FT                   /db_xref="GOA:D4GYS2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYS2"
FT                   /protein_id="ADE04330.1"
FT                   /translation="MTGDDQRAGADEHSNDDATDDDGVGTVHLVGSGPGDPELLTMKAA
FT                   RLIDEADVVLHDKLPGPEILEMIPVEKREDVGKRAGGEWTPQEYTNTRLVELAREGKDV
FT                   VRLKGGDPFVFGRGGEEMEHLADNGIPFEVVPGITSAVAGAGAAGIPVTHRDHVSSVSF
FT                   VTGHEDPTKDESAVDWDALAATGGTLVVLMGVGKLPLYTAELREAGLAGDTPVALIERA
FT                   TWPDMRVATGTLDTIVDVRDETDIEPPAITVIGEVAATRDRVKGFLQGGGADAIEMGAD
FT                   ANPTSGGAGGDE"
FT   gene            complement(79072..80163)
FT                   /gene="hemC"
FT                   /locus_tag="HVO_0078"
FT   CDS_pept        complement(79072..80163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="HVO_0078"
FT                   /product="hydroxymethylbilane synthase (porphobilinogen
FT                   deaminase)"
FT                   /EC_number="2.5.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05165"
FT                   /db_xref="GOA:D4GYS3"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYS3"
FT                   /protein_id="ADE05165.1"
FT                   /translation="MTTTLRLATRGSALARAQAASVQGALAGRRLDVELVEVETTGDRI
FT                   QDELIHRLGKTGAFVRALDERVLDGEVDAAVHSMKDMPTEKPADLVVAGVPERAPAGDV
FT                   LVTAEGHDIDDLPEGAVVGTSSLRRQAQLLNYRDDLEVEPLRGNVDTRIEKLLATHLQR
FT                   EHEARVENDKERQGKKGKTDHDEAFDETADEWFEGLTELERQALGRQVETEYDAIVLAE
FT                   AGLKRSGLTEKVNYERLPRTTFVPAPGQGAIAVTAADSVVIELIRDKLDHPRTRVETTV
FT                   ERTILAELGGGCIAPVGVHALLQGEHVHVDVQVLATDGSESIKTSRDLPVGNHANAARE
FT                   FAAALCDRGAGQLVDAAREEAEE"
FT   gene            80270..80659
FT                   /locus_tag="HVO_0079"
FT   CDS_pept        80270..80659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0079"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04168"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYS4"
FT                   /protein_id="ADE04168.1"
FT                   /translation="MPALDSAVRQVGDFVVVALLLFGLTSVVAPLDLFLSSVGVEPPWF
FT                   AGLVAAALVALALLLARPLRLRLVACVWGVGLVVTAVWIPLLVFLELQGDPVGILVSWA
FT                   AALGVGVALTYPPLWRAAEARLRVE"
FT   gene            80735..80968
FT                   /locus_tag="HVO_0080"
FT   CDS_pept        80735..80968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0080"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05125"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYS5"
FT                   /protein_id="ADE05125.1"
FT                   /translation="MSKCRTVIGLRGDDSDVNRSARLALTFGVAFVVALPLGFIFAPDP
FT                   TGIAPLFLTAGLAAVFGLPVYFGLSRASGSES"
FT   gene            complement(81002..82339)
FT                   /gene="hemL"
FT                   /locus_tag="HVO_0081"
FT   CDS_pept        complement(81002..82339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="HVO_0081"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /EC_number="5.4.3.8"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03275"
FT                   /db_xref="GOA:D4GYS6"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYS6"
FT                   /protein_id="ADE03275.1"
FT                   /translation="MNHDESRSLYDRALSVLAGGVNSSVRATQPYPFFVERGDGAHVID
FT                   ADGNRYVDYVMGYGPLLYGHDAPEPVQSAVQKHAAAGPMYGAPTEIEVEHAEFVARHVP
FT                   SVEMLRFVNSGTEATVSAVRLARGVTGRDKIVVMQGGYHGAQESTLVEGGPDGAKPSTP
FT                   GIPSSFADHTIPVPFNDEETVREVFAEHGEDIAAVLTEPILANTGIVHPVDGYLEALRD
FT                   VTEAHGALLIFDEVITGFRVGGLQCAQGKFGVTPDLTTFGKIIGGGFPVGAVGGKAELV
FT                   EQFTPGGDVFQSGTFSGHPVTMAAGHEYLKYAAENDVYGHVDRLGEKLRAGITDILEDQ
FT                   APEYTVVGTDSMFKTVFTRHGAAERADACVDGCSQVESCPNYDACPKTGADVSNTETDR
FT                   WERVFWQEMKDRGVFLTANQFESQFVSYAHTDEDIEKTLEAYKAAL"
FT   gene            complement(82482..83186)
FT                   /locus_tag="HVO_0082"
FT   CDS_pept        complement(82482..83186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0082"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04851"
FT                   /db_xref="GOA:D4GYS7"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYS7"
FT                   /protein_id="ADE04851.2"
FT                   /translation="MTVAVLGGLAVALFGMAAVGLLADRYLSDPDDLRADLLVSDANKW
FT                   AVFALLCGYVLVVEGRPLSSMTGRSLAPLAFVAVVGGGVFVLFAANAVTTPVFDRLGVG
FT                   GLDEGMSGLGSLSVRHRLFVAGTAGITEEVLFHGYAIERLLELTGSPLLAGGVSFAAFT
FT                   ASHAVGWERGAVARIAVPALLTTIMYLLVRDVVALVCIHALNDAVGLLLAGSVEDAGDA
FT                   DGADAAADGTAR"
FT   gene            complement(83382..83753)
FT                   /locus_tag="HVO_0083"
FT   CDS_pept        complement(83382..83753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0083"
FT                   /product="GlnK-type ammonia transport regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04547"
FT                   /db_xref="GOA:D4GYS8"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYS8"
FT                   /protein_id="ADE04547.1"
FT                   /translation="MSDADAPNDGEIKMVMAVIRPDKLSDVKTALAEIGAPSLTVTNVS
FT                   GRGSQPAKKSQWRGEEYTVDLHQKVKIECVVADIPADDVVDAIADAAQTGEKGDGKVFT
FT                   LPVESAVQVRTGKTGRDAV"
FT   gene            complement(83757..85127)
FT                   /gene="amt1"
FT                   /locus_tag="HVO_0084"
FT   CDS_pept        complement(83757..85127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amt1"
FT                   /locus_tag="HVO_0084"
FT                   /product="transport protein (probable substrate ammonium)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02598"
FT                   /db_xref="GOA:D4GYS9"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYS9"
FT                   /protein_id="ADE02598.1"
FT                   /translation="MLTPLQTDLASVVEGVNLVWVLTVTFLIFFMHAGFAMLEAGQVRA
FT                   KNVANQLTKNLLTWSIGVIVFFLLGAAVSSIVAALTSGSALDITGAFMSLYAPDASATT
FT                   AWVDWLFGAVFAMTAATIVSGAVAGRARLRAYLTYTILIAGVIYPVVVGFTWGGGFLDA
FT                   LGFHDFAGGMIVHGMGGIAGLTAAWIIGPRMDRFKPDGTANVIPGHSITFAVLGTLILA
FT                   FGWYGFNVGTAAAPLAYADGAVTLGSFAYVGRVALVTTLGMAAGAIGAGGVAMYKTGKV
FT                   DTLYVANGVLAGLVGITAIADDIVWPGALVVGLLAGAQLPVVFEFVEKRLRIDDVCAVF
FT                   PVHGSAGVLGTLLYPVFAVPLWHDGASFVSLAVPQVIGVGVIAIWTFVATAVVFDGFRA
FT                   LGQVRVSSDHEREGLDTAEHGVDTYPEFGSPDHDTGIRTDGSGVPSGDGFMTTGRED"
FT   gene            complement(85507..85866)
FT                   /locus_tag="HVO_0085"
FT   CDS_pept        complement(85507..85866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0085"
FT                   /product="GlnK-type ammonia transport regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03597"
FT                   /db_xref="GOA:D4GYT0"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYT0"
FT                   /protein_id="ADE03597.1"
FT                   /translation="MSDGEQGIKMVMAIIRPDKLSDVKTALAEVGAPSLTVTNVSGRGS
FT                   QPAKKGQWRGEEYTVDLHQKVKVECVVADIPADDVVDAIADAAQTGEKGDGKIFVLPVE
FT                   SAVQVRTGKEGETAV"
FT   gene            complement(85863..87266)
FT                   /gene="amt2"
FT                   /locus_tag="HVO_0086"
FT   CDS_pept        complement(85863..87266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amt2"
FT                   /locus_tag="HVO_0086"
FT                   /product="transport protein (probable substrate ammonium)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03887"
FT                   /db_xref="GOA:D4GYT1"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYT1"
FT                   /protein_id="ADE03887.2"
FT                   /translation="MIPLQVDPSVIAQGVNYVWILVVSFLIFFMQPGFALLEAGQVRAK
FT                   NVGNVLMKNMTDWALGVLVYFLVGAGVATIVGGLTSPGGFDVAAAFSYIGDSGAWIDWL
FT                   FGAVFAMTAATIVSGAVAERMDFRAYIVFAATITGFIYPVVQGLTWSGGLLSSGGYIGA
FT                   ALGVGYLDFAGATVVHMCGGVAGLVGAKMVGPRKGRFDSNGNSQPIPGHSMLLAVLGTL
FT                   ILAFGWYGFNVGTQATVLAATDSGGLEFMGAALGRVALVTTLGMGAGAVAAMIVSTSYQ
FT                   GKPDPLWMANGLLAGLVAVTGAVPHVTWWGGLILGALGGAIVLPAYRWTVDSLKIDDVC
FT                   GVFAVHGVAGAVGTALIPVFAVSGFSGTQLVMQVVGVVVIAAWTIIASAVVFAIADAVF
FT                   GLRVSEEEEEEGLDAGEHGVSVYPEFVGDAGPDGALGSPTATDGGSDVRTDGGVEQDET
FT                   VEANGGDSQ"
FT   gene            complement(87625..88608)
FT                   /gene="hemB"
FT                   /locus_tag="HVO_0087"
FT   CDS_pept        complement(87625..88608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="HVO_0087"
FT                   /product="porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02518"
FT                   /db_xref="GOA:D4GYT2"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYT2"
FT                   /protein_id="ADE02518.1"
FT                   /translation="MKFTDRPRRLRTDGIRPLVSETTLDATDLVAPVFVDATTDERVPI
FT                   ESIPGHERVPVAEAADRVAEVREAGVKAVIVFGIPESKDPEGSRAYARNGVVQEAVRAI
FT                   TAETDAYVITDVCLCEYTDHGHCGVLEDHAEDDPTLTVENGPTLDLLAETAVSHAEAGA
FT                   DMVAPSASMDGMVGAIRTALDDAGHDEIPIMSYAAKYESAFYGPFRDAADGAPAFGDRR
FT                   HYQMDPANAREALREVALDVEQGADVLMVKPGLPYLDIVRAIREGYDHPVAAYNVSGEY
FT                   AMLHAAAEKGWLDLDGVAHESLLSMKRAGADLIITYFAERVARQLD"
FT   gene            88714..89034
FT                   /locus_tag="HVO_0088"
FT   CDS_pept        88714..89034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0088"
FT                   /product="YkoX, putative"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04203"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYT3"
FT                   /protein_id="ADE04203.1"
FT                   /translation="MSAFTAQLPDFLRELLASDLALVALFFVFVLEGAMLLYVAPSELL
FT                   VPGALVLVGERLLLPILAVAVLGATVGQVGLFLVAKRGGREYLLSRPWFRVSEDSLDRF
FT                   DG"
FT   gene            89077..89226
FT                   /locus_tag="HVO_0089"
FT   CDS_pept        89077..89226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0089"
FT                   /product="alkaline phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03885"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYT4"
FT                   /protein_id="ADE03885.1"
FT                   /translation="MLFTRGMLTVPAGLSGMSVKRFLALSALGTVVFESALAALYVFGG
FT                   QVLA"
FT   gene            complement(89307..89471)
FT                   /locus_tag="HVO_0090"
FT   CDS_pept        complement(89307..89471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0090"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04693"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYT5"
FT                   /protein_id="ADE04693.1"
FT                   /translation="MQCHYCDREAAYAAEKDHIKVGLCERHFRKRVEELAESEELAALK
FT                   EKLDINRTK"
FT   gene            complement(89547..90341)
FT                   /locus_tag="HVO_0091"
FT   CDS_pept        complement(89547..90341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0091"
FT                   /product="PHP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02507"
FT                   /db_xref="GOA:D4GYT6"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYT6"
FT                   /protein_id="ADE02507.1"
FT                   /translation="MDESPPVADLHLHTTASDGRLTIDALPDAARAGGVDVVAVTDHDR
FT                   YHPELDAPVVERDGVTVVRGIELRVDAGDRRVDLLGYGLRERPALVETVERLQRNRVER
FT                   AREIVAAIEEETGVRLEIDIHDGVGRPHVARAIDASEAPYDYQGAFDELIGADGPCYVA
FT                   RELPTFDDGVAALRDACDVVGLAHPFRYRDPAGALELCADLDAVERYYPYGFDVEADLV
FT                   EEAVERYGLLATGGSDAHDETLGRAGPPETDFARFAAAVDGL"
FT   gene            90474..90758
FT                   /locus_tag="HVO_0092"
FT   CDS_pept        90474..90758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0092"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04528"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYT7"
FT                   /protein_id="ADE04528.1"
FT                   /translation="MRLNGLGDAIDRHEYPISSTDFAQRHGDEVIELQNGQETVAQILA
FT                   RLGDETYTCPQDVRDALLTGVGHEAIGRRYYSDRDPSPLGENGPEMVSF"
FT   gene            complement(90921..91928)
FT                   /locus_tag="HVO_0093"
FT   CDS_pept        complement(90921..91928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0093"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03475"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYT8"
FT                   /protein_id="ADE03475.1"
FT                   /translation="MARPLRFRYAPGRWDESRIGRDIFQPLDANLGAEMGAPWYAPPDG
FT                   YEARRFDMDNGDTALFAWTDDHAYWIGNTETPSSLWRTDKEGFDEAPFEVSRWAQRELI
FT                   AELFDQSPWLKPYSHLSWFFLPVFLSKDGRETTREFFHDHAAGFPDATRKEALEFYESF
FT                   FATGVLDEYREVMAGKLGTSEYFDPIRMAAAMGEFDVAYLLDDAGYDITPEIAVATGHS
FT                   IDFRAENTRAGGALIEVTRPLPPNRRSVSNPVAAIRDTAQTKTNGEGQLAEHGGGVTLF
FT                   VDCSSFPDDDWAAIMGEKPDVRHRPAVVFRLRPSGAVEGYSKGSVPVDLPWLTE"
FT   gene            92094..92270
FT                   /locus_tag="HVO_0094"
FT   CDS_pept        92094..92270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0094"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02773"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYT9"
FT                   /protein_id="ADE02773.2"
FT                   /translation="MSMGAYDEAEHERRERMTSQVEPGTDDDRKTYHGSVEYDSGDSTD
FT                   ALLEQFKRMKSDD"
FT   gene            complement(92298..92993)
FT                   /locus_tag="HVO_0095"
FT   CDS_pept        complement(92298..92993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0095"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03004"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYU0"
FT                   /protein_id="ADE03004.1"
FT                   /translation="MNDAPEYGETWVYESIVGALPGVRIGEAGAIALQIAVFEVAVLVF
FT                   AWVYDLWAAAVAGTAAIVVAAAGSVVMLRMGEWTRAARVPAPYRRLLFGSSIEVVLGVL
FT                   AFVALVTHLFVFDPRQPGTPLMTTLFGPEPPVVVVYLTLLVLWDLCYRIGTSWWAAVVG
FT                   LWGAIRYRFDGPTAETVRRVNLLNVGFAVAQVLLLPFVADQPVLLLAVGGHVVAVTVVS
FT                   VTAAALTRT"
FT   gene            complement(93097..94029)
FT                   /locus_tag="HVO_0096"
FT   CDS_pept        complement(93097..94029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0096"
FT                   /product="arNOG08307 family NADH-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04906"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYU1"
FT                   /protein_id="ADE04906.1"
FT                   /translation="MKVLVTGATGFVGRHLVPLLLDADHDVVVFVRDAARYDGPPGVEV
FT                   VEGDIFEPATLDPAMAGVDAAYYLIHSMHAGGDFEARDRLAARNFVDAAGSAGVERLVY
FT                   LGGLGEDRDQLSAHLRSRREVEHILASGAPALTTLRAAIIVGAGSASFEMVRQLATRLP
FT                   VMVTPQWVETRCQPVAIADVVAYLAGVLDHPETAGETYEIGGPDVLTYREMLQRVGAQL
FT                   GHAPRIVPVPVLTPRLSSYWIGLVTDVDTGVARPLIEGLKNPVVVGDDRIRDIVAVDET
FT                   PFDAAVERALREEREQREKTVEPASTTPT"
FT   gene            complement(94154..95038)
FT                   /locus_tag="HVO_0097"
FT   CDS_pept        complement(94154..95038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0097"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03890"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYU2"
FT                   /protein_id="ADE03890.1"
FT                   /translation="MRVDCEGCAGCCIDWRPVAPAALDHERRGPRAPLDDTYNLVPLTR
FT                   DEVRDFVEAGFGNALSPRLWEAPPGEGVEIDGVEIAAVDGKPAFFVGMRKPPKPVAPFG
FT                   LERTWLRACAFLDPETLQCRIHDTEFYPGECAEYPGHNLVLEQETECERVERHHGGERL
FT                   LDDAAPDDLHGLLLGPHALGAKLFVHPEPERLAGTIDHLKRRELTPEDRAEFVGVAVGS
FT                   HPGSTEVDGDRASRARAKTLESESWAGEAVAAWDAVAGRLGSAAGDAPDPDEVEVARGA
FT                   PETPGWDAVRDDG"
FT   gene            95156..95359
FT                   /locus_tag="HVO_0098"
FT   CDS_pept        95156..95359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0098"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03653"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYU3"
FT                   /protein_id="ADE03653.1"
FT                   /translation="MTSEPCDACGKGVRIAGGIGDLWNFPTSSSGGMTLELVDGSEHFL
FT                   CFDCMERLPGDREPTAEDVAAL"
FT   gene            95441..97351
FT                   /locus_tag="HVO_0099"
FT   CDS_pept        95441..97351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0099"
FT                   /product="helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03896"
FT                   /db_xref="GOA:D4GYU4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR010614"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYU4"
FT                   /protein_id="ADE03896.1"
FT                   /translation="MDPSRIIDSFPAPSFRGAQERALRDIRDAFADGNDVVLVRAPTGS
FT                   GKSLLARAIAGSAATVDETSPAQATDAYYTTPQVSQLDDVAEDDLLSDLKIIRGKSNYN
FT                   CIIRGEEDTPVDRAPCARKRGFDCSVRHRCPYFSDRAIASNRQIAAMTLAYFMQTAGSD
FT                   VFRKRDVVVVDEAHGLAEWAEMYATIDLKPRTVPVWDDIGVPDVAAAGDPVERASRFAE
FT                   TLVGVCKREKDELLTKSELMPEEAARRDRLQELIGELNWFVEDYRDPQSPTTWVVDQHD
FT                   GEGSPIAIKPLDPAKYLKHTVWDRGNKFALLSATILNKAAFCRSVGLDPSKVALVDVEH
FT                   TFPVENRPLYDVTQGKMTYEHRDETLPKIARLVVRLMAKHPDEKGLIHCHSYAIQAELR
FT                   RRLAEMGLGNRVRGHDRDDRNAELETWKATDRPEVFLSVKMEEALDLNGDLCRWQVLCK
FT                   APYLNTNDSRVARRLEDGQWAWYRRAALRTVIQACGRVVRAPDDYGDTYVADSSLLQLF
FT                   DKTRTDMPDWFAAQVDRMTKPDLPEFDPVVAGGRGSNAGNATGGTANLGGSTGRSRGAS
FT                   GSGSDSRRDSTRGSRSAGSRAGGSGGTSSGGSDGRETGGSDGSADDSGRSSHPLSDVWG
FT                   E"
FT   gene            97756..97950
FT                   /locus_tag="HVO_0099A"
FT   CDS_pept        97756..97950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0099A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0099A"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03650"
FT                   /db_xref="InterPro:IPR005368"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYU5"
FT                   /protein_id="ADE03650.1"
FT                   /translation="MHTNALATAMTLYRSGALTLSQAAARSGYSEDDLLLALQRHGVPV
FT                   HEDDAPAASLSADRPASAD"
FT   gene            complement(98087..99214)
FT                   /locus_tag="HVO_0100"
FT   CDS_pept        complement(98087..99214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0100"
FT                   /product="NMD3 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05095"
FT                   /db_xref="GOA:D4GYU6"
FT                   /db_xref="InterPro:IPR007064"
FT                   /db_xref="InterPro:IPR039768"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYU6"
FT                   /protein_id="ADE05095.1"
FT                   /translation="MSESRDFCPRCGDPVPERPEPLPGMPRERDDVLCDSCYFEDFDLV
FT                   DAPDEVQVRVCAQCGAIHRGNRWVDVGARDYTDIAIEEVSNSLGVHLNAEEVRWGVEPE
FT                   QVDENNIRMHCHFSGVVRGTPLEESIVVPVSIARETCQRCGRIAGGYFASLVQVRADDR
FT                   TPTTEEAETAIEIAESYIAEREDKGDRNAFITEVNRTPDGPNIKISTNQMGSGVAKQIR
FT                   ERFGGTIEEHPTLVTEDGDGNEVYRVTFVARLPRYTAGDVIDPEDGDGPVLVRSNRGRL
FT                   KGTRLTSGDLYESEFEEGERPEAEDLGSIEDAAETTVVTVEDEHAVQVLDPETYEAKTI
FT                   PRPDYFDPDASMVPVLKSPSGLHIFPEEVVDDDEE"
FT   gene            complement(99292..99930)
FT                   /gene="gptA1"
FT                   /locus_tag="HVO_0101"
FT   CDS_pept        complement(99292..99930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gptA1"
FT                   /locus_tag="HVO_0101"
FT                   /product="putative phosphoribosyltransferase"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03139"
FT                   /db_xref="GOA:D4GYU7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYU7"
FT                   /protein_id="ADE03139.1"
FT                   /translation="MFADREDAGRRLADLLDERDETADLVLAIPRGGLPVGREVADRLR
FT                   APLDVVVASKVGAPDNPELAVGAVAGDGSAWWNEDLLSYLDVGEDYLDREREREAAAAR
FT                   DKVSLYRGGDPLPDVAEKRVVVVDDGVATGATARACLRQVVAGGAERVVLAVPVGPPNT
FT                   LSELEAECDAVVAVESPEAFGAVGAFYRDFAQVSDEEAATYLRDGAGEH"
FT   gene            100055..100936
FT                   /gene="htpX1"
FT                   /locus_tag="HVO_0102"
FT   CDS_pept        100055..100936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpX1"
FT                   /locus_tag="HVO_0102"
FT                   /product="HtpX-like protease"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02285"
FT                   /db_xref="GOA:D4GYU8"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYU8"
FT                   /protein_id="ADE02285.1"
FT                   /translation="MNWKPDWGLRGRMALTMFLLFALYIVFAGLLAWYFDGLFIMAGFM
FT                   GVFLFAQFFFSDKIALYSMGASVVDEDDGPQARKLHAMVGRLSQQADLPKPKVAIADTR
FT                   VPNAFATGRSQKSSAVCVTTGLMETLDDDELEGVIAHELAHVKNRDVMVMTIASFLSSI
FT                   AFLIVRWGWLFGGDDNRQNAPVIVAIIASLVVWIISYLLIRALSRYREYAADRGAAVIT
FT                   GRPSALASALLKISGRMDNVPKRDMRDTSEMNAFFIIPIKSDFIGRLFSTHPSTENRVE
FT                   RLRDMEREMETA"
FT   gene            100943..101548
FT                   /locus_tag="HVO_0103"
FT   CDS_pept        100943..101548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0103"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03244"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYU9"
FT                   /protein_id="ADE03244.1"
FT                   /translation="MGLFDSFRAMLGISAESDATTKADPEDLFGMSTAYLTMEADLRFD
FT                   SADEAALCFSSVDSTDFADTVDAVEDILTAGSEETGTEFSRHTDGHGYNWVVLADDDPE
FT                   DLVTSVHFAADEFIERGYGSRLLAALFGFERDGDRAYWIYSFRRGAYYPFAPQGTSTRN
FT                   QSLEFKLESVLDGELEIEGDESYWYPLWPSTPNGHPWD"
FT   gene            101807..102838
FT                   /gene="radA"
FT                   /locus_tag="HVO_0104"
FT   CDS_pept        101807..102838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="HVO_0104"
FT                   /product="DNA repair and recombination protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02303"
FT                   /db_xref="GOA:Q48328"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR011938"
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="InterPro:IPR016467"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033925"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48328"
FT                   /protein_id="ADE02303.1"
FT                   /translation="MAEDDLESLPGVGPATADKLVESGYDSYQSIAVASPGELSNKADI
FT                   GSSTASDIINAARDAADVGGFETGSMVLERRQQIGKLSWQIDEVDELLGGGLETQSITE
FT                   VYGEFGAGKSQITHQLAVNVQLPPEQGGLGGGCIFIDSEDTFRPERIDDMVRGLEDEAL
FT                   EATLDDREMEGSIDDEETIKALVDDFLDKIHVAKAFNSNHQILLAEKAKELAGEHEDTE
FT                   WPVRLLCVDSLTAHFRAEYVGRGELAERQQKLNKHLHDLMRIGDLFNTGILVTNQVSSN
FT                   PDSYFGDPTQPIGGNILGHTSTFRIYLRKSKGDKRIVRLVDAPNLADGEAIMRVQDAGL
FT                   KPE"
FT   gene            103089..104234
FT                   /locus_tag="HVO_0105"
FT   CDS_pept        103089..104234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0105"
FT                   /product="FAD-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04892"
FT                   /db_xref="GOA:D4GYV1"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYV1"
FT                   /protein_id="ADE04892.1"
FT                   /translation="MTHRIVVVGGGTGGTVVSNRLAEELESEIDDGDVGVTLVSDDTKH
FT                   VYKPVFLYVPFGVAEPDDGVRDLRDLVDERVDIVTNRVRRVDTDEKCLYCQDGDEELDY
FT                   DTLVLATGAKLDPDAVPGFREGAHHFYNADGAERLRDALAEFEGGRLVLSVVGTPHMCP
FT                   AAPLEFTFIVDDWLRSRGLREDTDLVYTYPMERSHGKPEVAEWADPILAARGVRVETDF
FT                   VVDAVDPDERVVSAESGAEVDYDLLVGIPPHRGDELITDSGLGDAGWVDVDQRTLHATA
FT                   AEDVYAIGDTAALPIPKAGSAAHFQAFAVAERIAAEVRGRTPTKRYDGKTVCFVETGLD
FT                   EASFVSFDYETPATMRQPSKPVHWAKHAYNESYWLTARGML"
FT   gene            104245..104658
FT                   /locus_tag="HVO_0106"
FT   CDS_pept        104245..104658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0106"
FT                   /product="DUF1641 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03974"
FT                   /db_xref="InterPro:IPR012440"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYV2"
FT                   /protein_id="ADE03974.1"
FT                   /translation="MQDHEPTTTTEQQVPEELVRAIENNPEEVALLVERMGLVNDLIDV
FT                   LELGVGALDDEMVRSLARTGTSLAEVADDASDPDTVAGMKRLLRAVGDAEEAEATPVGA
FT                   VGLLRATRDPEVKAGLGYLVALAAALGAGTDEE"
FT   gene            complement(104705..105133)
FT                   /gene="iscU"
FT                   /locus_tag="HVO_0107"
FT   CDS_pept        complement(104705..105133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iscU"
FT                   /locus_tag="HVO_0107"
FT                   /product="iron-sulfur cluster assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03671"
FT                   /db_xref="GOA:D4GYV3"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYV3"
FT                   /protein_id="ADE03671.1"
FT                   /translation="MGIGSDMYRQQIMDHYKNPRNHGRLESPTFTHTGENPSCGDTITM
FT                   DVQLADDGETIERVAFSGDGCAISQASASMLTQRLPGTTLSELEAMDTDDITEMLGVDI
FT                   SPMRIKCAVLARQVAQDGAKIHDGEIEIEKTKTEDGDD"
FT   gene            complement(105206..105793)
FT                   /gene="mscS8"
FT                   /locus_tag="HVO_0108"
FT   CDS_pept        complement(105206..105793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscS8"
FT                   /locus_tag="HVO_0108"
FT                   /product="mechanosensitive channel protein MscS"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02908"
FT                   /db_xref="GOA:D4GYV4"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYV4"
FT                   /protein_id="ADE02908.1"
FT                   /translation="MLQSLTGFLVETLRETIAEFGTAVQDAAPKVLTAVVFLALAYVGI
FT                   KAILFVVRGVLDGLYPEEQDLVVELGVAVAGVFLWFGAALALLNIVGMTEIAASLGTAT
FT                   GFIALGVSYALSNMIADTVAGVYLLRDPDFNPGDRVKSDPVTGTVSSIELRKTRFESDE
FT                   GDTVVVANRDVEKKWTKYDAPAAEDASTADAT"
FT   gene            complement(105867..107147)
FT                   /gene="sufS1"
FT                   /locus_tag="HVO_0109"
FT   CDS_pept        complement(105867..107147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufS1"
FT                   /locus_tag="HVO_0109"
FT                   /product="cysteine desulfurase"
FT                   /EC_number="2.8.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05148"
FT                   /db_xref="GOA:D4GYV5"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="UniProtKB/Swiss-Prot:D4GYV5"
FT                   /protein_id="ADE05148.2"
FT                   /translation="MRVQESYPVDVDAIRADFPILERKVGGDISTPGEHDDDTTPLVYL
FT                   DNAATSHTPEQVVDAIVDYYHGYNSNVHRGIHHLSQEASVAYEDAHDRVAEFIGASGGR
FT                   EEVVFTKNTTESMNLVAYAWGLDELGPGDSVVMTEMEHHASLVTWQQIAKKTGAEVRYI
FT                   RVDDDGRLDMEHAKELIDDSTKMVSVVHVSNTLGTVNPVSELADMAHEVGSYIFVDGAQ
FT                   SVPTRPVDVEDIDADFFAFSGHKMCGPTGIGALYGKRDILDEMGPYLYGGEMIRSVTYE
FT                   DSTWEDLPWKFEAGTPPIAQGVGFAAAVDYLDDIGMENVQAHEELLAEYAYDRLTEFDD
FT                   IEIYGPPGDDRGGLVSFNLDSVHAHDLSSILNEQGVAIRAGDHCTQPLHDKLGVAASTR
FT                   ASFYIYNAREEVDKLVDAIDAARELFA"
FT   gene            107327..108373
FT                   /locus_tag="HVO_0110"
FT   CDS_pept        107327..108373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0110"
FT                   /product="sensor box histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02962"
FT                   /db_xref="GOA:D4GYV6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYV6"
FT                   /protein_id="ADE02962.1"
FT                   /translation="MSNATSSSLAFSSLDALPTQLAILDEDGVILYTNRAWREFGTEHD
FT                   YQGDSSSVGTNYLGVCDLSADADATTASEGIRAVIDDDRDEFSFEYPCETPEERLWFTM
FT                   RATRFTDDGETYVQIAHLDITDRKRAELEAEEKAERLRNLARMLSHDLRNPLSVAVGYV
FT                   ESLLDETAASDRLERVAGALDRMDDIITDALVLARHDTVEGLSTVDLETRAAAAWEHVE
FT                   TGTATLVVADSVEFRADSNLLGHVFENLFRNSAEHGASDDDLTVTVGVLDGDAAEAGFY
FT                   VEDDGVGIPTETRDVVFEAGYSTGEEGTGLGLSIVAQAVRTHDWDVAVTEAEGGGARFE
FT                   ITGVERPA"
FT   gene            complement(108419..108721)
FT                   /locus_tag="HVO_0111"
FT   CDS_pept        complement(108419..108721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0111"
FT                   /product="DUF424 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04182"
FT                   /db_xref="InterPro:IPR007355"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYV7"
FT                   /protein_id="ADE04182.1"
FT                   /translation="MLLRERETPEGLLVSVCDPDCIGETYTDDGVSLDVTEDFYGGGEA
FT                   ETADEDAVVDSLTRATVANIVGEESVSVAIDAGLVDEETVLEVDGTLHAQLLWLR"
FT   gene            complement(108722..109462)
FT                   /locus_tag="HVO_0112"
FT   CDS_pept        complement(108722..109462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0112"
FT                   /product="tetratricopeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04111"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYV8"
FT                   /protein_id="ADE04111.1"
FT                   /translation="MTDDGNRPHRFSEGQGFDEDYSDFSLDPPELSVDPTKVDPVDSRV
FT                   LTDILDQRNIDPEDVDVEKLLDVALSYMQINRFEEATGAFERVARYAGDDDNIAQEAWV
FT                   NKGAAHGQLEEWDEAIGSYREALKLDDDSEHAATAHTNLAYALWEAGQTADALDHAERA
FT                   VELDPRFPQAWYNRGFFLHERGLNEDAVNAFDNAIRLGMRTPGVHEEKARALEELGRDE
FT                   EAEQAQQQADDLREQAEAELVEEY"
FT   gene            109554..110171
FT                   /locus_tag="HVO_0113"
FT   CDS_pept        109554..110171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0113"
FT                   /product="putative phosphatase (histidine phosphatase
FT                   family protein)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02916"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYV9"
FT                   /protein_id="ADE02916.1"
FT                   /translation="MSAPPTTVVSFVRHAHVPSVSDAERTPGLSRHGRRDAARVTARLA
FT                   DLADVVATSPAERARATVEGVADAADAPLIVDDDLRERELADSPIEDFDEAVEHLWANP
FT                   NASHPGGESHAEAQARGVAAVDRLVEAYPDRHVVVGTHATLMALVFNAYDPRYGREFWT
FT                   GLTTPDVYEVTFVDSEAFSIARTWTPEEAAREGDADRDPAER"
FT   gene            110198..110752
FT                   /gene="ligT"
FT                   /locus_tag="HVO_0114"
FT   CDS_pept        110198..110752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligT"
FT                   /locus_tag="HVO_0114"
FT                   /product="RNA 2',3'-cyclic phosphodiesterase"
FT                   /EC_number="3.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05007"
FT                   /db_xref="GOA:D4GYW0"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYW0"
FT                   /protein_id="ADE05007.1"
FT                   /translation="MRCFLAVDLPDSLAAGVAAVQDRLSDADGLRFTDPESAHVTLKFL
FT                   GEVSPDRVGAVEDAVESAVEAAGVGPFDASVGGLGVFPSLDYIRVVWVGVDDGAAELTR
FT                   LHEAIERETTALGFDPEDHEFTPHVTLARMDDARGKVLVRRVVGGESPTVGSFRVREVR
FT                   LKKSDLGPDGPEYETVARVSL"
FT   gene            110903..111055
FT                   /gene="rpl39e"
FT                   /locus_tag="HVO_0115"
FT   CDS_pept        110903..111055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl39e"
FT                   /locus_tag="HVO_0115"
FT                   /product="50S ribosomal protein L39e"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02422"
FT                   /db_xref="GOA:D4GYW1"
FT                   /db_xref="InterPro:IPR000077"
FT                   /db_xref="InterPro:IPR020083"
FT                   /db_xref="InterPro:IPR023626"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYW1"
FT                   /protein_id="ADE02422.1"
FT                   /translation="MGKKSKSKKKRLAKLERQNSRVPAWVMLKTDMEVTRNPKRRNWRR
FT                   SNTDE"
FT   gene            111059..111337
FT                   /gene="rpl31e"
FT                   /locus_tag="HVO_0116"
FT   CDS_pept        111059..111337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl31e"
FT                   /locus_tag="HVO_0116"
FT                   /product="50S ribosomal protein L31e"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04695"
FT                   /db_xref="GOA:D4GYW2"
FT                   /db_xref="InterPro:IPR000054"
FT                   /db_xref="InterPro:IPR023621"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYW2"
FT                   /protein_id="ADE04695.1"
FT                   /translation="MSANDFEERVVTVPLRDVQAVPAHERAGRSMTLIREHLAKHFKVD
FT                   AENVRLDTQINEDIWAHGRQSPPSKFRVRAARFDEDGESVVEAEPAE"
FT   gene            111341..112006
FT                   /gene="tif6"
FT                   /locus_tag="HVO_0117"
FT   CDS_pept        111341..112006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tif6"
FT                   /locus_tag="HVO_0117"
FT                   /product="translation initiation factor aIF-6"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04464"
FT                   /db_xref="GOA:D4GYW3"
FT                   /db_xref="InterPro:IPR002769"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYW3"
FT                   /protein_id="ADE04464.1"
FT                   /translation="MLRASFAGSSYIGVFARATDDALLVRPDADDSLAEQMAEELDVPL
FT                   VKTTVGGSGTVGALATGNENGLLVSSRATSREKEALTDAVDLPVYELPGRINAAGNVVL
FT                   ANDYGAYVHAELSDEAVAAVEEALEVPVERGDLADVRTVGTAAVANNRGVLCHPKSREP
FT                   ELEALEALLDVRADIGTINYGGPLVGSGLVANDESYVVGEDTTGPELGRIEDALDYID"
FT   gene            112088..112264
FT                   /gene="rpl20e"
FT                   /locus_tag="HVO_0118"
FT   CDS_pept        112088..112264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl20e"
FT                   /locus_tag="HVO_0118"
FT                   /product="50S ribosomal protein L20e"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03066"
FT                   /db_xref="GOA:D4GYW4"
FT                   /db_xref="InterPro:IPR023573"
FT                   /db_xref="InterPro:IPR028877"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYW4"
FT                   /protein_id="ADE03066.1"
FT                   /translation="MSQFIITGSFTSRGVVHEFTKTVEAPNENVAQERAFSLIGSEHGI
FT                   KRTKVELNEVTAA"
FT   gene            112261..112734
FT                   /gene="pfdA"
FT                   /locus_tag="HVO_0119"
FT   CDS_pept        112261..112734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfdA"
FT                   /locus_tag="HVO_0119"
FT                   /product="prefoldin alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02651"
FT                   /db_xref="GOA:D4GYW5"
FT                   /db_xref="InterPro:IPR004127"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="InterPro:IPR011599"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYW5"
FT                   /protein_id="ADE02651.1"
FT                   /translation="MMGGGQQQLQQLSQELQALDEEIESLEAEVSDLNDEKDEIDEAVE
FT                   AIETLETGSTVQVPLGGDAYLRAEVQDIDEVVVSLGANYAAEQEQSTAIETLRRKQDAL
FT                   DEEIASVRGQIEELEEESDEIEEQAMQAQQQMQQQQMQQMQQMQGEGDDGDDE"
FT   gene            112767..114137
FT                   /gene="ftsY"
FT                   /locus_tag="HVO_0120"
FT   CDS_pept        112767..114137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="HVO_0120"
FT                   /product="signal recognition particle receptor FtsY"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05025"
FT                   /db_xref="GOA:D4GYW6"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/Swiss-Prot:D4GYW6"
FT                   /protein_id="ADE05025.1"
FT                   /translation="MFDGLKKKLNRFRNDVEETAEEKAEAAADEAESDADAEAESAPAD
FT                   TDNAAVEPEASEPAAADPDADAVGDADAGSEADAVDAADAPADAESSSAAVEADAESES
FT                   ESAATPEPDSEVDAGADTGDEPSGEPTADEVEPRESLASDAAKAALTEEDEDDSSGPGR
FT                   LRRAAAFATGKVVIEEEDLEDPLWELEMALLQSDVEMQVAEEILETIREKLIGETRKQV
FT                   ESTGQLVSEALHDALYEVISVGQFDFDQRIAEADKPVTLIFTGINGVGKTTTIAKLAKY
FT                   FEKQGYSTVLANGDTYRAGANEQIREHAEALDKKLIAHEQGGDPAAVIYDGVEYAEAHD
FT                   IDIVLGDTAGRLHTSNDLMAQLEKIDRVVGPDLTLFVDEAVAGQDAVERARQFNDAAAI
FT                   DGAILTKADADSNGGAAISIAYVTGKPILFLGVGQGYDHIEKFDPEQMVERLLGEDE"
FT   gene            complement(114180..114797)
FT                   /locus_tag="HVO_0121"
FT   CDS_pept        complement(114180..114797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0121"
FT                   /product="LysE family transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04407"
FT                   /db_xref="GOA:D4GYW7"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYW7"
FT                   /protein_id="ADE04407.1"
FT                   /translation="MTTLAFGLDAATYLAFCGAAVALILAPGPDTMYVLARGLDGRGPG
FT                   VRSALGIATGVLFHTLLATVGAAALFRTVPEAAAALKYVGAAYLGYLGVTSLRNDEFDP
FT                   SVETDAGASFRRGVLVNALNPKVALFFLAFLPGFAGQGAGAGVRMAGLGATYAALTALY
FT                   LSVVALGANRLGSRLAETRVASALNYVGAGTMLLLGVVLALE"
FT   gene            complement(114831..115805)
FT                   /gene="serA1"
FT                   /locus_tag="HVO_0122"
FT   CDS_pept        complement(114831..115805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serA1"
FT                   /locus_tag="HVO_0122"
FT                   /product="putative D-2-hydroxyacid dehydrogenase"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03704"
FT                   /db_xref="GOA:D4GYW8"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYW8"
FT                   /protein_id="ADE03704.1"
FT                   /translation="MTTILVLDRPTHGIPASEYAAALRERLPDATVRHPKTTAETLDAA
FT                   TDATIITSTSLPDEVLDAADELRLFAGAAAGYDHLPLETLRERGVRVTNASGVHGPNIA
FT                   EHVIGWLLMITRRLDEGLRRQRRREWRRFQSYGELQGSTATVVGLGAIGQAVVERLDAF
FT                   GVETVGVRYTPEKGGPTDEVLGFDDLESALVRTDFLVVACPLTDETRDLIDRRALSALP
FT                   EHAILVNVARGGIVDTDALVSHLRSNRLRAAALDVTDPEPLPEDHPLWGFENVYITPHV
FT                   SGHTPHYWTRVADILAENVGRLASASDGETPTLRNQVVPSPNP"
FT   gene            115896..117293
FT                   /gene="srp54"
FT                   /locus_tag="HVO_0123"
FT   CDS_pept        115896..117293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srp54"
FT                   /locus_tag="HVO_0123"
FT                   /product="signal recognition particle 54K protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03670"
FT                   /db_xref="GOA:Q977V2"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q977V2"
FT                   /protein_id="ADE03670.1"
FT                   /translation="MVLDNLGSSLRGSLDKLRGKSRLDEDDVQEIVKEIQRSLLSADVD
FT                   VSLVMDLSDSIKTRALEEEPPGGTSARDHVLKIVYEELVDLIGESTEIPLESQTIMLAG
FT                   LQGSGKTTTSAKMAWWFSKKGLRPAVIQTDTFRPGAYDQAKQMCERAEVDFYGDPDCDD
FT                   PVQIAREGLEATEDADVHIVDTAGRHALEDDLIDEIEEIEGVVQPDLNLLVLDAAIGQG
FT                   AKEQAQQFDESIGIGGVVITKLDGTAKGGGALTAVNETDSSIAFLGMGETVQDIERFEP
FT                   NGFISRLLGMGDLKQLSERVERAMSETQAEDEDWDPEEMMKGNFTLKDMQKQMEAMDKM
FT                   GPLDQVLDMIPGFGGGIKDQLPDDAMDVTKDRMRSFEVIMDSMTEEELENPRKVGASRV
FT                   RRIAQGSGQDEETIQELLEQHRMMEQTIKQFQNMGDGDMQRMMKKLQNQGGGGGGGMGG
FT                   LGGMGPF"
FT   gene            117403..117984
FT                   /gene="mgtE2"
FT                   /locus_tag="HVO_0124"
FT   CDS_pept        117403..117984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgtE2"
FT                   /locus_tag="HVO_0124"
FT                   /product="MgtE family transport protein (probable substrate
FT                   magnesium)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04251"
FT                   /db_xref="GOA:D4GYX0"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYX0"
FT                   /protein_id="ADE04251.1"
FT                   /translation="MTVRDVAVEAYKEALPALAASLVGGLVAGVVLGGMRAELRAVPGL
FT                   LVLVPALLATRGNVYGSLGARIATALHQGLIEPRVTGGDERLRAAATAALANGVLTSTF
FT                   AAVVAYFLLTFLGSRVAPLPILVGVAIVAGLLSGIVLTVVVVSVVFAGYRRGRNPDTIV
FT                   GPVVTTTGDVFGVLFLLIAVRTVLAVAGVF"
FT   gene            117985..118545
FT                   /gene="mgtE1"
FT                   /locus_tag="HVO_0125"
FT   CDS_pept        117985..118545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgtE1"
FT                   /locus_tag="HVO_0125"
FT                   /product="MgtE family transport protein (probable substrate
FT                   magnesium)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04515"
FT                   /db_xref="GOA:D4GYX1"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYX1"
FT                   /protein_id="ADE04515.1"
FT                   /translation="MPTEWTVRAITRAMLPVLLVLTLVELGSGLVLGSFEAQLFRYPSL
FT                   LVLVPVTIGTAGNLGSVLAARLSTSFHLGTLSFSPRDDELAGNAVATLALAVTVFPVIG
FT                   AGAWVATLLVSGDTSLALQKVVLVALSSGISLAVLAVVVTFSATYLAYRFGLDPDDVVI
FT                   PVVTNLCDVLGVVVLFGVAQVLV"
FT   gene            118620..119639
FT                   /locus_tag="HVO_0126"
FT   CDS_pept        118620..119639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0126"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02964"
FT                   /db_xref="InterPro:IPR038880"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYX2"
FT                   /protein_id="ADE02964.1"
FT                   /translation="MQPSAVLPVLFEVLPRVARIAAYIAVGVFAANLVVAFGLVERIAG
FT                   LSRYLTSPANLPDEVGTAIVTTAASTTAGYGMLAEFRESGVLDDRATLVAVTINTFFGF
FT                   VQHIFTFYWPVLIPILGREVGFMYVGARAAIALAITATGVVAGAVLLADRNTTPVAVTE
FT                   TDGSGGAVDAADSAADAGDSGDAAESDDSLRETVDDAARSTWKKLRRIVPRLAVVYVAV
FT                   TLLLRTTDLESFAALASPLTNLVGLPGAAVPVVVAFAFDTTTGAATIAPAIGETFTPRQ
FT                   AVATMLIGGIISFAVSTFKRSIPFQYGIWGPEFGSKVIAVNTGLKIVFIAVAVALLVA"
FT   gene            complement(119674..120090)
FT                   /locus_tag="HVO_0127"
FT   CDS_pept        complement(119674..120090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0127"
FT                   /product="UPF0201 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03873"
FT                   /db_xref="InterPro:IPR002739"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYX3"
FT                   /protein_id="ADE03873.1"
FT                   /translation="MIYSVDVRIEVPVRDTEVTDRVGDAVENIFPGVELDHEPGQLVGE
FT                   AHELERFSERLHEQAILDTARREFAKRRDDDGFSFALKKQAAFKGVVNFSVGNPDELGD
FT                   IEVHVTVRDPSVDEVIDYIAPPTEEGRPVDPNDR"
FT   gene            complement(120093..120662)
FT                   /gene="coaE"
FT                   /locus_tag="HVO_0128"
FT   CDS_pept        complement(120093..120662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="HVO_0128"
FT                   /product="putative dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04630"
FT                   /db_xref="GOA:D4GYX4"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYX4"
FT                   /protein_id="ADE04630.1"
FT                   /translation="MRVIGTVGLPGSGKGELAEVARNAGVPVVTMGDVIREECRKRGLD
FT                   PATDHGKIATALREEEGDDAIAARSLPMVEQHLESNDVVLVDGLRSGVELDRFREAFGD
FT                   DFVLVSVEAPFETRAERLLDRDRDDSDTDVEALKKRERRELDFGMGDAMDRADVVIQNT
FT                   GTLAEYRETITKLFEEGPEALAEADA"
FT   gene            120802..121179
FT                   /locus_tag="HVO_0129"
FT   CDS_pept        120802..121179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0129"
FT                   /product="DUF307 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04924"
FT                   /db_xref="InterPro:IPR005185"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYX5"
FT                   /protein_id="ADE04924.1"
FT                   /translation="MSQRSFVVRALWFVFVGWWATPAVVNVAWFLNATVIGIPLGVALI
FT                   NLVPTVLSLKEPKTRLDPDSGRGQRSVVVRAVYFVFVGWWLSWVWANVAVLFTLTIVGL
FT                   PVGIWMLNRLPAVTSLYRFDG"
FT   gene            121223..121296
FT                   /locus_tag="HVO_3016"
FT   tRNA            121223..121296
FT                   /locus_tag="HVO_3016"
FT                   /product="tRNA-Arg"
FT   gene            121710..121985
FT                   /locus_tag="HVO_0131"
FT   CDS_pept        121710..121985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0131"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04454"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYX6"
FT                   /protein_id="ADE04454.1"
FT                   /translation="MDVLGIVAAAVVFGVAAYNLVTSLDGRFARLLFGCLGVVAATLYV
FT                   IEQFGLAASLGLNVAHGLQFVAALLVVSALVDFLARRAEAGDSGSS"
FT   gene            122059..122181
FT                   /locus_tag="HVO_0131A"
FT   CDS_pept        122059..122181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0131A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0131A"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03002"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYX7"
FT                   /protein_id="ADE03002.1"
FT                   /translation="MESALHEGPVRVLVNGWVEVPGGRYLSPHAVHHIDVRVPE"
FT   gene            complement(122191..122298)
FT                   /locus_tag="HVO_0131B"
FT   CDS_pept        complement(122191..122298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0131B"
FT                   /product="small CPxCG-related zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0131B"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C9J6T4"
FT                   /protein_id="AOP12805.1"
FT                   /translation="MGDRACYREFCPDCDAPVTIVDGECPDCGRELTVV"
FT   gene            complement(122368..122781)
FT                   /locus_tag="HVO_0132"
FT   CDS_pept        complement(122368..122781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0132"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYX8"
FT                   /protein_id="ADE03642.1"
FT                   /translation="MSPPESPATNADSDATTPANRPPLLAVVAPRISEAAALAGPLLHG
FT                   AGPLVRAPHSSAPSQLRATLAAMRRPDAPLVVATDSAAAVRDADRVHVVDGGVVVESGA
FT                   PSDLLEVPGVYARRYGAELGANFAGRGKDVDDE"
FT   gene            complement(123087..124769)
FT                   /gene="ths1"
FT                   /gene_synonym="cct1"
FT                   /locus_tag="HVO_0133"
FT   CDS_pept        complement(123087..124769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ths1"
FT                   /gene_synonym="cct1"
FT                   /locus_tag="HVO_0133"
FT                   /product="thermosome subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03512"
FT                   /db_xref="GOA:O30561"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012714"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:O30561"
FT                   /protein_id="ADE03512.1"
FT                   /translation="MSQRMQQGQPMIILGEDSQRTSGQDAQSMNITAGKAVAEAVRTTL
FT                   GPKGMDKMLVDSGGQVVVTNDGVTILKEMDIDHPAANMIVEVSETQEDEVGDGTTTAVI
FT                   NAGELLDQAEDLLDSDVHATTIAQGYRQAAEKAKEVLEDNAIEVTEDDRETLTKIAATA
FT                   MTGKGAESAKDLLSELVVDAVLAVKDDDGIDTNNVSIEKVVGGTIDNSELVEGVIVDKE
FT                   RVDENMPYAVEDANIAILDDALEVRETEIDAEVNVTDPDQLQQFLDQEEKQLKEMVDQL
FT                   VEVGADAVFVGDGIDDMAQHYLAKEGILAVRRAKSSDLKRLARATGGRVVSSLDDIEAD
FT                   DLGFAGSVGQKDVGGDERIFVEDVEDAKSVTLILRGGTEHVVDELERAIEDSLGVVRTT
FT                   LEDGKVLPGGGAPETELSLQLREFADSVGGREQLAVEAFAEALDIIPRTLAENAGLDPI
FT                   DSLVDLRSRHDGGEFAAGLDAYTGEVIDMEEEGVVEPLRVKTQAIESATEAAVMILRID
FT                   DVIAAGDLSGGQTGSDDDDGGAPGGMGGGMGGMGGMGGMGGAM"
FT   gene            complement(124992..125534)
FT                   /locus_tag="HVO_0134"
FT   CDS_pept        complement(124992..125534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0134"
FT                   /product="KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03979"
FT                   /db_xref="GOA:D4GYY0"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR019964"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="InterPro:IPR039912"
FT                   /db_xref="UniProtKB/TrEMBL:D4GYY0"
FT                   /protein_id="ADE03979.1"
FT                   /translation="MQHVKVPQDRIGVLIGEGGSTLREIESRAEVRLDVDSENGSVAID
FT                   SVGDPVLGMVAPDVVRAVGRGFAPEDAMALLDDDMMMFELIDIDRHTRNKNDMRRQKGR
FT                   LIGENGRTRELMEELTGADVVIYGTTLGIIGQPEEVEVVRRAVEMILDGAPHGAVYSFL
FT                   ERKHNELTQGFNVRQNN"
FT   gene            complement(125628..126500)
FT                   /gene="rio1"
FT                   /gene_synonym="pkn2"
FT                   /locus_tag="HVO_0135"
FT   CDS_pept        complement(125628..126500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rio1"
FT                   /gene_synonym="pkn2"
FT                   /locus_tag="HVO_0135"
FT                   /product="RIO-type serine/threonine protein kinase Rio1"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02358"
FT                   /db_xref="GOA:D4GYY1"
FT                   /db_xref="InterPro:IPR000687"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR018935"
FT                   /db_xref="UniProtKB/Swiss-Prot:D4GYY1"
FT                   /protein_id="ADE02358.1"
FT                   /translation="MTDEFGMVEPQEGEAFGDEWEEIDVSDDEADRIARRKDRDFDEFR
FT                   MRLKDADQFKVEQSVFDDATFAAIYKLVQDGHIDAFGGPISTGKEANVFEALGGDDADV
FT                   AVKIYRINASDFRHMRDYLEGDPRFENIGHDKGQVVRAWVRKEFANLERAQRAGVRVPK
FT                   PIAVQRNVLVMELVGVVDDRARRLSEVRVENPQTAYEVVREYMRRLHRAGLVHGDLSEY
FT                   NLIIHDGELVVIDLGQAVTVHHPNAEEFLRRDCRNVANFFRRQGADADGDSLYEFVTGD
FT                   EGEDGDGDE"
FT   gene            complement(126602..126892)
FT                   /gene="tif1A1"
FT                   /locus_tag="HVO_0136"
FT   CDS_pept        complement(126602..126892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tif1A1"
FT                   /locus_tag="HVO_0136"
FT                   /product="translation initiation factor aIF-1A"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04479"
FT                   /db_xref="GOA:D4GZ79"
FT                   /db_xref="InterPro:IPR001253"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018104"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZ79"
FT                   /protein_id="ADE04479.1"
FT                   /translation="MSDDENESRRDLRMPNDDEVFAVVTNMLGANRIRVRCADGVERTA
FT                   RIPGRMQKRIWIREDDVVLVEPWDWQDEKADVSWRYEKSEADQLRREGHIQ"
FT   gene            126998..127177
FT                   /locus_tag="HVO_0136A"
FT   CDS_pept        126998..127177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0136A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0136A"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05030"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZ80"
FT                   /protein_id="ADE05030.1"
FT                   /translation="MLDKLGTKGIAGVVSLLLGIGIVASQAPVVAAGLAFVVAGLGLVA
FT                   GGLAEGVMKMFGMA"
FT   gene            complement(127203..128030)
FT                   /locus_tag="HVO_0137"
FT   CDS_pept        complement(127203..128030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0137"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02726"
FT                   /db_xref="GOA:D4GZ81"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZ81"
FT                   /protein_id="ADE02726.1"
FT                   /translation="MPRPSDVLVHRNRTVADREERTLTADVYCPESPAATEIAETTASP
FT                   AAEPTRPLVVYVYGGAWETGSTGQFARWALDAADGGFVAAEVSYRLGHEAPFPAQIEDV
FT                   CEGIDWLTDRADEFGIDTDAVAVVGHSAGAHLALLAALSDGEFGRRTDIDAAVGVSGVY
FT                   DLRADDHEHAGESLPLFENRPSAAELRRCSPITYVDDDTDADADAPPTLLLHGSEDSVV
FT                   APDQSARLADALEGAGTQVEYDAVDAADHVFLHSSYHYPAVRKRVFSFLRESL"
FT   gene            complement(128123..129109)
FT                   /gene="tyrS"
FT                   /locus_tag="HVO_0138"
FT   CDS_pept        complement(128123..129109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="HVO_0138"
FT                   /product="tyrosine--tRNA ligase"
FT                   /EC_number="6.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02671"
FT                   /db_xref="GOA:D4GZ82"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023617"
FT                   /db_xref="InterPro:IPR023684"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZ82"
FT                   /protein_id="ADE02671.1"
FT                   /translation="MDAYDLITRNASEVVTEDEVRALADDPEGKRAYVGYEPSGVLHIG
FT                   HMLTANKLIDLQAAGFEVVVLLADVHAYLNGKGTFEEIRETAERMKAQFIAYGLDESQT
FT                   EFVLGSEYQLDESYVLDLHAVELETTLSRAERAMAEIKSGDGVTVAQAVYPIMQALDIV
FT                   YLDVDLAIGGMEQRKVHMLARDTLPSIGEESPTCMHTPLIADLGTGIGKMSSSEGVTIS
FT                   MEDSTEDIEDKVNGAFCPPTADPEPTDEGEERENPVLQIFEYHVFPRFERVVVERPEQY
FT                   GGNLDYDDYETLEADLESGELHPADAKGALADYLDELIEPGRAKIAE"
FT   gene            129199..129504
FT                   /locus_tag="HVO_0139"
FT   CDS_pept        129199..129504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0139"
FT                   /product="uncharacterized protein"
FT                   /EC_number="3.6.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03270"
FT                   /db_xref="GOA:D4GZ83"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZ83"
FT                   /protein_id="ADE03270.2"
FT                   /translation="MSDSGTTTRAPVIIFAALILVVFGLLAVMWASVRGGHLLPHILGF
FT                   AVYFLAFHVYLPYRVHKDATLKGRNATFWAVIAFLLPLVGAALYFVVAVVGHDATD"
FT   gene            complement(129520..131589)
FT                   /locus_tag="HVO_0140"
FT   CDS_pept        complement(129520..131589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0140"
FT                   /product="DUF460 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02551"
FT                   /db_xref="InterPro:IPR007408"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZ84"
FT                   /protein_id="ADE02551.1"
FT                   /translation="MNDRTSALDSVVFGVDIQSGDIRGDSPSYALVVLDTRDTESDEVR
FT                   IERDVVSFRKLRRLIERDEPRVVATDNMYELATDKDDLVRFLRWLPHGTQLVQVTGAER
FT                   PEPLSRVASRHGVPYGKDPMKEAEAAARLALANVGYEVAAFENTTTVKVSRGRSTGKGG
FT                   WSQDRYTRRIHGSVKQQSREVESSLKEANLDYERDVTEKYGGYSQALFTVEGRPEDIPV
FT                   SSHRSGDTRVEIERERRDGIEFEPLVKRRDRVIVGIDPGTTTAVAVVGLDGRVLDVHST
FT                   RTADTAAVIEWLIERGRPSLVAADVQPMPETVEKFRRSFDAAGWAPASDIPVDEKLHRT
FT                   REVDYENDHERDALAAALFAFDDHEDQFERISRKVPADVDREEVIARVLVSEESVEAVL
FT                   REMADDGDGGDPDDADEEAHEEPELTPEEREIRELRSRVERLESHVGDLKSTIEEKDET
FT                   IEEYKEELSDARREERREARERREVTRLERENGRLERKVESLESDKAELADKLDQLKSL
FT                   WKLDHSNFADVNTNGIFTSDSEWEVAGRESEANESGGNLVPVKIVEQFTNGALDHTVEE
FT                   YGIAAGDVVYLRDASGAGRTTAERLAEFDPKVVLRSGNLSEAADEVLFEADVPVAPAGG
FT                   VTIQEIDELAVAKESEVESAISDWEDRAEERQKEQREEMVDQIISEHRAENRRG"
FT   gene            131762..132754
FT                   /locus_tag="HVO_0141"
FT   CDS_pept        131762..132754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0141"
FT                   /product="stomatin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04841"
FT                   /db_xref="GOA:D4GZ85"
FT                   /db_xref="InterPro:IPR000163"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZ85"
FT                   /protein_id="ADE04841.2"
FT                   /translation="MISSDIPDPPSVTSRSLTRIALIGVVALLLIAAPIAGVLAWEPVE
FT                   EGNVKVVKKWGATTGTVFEPGAHFVNPVSQSTSSLSVRPQSYTMSSSTSEGDRRGDDAI
FT                   TVLSEDGLRTDIDVTVRYRIDAGQAVEFYRNYRTLATAEERLIRPSIRSVLRTEAGRLP
FT                   VTVIYTGESQTQLKAAAERELAEEFADDGLILEAVQVRNVELPAEYAQAVEQKEITEQR
FT                   RQQKQDELAVEELEAERKRIEAQGQADANRILAESLSDEVLAQKYIGKLDETDTVYIPV
FT                   GDGGYPQFVRSLDSDGSSSSGSSAGSSSDTTSASSRSSTSSGSENETSN"
FT   gene            132763..133107
FT                   /locus_tag="HVO_0142"
FT   CDS_pept        132763..133107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0142"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03332"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZ86"
FT                   /protein_id="ADE03332.1"
FT                   /translation="MRLLRELAVAVALLVIVGVLARSGVGRFVLPVVGLAVAAALVALL
FT                   ATQSAYPRTAVGPRTRIIESAAQSADAACVECGSPATARRRYVREWVVLGVPVVLLDDG
FT                   ENPVCDAHRD"
FT   gene            complement(133150..134028)
FT                   /gene="phzF2"
FT                   /locus_tag="HVO_0143"
FT   CDS_pept        complement(133150..134028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phzF2"
FT                   /locus_tag="HVO_0143"
FT                   /product="PhzF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03599"
FT                   /db_xref="GOA:D4GZ87"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZ87"
FT                   /protein_id="ADE03599.1"
FT                   /translation="MPQNAFHTVDAFATAKYAGNQLAVFEDADALRSEQMAALANEMNY
FT                   SETTFIEGGSPDDGYDVRIFTPDGEIPFAGHPTLGTAAVLRDHFGAGDEVTLNLGVGPI
FT                   SVEVRGDGSDSEQYWMTQNAPRFGAELDRETLAEVLSLDANDFDADWPIQVVSTGLPAV
FT                   MIPLRDRDALARSEVFTPAYRSFFDDVGVENLFLFCPDPRDDANDFAARMYAPGHGVTE
FT                   DPATGSANGCFAGYLARHRYFGDDEIEVTVEQGYEMGRPSQLHLEAEDRGDEVAVRVGG
FT                   RVEFVSTGRLV"
FT   gene            complement(134083..135036)
FT                   /gene="rnz"
FT                   /locus_tag="HVO_0144"
FT   CDS_pept        complement(134083..135036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnz"
FT                   /locus_tag="HVO_0144"
FT                   /product="ribonuclease Z"
FT                   /EC_number="3.1.26.11"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02929"
FT                   /db_xref="GOA:D4GZ88"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:D4GZ88"
FT                   /protein_id="ADE02929.2"
FT                   /translation="MSMRATFLGTGGAVPTTARAPSAFLVNRDGERLLFDCGEGTQRQM
FT                   MRYGTGFGVSHLFVTHLHGDHILGIPGLIQTLDFNDRDDSLAIHGPPGSKGHLEQLVHA
FT                   GGYQPGFHVSVHEVRPGNVAYRADDYEVRAFDTEHRTASVGYALVEDDRPGRFDREKAE
FT                   ELGVPVGPAFGRLHAGEDVELEDGTVVRSEQVVGDPRPGRTVVYTGDTRPLNSTVEVAC
FT                   DADLLVHDATFTDEEAERAKQTAHSTAREAARVARDADVRRFALTHISARYAADPSPLL
FT                   EQAREVYDGEAFVAEDGQKLEVPYADSDGGGAETGE"
FT   gene            135168..136193
FT                   /gene="rfcC"
FT                   /locus_tag="HVO_0145"
FT   CDS_pept        135168..136193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfcC"
FT                   /locus_tag="HVO_0145"
FT                   /product="replication factor C small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04396"
FT                   /db_xref="GOA:D4GZ89"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR013748"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZ89"
FT                   /protein_id="ADE04396.1"
FT                   /translation="MDAPLWTETHAPGLDDLPQPEVRDRLRRAVDEPMNLVVQGPPGVG
FT                   KTAAVRALAREAHADPENDLIELNVADFFNRTKKQIRADPRFEQFLDGRSRMAKRDMIN
FT                   RVLKESAGYAPMSGEYKTIVLDNAESIREDFQQALRRVMEQHHRTTQFVITTRQPSKLI
FT                   PPIRSRCFPVPMPAPDDEALEALLADILDAEGVDYDAGGLQFLTDASNGNVRKAVLSAQ
FT                   RTATEADEVTMSTVHAALGDVGFDDELKTLLINAREGDIKDARKTLTTLLDDEGYEGQE
FT                   LLADILRVADSTPERFADGELARLHELAGQVDLDISTGIDDRLHITHLLTSWGADVRGE
FT                   A"
FT   gene            136193..136798
FT                   /gene="psd"
FT                   /locus_tag="HVO_0146"
FT   CDS_pept        136193..136798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psd"
FT                   /locus_tag="HVO_0146"
FT                   /product="putative archaetidylserine decarboxylase"
FT                   /EC_number="4.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03199"
FT                   /db_xref="GOA:D4GZ90"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033175"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZ90"
FT                   /protein_id="ADE03199.1"
FT                   /translation="MRFAPGYRRFALPAFVGAAVAAVVFPPLGAVLLAVGAFVLWFFRD
FT                   PERSPPDEPGVVAPADGRVSVIRVEDGRVRVGVFMNVTDVHVNRAPVSGSVRTVTHRPG
FT                   AHKPAFSKDSDRNERVDIELDTDAGDHEVSLIAGAFARRIHSYVAPGDELVRGQKLGHI
FT                   DFGSRADVLLPPEFGSEDVVVEKGESVRAGETVLARRE"
FT   gene            137039..137458
FT                   /gene="ureB"
FT                   /locus_tag="HVO_0147"
FT   CDS_pept        137039..137458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureB"
FT                   /locus_tag="HVO_0147"
FT                   /product="urease beta subunit"
FT                   /EC_number="3.5.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02537"
FT                   /db_xref="GOA:D4GZ91"
FT                   /db_xref="InterPro:IPR002019"
FT                   /db_xref="InterPro:IPR036461"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZ91"
FT                   /protein_id="ADE02537.1"
FT                   /translation="MTGEFVPGEVITADGTITLNEGRETAEVTVGNTGDRPIQVGSHFH
FT                   FFEANAALSFDREAAYGMRLNIPAGTAVRFEPGDQTSVELVAIGGKRRAHGMNGMVNGS
FT                   VDTDPSAAVERLRAAGFADTGAPDDEHGTAEGSSE"
FT   gene            137455..139161
FT                   /gene="ureC"
FT                   /locus_tag="HVO_0148"
FT   CDS_pept        137455..139161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureC"
FT                   /locus_tag="HVO_0148"
FT                   /product="urease alpha subunit"
FT                   /EC_number="3.5.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04674"
FT                   /db_xref="GOA:D4GZ92"
FT                   /db_xref="InterPro:IPR005848"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011612"
FT                   /db_xref="InterPro:IPR017950"
FT                   /db_xref="InterPro:IPR017951"
FT                   /db_xref="InterPro:IPR029754"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZ92"
FT                   /protein_id="ADE04674.1"
FT                   /translation="MTKDIDREAYADLYGPSEGDRVRLADTELFAEVETDLRTHGDEAV
FT                   FGGGKTLRDGLGMAPDVTQADGALDWVITNATVIDPVLGVVAGDIGIRDGDIVGVGKAG
FT                   NPDTMDGVDMVVGPATDVYPAEGKIATAGALDIHVHWNSAQLHEHGLASGITTMLGGGY
FT                   GGGATTCTTGPQNIKRFLQAAEAWPVNVGFYGKGNASTPEPLIEQVEAGACALKLHEDW
FT                   GSMPAAIDTCLDVAEDEDVQVCMHTDTLNEAGFVENTFAAVDGRTMHLFHIEGAGGGHA
FT                   PDIMELVGEPNMLPSSTNPSMPYTDNTFDEHLDMVMVCHHLNPDVPEDVAFAESRVRAE
FT                   TIAAEDVLHDMGAISMMTTDSQAMGRQAELVSRTWQAASKMKSQRGPLPEDEGTGADNH
FT                   RIKRYLAKYTINPAISAGIDDYVGTLEPGKLADVVLWDPAFFGVKPAMIFKGGFPVHSE
FT                   MGEANGSLMTCEPILQRQRAGADGKAKHGLSLSFVSPAAADNDVGEAYGLDSRVVPVGG
FT                   TRTPGKEDMLYNDYCPDDIDVDPETFEVEVDGELVTCEPASELPLAQRYTL"
FT   gene            139158..139553
FT                   /gene="ureA"
FT                   /locus_tag="HVO_0149"
FT   CDS_pept        139158..139553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureA"
FT                   /locus_tag="HVO_0149"
FT                   /product="urease gamma subunit"
FT                   /EC_number="3.5.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02323"
FT                   /db_xref="GOA:D4GZ93"
FT                   /db_xref="InterPro:IPR002026"
FT                   /db_xref="InterPro:IPR012010"
FT                   /db_xref="InterPro:IPR036463"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZ93"
FT                   /protein_id="ADE02323.1"
FT                   /translation="MKLTPKEQERLTVFTAAEVARRRKERGVPLNHPEAVAYITDWCIE
FT                   RGRDGQSVAEIRSGASQLLGREDVMDGVPEMIDMIQVEPMFPDGTKLVTVHDPIRSDSV
FT                   GTADSTADAATDGGDTDDIDTSGGDDA"
FT   gene            139550..140173
FT                   /gene="ureG"
FT                   /locus_tag="HVO_0150"
FT   CDS_pept        139550..140173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureG"
FT                   /locus_tag="HVO_0150"
FT                   /product="urease accessory protein UreG"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03146"
FT                   /db_xref="GOA:D4GZ94"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004400"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZ94"
FT                   /protein_id="ADE03146.1"
FT                   /translation="MSLTHRDVATVGIGGPVGSGKTSLLTELVPQLRERGLNVGVIAND
FT                   ILTQEDADVLRERFAGVVPESLVAGVETGACPHTGIREDPSMNLQQIDDFLADHPELDI
FT                   VLIESGGDNLAATFNPELADYSLYVISVAEGDDIPRKRGPGVVDCDLLVINKTDLAPHV
FT                   DADLDVMERDAKAVRSGPFVFTDCRSQTGIEEVLTHVREGVLFA"
FT   gene            140173..141072
FT                   /gene="ureD"
FT                   /locus_tag="HVO_0151"
FT   CDS_pept        140173..141072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureD"
FT                   /locus_tag="HVO_0151"
FT                   /product="urease accessory protein UreD"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04932"
FT                   /db_xref="GOA:D4GZ95"
FT                   /db_xref="InterPro:IPR002669"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZ95"
FT                   /protein_id="ADE04932.1"
FT                   /translation="MAADSPPPSFERYAAEPVPQAAVGAPGKDGVLELTFERTSRGTAL
FT                   VHDYATVPFHISGTLGHDPHPEAETVFVQSPTGGVAQGDRHDLTIAVEADAIAHVSTQS
FT                   STKVQTMERNYAGVDTALSVAAGGHLDYVPEPTILHADARYTQDLRLDVADGATAIVGD
FT                   VVVSGRLARGERFEFDRYRSRLRATGPDGLLFEDATHLAPDESDPSAPGLLGEHAVYGT
FT                   LFVVAPGRDAASLSDDLHEAVAATDARAGATELPNDAGVAVRALGDCADTVRTACDAAW
FT                   DRARRALLDASAPSGRKY"
FT   gene            141072..141731
FT                   /gene="ureE"
FT                   /locus_tag="HVO_0152"
FT   CDS_pept        141072..141731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureE"
FT                   /locus_tag="HVO_0152"
FT                   /product="urease accessory protein UreE"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04669"
FT                   /db_xref="GOA:D4GZ96"
FT                   /db_xref="InterPro:IPR004029"
FT                   /db_xref="InterPro:IPR012406"
FT                   /db_xref="InterPro:IPR036118"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZ96"
FT                   /protein_id="ADE04669.1"
FT                   /translation="MLVADTYLGHRDDPAVRGRLDEADAARVVLSDDDRRRSRVRTETE
FT                   DGRDLGVVVGRELDDGDVLETETGDLVVVELAAIDVLVVDVGAADVSTTAAVELGHALG
FT                   NRHWNLAIRDGEALFPVPDTYERMEATVADHLPPGVTTRRETVSPALFDGDEPDHGHGG
FT                   HGHGGHDHSHEHGGHGHSHGEHSHDHDDGHSHGHDHDDGHDHSHDGLLRSARGDER"
FT   gene            141728..142417
FT                   /gene="ureF"
FT                   /locus_tag="HVO_0153"
FT   CDS_pept        141728..142417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureF"
FT                   /locus_tag="HVO_0153"
FT                   /product="urease accessory protein UreF"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03697"
FT                   /db_xref="GOA:D4GZ97"
FT                   /db_xref="InterPro:IPR002639"
FT                   /db_xref="InterPro:IPR038277"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZ97"
FT                   /protein_id="ADE03697.1"
FT                   /translation="MTDGARLESFRLADSFLPVGTYTASYGLEQFVQEELISDADDLRA
FT                   LLSTYLKQQVGPCELVALRAAHTAARDGDFDAVCRADRRLTAATLSKEFRKSARQSGNR
FT                   LLSLQRELRESPLLDEYAEAVDAGDATGNYAVVLGVAAASADIDASEACLLCCHGFVTG
FT                   LVGAAQRVLSLGHTDAQRILHDLQPVMTEAAADSADRGIDEMSPFAPLIDVLSANHERA
FT                   DRRLFMS"
FT   gene            142507..142956
FT                   /locus_tag="HVO_0154"
FT   CDS_pept        142507..142956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0154"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04141"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZ98"
FT                   /protein_id="ADE04141.1"
FT                   /translation="MQRRQVLASLGSLALLSGCLGGPAESPTETTTTTGTNTSESESTE
FT                   SGRAATTTSDCGRTEFCEGSELVRVRVDGGFSGKVVLNPACRESDIELSPGETETLIRQ
FT                   TDAETCDVELLVDGEVAYDGRIQDYEYVMVRVGSDGEISLQKEVL"
FT   gene            complement(142995..143201)
FT                   /locus_tag="HVO_0155"
FT   CDS_pept        complement(142995..143201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0155"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04546"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZ99"
FT                   /protein_id="ADE04546.1"
FT                   /translation="MSRTVRETLAEAYDPDPRAMAIVAMGSSFLLVSLLSNPSSNPSYL
FT                   FGLVVAVLSLVVSVVVLAVETRR"
FT   gene            complement(143303..144268)
FT                   /gene="trmG10"
FT                   /locus_tag="HVO_0156"
FT   CDS_pept        complement(143303..144268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmG10"
FT                   /locus_tag="HVO_0156"
FT                   /product="tRNA (guanine(10),N(2))-dimethyltransferase"
FT                   /EC_number="2.1.1.213"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02851"
FT                   /db_xref="GOA:D4GZA0"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZA0"
FT                   /protein_id="ADE02851.1"
FT                   /translation="MYGLELAGEEDAFAAREAEAAATGVTVVAPGLATARGVEPERARR
FT                   LAYTRRVVELVGRCAPDIEAARAVVAAANVDREGTVAVRARDVRGLTGISTTDAERELG
FT                   SALVDRGFGVDLDDPDHELRVCFSEDACLVGWTAVEAVRDFTDRKPTDRPFFQPGSMAP
FT                   VDARAFVNMAGAEPGARILDPMCGTGGVLLEAGLVGADVVGVDAQAKMVGGARENLRHY
FT                   VGSGDVVRGDATALPLRDDSMDGAVFDAPYGRQSKIARHSLADLVGGALAEVRRVAPEC
FT                   VMVADRSWAEAAEDAGWGVERVFERRVHRSLVRYVHLLHR"
FT   gene            144416..144727
FT                   /locus_tag="HVO_0157"
FT   CDS_pept        144416..144727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0157"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03289"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZA1"
FT                   /protein_id="ADE03289.1"
FT                   /translation="MTSHDAILWGAAALTCGLGDYVTTVLGVRTAGVQEGNPLVRRLSG
FT                   GDPGPGSFAVLKLVSVALFFAAYWALKPAVARLAVPLSLTVLGAVVTARNARIIHRRA"
FT   gene            144786..145355
FT                   /gene="tbp1"
FT                   /locus_tag="HVO_0158"
FT   CDS_pept        144786..145355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tbp1"
FT                   /locus_tag="HVO_0158"
FT                   /product="TATA-binding transcription initiation factor"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04113"
FT                   /db_xref="GOA:D4GZA2"
FT                   /db_xref="InterPro:IPR000814"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR030491"
FT                   /db_xref="InterPro:IPR033711"
FT                   /db_xref="UniProtKB/Swiss-Prot:D4GZA2"
FT                   /protein_id="ADE04113.1"
FT                   /translation="MTDPKDTINIENVVASTGIGQELDLQSVAMDLEGADYDPEQFPGL
FT                   VYRTQEPKSAALIFRSGKIVCTGAKSTDDVHESLEIVFDKLRELQIPVDDDPEITVQNI
FT                   VTSADLGENLNLNAIAIGLGLENIEYEPEQFPGLVYRLDEPSVVALLFGSGKLVITGGK
FT                   QPTDAEAAVDVIISRLSELGLLNGSF"
FT   gene            145435..145812
FT                   /locus_tag="HVO_0159"
FT   CDS_pept        145435..145812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0159"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03708"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZA3"
FT                   /protein_id="ADE03708.1"
FT                   /translation="MDALTLQTATGAPVTAVAGTFALFALFLSLTAHIAARNVLGDVEL
FT                   KKAFAVGPVPAAIAVVFTSFGWNSFVALALALGLDFGFVKYLYGRSTRLSAYVIVIHFV
FT                   VSVLLGLVLFGLSAILLTAPF"
FT   gene            145858..146799
FT                   /locus_tag="HVO_0160"
FT   CDS_pept        145858..146799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0160"
FT                   /product="Abi/CAAX family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04262"
FT                   /db_xref="GOA:D4GZA4"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZA4"
FT                   /protein_id="ADE04262.1"
FT                   /translation="MSPRRLLWNDAERRPRAPFRLLLTPVVFVAVSLVVGFSLSTALGG
FT                   LAGSSRLASLVVSLVSVGASGLAAFVVARYVDRRTVADLGLGLDREWAVDLGFGLALGT
FT                   GLMTAVFVVGVAAGWIAVSPAPLGVDRLLGVGSLLAFFVVVGIAEELLLRGIVLTDVAE
FT                   GLRWRFGPDAAVAGGLAVSSAVFGVAHYTNPNAGFASTTSITLAGVMLGLGYALTGDLA
FT                   IPTGIHISWNFVQGGVFGFAVSGLDFGTSLVETTERGPDVITGGAFGPEAGLLGVGAIV
FT                   LGAVCIAAYVRVRRGDLGFEPSVTVPDLRWKE"
FT   gene            complement(146821..147666)
FT                   /gene="hisG"
FT                   /locus_tag="HVO_0161"
FT   CDS_pept        complement(146821..147666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisG"
FT                   /locus_tag="HVO_0161"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04771"
FT                   /db_xref="GOA:D4GZA5"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR013115"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR020621"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZA5"
FT                   /protein_id="ADE04771.1"
FT                   /translation="MRIAVPNKGRLHEPTIELLERAGLHLDNGAERKLYAGTVDPDVTV
FT                   LFARAADIPEYVRDGAAEVGITGLDQVRESGHELEDLLDLEYGKCRLVLAAPEDGDIET
FT                   VADVSGKVVATEFPHIARTYFEEEGIDAEVVEVTGATELTPHVEMADAIIDITSTGTTL
FT                   RVNRLAVIDEVLSSSVRLFARPDVVDDPKVQQLLMALESVRSAEGKRYLMMNAPREKLD
FT                   EVKEVIPGLGGPTVMDVAGDSTVAVHAVVNERDVFEVVSDLKNVGASGILVTEIERLVE
FT                   "
FT   gene            147744..148844
FT                   /locus_tag="HVO_0162"
FT   CDS_pept        147744..148844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0162"
FT                   /product="peptidase M48 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04878"
FT                   /db_xref="GOA:D4GZA6"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZA6"
FT                   /protein_id="ADE04878.1"
FT                   /translation="MAPVTFAGALVGVSLLGAGWSRLSAGRLERRDVSVQRFRQRVRSN
FT                   WLYAAVLFVGVVWWTNADRALLAAVGLQTDWPWAALGWALTGVGAAVVATVSYMGAFPV
FT                   ARRVRDADMGAGTVAAKMFRYHLVVAALVFCVVTVLHVEFRVLETSGLITLLAFAAAAY
FT                   AFSAPLVGVSQTTAVPDDATRERLDRLCDRASLSVSRIRLLDGGGHRSDHLVRGPVGRK
FT                   TLFLTDSLLDRYDDETVSALLAVDAARLGRFVYELRLFTVTAVAGLVVWGVGRSPFGLL
FT                   PSLLAFAGTGVILLVTGEYASKRLIYRADEAAAERVGRAAVADALAATADEVDPGRAGS
FT                   RLSFEPSLASRIERLRDGSGAGETDA"
FT   gene            complement(148866..149378)
FT                   /locus_tag="HVO_0163"
FT   CDS_pept        complement(148866..149378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0163"
FT                   /product="ArsR family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02791"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZA7"
FT                   /protein_id="ADE02791.1"
FT                   /translation="MSETRTRVADHIKHNPGVHFNELVRALDLAPGQVQHHVRRLLSDE
FT                   TVRRSEFYGRTHYFPPEFDAWERGALALVRRETARDILGHLLEHGDARPDDVADDIGVA
FT                   RSTLEWHLDHLVERDVVRKERDLHNRVTLVLTHPERTTRLLDDVSPSLPERFVDRFDRL
FT                   LDHLVEG"
FT   gene            complement(149375..149722)
FT                   /locus_tag="HVO_0164"
FT   CDS_pept        complement(149375..149722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0164"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03661"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZA8"
FT                   /protein_id="ADE03661.1"
FT                   /translation="MEPPSNLALVPGHVQAGGPWMTAVVVLAGVSSVTLAALGVAVFLR
FT                   RRTRSHLLVALALLAFASRAAVAALTLGGVLSEFDHHVVEHLLDLAMAGLVLAAIYYAR
FT                   SIEREAGVNDP"
FT   gene            149886..151178
FT                   /gene="mtaD"
FT                   /locus_tag="HVO_0165"
FT   CDS_pept        149886..151178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtaD"
FT                   /locus_tag="HVO_0165"
FT                   /product="5-methylthioadenosine/S-adenosylhomocysteine
FT                   deaminase"
FT                   /EC_number="3.5.4.28"
FT                   /EC_number="3.5.4.31"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04483"
FT                   /db_xref="GOA:D4GZA9"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR023512"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZA9"
FT                   /protein_id="ADE04483.1"
FT                   /translation="MNTLRIAGGQVLRPDATVEDADVLVDRDEGTILDIGADLDADADE
FT                   TLDAAGCLVTPGLVNAHCHVAMTLLRGYADDKPLDAWLREDIWPAEGALTPEDVRAGAE
FT                   LGLVEMIKSGTTGFADMYFHVPEIAAAVEEAGLRARLGHGVVTLGKDDADARADIDESL
FT                   DVAREFDGAADGRIRTAAMPHSLTTVAEEYLHEFVADAHDEGIPVHYHANETTDEVDPI
FT                   VDERGERPLSYAKDLGMLTADDFLAHGVHVDDAEIDLLADAGTGVVHCPASNMKLASGM
FT                   APVQKLLDAGVTVGLGTDGAASNNDLDMFDEMRDAAMLGKLAAEDASAVAAPDVVRMAT
FT                   AGSAAAVDLPGGALEVGGAADLAVVDLDAPHLTPANDLVSHLAYAARGSDVRHTVCDGR
FT                   VLMRDREVLTLDEDAVMARAREAVASLRERV"
FT   gene            complement(151249..151560)
FT                   /locus_tag="HVO_0166"
FT   CDS_pept        complement(151249..151560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0166"
FT                   /product="HTH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05065"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZB0"
FT                   /protein_id="ADE05065.1"
FT                   /translation="MLVIDNGKTLAEQELFALMSAPAVPDLLRVADEPLTVKELSCRAD
FT                   VPLSTAYREVKRLHEASLFEKSIMVDHSDGRHVAQYHRTFERMEVSVTDDGLRIELAG"
FT   gene            151659..152945
FT                   /gene="ahcY"
FT                   /locus_tag="HVO_0167"
FT   CDS_pept        151659..152945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahcY"
FT                   /locus_tag="HVO_0167"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02775"
FT                   /db_xref="GOA:D4GZB1"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZB1"
FT                   /protein_id="ADE02775.1"
FT                   /translation="MSEHYAPVSEHLDDVEAARTEGRRKMDWALQHMPILQELREQFES
FT                   EQPLAGEVVGMAMHVEAKTANLVELLALGGAEVAITGCNPLSTHDDVSAALDANDDITS
FT                   YAVRGVDEEGYYAAIDAVIAHEPTVTVDDGMDMVFTIHEEYPELIETIVGGAEETTTGV
FT                   HRLRAMDEDGELNYPVFAVNDTPMKRLFDNVHGTGESSLATIAMTTNLSYAGKNVVVGG
FT                   YGYCGKGVAKKASGQNANVIVTEVDPRRALEAHMEGYDVMPMEEAAKVGDVFITTTGNR
FT                   DVITREDFENMKDGVLLANAGHFDIEIDLDALSDLAVDEYEARDGVDAYELEDGRRLNV
FT                   LAEGRLVNLASPIALGHPVEVMDQSFGVQAVVVRELVENGDDYDAGVHDVPDELDREVA
FT                   EIKLDAEGIEFDSMTDEQREYMGSWAHGT"
FT   gene            complement(153018..153350)
FT                   /locus_tag="HVO_0168"
FT   CDS_pept        complement(153018..153350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0168"
FT                   /product="small multidrug export protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03434"
FT                   /db_xref="GOA:D4GZB2"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZB2"
FT                   /protein_id="ADE03434.1"
FT                   /translation="MNPYVLLAGAIASELVGTTALKLSAGFSKPLPSLGVVAGYGLAFY
FT                   LVSLTLEELPIGVVYGTWAALGIVGVAAIGVVAFDEPVDLTGVVGLLLILAGIYCVNVL
FT                   SEMAAH"
FT   gene            153402..154259
FT                   /locus_tag="HVO_0169"
FT   CDS_pept        153402..154259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0169"
FT                   /product="TrmB family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04542"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZB3"
FT                   /protein_id="ADE04542.1"
FT                   /translation="MRSVAPRSTGTINLLTTGRRTPPHDRTRELGLSTYEEKAYRTLLA
FT                   TGAATAATVSDASGVPNGRVYDVLNGLRSRRLVRAQSTQPTRYAAVDPGAAVERLLAER
FT                   AAELREEWTRYRDVADAVRSNLLPTPPADGSVWLGRLGGDEMRTAMHEHVRAATESVSA
FT                   AVGPPYERASWETLRTEFDAFFEGARDDLGVSLLLSDPVLDSLPDEFRGLVASKPQTVR
FT                   IRVLPHLPVSFDVVDESVASVDIPHPQSAADRLGVVVVTDAGVVDEFDRQFRALWGDAV
FT                   PLFE"
FT   gene            154332..154754
FT                   /gene="hjc"
FT                   /locus_tag="HVO_0170"
FT   CDS_pept        154332..154754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hjc"
FT                   /locus_tag="HVO_0170"
FT                   /product="Holliday junction resolvase Hjc"
FT                   /EC_number="3.1.22.4"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03775"
FT                   /db_xref="GOA:D4GZB4"
FT                   /db_xref="InterPro:IPR002732"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR014428"
FT                   /db_xref="UniProtKB/Swiss-Prot:D4GZB4"
FT                   /protein_id="ADE03775.1"
FT                   /translation="MSSNRKGDRRERELVNALDEAGFAVMRAPASGSATTRELPDVLAG
FT                   NGEVFYAIEAKASSGRPIYLSGEEVEALVYFSRNFGAKARIAVRFDREDWYFFHPGDLY
FT                   VTDGGNYRVKKETALAEGEDFESFTGGPTQTKLGGD"
FT   gene            complement(154782..155471)
FT                   /locus_tag="HVO_0171"
FT   CDS_pept        complement(154782..155471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0171"
FT                   /product="SWIM zinc finger domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04362"
FT                   /db_xref="GOA:D4GZB5"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZB5"
FT                   /protein_id="ADE04362.2"
FT                   /translation="MTHIAHTPASTRRPVRRKTTLPSDGLSGRARRARVEPMAVRPLRD
FT                   GRYVVETDGGTYVVDVEARTCTCPDNAIRHARCKHLRRVAIEITRGEVPPPGRRRATCA
FT                   VCGDETFVPMDATGPQLCRDHDHRPGDLVRDRESGGLLVVTRALGTRADETPTETGTLV
FT                   SAYETNADYGDHEPTFEAVYLDSLPVNAGLSDLGELHAYRFPASRLSRVERGFVGANSL
FT                   GERLARA"
FT   gene            155649..155852
FT                   /locus_tag="HVO_0172"
FT   CDS_pept        155649..155852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0172"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04842"
FT                   /db_xref="GOA:D4GZB6"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZB6"
FT                   /protein_id="ADE04842.2"
FT                   /translation="MAIEAEMRRKIAVSIVAVGVFIALIVGIGATYNQSGLVSTGGLAL
FT                   VGAITAFVLVMAGIGVWLSRSS"
FT   gene            complement(155952..157052)
FT                   /gene="priL"
FT                   /locus_tag="HVO_0173"
FT   CDS_pept        complement(155952..157052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priL"
FT                   /locus_tag="HVO_0173"
FT                   /product="DNA primase large subunit"
FT                   /EC_number="2.7.7.-"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02575"
FT                   /db_xref="GOA:D4GZB7"
FT                   /db_xref="InterPro:IPR007238"
FT                   /db_xref="InterPro:IPR023642"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZB7"
FT                   /protein_id="ADE02575.1"
FT                   /translation="MRPLHARYPFFAAAREAVESADVAIATLVAEDAPAVERGVERVER
FT                   ALMEGTVEPDPGEAYPRETKTELLSYPISRIIVSLVETPAAVDKYARAEADTSYERMLA
FT                   DFDAGDDDVHGEARASLDDFLREFDLDGAVRAESNRNRNSRRAPDNYWVDVGPYLTYSD
FT                   TDWGADWRLVNRSLADGAVRVTREELSELLREAVRRRVAEGLPFAVRGSDAGDRLADAL
FT                   KPHVERLRNLLSDRGAVNVVYVDAVDPDHFPPCVEALLARAREGESLPNEAAFALAAFL
FT                   VGVGLDPDEVGGVVGDETAEALQKRATVLADSSGSQYAPPTCETMQAYDLCVNRDDRCD
FT                   TIKHPMNYFETATNDADADAADEAAD"
FT   gene            157202..157795
FT                   /locus_tag="HVO_0174"
FT   CDS_pept        157202..157795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0174"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03370"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZB8"
FT                   /protein_id="ADE03370.1"
FT                   /translation="MPHFDYPCPDCRATTSLHDADCRFEGTPWVEVERAYVDIVSVLAG
FT                   GPCDEETLRREAPGEWGPLQQAALRRLKRDERVSDANSGVLRLRTAEEFREEVSEPTRE
FT                   PMRTLHQYGSVPGCHDNAVFAMIAWYEMVGLSWPETRENVVNWLRDTGAWDRGGFEEAT
FT                   PAELVEKKRHVYEAGYGWKEKAVSAKRVIDRYRS"
FT   gene            complement(157928..158671)
FT                   /gene="pcnA"
FT                   /locus_tag="HVO_0175"
FT   CDS_pept        complement(157928..158671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcnA"
FT                   /locus_tag="HVO_0175"
FT                   /product="DNA polymerase sliding clamp"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03802"
FT                   /db_xref="GOA:D4GZB9"
FT                   /db_xref="InterPro:IPR000730"
FT                   /db_xref="InterPro:IPR022648"
FT                   /db_xref="InterPro:IPR022649"
FT                   /db_xref="InterPro:IPR022659"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZB9"
FT                   /protein_id="ADE03802.1"
FT                   /translation="MFKAIVSAATLRDALDSVSVLVDECKIRLNEESLSIRAVDPANVG
FT                   MVDLTLDAAAFESYEAHGGVIGVNLSRLEEVAGMAGAGDLIHLTLDEETRKLNIRIDGL
FT                   SYTLALIDPDSIRQEPDIPDLDLAANIVLEGTHLDRGIKAADMVSDHIRLRVDGAEETF
FT                   HIEAEGDTDDVDLSLPPADLISIEAGAADSLFSLDYLKDMNKAIPTDAEVTVELGEEFP
FT                   VKLHYQIAEGMGTITYMLAPRIQSD"
FT   gene            158945..159406
FT                   /gene="arsC"
FT                   /locus_tag="HVO_0177"
FT   CDS_pept        158945..159406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsC"
FT                   /locus_tag="HVO_0177"
FT                   /product="arsenate reductase (glutaredoxin)"
FT                   /EC_number="1.20.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04595"
FT                   /db_xref="GOA:D4GZC0"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZC0"
FT                   /protein_id="ADE04595.1"
FT                   /translation="MTDAADVDVDADTDATTTRVAFVCVQNAGRSQMATAFARRERDER
FT                   GVGDRIEVVTGGTDPADHVHDEVVEVMGEKGFDLADETPRAIEQDEIMNVDIVVTMGCS
FT                   AEGICPMTWRGDARDWDLDDPDGRDLDAVRAIRDDIEGRVSALFDELAG"
FT   gene            complement(159403..161649)
FT                   /gene="cat1"
FT                   /locus_tag="HVO_0176"
FT   CDS_pept        complement(159403..161649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cat1"
FT                   /locus_tag="HVO_0176"
FT                   /product="transport protein (probable substrate cationic
FT                   amino acids)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03766"
FT                   /db_xref="GOA:D4GZC1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZC1"
FT                   /protein_id="ADE03766.1"
FT                   /translation="MSDEELAKDLGLLSALTIGIGTMIGAGIFVLPGVAASTAGPVVVA
FT                   SFVVGGLIALVNALSVSELGTAMPKAGGGYYVNRALGPLFGSIAGLGDWMGLAFASAFY
FT                   SIGFGQYLATLVPMPEFLFLNEVQVGALVAGAVFVGVNYIGAKETGGVQTVIVTVLLAI
FT                   LALFAVQGWLSFDVATLVGDGGIAPFGYGAILPGTALVFVSFLGYAKIATVAEELKNPG
FT                   RNLPLAVIGSVAIVTVLYAILVSIMLGVVPWPDLSQSAPLTQATQLAFPGGLAGLAVTV
FT                   VTLGALLATVSSANASILASARINFAMGRDRVVTNWLNEIHPNYATPYRSILVTGAVII
FT                   LFIAALGRDIEVLAKAASVLHLVVYALMNAALIVFRETDPEYDPAFTVPLYPVTPLVGM
FT                   ALSLGLLAFVGGEELLLSGLFVVGAVVWYFVYARNNADRQGLLGRHILSRGDELPNTVV
FT                   DAAATVAPNGSGRIDDAPATTTMVAVSNPRTERALVTLAAALAKFDGGRVLATHVIQVP
FT                   DQTSLAAADDQRDRISKASERLMADARADVEQLDVPVDTRTILSHEGLAEVFDAARQHG
FT                   VDRVIMGHSGAKLAGGRVEGALDELTHDLPCDVVVLDGEEFDPSEVLLPTAGGHSSDLS
FT                   AEVARALQATTDAHISVLHVADEVAAGRGFLEQWVAEHDLHGVEQLVETGDVETVIGEA
FT                   AADKSLVLVGATETGLLSRLVGGSLALSVLDDLETTVLLAERPRRRSLRERLFG"
FT   gene            complement(161646..161891)
FT                   /locus_tag="HVO_0178"
FT   CDS_pept        complement(161646..161891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0178"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04187"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZC2"
FT                   /protein_id="ADE04187.1"
FT                   /translation="MRDREDEPARRRMTHEDFVLRNYIHFYFRIRSERVEHISLHNRVA
FT                   TMHETNVTETADSAALRPEQRVPKRRSEGPSTEANG"
FT   gene            162031..162816
FT                   /locus_tag="HVO_0179"
FT   CDS_pept        162031..162816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0179"
FT                   /product="Lrp/AsnC family transcription regulator / TrkA
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03320"
FT                   /db_xref="GOA:D4GZC3"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZC3"
FT                   /protein_id="ADE03320.1"
FT                   /translation="MPYRNTDHRLDEIDRRILYALMDDARNTSASTLAAEAGVSGATIR
FT                   NRIHKLEDSGIIRGSTAQVDFELAGGKLTNLYLCDVPVTEREALAHEARAIPGVINVRT
FT                   LMTGRRNLHVLAVGESTGDLRRVARLLTDIGIHIEDEDLLEEELFAPYGPFDPDDGGHA
FT                   PEANDFISLTGDASVVEVPVQSDAPIASLTLEDASERGILDDETLVIAIERGDRELTPH
FT                   GDTVIEPDDIVTVLSRAGGDADADALSAFRGPQTESSPG"
FT   gene            162982..163761
FT                   /gene="rlmE"
FT                   /gene_synonym="ftsJ"
FT                   /locus_tag="HVO_0180"
FT   CDS_pept        162982..163761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlmE"
FT                   /gene_synonym="ftsJ"
FT                   /locus_tag="HVO_0180"
FT                   /product="23S rRNA (uridine-2'-O-) methyltransferase"
FT                   /EC_number="2.1.1.166"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05153"
FT                   /db_xref="GOA:D4GZC4"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZC4"
FT                   /protein_id="ADE05153.1"
FT                   /translation="MARKDHYYNKAKQEGYRARSAYKLKQLDGDAGLFGPGNTVVDLGA
FT                   APGGWLQVVSEEVGDHGKVVGVDLQRIRGIDRDNVQTIRGDMTEDETKEELTAVIGERG
FT                   ADAVVSDMAPNMTGEYSLDHARSVYLARQAFEVAQELLATGGDFAVKVFDGPDVADLRA
FT                   DMEREFQYVRSMRPDASRDSSSEQYLVGKHFLTAPVRKGDELDVEIVDVGSEGDGIAKV
FT                   EEFTLFVSGTEAGDMPTVRVTDVKPRFAFAEPIDDED"
FT   gene            163911..164312
FT                   /locus_tag="HVO_0181"
FT   CDS_pept        163911..164312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0181"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02765"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZC5"
FT                   /protein_id="ADE02765.1"
FT                   /translation="MSADTTTTESQPLFTGLPSGIVPYVAILGALASVYAHLSLAPVLM
FT                   QFDQTQAILFVLAGVGFLAGIAVYLSKFWRREFYLVAIAFALAQIAAWAVMSGRVSEMA
FT                   ILSKGGEAVFSAAAAYLYLSDSPETDGAA"
FT   gene            complement(164385..164561)
FT                   /locus_tag="HVO_0182"
FT   CDS_pept        complement(164385..164561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0182"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03127"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZC6"
FT                   /protein_id="ADE03127.1"
FT                   /translation="MADEHHHRLTERDGMEMGIRCPNCGTYTSFGDILATGACRGGWKG
FT                   CRTGLRLDLVVVE"
FT   gene            complement(164618..165337)
FT                   /locus_tag="HVO_0183"
FT   CDS_pept        complement(164618..165337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0183"
FT                   /product="DUF165 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04333"
FT                   /db_xref="GOA:D4GZC7"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZC7"
FT                   /protein_id="ADE04333.1"
FT                   /translation="MSEGRSAIGQVALVGLFVTALTTAQLTASKLLSIPLPSAVGELPF
FT                   VGAAILMPGAALAYALTFFASDCYSELYGRRAAQVMVNVGFAMNFVLLGLVWSTIAAPA
FT                   ANPEFAAQFATVLSSGTNVVAGSLLAYLVSQNWDVVVFHGIRELTDGSLLWLRNIVSTA
FT                   TSQAIDTVIFVGVGFYAAPTVLGIGDVLPWNVLVGLAVGQYLLKLLIAIVDTPFVYGTV
FT                   ALLRGDDESSTDGWVAD"
FT   gene            complement(165330..165506)
FT                   /locus_tag="HVO_0184"
FT   CDS_pept        complement(165330..165506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0184"
FT                   /product="CopG domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04819"
FT                   /db_xref="GOA:D4GZC8"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZC8"
FT                   /protein_id="ADE04819.1"
FT                   /translation="MAKISVEIPDELLADLDEHVGDDKKFVNRSDAVRASIRKTLDILD
FT                   EIDDRHNRLVEDE"
FT   gene            complement(165626..167782)
FT                   /gene="tatCt"
FT                   /locus_tag="HVO_0185"
FT   CDS_pept        complement(165626..167782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatCt"
FT                   /locus_tag="HVO_0185"
FT                   /product="Sec-independent protein translocase subunit
FT                   TatCt"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02320"
FT                   /db_xref="GOA:D4GZC9"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/Swiss-Prot:D4GZC9"
FT                   /protein_id="ADE02320.1"
FT                   /translation="MSSALDEDTQQTIAAGRETAGAMLRAAQKDLQKVFIVFLVGFLGT
FT                   FYALRLYVWEFFRGVTKAQMDASVSGNVSIIAQTPFDVILLQAKIGLVVGVLFALPPFI
FT                   YVSRGALKARDAWPKSPVAPWKLALIGLTMVALFAAGVAYGYFVFFPFTFAFLAQNAIS
FT                   AGFTPSYSIVKWAQFIFLLTLSFGLASQLPLAMTGLSYAEVVPYELFRDKWRHAIVGIF
FT                   AFGALFTPPDPFTQIMWAVPVILLYAFSLYLARVVVTAKRGSEKIDVKSTATTHWNLLA
FT                   GVGVVVGLLVYAFYEYGGVELANDGLAAIGSDYVFLAPGSGVALGAFVVAGGFVGLAFG
FT                   LAYLVYRDIERLERTEIGVGDPTKLDLSALDVAGVRAAPPEAFADLEEDEVMALASAAI
FT                   DDGDKAKAQALIDRFDEAEADREAEAADAEDEPGELEDRTTRAGGAFVSELTEGETDED
FT                   DIGGYYTDIAFIVDSLTSRAFWVVGWFMLVLATTFGWLYTGGIRDVYDDFLGRLPAAVR
FT                   PEEVLNVVALHPMEALIFEVKFSTILAVLATLPLVAYFVWPALRERNIIRKRRRTVFVW
FT                   TGALAGGLLGGFALGYTYVAPTVITFLVEDALAANMIITYRITNFFWLIFFTTAGIGLL
FT                   ADVPILMVLLNTAGISYRMMRNRWREVTVFILAISAVFTPASITTMFMVTLPLMAAYGV
FT                   GLGVLFVLTVGGRRDLSPARGAAE"
FT   gene            167913..169238
FT                   /gene="tatCo"
FT                   /locus_tag="HVO_0186"
FT   CDS_pept        167913..169238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatCo"
FT                   /locus_tag="HVO_0186"
FT                   /product="Sec-independent protein translocase subunit
FT                   TatCo"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04167"
FT                   /db_xref="GOA:D4GZD0"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/Swiss-Prot:D4GZD0"
FT                   /protein_id="ADE04167.1"
FT                   /translation="MADEERDAGLSAADDETDASDDTDQRSSDGDADDADDASSSSDGP
FT                   VYGRVTPRDETVTHGSDDDASADVAAETGDNGDDSDSDTDAAPDDADDSATDSDADSDD
FT                   EPRLLADDEHTSHVPEGTYDDSSDESADDVDPDAAADGASPALTGEDEMGGVAPSSVSA
FT                   EDADFDDEDVGGLVGEAPESDQEMPLTAHIEEMIRRLAVVLGVAGAITLVLFPGADILN
FT                   ALVDTQAAFGVHIPSATDVINFLWNSHIPGAETIVDRRPRLYGPLELILTKLKVAGLAG
FT                   TVIGLPVFVYETYLFMRPGLYPKERKYYLAAVPTSLVLALVGVLFAHFVVLPAIFAYFT
FT                   SYTEGTAVVAFGLKETFNLILILMGYMAVVFQIPLFVELAIMMNLVTRRWLEDRRLLFW
FT                   GAFLGLAFLVSPDPTGMAPIIIGATMITLFEGTLAALRWTGN"
FT   gene            169351..169671
FT                   /locus_tag="HVO_0187"
FT   CDS_pept        169351..169671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0187"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04953"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZD1"
FT                   /protein_id="ADE04953.1"
FT                   /translation="MADLVALSAVALPLWFAVSVWAGIDATRHSSHNAFLWSLSVFVGG
FT                   ILGLALYLNPGRDEPGVGRRAGQSRSPDGISSARTETVSCPNCHSLEEADRDTCRFCGE
FT                   SL"
FT   gene            complement(169702..170184)
FT                   /locus_tag="HVO_0188"
FT   CDS_pept        complement(169702..170184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0188"
FT                   /product="START domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02910"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZD2"
FT                   /protein_id="ADE02910.1"
FT                   /translation="MAHELVTSIEIDAPPERVWEALVDFDRYPEWNPFMRIAGRPNEGA
FT                   TLTVHLRPPGGRESEFEPDVVYCEKHRELRWVGHLVVPGLFDGEHRFRLEPLDGGERTR
FT                   FEHAETFSGVLAGLLLRFVGEQTRAGFVAMNEGLKTRVEGVVAAENRKATESSDAV"
FT   gene            170259..170897
FT                   /locus_tag="HVO_0189"
FT   CDS_pept        170259..170897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0189"
FT                   /product="CobC/GpmA family phosphatase"
FT                   /EC_number="3.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03442"
FT                   /db_xref="GOA:D4GZD3"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZD3"
FT                   /protein_id="ADE03442.1"
FT                   /translation="MATLLLARHGETTWNRAGRVQGWVPVSLTERGREQADALARHVAD
FT                   SYEVDRLVSSDIERAQETARPVARELGLEPVLDSAWRERDVGSFQGLEFDELTDRYPQY
FT                   FLSAVGAPAARERPPSGESLVEVRRRVLNAHEGLADSLDADETVLVVSHGAPIRLSLGE
FT                   VKGLDIVETMLSQPLDNGGICEFEVELSDDGDEPLVHVVAENETRFLTT"
FT   gene            complement(170943..171839)
FT                   /locus_tag="HVO_0190"
FT   CDS_pept        complement(170943..171839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0190"
FT                   /product="TIGR00268 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05063"
FT                   /db_xref="GOA:D4GZD4"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR005232"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZD4"
FT                   /protein_id="ADE05063.1"
FT                   /translation="MSERDVAAKADAVREALAERESVLIAFSGGVDSSVVAALAHEALG
FT                   DDAVACTAKSETLPDAELDDAKRVAEEIGIEHLTVEFSELDNPDFVANDDDRCYHCRTM
FT                   RLGRMYEAARDRGIEAVCDGTNASDPGEGHRPGLRAVEELEVLSPLLAHGITKEEVRAI
FT                   ADDYDLSVADKPSMACLSSRIPTGLEVTEERLSRVERAETILRTWGFEQFRVRDHDGLA
FT                   RIEVAPEELDRALDADFVRAARDHLKDAGFDHVTLDLHGYRTGSVSPGAEAETDADAGD
FT                   DDLLVDDVFAQDYPMRK"
FT   gene            172017..174011
FT                   /gene="mutS5a"
FT                   /locus_tag="HVO_0191"
FT   CDS_pept        172017..174011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutS5a"
FT                   /locus_tag="HVO_0191"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04350"
FT                   /db_xref="GOA:D4GZD5"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012401"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZD5"
FT                   /protein_id="ADE04350.1"
FT                   /translation="MDFETIPGVGEKTAAALAELDDAERALTDGDVAALARAPGLTEGR
FT                   AAAIARGAIRRDHDDPGGFLATDRASEIYRDALGLLQARTVTTYAEKRLETLFPTGSAP
FT                   RIEEVRAFAADATDLDPDPDVLAALSGVEPLADPTPRRVRERCIATADAERYAAAKEAF
FT                   PELSIEVVEDGRDIAELARSYSTVVVLDESFAGIDVDGDVRVLPDAAERTDEVVPERLL
FT                   AFFAANREALEAAAAVHEVAELDPPCDLAALRDVLSRLADDGTVLGDDELERLSNAVDD
FT                   LDTAVSTAESVANDRLRDVIRERDVTIEGTDFLSLVEQGARVDSLLSRELEDEFDEALS
FT                   AARDHLVESLSLRPGEADLTERVFPDDPSFPLGHDEEAVGRLRTELKAARDRRAAKLKA
FT                   GLAADLGDLRDPVETLVRDALELDVRLAVSRFARDFDCVFPEFTGAAGDDGAGSFAIEA
FT                   GRSPLLDVDFSDVDPVDYEVSGVTLLSGVNSGGKTSTLDLVGLVVVLAHMGLPVPAESV
FT                   RLSRFSELHYYAKSQGTLDAGAFESTLRDFAALTDGAADRLVLVDELESITEPGASAKI
FT                   IAGILEELAEQGAAAVFVSHLAGGIREAADVSVAVDGIEAVGLEDGELVVNRSPVKDHL
FT                   ARSTPELIVEKLAGENETSFYGRLLEKFD"
FT   gene            174066..174335
FT                   /locus_tag="HVO_0193"
FT   CDS_pept        174066..174335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0193"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03818"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZD6"
FT                   /protein_id="ADE03818.1"
FT                   /translation="MPSDSLSPEERQQYDLVYHATKNAIWDVLGTAVYVLFLVFGGFLV
FT                   LFVFVLPALSALSQTGGTPVVLGVGAVGLILFVAIGYRIVRLLQ"
FT   gene            complement(174329..174736)
FT                   /locus_tag="HVO_0192"
FT   CDS_pept        complement(174329..174736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0192"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03161"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZD7"
FT                   /protein_id="ADE03161.1"
FT                   /translation="MATRAQLTALLVSLALVGGGVLGFGFAADEDYSYRYEQQLSETPE
FT                   TVPPLYSELSQSEQRAVDRALAGEVLRFEDDPGNLPGLVERDGNYYAFEFDATTDYTAP
FT                   TTVGSLVAVLLGAVGVVATVRWELASRYVTY"
FT   gene            174892..176016
FT                   /gene="orc9"
FT                   /locus_tag="HVO_0194"
FT   CDS_pept        174892..176016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orc9"
FT                   /locus_tag="HVO_0194"
FT                   /product="Orc1-type DNA replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04692"
FT                   /db_xref="GOA:D4GZD8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014277"
FT                   /db_xref="InterPro:IPR015163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZD8"
FT                   /protein_id="ADE04692.1"
FT                   /translation="MREDPEEGMLSWDETVFRDEHVFEIDHVPETFNHRESQLRSLKYA
FT                   LRPAVRGSRPLNTMVRGPPGTGKTTAVQKLFGELGTQSGVRTVRVNCQVDSTRYAVFSR
FT                   VFEHIFEYEPPSSGISFKKLFGQITDRLVEDDEVLVVALDDVNYLFYENEASDTLYSLL
FT                   RAHEAHSGARIGVIIISSDLSLDVIDELDGRVQSVFRPEEVFFPRYDVDEIVDILRGRS
FT                   KRGFHEDVIGAPELDQVAEFTADSGDLRVGIDLLRRAGLHAEMRASRTVDMEDVEAAYD
FT                   KSKYVHLSRCLQGLSDPERELVRVVAEYDGERAGAVYDAFNEATGLGYTRYSELVNKLD
FT                   QLGVIEARYTEIEGRGRTRAISLAYDADAVLDRL"
FT   gene            176077..176769
FT                   /gene="rpiA"
FT                   /locus_tag="HVO_0195"
FT   CDS_pept        176077..176769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiA"
FT                   /locus_tag="HVO_0195"
FT                   /product="ribose-5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03943"
FT                   /db_xref="GOA:D4GZD9"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZD9"
FT                   /protein_id="ADE03943.1"
FT                   /translation="MKTTGGTDAQKRRAAAAAVEAVEDGAVVGLGTGSTTAFAIRAIGD
FT                   RVADGLDVRGVPTSFAARELARECGIPVVDLDEVDAVDLAIDGADQVALADSALVKGGG
FT                   AAHAREKVVDAFADRFLVVADPSKIAETLSHAVPVEVLPSARTTVAAGVSDLGGEATLR
FT                   RAERKDGPVVTDNGNLVLDCEFGAIPNPESLATDLASLPGAVEHGLFVGLADAVYVGTD
FT                   DGVEVTEL"
FT   gene            complement(176934..177101)
FT                   /locus_tag="HVO_0196"
FT   CDS_pept        complement(176934..177101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0196"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03460"
FT                   /db_xref="GOA:D4GZE0"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR015207"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZE0"
FT                   /protein_id="ADE03460.1"
FT                   /translation="MADLIVKAAVKEALKDKNVASDFYDALDEEVKELLEDAARRAEQN
FT                   DRKTVQPRDL"
FT   gene            177286..178047
FT                   /gene="purE2"
FT                   /locus_tag="HVO_0197"
FT   CDS_pept        177286..178047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE2"
FT                   /locus_tag="HVO_0197"
FT                   /product="PurE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02592"
FT                   /db_xref="GOA:D4GZE1"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="InterPro:IPR039476"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZE1"
FT                   /protein_id="ADE02592.1"
FT                   /translation="MRDILEAVADGSLSPAEAEVRLSGYATTDAGRFDAARETRRGVPE
FT                   AILAEGKTPDETATLAVAAVETSGRALVTRADTAHAEAVADALPDADIDRDARAKTVVA
FT                   AAPEFERPDLDATVAIATGGTSDAEAAGEAAAVLREMGVDVERIEDVGVAHLGRVLDNL
FT                   DTLREADVVVVAAGREGALPTVVAGLVDTPVIGLPVSTGYGHGGDGEAAVLGMLQSCTV
FT                   LSAVNVDAGYIAGAQAGLIARAVADARDDDA"
FT   gene            178195..178344
FT                   /locus_tag="HVO_0197A"
FT   CDS_pept        178195..178344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0197A"
FT                   /product="small CPxCG-related zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0197A"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04516"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZE2"
FT                   /protein_id="ADE04516.1"
FT                   /translation="MPVCDHCGSHVSERFARVFADKNGQVLACPNCSANAGIAEVARQR
FT                   ARTA"
FT   gene            178439..178678
FT                   /locus_tag="HVO_0198"
FT   CDS_pept        178439..178678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0198"
FT                   /product="UPF0213 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02751"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZE3"
FT                   /protein_id="ADE02751.1"
FT                   /translation="MHFVYVIECNDGSLYTGYTTDVERRVAEHDAGEGAKYTRGRTPVE
FT                   LVHVEEFDSKSAAMSREYEIKQLRRREKQRLVES"
FT   gene            178741..180114
FT                   /gene="pmm2"
FT                   /locus_tag="HVO_0199"
FT   CDS_pept        178741..180114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmm2"
FT                   /locus_tag="HVO_0199"
FT                   /product="phosphohexomutase (phosphoglucomutase /
FT                   phosphomannomutase)"
FT                   /EC_number="5.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04687"
FT                   /db_xref="GOA:D4GZE4"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZE4"
FT                   /protein_id="ADE04687.1"
FT                   /translation="MDEISFGTDGWRATLDTFTDDRVRVVGQAVADYLADEGFTAPVLV
FT                   GYDARETSPGFAESLAEVVAGNGFDVLLPERDCPTPLVAYAIADRGLSGALMVTASHNP
FT                   PEYNGVKFIPSDGAPALPDVTDAVAERLAEPDLLPESERGTIERVDVVSPHADHAMDLV
FT                   GDDLSDLTVVYDAMHGSGRGVTDALLEAAGAEVVRLRCERDADFGGISPEPSAENLGGL
FT                   AEAMAEHDADLGVANDGDADRIGIATPDRGVLDENLFFAAVYDYLLESDSGPAIRTVST
FT                   TFLIDRIAEAHGEEVFETAVGFKWVADGMREHDALMGGEESGGFSVRGHVREKDGVLMG
FT                   LLAAAATAEEDFDARLDRIEAEHGDIVADKISVACPDAEKARVIDDLEDVLPETVAGRD
FT                   IAKVVTLDGFKLLLDDGSWLLVRPSGTEPKMRVYAEAGSEDAVSTLLEAGRELVEPLV"
FT   gene            complement(180124..180504)
FT                   /locus_tag="HVO_0200"
FT   CDS_pept        complement(180124..180504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0200"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03829"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZE5"
FT                   /protein_id="ADE03829.1"
FT                   /translation="MAHRDRSDRILTDWDRVFDALADPSRRYVLEYLHDRSEPASVWDL
FT                   AVALAVRTTDLPPDEVDVQVVQQAEVGIVHVHLPKLQAADLVESGGDGVSLTEHAETLP
FT                   LFTPAYRGVVRPVGDEEERREP"
FT   gene            complement(180588..180998)
FT                   /locus_tag="HVO_0201"
FT   CDS_pept        complement(180588..180998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0201"
FT                   /product="GNAT family acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05082"
FT                   /db_xref="GOA:D4GZE6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZE6"
FT                   /protein_id="ADE05082.1"
FT                   /translation="MEDTERDRETGGARVREGDPDELVAVMRVLDAGLLEADAGEIRDR
FT                   LAAGDCLVAEASGRVVGALALDGDYIEAVAVSPSRRGRGVGTQLVRAALDRRGRLVVDF
FT                   DGGVKPFYESLGFDIEDRSDDEGRFRGVLRDE"
FT   gene            complement(181007..181207)
FT                   /gene="samp2"
FT                   /locus_tag="HVO_0202"
FT   CDS_pept        complement(181007..181207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="samp2"
FT                   /locus_tag="HVO_0202"
FT                   /product="ubiquitin-like modifier protein SAMP2"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03392"
FT                   /db_xref="GOA:D4GZE7"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="PDB:2L32"
FT                   /db_xref="PDB:2LJI"
FT                   /db_xref="PDB:4HRS"
FT                   /db_xref="UniProtKB/Swiss-Prot:D4GZE7"
FT                   /protein_id="ADE03392.1"
FT                   /translation="MNVTVEVVGEETSEVAVDDDGTYADLVRAVDLSPHEVTVLVDGRP
FT                   VPEDQSVEVDRVKVLRLIKGG"
FT   gene            181313..182296
FT                   /gene="rfcA"
FT                   /locus_tag="HVO_0203"
FT   CDS_pept        181313..182296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfcA"
FT                   /locus_tag="HVO_0203"
FT                   /product="replication factor C small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02529"
FT                   /db_xref="GOA:D4GZE8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR013748"
FT                   /db_xref="InterPro:IPR023748"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZE8"
FT                   /protein_id="ADE02529.1"
FT                   /translation="MSEAAESGDAPAGREIWIEKYRPQTFDDVYGQDDIVERLRSYIER
FT                   DDLPHLLFAGPAGVGKTTSATAIARAIYGDDWRGNFLELNASDERGIDVVRDRIKNFAR
FT                   SSFGGHDYRVIFLDEADSLTNDAQSALRRTMEQFSDNTRFILSCNYSSKIIDPIQSRCA
FT                   VFRFSPLGDDAIAEQVRDIAAAEDIEVTEDGLDALVYAAGGDMRRAINSLQAAATTGEV
FT                   VDEEAVYMITSTARPEDIEEMVRAAIDGEFTAARKQLETLIVDTGMAGGDIIDQLHRSV
FT                   WEFDLDERDAVRLMERIGEADYRISEGANEQVQLEALLASLALSQN"
FT   gene            complement(182364..184730)
FT                   /locus_tag="HVO_0204"
FT   CDS_pept        complement(182364..184730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0204"
FT                   /product="sensor box histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04938"
FT                   /db_xref="GOA:D4GZE9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZE9"
FT                   /protein_id="ADE04938.2"
FT                   /translation="MHATDPTVFVDDDFDDIALGDGVTVASASDENDPSDAACVVVTDP
FT                   DAEIPRDVPTILYTEVSPEAVERPARFDAYVSRGDRSGLESQVRWVLASTADRDAEEVA
FT                   LARNDAEWDRLKRLYEGTTDLITAGTVDELYERAIGLTEHILEFDNTSFFVHDGDSFYV
FT                   AANNDDMAGTGPIPSDTGLLGETHRTKRSFLVDDVRDHPVADPDDPAYRSAVSVPLGDD
FT                   GVFQAISNEVGAYDETDLTLAELLVSYVSETRSRIESEAAVRKSREQIERLHRGATELA
FT                   AATSLDELFEQTVEITDDILEFDISYVGVVEDGYIVPAAISSDAPADGAERVPLDDGGI
FT                   AAEVYLSGNTDITDDVRNHPEARPVKRMYRAVLSVPIGDLGVFQATTFTPGAFDERDAE
FT                   LAELLMAHVAVTAERIRAESRLREERDRSTALFEHVSDAAVAYDVEAGAVTVRDVNRAF
FT                   QSAFGYDADDVVGSDLLGRIVPPEPDPDPVPEPGADETIPELLVATGESYRGEVRRRTD
FT                   GGVREFILNVVPLSPGEERGAGYAIYTDITERKTRESELERQNERLEEFANIVSHDLRN
FT                   PLSVARGNLELARETGDEVRFDTAERALEQMEELIDDLLSLARRGQLVDETERVDLGAV
FT                   ARQAWATTDTGDAELVTSQSVVVDADEDRLAELLSNLFRNAVEHGSTGNQTASGDAVEH
FT                   GSTGSRDTPDDAVEHDGRDVRVEVGGVDGGFYVEDDGPGIEPERRDEVFEPGETTGEDG
FT                   IGYGLAIVQSIAEAHGWSAIVTSGTAGGARFEFRA"
FT   gene            complement(184851..185336)
FT                   /gene="tspO"
FT                   /locus_tag="HVO_0205"
FT   CDS_pept        complement(184851..185336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tspO"
FT                   /locus_tag="HVO_0205"
FT                   /product="TspO family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04948"
FT                   /db_xref="GOA:D4GZF0"
FT                   /db_xref="InterPro:IPR004307"
FT                   /db_xref="InterPro:IPR038330"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZF0"
FT                   /protein_id="ADE04948.1"
FT                   /translation="MKLASLRRRPAVELLAWVALAQLAGALGSVFTVTDAGSWYATLAR
FT                   PWFAPPNWVFGPVWVTLFTLMGVAAWLVSRRDHPRRERALAVFVGHLVVNVAWSAAFFG
FT                   LRSPAVGLAVIVVLLAAILATTREFAAVNRRAAALLVPYLLWTCFAAALNYGFWSLN"
FT   gene            185459..188227
FT                   /gene="alaS1"
FT                   /locus_tag="HVO_0206"
FT   CDS_pept        185459..188227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alaS1"
FT                   /locus_tag="HVO_0206"
FT                   /product="alanine--tRNA ligase"
FT                   /EC_number="6.1.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04452"
FT                   /db_xref="GOA:D4GZF1"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR022429"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZF1"
FT                   /protein_id="ADE04452.1"
FT                   /translation="MSELEAEYRLDYFEEEGFYRKQCPVTGVHFWTRDPDRETCGEPPA
FT                   DDYTFIDNPGFDEEYTLEEMREKFLSFFEEHDHERIDPYPVAANRWRDDVLLTQASIYD
FT                   FQPLVTSGETPPPANPLTVSQPCIRMQDIDNVGKTGRHTMAFEMMAHHAFNAREEAGDK
FT                   YAYEGEVYWKDETVRLCDEFFESLGADISEITYIEDPWVGGGNAGPAFEVLYRGAELAT
FT                   LVFMSMKQDPDGDYELKDGNTYSPMDTYIVDTGYGLERWTWVSQGTPTVYEAVYPDMIE
FT                   FLKDNVGIEHTDEEEELIHRAAKLSGHLDIDEIDDLATARAEVAGELGVDEAELTSLLR
FT                   PLEDIYAIADHCRTLAYMFGDGIVPSNVGTGYLARMVLRRTKRLVDNLGVDAPLDELVD
FT                   MQAERLDYQNRDTIRDIVRSEERKYRKTLERGSRKVQQLADDYADTDEPIPLDELIELY
FT                   DSHGIQPDMVQDIAEERGATVDIPDDFYSLVADRHEQVDGEGEADERDDRLGDLPATDK
FT                   LYYDDQERTEFEAVVLDVFEREEGYDVVLDQTMFYPEGGGQPADHGSLATDDTTVEVTD
FT                   VQIVGDVVLHRTDEDPGKGEFVRGQLDAERRRRLMRHHTATHVIGHAIRTVLGDHIRQA
FT                   GASKGVDRSRLDVTHYDRITREEVTQIERVANEIVMRNIPVKQEWPDRRDAEKKYGFDL
FT                   YQGGIPPGEQIRLIHVGSDVQACGGTHVKRTGDIGAVKVLTTEPVQDGVERVVFAAGDA
FT                   AVEATQRTEDALYGAADVLDVNPADVPETAERFFTEWKERGKTIDRLKTELAEARAAAG
FT                   ADEIDIDGTPAVVQRLDGDADELRATANALVEEGKVAVLGSAAGGSAQFVVGVPDDVGI
FT                   NAGQVVGRLAGKVGGGGGGPADFAQGGGPDVDALDGALDEAPDVLRTVLNA"
FT   gene            188332..189108
FT                   /locus_tag="HVO_0207"
FT   CDS_pept        188332..189108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0207"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03645"
FT                   /db_xref="GOA:D4GZF2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZF2"
FT                   /protein_id="ADE03645.1"
FT                   /translation="MPTAVADGVELYYDSEGDGETVAFVGDAGYGAWQWGWQHAAVAGR
FT                   YESLVTDLRGAGRSDAPAGPYSVATLVSDLVAVLADANVRKAHLVGFGLGGLVALEAAR
FT                   TTNRARSLTLVGTAASGDGIDPDPLSAAPDDPAALRESLAPALSEEFRAEQPDVVEQLV
FT                   SWRKREDADPEAWAAQAAAVADYDAGPLYEVTVPTLVLHGGDDPVWPVEGGRALAEGLP
FT                   RGEFESFAGARHLVTVERSRLVNDALVSFLESLDDD"
FT   gene            189223..189936
FT                   /gene="guaAa2"
FT                   /locus_tag="HVO_0208"
FT   CDS_pept        189223..189936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaAa2"
FT                   /locus_tag="HVO_0208"
FT                   /product="glutamine amidotransferase (homolog to GMP
FT                   synthase subunit A)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04285"
FT                   /db_xref="GOA:D4GZF3"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZF3"
FT                   /protein_id="ADE04285.1"
FT                   /translation="MTRPRLAFLDASHGDSSTSRNFRRELDADLVEFDVTDGRLPDHFD
FT                   YDGVVISGSSSSVYWDEPWIRNLVSWVADADERGVPLLGVCFGHQVVAAALGGTVEDMG
FT                   AFELGYNEIERTRPDDGNDILAGIGERFTVFTSHGDRVTELPSGADLLAENEFGVHAFR
FT                   RNHAFGVQFHPEYDTDTAEAIARQKDFLPDERIRSVVDGITPENYAAACEAKRLFDNFV
FT                   TYVNRTNAGSVESAA"
FT   gene            190112..191275
FT                   /gene="acd1"
FT                   /locus_tag="HVO_0209"
FT   CDS_pept        190112..191275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acd1"
FT                   /locus_tag="HVO_0209"
FT                   /product="glutaryl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.6"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03487"
FT                   /db_xref="GOA:D4GZF4"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZF4"
FT                   /protein_id="ADE03487.1"
FT                   /translation="MLDYLELEGDLTGEEKLVRDEARRFVDEQVKPDIGEHYEAGTFPT
FT                   DLIPKMGDLGFYAPNLDGYGLPGLGERAYGLLMQELEAGDSGLRSMASVQGSLVIYPIH
FT                   AYGSDEQKQRWLPKLGSGEAVGCFGLTEPQHGSDPSGMETRAERDADGYVLNGSKTWIT
FT                   NSPIADVAVVWARDVSAEGSPVRGFLVETDRDGVTTNKIEGKLSMRASVTGEIGLDDVR
FT                   VPEEDVLPGVEGMNGPLSCLTQARFGIAWGVVGAARDAFEDARQYAKDRDQFGGPIARF
FT                   QLQQGKLAEMATQITNAQLMAHRLTDLKERGDLRHQQVSMAKRHNVRVAREVTRTAREM
FT                   LGGNGITTDYSPMRHMENIETVYTYEGTDDIHTLVLGADLTGIEAFH"
FT   gene            191384..191674
FT                   /locus_tag="HVO_0210"
FT   CDS_pept        191384..191674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0210"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02995"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZF5"
FT                   /protein_id="ADE02995.1"
FT                   /translation="MTTSAQDRPTALDLSREETWIVHAALLDAIERAVDADEEPTPAPG
FT                   LLARVEAGDEDFDSAELDYLVDALRTYRTQAPARDDHHISRVLEHIEAARA"
FT   gene            191877..192200
FT                   /gene="ferB1"
FT                   /locus_tag="HVO_0211"
FT   CDS_pept        191877..192200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ferB1"
FT                   /locus_tag="HVO_0211"
FT                   /product="ferredoxin (3Fe-4S)(4Fe-4S), zinc-containing"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02374"
FT                   /db_xref="GOA:D4GZF6"
FT                   /db_xref="InterPro:IPR009157"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZF6"
FT                   /protein_id="ADE02374.1"
FT                   /translation="MAIDSNFDQNRERAGEENGVAVWGPVEPPEKLGIHGTHVAVDYDI
FT                   CLADGACLENCPVDVFTWVDTPDHPVSEKKVEPTNEDQCIDCMLCVDICPVDAIDVDAS
FT                   RQA"
FT   gene            192245..192619
FT                   /locus_tag="HVO_0212"
FT   CDS_pept        192245..192619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0212"
FT                   /product="glyoxalase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05077"
FT                   /db_xref="GOA:D4GZF7"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZF7"
FT                   /protein_id="ADE05077.1"
FT                   /translation="MGLIHTALVVSDIDATLDFYADLGLERTNEFELDGVRNVYVGSDD
FT                   TDMELQFKYDPTSAARVEPAGIDHVAVEVADADRAFEDIVEAQSPDIVKPPVDIDPVNA
FT                   RAAFVKDPDGYVVELVSIED"
FT   gene            192742..193194
FT                   /gene="dpsA2"
FT                   /locus_tag="HVO_0213"
FT   CDS_pept        192742..193194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dpsA2"
FT                   /locus_tag="HVO_0213"
FT                   /product="ferritin / Dps domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04036"
FT                   /db_xref="GOA:D4GZF8"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZF8"
FT                   /protein_id="ADE04036.1"
FT                   /translation="MSEDVTALLKRAYQDEIETVMNYMTNSIVLDGVRAEEIKESLQTD
FT                   IQEELTHAEQLGNRLKQLDEQPPGSASFEARQHDLQPPEDSTDVLAVINGVLTAEEDAI
FT                   ETYRALIDAAEEANDPVTEDLAVTILADEEAHRTEFRGFKKEYDRE"
FT   gene            193386..194348
FT                   /locus_tag="HVO_0214"
FT   CDS_pept        193386..194348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0214"
FT                   /product="L-lactate dehydrogenase"
FT                   /EC_number="1.1.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03075"
FT                   /db_xref="GOA:D4GZF9"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZF9"
FT                   /protein_id="ADE03075.1"
FT                   /translation="MSTERGKGTVAVVGGAGAVGSSTAFALMESSLVGEIILVDIAEER
FT                   VEGEAMDLNHGAYFTSPVRVRTGDYEDCWDADVVIVTAGASQKPDETRLDLMERNADIF
FT                   ADMIPQITEGLNDDAVMLIVTNPVDVLSYVTWKVSDLPAERVIGSGTVLDTSRFRHSLS
FT                   REFDLDPANVHAYVVGEHGDSEVLVWSSANLGGIPFESYATSHGVDDIDALKARVEEEV
FT                   REAAYEIIERKERTNYGVARSVAATTERILGGDNSILTVSTLVSGEHGIDDVYMSLPCT
FT                   VNQSGVRDVHEFDLSADETAALRESAGVIRESIDRLDLQ"
FT   gene            complement(194367..196481)
FT                   /locus_tag="HVO_0215"
FT   CDS_pept        complement(194367..196481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0215"
FT                   /product="iron-sulfur protein (4Fe-4S)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02774"
FT                   /db_xref="GOA:D4GZG0"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZG0"
FT                   /protein_id="ADE02774.1"
FT                   /translation="MDFAAQADVTRETFWTISPVGEALFYGLAAIASLVFLYGVYERFA
FT                   RYAKGGEDPFDRLSDLPGRTVRAAKVVFSNEKQFKRDRFAGVMHAFIMWGFLTLLIGTT
FT                   ILAIDIDVWRRVTGSSFFVGDFYLSYSFVMDLMGLLFVVGVGMALWRRYGVRHPRLWGK
FT                   HTGFEDAAFVWTLFFLGVGGYVLEGIRIVGTDFPDFETVSFVGYFVALVFDAAGMGQGL
FT                   AQTLYWFGWWSHALLALAFVAAVPYAKPLHMLTSFANVVTADEKAGTRLPKVPADTPPD
FT                   EIGYVSEDDFSWKAMLDMDACTKCGRCTDACPAKASGRNLDPRDVILDLKAYRESVDAG
FT                   GDSIDIVADGGTSVVDAESMESCMACMACMDACPVDIEHLTHFTEMNRRLTETGQQQEP
FT                   VQEAMMNIFQNGNAFGDPQRKRPDWTDDLDFEVPDARDESVEFLWYVGDYPSYDERNRA
FT                   VARSLAQIFEEAGVSYGILYEDEGHDGNDVRRVGEEGLYEMLVEDNVDAMADCEFDKIV
FT                   CTDPHSYNTFKNEYPEMDDSFDYPVYHYTQLVERLVGDDRLGLAGDELAAQTVTYHDPC
FT                   HLGRYNGEYEAPREVIRATGVELAEMPRNRDQSFCCGGGGGGLWMDHDEESKPSEERLR
FT                   EALDDTTGGVERFVVACPMCATMYEDGRKTGDYEEAIDVVDISELVVEALDAKAAATGT
FT                   GADTTPASAD"
FT   gene            complement(196563..197267)
FT                   /gene="bioN"
FT                   /locus_tag="HVO_0216"
FT   CDS_pept        complement(196563..197267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioN"
FT                   /locus_tag="HVO_0216"
FT                   /product="ABC-type transport system permease protein
FT                   (probable substrate biotin)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02563"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZG1"
FT                   /protein_id="ADE02563.1"
FT                   /translation="MLTYEPGDTLAHRLDPRTKLAVQVAFAAAGFAHTTPAGLVALGVV
FT                   AAGCLRAADASPVSALRDLRYAIPLLALGPVVEAARLGAPWFDLEAAVEPALASVRVLL
FT                   VFFVAAAYVRTTPVRESRAAIQLLVPGRFGVALGVGVALVFRFLPLVRRDLRRVREAQA
FT                   ARLGSERRLDERLSLVAAAGLRRSFARADALALALRARCFAWNPTLPEIRFGRRDAPGL
FT                   VLAAALLVSLAL"
FT   gene            complement(197261..197962)
FT                   /gene="bioM"
FT                   /locus_tag="HVO_0217"
FT   CDS_pept        complement(197261..197962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioM"
FT                   /locus_tag="HVO_0217"
FT                   /product="ABC-type transport system ATP-binding protein
FT                   (probable substrate biotin)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04486"
FT                   /db_xref="GOA:D4GZG2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZG2"
FT                   /protein_id="ADE04486.1"
FT                   /translation="MIRVEGLVHRYGDTVAVNGVDLAIDDGECVVVAGANGSGKTTLVR
FT                   HFNGLLDPDEGTVSVNGRTVSDHLVAARTAVAMVFQHPEDQLVAATVGADVAFGPENLG
FT                   LDRGDIDRRVRESLAAVNLDGREDERVDSLSGGEVERLAIAGALAMRPDHLVLDEPFTG
FT                   LDEPARRSVLARLRDLRAEGTSLVVVTHDLRDVAELADRVVVLADGDVALDAAPDEAAD
FT                   RLPDLDVRPPC"
FT   gene            complement(197963..198541)
FT                   /gene="bioY"
FT                   /locus_tag="HVO_0218"
FT   CDS_pept        complement(197963..198541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioY"
FT                   /locus_tag="HVO_0218"
FT                   /product="biotin transport protein BioY"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03686"
FT                   /db_xref="GOA:D4GZG3"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZG3"
FT                   /protein_id="ADE03686.1"
FT                   /translation="MATERESVELVGDELVGNIARAALFAALMGASGYVSFPNPISPIP
FT                   VTMQVLVVFLAGIFLGPVWGGGSIALYLAAGGLGAPVFAGGSAGLAPLVGPTAGYLWSY
FT                   PVAAVVVGLVVHGGISAGDYRVSTPRLVGAMVAGTVVVYAFGTLGFAYVNRVGLESAFW
FT                   TASAAFIPAEAFKIAAAVGIVRSDAIAAQ"
FT   gene            198709..199314
FT                   /gene="cmi4"
FT                   /locus_tag="HVO_0219"
FT   CDS_pept        198709..199314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmi4"
FT                   /locus_tag="HVO_0219"
FT                   /product="conditioned medium-induced protein 4"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04814"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZG4"
FT                   /protein_id="ADE04814.1"
FT                   /translation="MDEKTAELRDIFIEATGSDTVTEQQSESRGSLADVDDPEAVRERV
FT                   RDIVATMRERYAFDTEFDDDALVALVVGFFDGDSDADLAVELDASPEAVRTARFDLHLV
FT                   RDADREFPFDADRFDTLLVDGADDEAIVEALDVPVEVVSECRPVAEADIRSSRANYRFR
FT                   DDFAELLTDDDLSNRMAEDARRDGLREATEDIETDVSL"
FT   gene            199368..201476
FT                   /gene="mcm"
FT                   /locus_tag="HVO_0220"
FT   CDS_pept        199368..201476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcm"
FT                   /locus_tag="HVO_0220"
FT                   /product="ATP-dependent DNA helicase MCM"
FT                   /EC_number="3.6.4.12"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04992"
FT                   /db_xref="GOA:D4GZG5"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027925"
FT                   /db_xref="InterPro:IPR031327"
FT                   /db_xref="InterPro:IPR033762"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041562"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZG5"
FT                   /protein_id="ADE04992.1"
FT                   /translation="MAQAPQNRDLTERFIEFYRNYYREEIGTLAQQYPKEKRSLHIDYD
FT                   DLYRFDSELADDYITKPGQFQEYAEEALRLFDLPADVKLGQAHVRMRNLPETVDIRNLR
FT                   VNDDHIGTLISVQGIVRKATDVRPKITEAAFECQRCGTMSYIPQGDGGFQEPHECQGCE
FT                   RQGPFRIDFDQSNFVDSQKLRVQESPEGLRGGETPQSIDINLSDDVTGKVTAGDHVTVV
FT                   GVLHIEQQTSGNEKTPVFDYYMEGISLTIEDEEFEDMEISDEDVAEIVELSNDPAIYEK
FT                   MVESVAPAIYGYEQEKIAMILQLFSGVTKHLPDGSRIRGDLHMLLIGDPGTGKSQMLSY
FT                   IRHIAPRSVYTSGKGSSSAGLTAAAVRDDFGDGQQWTLEAGALVLADKGIAAVDELDKM
FT                   RPEDRSAMHEGLEQQQISVSKAGINATLKSRCSLLGAANPKYGRFDQYEPIGEQIDLEP
FT                   ALISRFDLIFTVTDDPDPDEDSKLADHILKTNYAGELNTQRTNVANSEFTEQQVDAVTD
FT                   EVAPTIDADLLRKYIAYAKRTCYPTMTDEAKEVIRDFYVDFRARGADEDAPVPVTARKL
FT                   EALVRLGEASARVRLSDKVTREDAERVTGIVESCLRDIGMDPETGEFDADIVETGRSKT
FT                   QRDRIKNLLELIRTMQEEYEEGAPHEEVLERANSELNMDEKTVNDQLDKLKMKGDIYEP
FT                   RGDVYRAT"
FT   gene            201577..201879
FT                   /locus_tag="HVO_0221"
FT   CDS_pept        201577..201879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0221"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02380"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZG6"
FT                   /protein_id="ADE02380.1"
FT                   /translation="MDRISAIRNIEDAIRDLESGDADLASTEQRVVTVLRTFATEFEDD
FT                   AGDGTLDAWTAVGDDRAEGLVVLAADADDARARVRDLLDEATGDADDVTFSVERV"
FT   gene            202030..202368
FT                   /locus_tag="HVO_0222"
FT   CDS_pept        202030..202368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0222"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03769"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZG7"
FT                   /protein_id="ADE03769.1"
FT                   /translation="MLLVVTYSQAARTTLRNICRTHDEVVVRQLGRAALFDETELAAFL
FT                   ALRLREKHDEDVQIEQTQPFNEFAAVPDAVREAAAAYEDRESPATPYSKFASGTDHPSA
FT                   AEMQRREL"
FT   gene            202365..203306
FT                   /locus_tag="HVO_0223"
FT   CDS_pept        202365..203306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0223"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04082"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZG8"
FT                   /protein_id="ADE04082.1"
FT                   /translation="MRLRLPDGTAVEGRAIDLASDSVAVDADEVVAAIRADGRADAPGA
FT                   VRIDCSSPGPGHDRLGRVPVSDPAPSRGWLLAAVGRSRGRRAPVADDLDRLEAKLAEHR
FT                   DRAAGESNADDPERVDTSAAALRQARHRVAAAGEDESRLRERVATLRGRVNAHRDAGDD
FT                   EATAAARQELVEAATELSEVETERVAAEQRLSALEQASRAERDRRDARLKLEDAVENRR
FT                   RDARAYFAAELGAEFEAALRDLASLPAAATPAVDSPPVPPAPESDPVARSLAAVRLADL
FT                   SAPVVLSCGRFSDAEAAADWLGAPVVRCSPSD"
FT   gene            203358..204212
FT                   /locus_tag="HVO_0224"
FT   CDS_pept        203358..204212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0224"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04656"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZG9"
FT                   /protein_id="ADE04656.1"
FT                   /translation="MHSDIDVSADDGVALVSVRVDNDAPVDRRVRLRNRLDGPVLPPRR
FT                   AGVPEPGWDNEGFEGVVPAGSTVALGYAVPLSPPGDRDAEAVDADGLPEHAVDVETLGR
FT                   ADESDEAADSTPEGAIRSLGSARPPADAVPVSADPPPTVSAPETPESAPDTAGDERPDP
FT                   LPRPDPDAAGGERSTPSEQPTDADVSAAVETREPRDHETQRPSEPASLAAVERRIDLAE
FT                   RLDGASVADAAAALSEAERGVEALESLDADRERLRRLAARATALADRAADADPDVDALR
FT                   RLA"
FT   gene            204209..204871
FT                   /gene="minD1"
FT                   /locus_tag="HVO_0225"
FT   CDS_pept        204209..204871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minD1"
FT                   /locus_tag="HVO_0225"
FT                   /product="MinD/ParA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02300"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZH0"
FT                   /protein_id="ADE02300.1"
FT                   /translation="MILAVVSGKGGVGKSTLSFELAAELGSVVVDADLGMANLPYAPGP
FT                   DLHDVLAGRADPLEAVRSGGPVSILPCGRTLAGARAADTRLLADALHAVEAAYGDVVVD
FT                   CPAGMRADAGVPLAVADACVVVASPKGYALADAVRTRELARELGCGLAAVAVNRVVDAV
FT                   PLDAFADVLGAPATGIPADSRLAEAVERFEPVVASSPESLPSARIRELADAVRVSGR"
FT   gene            complement(204965..205831)
FT                   /gene="tfb7"
FT                   /locus_tag="HVO_0226"
FT   CDS_pept        complement(204965..205831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tfb7"
FT                   /locus_tag="HVO_0226"
FT                   /product="transcription initiation factor TFB"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03115"
FT                   /db_xref="GOA:D4GZH1"
FT                   /db_xref="InterPro:IPR000812"
FT                   /db_xref="InterPro:IPR013137"
FT                   /db_xref="InterPro:IPR013150"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR023484"
FT                   /db_xref="InterPro:IPR023486"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZH1"
FT                   /protein_id="ADE03115.1"
FT                   /translation="MSEARSPQGCPECDGHLGFEAGETVCTDCGLVVSEYRIDHGPEWR
FT                   SFADDDRNPARTGAPLTRSRHDRGLSTEIGRSTRIKGRKRRQFARMRRQHNRARISTKR
FT                   ERNQVYAFTEIRRVTSALSLPNHIRDQACSLFESAQNEDLLRGRSLEGFAAACVYAACR
FT                   VAGVSRSVEEVCDVSKATEAEHQAAYGALNRDLGLPVAPADPTEYLPRFATKLDLDSDT
FT                   ERRAREYVAEARDEGLVGGKNPCGVAAACLYTAASDRGEDCTQAEAADVADVTPVTLRK
FT                   TYVALRE"
FT   gene            205994..206515
FT                   /locus_tag="HVO_0227"
FT   CDS_pept        205994..206515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0227"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04006"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZH2"
FT                   /protein_id="ADE04006.1"
FT                   /translation="MGLSEIAAALETTTTEQRSRCVPTVDDTDVSLRERFEAHADALPC
FT                   APAAAERVVEAHGSGTSVGASARDAGVAPVTAAKLLHRCGEAGVTPLAPEARRIVRDWI
FT                   DGRISRADALALTGAEPSEFALATYVETHDPIDPLVEAVEGALADRTDAAVAKRDSLAE
FT                   TMSSVTDMQF"
FT   gene            complement(206630..207373)
FT                   /locus_tag="HVO_0228"
FT   CDS_pept        complement(206630..207373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0228"
FT                   /product="ParA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02813"
FT                   /db_xref="InterPro:IPR017746"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZH3"
FT                   /protein_id="ADE02813.1"
FT                   /translation="MSIPTTIALVGATGGAGTTRLSLELAAALATDGRDVAVLDAAFAT
FT                   QGLSDYVSGTLDPDATALVTDAADVPLESGLVAFETDAEGRVAVCPAAAPFERLARAMT
FT                   PDAARAFEGRIAEAADGFDHVLVDAPLLASNQTVAAAAACDRVALVAPATDRGADAVGR
FT                   LSARAADIDTDIDAVVSTFGALDDADVVVPETEATGLADAPACREDAELAAGVAAVAEV
FT                   LLDIEIDAVAATDGVLGSVSEYVRR"
FT   gene            complement(207442..208257)
FT                   /locus_tag="HVO_0229"
FT   CDS_pept        complement(207442..208257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0229"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03745"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZH4"
FT                   /protein_id="ADE03745.1"
FT                   /translation="MAVLQSFRTALRIVTETPVLVAFALAFGLVGALNNASGPAGAVGS
FT                   LLQLLAVPALTGAFYTVADGARPGSDTDLRASTAAQRYYVSLLGATLLAGLVVFVVAMV
FT                   VGGSVLGYVGFDRLNAVLNGSASLTPAELAASGVALVVLMAVVYVFIFFDTAVVLDGQT
FT                   AGGSLSRSVDFVLSNLRAVVGYAVVATAVTSVVDLPVLWFVTLDGATTVAGAVTAFQAP
FT                   MSTVDIAVVAVGSTVTTLVGRTYKVCFYRACADAAPGADPESGDGEWTA"
FT   gene            complement(208346..208762)
FT                   /gene="hit1"
FT                   /locus_tag="HVO_0230"
FT   CDS_pept        complement(208346..208762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hit1"
FT                   /locus_tag="HVO_0230"
FT                   /product="histidine triad family protein (homolog to
FT                   bis(5'-nucleosyl)-tetraphosphatase)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03086"
FT                   /db_xref="GOA:D4GZH5"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZH5"
FT                   /protein_id="ADE03086.1"
FT                   /translation="MSDCIFCAIVDGDIPGRIVHETDQSLAFLDANPLAPGHTLVVPKE
FT                   HHARLDEVPADAAADLFAAVNDLVPRVEAAVDADATNVGINNGPAAGQEVDHVHVHIVP
FT                   RFEGDGGSPIHAVAGERPDLSDEELADIEAAISG"
FT   gene            complement(209051..209686)
FT                   /gene="udg1"
FT                   /locus_tag="HVO_0231"
FT   CDS_pept        complement(209051..209686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="udg1"
FT                   /locus_tag="HVO_0231"
FT                   /product="uracil-DNA glycosylase"
FT                   /EC_number="3.2.2.27"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03935"
FT                   /db_xref="GOA:D4GZH6"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZH6"
FT                   /protein_id="ADE03935.1"
FT                   /translation="MVDADPRFPDADETLVLEPDCARCPALVDCRNRISWGVGPDDATV
FT                   MVVGEAPGAGNPDAERWRGGNWTGMSYTARHSGRRIRETMAAVGYESGVFYTNAVKCFP
FT                   SDGEGSNRAPTAAEKANCRDHLVSELEAVDPDVVVPTGRHATESVLALDDASLDGFLDT
FT                   VLDPVESERFGYTVVPLLHPSYRDVWLSRLGYELEEYLADLEALLPER"
FT   gene            complement(209687..209917)
FT                   /locus_tag="HVO_0232"
FT   CDS_pept        complement(209687..209917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0232"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04766"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZH7"
FT                   /protein_id="ADE04766.1"
FT                   /translation="MGRYGDIDYPRMTKTGLGLGLALFLFGAIGAKVALAVSGGAIPGW
FT                   ERTLFFDAEWLGIALVLFSPIIFGIVLPLTE"
FT   gene            complement(209972..210823)
FT                   /gene="prsA"
FT                   /locus_tag="HVO_0233"
FT   CDS_pept        complement(209972..210823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prsA"
FT                   /locus_tag="HVO_0233"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02619"
FT                   /db_xref="GOA:D4GZH8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037514"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZH8"
FT                   /protein_id="ADE02619.1"
FT                   /translation="MLVPGASSQALAAALADELGESLAAVEYDRFPDGETLAAVPGFDA
FT                   DAATIVASTASNDAYVELLQLQDAVREAGASAVTTVIPYMGYARQDKAFEAGHPISARA
FT                   VARAVSTTTDRVVLVNPHEDAVADFFDVPVDIVDAAGRLAEPLPELDAPLFLSPDSGAI
FT                   DIAETVRDAYGEGETDYFEKVRHSGTDVDITPSDADFEGRDVVITDDIIATGSTMSEAV
FT                   GVLADGGAKRVFCATVHPLLARNARTKLARAGIERVVGTDTIERDVSEVSVAPVLAGEI
FT                   ER"
FT   gene            complement(210884..211711)
FT                   /locus_tag="HVO_0234"
FT   CDS_pept        complement(210884..211711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0234"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03493"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZH9"
FT                   /protein_id="ADE03493.1"
FT                   /translation="MADFDLSIDEKRVYADKSGKQTAYVAAGVGVVTVDVSDDLVGGFR
FT                   IDRRCTALDAAGSPGEVVVATDEDVLLVQGDDYHELDFGPAAAVGFHRNRVVAADDSGR
FT                   VARFDESGWTDLGAVGAVRALDGSLVAADDGVYRIGDGGLSHVGLNDVTDVSDPAGRLG
FT                   GDSGTPLAATDSGLYALGNGWMDALDGAFSAVASMPDGRAHAVGPDGVVARDEESGAWE
FT                   AAPIPLDESVVALAHDARAAYAVTDAGSFCVRLTGGDWRTQVLGLETVGVAVR"
FT   gene            complement(211808..212152)
FT                   /locus_tag="HVO_0235"
FT   CDS_pept        complement(211808..212152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0235"
FT                   /product="SWIM zinc finger domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05037"
FT                   /db_xref="GOA:D4GZI0"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZI0"
FT                   /protein_id="ADE05037.1"
FT                   /translation="MDSADDWRAALAETGRLSPQIVQAIVDAHGDRGVTAIEAVSERRV
FT                   KRYRDFDVVVGYDDEYVVEDRGCTCKDSQYNLDPDEGERCWHVLAVDVAEALDELDHHD
FT                   MWYSDVREFL"
FT   gene            212299..213429
FT                   /gene="trm1"
FT                   /locus_tag="HVO_0236"
FT   CDS_pept        212299..213429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trm1"
FT                   /locus_tag="HVO_0236"
FT                   /product="tRNA (guanine(26)-N(2))-dimethyltransferase"
FT                   /EC_number="2.1.1.216"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04412"
FT                   /db_xref="GOA:D4GZI1"
FT                   /db_xref="InterPro:IPR002905"
FT                   /db_xref="InterPro:IPR022923"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR042296"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZI1"
FT                   /protein_id="ADE04412.1"
FT                   /translation="MHVSEGGVEIEVPDARDGASAGTGDDVFYNPTQELNRDITAAVLR
FT                   AFREREPRAESYLDAMAASGIRGVRAAAEGYDVTCADLDADAVELAQSNLDRAGNGGEA
FT                   VHRNANALMYDEVFDVVDLDPFGTPMPFADPTFANTRDLVCVTATDTAPLCGAHQKSGI
FT                   RKYGCLPQNTDYHPEMGLRTLLGAMVRTAARYDKAAVPILSHATRHYARAYLELDERAT
FT                   KADELLESTGFVYHCEDCLHREAERSLVAHPPEACANCDSTRILEAGPIWLGPVSEPAF
FT                   AGAVRDEVTEDFGTAKRARKLLDTLAVELDTPTHFDQHRLCKLWGRSASKMETFLETLR
FT                   DAGYDATPAHYHGTAFKTDATVAEIREVTAALDPEA"
FT   gene            213507..214844
FT                   /locus_tag="HVO_0237"
FT   CDS_pept        213507..214844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0237"
FT                   /product="UPF0761 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03138"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZI2"
FT                   /protein_id="ADE03138.1"
FT                   /translation="MSANIRTAVPVARAVVDTIREKEISFLAASISYYALVSLIPLLVL
FT                   GVVVATAVGGAALQAQLQTLVEQYLVPTGQGLVEEALSDRTGQGSVGAVGLGLTVWGAL
FT                   KLFRGLDIAFSRIYGSEAGGLLDQLRDGAIALASIGVGTIGVAVLTALLGLLDVPFLQL
FT                   LSPLLLLLTLCAAFFPLYYVFPDADLSPRQVVPGTVFAAVGWTLLGVGFGIYASVAGAS
FT                   VAGALGTLLLLVTWFYFSGLILISGAVVNAVLAGVGGDASPAEPRDPPGGPRGVDRQVQ
FT                   HTGGRHDARTDMSDDRGDTDGPRTEDADDAETGASVSPRGAPDIEELESQVEELRADLD
FT                   AFEDDVTDRTVEKPKLEAELKRYVRRRMRRGKARGWGPYLVLGYGVVLTLGAFHYLQSD
FT                   LIAVVAMLIIFLSTLGLYVLFVIFGIGLSALGVPGRAIDAVRKRRG"
FT   gene            214846..215811
FT                   /locus_tag="HVO_0238"
FT   CDS_pept        214846..215811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0238"
FT                   /product="putative PAP2-type phosphatase"
FT                   /EC_number="3.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02836"
FT                   /db_xref="GOA:D4GZI3"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZI3"
FT                   /protein_id="ADE02836.1"
FT                   /translation="MFRSALSLQTRGFGELVLADAPDALVFLFGLVTQLGDQWFFFVAF
FT                   TSLYWLCRPRITARPRRTAASFVGLALGSLALVTALKVGFALPRPPTAAVAAAPAWPSP
FT                   LSDLFVSFTTDDGFGFPSGHALGTTVVYGAAVSLLDVWDRRRRLVAAAVVVGIVSLSRV
FT                   FLGVHYGVDIVVGVLLGLGFLKAVSVVAAADDPDATGHLDPARLFAIAAGLSVLALAVV
FT                   FATGLSGHTENAAAALGGSLGGLFGWTRLAGHESLPTLSPPVALVAFLGAGGLWVGVDV
FT                   ADASVPVTVLVTAAVVAFILVAPRIQGRLGLGNGATRRAD"
FT   gene            complement(215944..217314)
FT                   /gene="glnA"
FT                   /locus_tag="HVO_0239"
FT   CDS_pept        complement(215944..217314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="HVO_0239"
FT                   /product="glutamine synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03696"
FT                   /db_xref="GOA:P43386"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/Swiss-Prot:P43386"
FT                   /protein_id="ADE03696.1"
FT                   /translation="MTEDNALTDGGLSDEAQAVIDEIEEKNVDFLRLQFTDILGTVKNV
FT                   SIPASQAEKAFTEGIYFDGSSIDGFVRIQESDMRLEPDPSTFAVLPWRKKENSAAGRLI
FT                   CDVFNTSTGEPFSGDPRGVLKRAIERAEELGYDVNVAPEPEFFLFEEDEDGRATTVTND
FT                   AGGYFDLAPKDLASDVRRDIIYGLESMGFDIEASHHEVAEGQHEINFTYDDALSTADNV
FT                   ATFRSVVRAIAAEHDLHATFMPKPIPRINGSGMHTHISLFKDGENAFHDGDDEFDLSDT
FT                   AKSFVAGILDHAPAITAVADPTVNSYKRLVPGYEAPVYIAWSDRNRSALIRKPAARTPA
FT                   ASRIEARFPDPSCNPYLAFAALIHAGLDGVEKGLDCPDPVRENIYEFDEAKREEYGIET
FT                   LPKDLGGAVDALEEDEVIQEALGDHVFEKFVEAKRSEFKDYLVDVSQWELDRYLETF"
FT   gene            217441..217899
FT                   /locus_tag="HVO_0240"
FT   CDS_pept        217441..217899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0240"
FT                   /product="Lrp/AsnC family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04171"
FT                   /db_xref="GOA:D4GZI5"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZI5"
FT                   /protein_id="ADE04171.1"
FT                   /translation="MTYENLDAKLINALLGDGRASLRSLAEELDVSVTTVSNHLRDLED
FT                   EGVIEGYTPRVNYDALGYDVTAVIQLKVEGSALPEITERLRAEKQMISVYEVTGDYDII
FT                   AIGKFRDTDGMNTQIKKLLTDADIRESNTSVVLNAVTENEQFDLDLEE"
FT   gene            complement(217905..218057)
FT                   /locus_tag="HVO_0241"
FT   CDS_pept        complement(217905..218057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0241"
FT                   /product="small CPxCG-related zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04682"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZI6"
FT                   /protein_id="ADE04682.2"
FT                   /translation="MPAVQCRECGRDVAVHEIETTTKTTPDGFDTRYRCPYCKSEMRDV
FT                   KTRIV"
FT   gene            complement(218337..219419)
FT                   /gene="pepB1"
FT                   /locus_tag="HVO_0242"
FT   CDS_pept        complement(218337..219419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepB1"
FT                   /locus_tag="HVO_0242"
FT                   /product="aminopeptidase (homolog to leucyl aminopeptidase
FT                   / aminopeptidase T)"
FT                   /EC_number="3.4.11.-"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02476"
FT                   /db_xref="GOA:D4GZI7"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="InterPro:IPR035097"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZI7"
FT                   /protein_id="ADE02476.1"
FT                   /translation="MDPRIREHARTIVDHSTSVEAGDNVVVSAPSVAEDLVTAIHELLG
FT                   DRGANVVAMDANPRFTRAFLRAGDDDYETPEHVLALYEETDVIIRVRGETNATEQSDVP
FT                   PETNAAYKRAYKPVQGEMLSKRWCLTQYPAKGSAQLAGMSTEAYENFVYDAVTLDWDAQ
FT                   GELQQQLVDILNDGDEVRITSGDETDVTMSIAGNTAINDTAEHNLPGGEVFTAPVRDSV
FT                   NGEVHFDLPLYRQGREVSGVRVRFEDGEVVDYSAEGNEEVLDGVFDTDEGARYLGELGI
FT                   GMNRGIDQFTYNMLFDEKMGDTVHMAVGSAYPETVGADNELNESAEHVDMIVDMSEDSV
FT                   IEVDGEVVQRDGTFVFEDGF"
FT   gene            219536..220561
FT                   /gene="ltaE"
FT                   /locus_tag="HVO_0243"
FT   CDS_pept        219536..220561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ltaE"
FT                   /locus_tag="HVO_0243"
FT                   /product="threonine aldolase"
FT                   /EC_number="4.1.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03363"
FT                   /db_xref="GOA:D4GZI8"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR023603"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZI8"
FT                   /protein_id="ADE03363.1"
FT                   /translation="MIDLRSDTVTLPSDEMREAARDAAVGDDVYGDDPTVNELEARAAE
FT                   LVGKEAALFVPSGTMGNQIAARVHADPGQEALVDEKAHVYEWEVGGFAQLSGLQVRAYD
FT                   AGERAAPTPAQVRDHAREESLHVAGTGVLCLENTHNARGGVAVPKADIDAAADAARDLG
FT                   IPVHLDGARLFNACVALDEDPTAMVERVDTVMCCLSKGLGAPVGSMLAGPEAFIEEAVR
FT                   VRKQFGGGMRQAGLIAAPGLVALDNVDRLADDHANATVLAEGLDAVSGLSVPTPDTNIV
FT                   VVDSEGAGLTAEEFVELCDDVGVLGGTFGQYHTRFTTNLNVSRADVERAVDLVADAVES
FT                   R"
FT   gene            complement(220622..221566)
FT                   /locus_tag="HVO_0244"
FT   CDS_pept        complement(220622..221566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0244"
FT                   /product="transport protein (probable substrate
FT                   zinc/cadmium/cobalt)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03876"
FT                   /db_xref="GOA:D4GZI9"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="InterPro:IPR040177"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZI9"
FT                   /protein_id="ADE03876.1"
FT                   /translation="MAGSTSVVVAALFANGVIAVLKFLGYLATGSPSMLSETYHSISDT
FT                   GNQVFLLIGIRDSKRGETQSHPFGHGKSQFFYSFLVSVMLFGIAGWESAKHGYDALMHP
FT                   GHGGGGEALVLLGFEIEPVLVNVAILLGAIAFESYAFLKANAELRRQIEEYEWSGLVEA
FT                   FRETSDVTTLTAFTEDTVALVGAVLALAGIGLTELTGNELFDAGAALLIGILLMGFAIA
FT                   LAWENKRLLIGESVPVDEEQALRDIVKNDPRVVHIDHFRASYVGPEKLLVALDVSFDPE
FT                   LDTEELDDHITEIEDELKAADDRVHFVYIEPEL"
FT   gene            221699..222217
FT                   /locus_tag="HVO_0245"
FT   CDS_pept        221699..222217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0245"
FT                   /product="MJ0936 family phosphodiesterase"
FT                   /EC_number="3.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02822"
FT                   /db_xref="GOA:D4GZJ0"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041802"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZJ0"
FT                   /protein_id="ADE02822.1"
FT                   /translation="MLVVVSDTHSTDGHRLTDRTLDAVREADLVVHAGDFMRESVLDAF
FT                   VDEADSFLAVYGNNDGSEIRDRIPAARNVIYGGVEFAVTHTRRGGNTALSMFGRERGAD
FT                   AVVFGHSHRPGFHGTGPIPLLNPGSHAQPRGNRKAHAELEELPDGGLRGRLVTVDGETF
FT                   ETFRIVPDE"
FT   gene            complement(222424..223386)
FT                   /locus_tag="HVO_0246"
FT   CDS_pept        complement(222424..223386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0246"
FT                   /product="ArsR family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03481"
FT                   /db_xref="GOA:D4GZJ1"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZJ1"
FT                   /protein_id="ADE03481.1"
FT                   /translation="MADLIPSSPGDPDDDRDDRDPKVIGLDSDEADDLLGAISSSTART
FT                   VLASLHESPATPSDLAAEIDTSLQNVQYHLGNLSEAGLIEVADTRYSEKGREMNVYTPA
FT                   DRALVVVAGREDETKGLKGALTRLIGGVGVLGIGAAVVNRLARAGSMLPFGLGGSTGGA
FT                   GDSGAGQSGGSGADLNATRTADSANATPATAETASTPTRTATETATTDGGGGFSIAEAT
FT                   TTADSTTQTAEATRTAVESTPTVTEAAQTATETVTATPTQTPVPDTTAAQTATETAARV
FT                   TSGSGGLAETIGTLSPGTLFFLGGLTVLLAWVAVGVLRD"
FT   gene            223483..223650
FT                   /locus_tag="HVO_0247"
FT   CDS_pept        223483..223650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0247"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04408"
FT                   /db_xref="GOA:D4GZJ2"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZJ2"
FT                   /protein_id="ADE04408.1"
FT                   /translation="MTDPLVVDGLVDFLAGNPVFVGLLAALLLFVFFGYLLVRRTLLGL
FT                   SEGYDEARRR"
FT   gene            223693..224892
FT                   /locus_tag="HVO_0248"
FT   CDS_pept        223693..224892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0248"
FT                   /product="transport protein (probable substrate
FT                   phosphate/sulfate)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02681"
FT                   /db_xref="GOA:D4GZJ3"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZJ3"
FT                   /protein_id="ADE02681.1"
FT                   /translation="MVAAGTLATFVVAALASLFMAWAIGAGSSGSTPFAPAVGANAISV
FT                   MRAGFIVGLLGFAGAFLQGANVTNAVGTELIGGVTLTAGAAVVALLTAAVLVAIGVFAG
FT                   YPIATAFTVTGAVVGVGLAMGGDPAWSKYQQIVSLWVLTPFVGGGASYATARLLRADGV
FT                   SERWTVPALAGLVGLLVANMEFAGLGGASGSASVARAAAVELTGLGGLGETGWFVAASL
FT                   LVALAAAAVVGRWVTTDKTRGQRRFLLVLGGLVAFSAGGSQVGLAIGPLVPLLDVVAVP
FT                   LPALLVGGGLGLLAGSWTGAPRMIKALAQDYSSLGPRRSIAAMIPSFAIAQTAVALGVP
FT                   VSFNEIIVSAIIGSGYAAGGSGVSGRKMLYTVLAWIGSLALALGLGYGVFTLASSVLGV
FT                   "
FT   gene            224889..225164
FT                   /locus_tag="HVO_0249"
FT   CDS_pept        224889..225164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0249"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03622"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZJ4"
FT                   /protein_id="ADE03622.1"
FT                   /translation="MNVRALRVALTTLVSALWAAFGVYHVAMAVVTGISLRGFAFGTVG
FT                   LGAFALAIRFRGRARRLGDGTADATGLVVLALASLVLVVLSVTLLE"
FT   gene            complement(225232..226647)
FT                   /locus_tag="HVO_0250"
FT   CDS_pept        complement(225232..226647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0250"
FT                   /product="DUF21/CBS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03865"
FT                   /db_xref="GOA:D4GZJ5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZJ5"
FT                   /protein_id="ADE03865.1"
FT                   /translation="MGLPPTQLPPASTLAAAQVSNIPLDDTTITVLGVAAIIVLVGLSA
FT                   FFSSSEIAMFSLAKHRVDSMVEEGIPGAERVKSLKDDPHRLLVTILVGNNIVNIAMSSL
FT                   ATGLLAVLDFGAGESVLISTFGITTLVLLFGESAPKSYAVENTESWSLRIARPLKYAEL
FT                   LLLPLVVLFDHLTRLVNRVTGGQTAIETTYVTRDEIQNLIETGEREGVIEEEEREMLDR
FT                   IFRFNSTIAKEVMTPRLDMTAVPKDATIDEAIETCVQADHERVPVYDGNLDNIIGIVNI
FT                   RNLVREKYYGERGVGIADIVSPTLHVPESKNVDELMAEMQDTRMQMVVVIDEFGTTEGL
FT                   ITLEDMVEEIVGDILEGDEEEPFESVDENTYLVRGEVNIDEVNEMLDIELPEGEEFETL
FT                   AGFIFNRAGRLVEEGEEISYNDIVIRIEQVDNTRIMKARIRTNAGIEAADGNGDGDDEE
FT                   NGGDEEAEVEPDT"
FT   gene            226809..227072
FT                   /gene="grx2"
FT                   /locus_tag="HVO_0251"
FT   CDS_pept        226809..227072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grx2"
FT                   /locus_tag="HVO_0251"
FT                   /product="glutaredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04536"
FT                   /db_xref="GOA:D4GZJ6"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZJ6"
FT                   /protein_id="ADE04536.1"
FT                   /translation="MADEQPAITLYRLQACPFCERVVRTLDEQGLAYQSRFVEPMHSDR
FT                   NVVKRVSGKRSVPAIVDDNTGVTMSESANIVDYLEHTYGEGA"
FT   gene            227072..227578
FT                   /gene="bcp2"
FT                   /locus_tag="HVO_0252"
FT   CDS_pept        227072..227578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcp2"
FT                   /locus_tag="HVO_0252"
FT                   /product="homolog to peroxiredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02559"
FT                   /db_xref="GOA:D4GZJ7"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZJ7"
FT                   /protein_id="ADE02559.1"
FT                   /translation="MPEFDVVSLPDHDAPSVGDTAPDFTRPLVNAEFWEDAALSDLTDD
FT                   GPVLLVFHTMAGAFPATYVWNELRDRGVPDEVQTVGVSISSPYEHKSFLAERGVDARLF
FT                   SDPAAGVAADYDLEHDLDGMAGVTEHRPAVFLLDEERTVQYRWVAAEWPDFPDYEGIAD
FT                   ALDDL"
FT   gene            227672..228271
FT                   /gene="yrdC"
FT                   /locus_tag="HVO_0253"
FT   CDS_pept        227672..228271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrdC"
FT                   /locus_tag="HVO_0253"
FT                   /product="threonylcarbamoyl-AMP synthase YrdC"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03295"
FT                   /db_xref="GOA:D4GZJ8"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZJ8"
FT                   /protein_id="ADE03295.1"
FT                   /translation="MSDDVQRAAAAIRRGEAVVYPTETVYGMGADATNADAVERVFDIK
FT                   GRDRDNPLSAGFPDVDAALELVEVDDREEAFMRRFLPGPVTVVVERRDSLPDALVAGKD
FT                   RIGVRIPDHELALALFRASGTPVTATSANRSGTGSITHPSQLSDEIREAVAVVLDGGTT
FT                   PGTESTVVDPGRGVVHRRGAMADDIEAWLDEHDDDA"
FT   gene            complement(228343..229032)
FT                   /locus_tag="HVO_0254"
FT   CDS_pept        complement(228343..229032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0254"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03495"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZJ9"
FT                   /protein_id="ADE03495.1"
FT                   /translation="MSALVAASDLACAAYCPRQLYYARRDDDRTPPPAVREVRALAFDY
FT                   PDLLDATDDELASRPISVSPAAYRERLTRLRERDDWDALTDPVARDELLAGKDCRGVAH
FT                   KLVGAPDGEGDRPPVPVPSLVSPGEPPERGVWEPQRVRAVALAKALAWEREAPVPRALV
FT                   EYPAVGVVRTVGLTTGNKAAYRRALRVARDLDFVPSRLRDSAKCESCTYRERCGVKTWS
FT                   LSSLLGR"
FT   gene            229170..230783
FT                   /locus_tag="HVO_0255"
FT   CDS_pept        229170..230783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0255"
FT                   /product="polyamine aminopropyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04382"
FT                   /db_xref="GOA:D4GZK0"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZK0"
FT                   /protein_id="ADE04382.1"
FT                   /translation="MASTATGSWLRMTRPELAVFVSGVTSMGLEILAGRMVAPEFGSSI
FT                   YTWGSIIGVFLAALSLGYHRGGQQAEQASNGALARVFIGTAAYIAGVILLGDLFIQSTA
FT                   GLPVPSRFASLPAITLLFGPPTYFLGFISPYAAELSGRTDVGSASGHVYAVGTVGSIIG
FT                   AFATTYVLIPSLSVTNIGLVFGLVSVVTALALVRPEIGREEAVWSVGIAAVLVLASATG
FT                   GVGLDSRGSTVYHTQTAYQELRVADAGGTRTLYLDGQPHSAMDLDDPTRHVFDYTSYFH
FT                   VPFLLSDDIDRVLFVGGGGFTGPRVFLEKYPNVTVDVVELDPEVVDIAEEYFRVEESPR
FT                   LNVHTMDGRQYLRETNRTYDLIVLDAYQKDKVPFQLTTQEFMQLTSDRLDDDGVLFANV
FT                   ISAPSGPASQFYRTEYKTIQSVYPQVYSFPTAGRVVVQNIEVVATKDETLVTAEELQRR
FT                   NRNRNIGIDLAAELTSYRNDEPTDDVPLLTDDRAPVDSLLDPMVGQRYVVQRTNETEQR
FT                   AADRNATPRSAVAGTAVRAA"
FT   gene            230787..231071
FT                   /locus_tag="HVO_0256"
FT   CDS_pept        230787..231071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0256"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05177"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZK1"
FT                   /protein_id="ADE05177.1"
FT                   /translation="MVHDRIHAREPTHDRDRWTEGVVESTVERDGHWVARARPAGSDRP
FT                   ADETVERAGDGSVELVVTFAVRDLFLRRLDVDAGESPVGCRFWYRKKRR"
FT   gene            complement(231140..231331)
FT                   /locus_tag="HVO_0257"
FT   CDS_pept        complement(231140..231331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0257"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02301"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZK2"
FT                   /protein_id="ADE02301.1"
FT                   /translation="MSIQPLDVLGGVMFLAGLTVVTGVVASAVAPGQRLGVGASLMVLG
FT                   TAAVAGPRMYQTALETTN"
FT   gene            complement(231538..232569)
FT                   /locus_tag="HVO_0258"
FT   CDS_pept        complement(231538..232569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0258"
FT                   /product="XerC/D-like integrase"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04781"
FT                   /db_xref="GOA:D4GZK3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZK3"
FT                   /protein_id="ADE04781.1"
FT                   /translation="MNGPSELKPREAVRRYLDRRGTELSESSIKTYRYRLKLWVEWCED
FT                   QNIERVSDLNGWTFEQFEAFRAGQGIASPTLHGEMETLLGFIEYLERIEAVEDGLSKKV
FT                   HVPSVPMSERSRDTMLVPDDALRLLRYYRSHSSVRGTRFHAVLELAWHTGARLGALRGL
FT                   DLRDYYPDEQYVEFVHRPESETPLKNQMNGERTVSLLPEVVESLNTYIEKFRPDGHDDF
FT                   GRSPLFVTHHGTRISKNGFRGWMYQATQPCVAGPCPHEYEKDSCEFAGSYTQGSKCPSS
FT                   RSPHHIRTGSITWHRDRGFPAEVTAERVNASQEVIEQHYDKASQRERMELRRRPHLDKL
FT                   RIE"
FT   gene            complement(232566..232742)
FT                   /locus_tag="HVO_0259"
FT   CDS_pept        complement(232566..232742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0259"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04344"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZK4"
FT                   /protein_id="ADE04344.1"
FT                   /translation="MQMTYYPTCAVCRMEVDPSEDYVSVEAEYRFTADRNDVDDYYLHW
FT                   RCAMSVFDGWGEP"
FT   gene            complement(233026..233268)
FT                   /locus_tag="HVO_0259A"
FT   CDS_pept        complement(233026..233268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0259A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0259A"
FT                   /db_xref="UniProtKB/TrEMBL:L9UF68"
FT                   /protein_id="AOP12806.1"
FT                   /translation="MIFVGPERGGSSTALRKGPSIAMTEAKTTGVTTRIATDAAQFDKG
FT                   DESTCEVCLLRPAVGVDAETRLSACRKCAALEVDR"
FT   gene            233415..233702
FT                   /locus_tag="HVO_0260"
FT   CDS_pept        233415..233702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0260"
FT                   /product="homolog to phage PhiH1 repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03498"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZK5"
FT                   /protein_id="ADE03498.1"
FT                   /translation="MRKSASWMTIWDDRILEWAREHESASAAAMKDTEYFQVSRSSLSR
FT                   RLSKLNEKGLLQHLGNGVYVITATGESYLEGELSAEELNGENGEEGSASA"
FT   gene            233714..234040
FT                   /locus_tag="HVO_0261"
FT   CDS_pept        233714..234040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0261"
FT                   /product="homolog to phage PhiH1 repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03082"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZK6"
FT                   /protein_id="ADE03082.1"
FT                   /translation="MRKSGDWMTIWDDRILEYLLEHGWGSPETIHWEIGRETTLHQIRE
FT                   RCRVLCHAGLASPFIDERSADMFEITIWGQLYLEGKVNAGLIRPLPKPRPPDKVRPRYW
FT                   SQIA"
FT   gene            234085..234963
FT                   /locus_tag="HVO_0262"
FT   CDS_pept        234085..234963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0262"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05196"
FT                   /db_xref="InterPro:IPR031832"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZK7"
FT                   /protein_id="ADE05196.2"
FT                   /translation="MSGTKFYFATFEVEGNFGFDYPADMEYDRKVRESLTDFVELEGAV
FT                   AQGDSEEWYFGRPEFDANMIYGKFGKVYADEPLTYDDEIGDFVEGDEPNKEADYSLFAI
FT                   DLENNLVIFSSTYRVRHRNFTKYLKKGYDSFTGGDASIHLELVRNKEGVETVIQNYPVH
FT                   KIHAELVPSNPSPDEEWEELDESLREMLADKLGITAEQYNDGGLDFSESFLSQVASMSQ
FT                   SKYGESWEITYSDDDGEFKVISSDDDPASKVIDEEPTTTGGLKAHIEGILSYGLTFLDS
FT                   VPHKASSASCF"
FT   gene            complement(235110..236276)
FT                   /locus_tag="HVO_0263"
FT   CDS_pept        complement(235110..236276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0263"
FT                   /product="ISH3-type transposase ISH51"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04784"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZK8"
FT                   /protein_id="ADE04784.1"
FT                   /translation="MSNNQQTDDEIHEDQLLNFLVNSLDEEVALSLAENAELDAEDIYE
FT                   VLVGACADGTSVSTLCKRSEDAPHENSVLYHLRTKFDLETLEQIGNTLLQKDILNVLPQ
FT                   QVEVCADLHLRPYYGDEDDTDGLYHSQAKRGTTAFHAYATLYARVKNKRYTLAVRRLED
FT                   GDTASSVLAEFLGILDGLDLGVKAVYLDREFYDSKCLTLLQAHNHAYVMPIVRWGQTIK
FT                   RELSEGWSRVIQHSLTAKLDGHSWTVEFPVYIDCTYQNGRYDEHGVARHGYAADAPFID
FT                   SPRDARYHYAKRFGIEASYRLSEQSIATTSTQNPVVRLLYVVVSLLLQNVWRYLHWEYV
FT                   ATPRRGGRRLWEWSFKEFINMVRRAAWTALAVRRAVPANRPPDDRFHR"
FT   gene            236333..236932
FT                   /locus_tag="HVO_0264"
FT   CDS_pept        236333..236932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0264"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03852"
FT                   /db_xref="GOA:D4GZK9"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZK9"
FT                   /protein_id="ADE03852.2"
FT                   /translation="MVNRGTVQRIRSFGPIRIVTSFEVIGAALLTAIARCSFSGSFQPD
FT                   GMSSFVAAATGISSSLIAVVLTGIAILVSLSSEQFLSFLREQDIYDRIMFVFEYTVALA
FT                   IITSLLGSILQTVEYSEYMFWIFVFFFIYLLLSTMQIVSTIIEYGDKIGEFSKANNFEP
FT                   NEDLKKDMQDLIQEHGNFDEDDNQTRNRGENESESE"
FT   gene            complement(236934..237194)
FT                   /locus_tag="HVO_0264A"
FT   CDS_pept        complement(236934..237194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0264A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0264A"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04155"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZL0"
FT                   /protein_id="ADE04155.1"
FT                   /translation="MTKRTSLKLTDERQLLFDKASEIVARDVSDDPPRSDVIDAALTHL
FT                   IESYENLEEVRDAYPPQTVKDCCNTSVLGMRYRTSLESQWR"
FT   gene            237481..237741
FT                   /locus_tag="HVO_0265"
FT   CDS_pept        237481..237741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0265"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04768"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZL1"
FT                   /protein_id="ADE04768.1"
FT                   /translation="MASATRDDNGEEGVEFIHEDDGSITARDIETGIASFGETKSEALR
FT                   MLSEALLLHEGGGEPVTDEDLEELGLDTDEFDDRELPDFMQ"
FT   gene            237743..237988
FT                   /locus_tag="HVO_0266"
FT   CDS_pept        237743..237988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0266"
FT                   /product="UPF0395 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02864"
FT                   /db_xref="GOA:D4GZL2"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR038570"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZL2"
FT                   /protein_id="ADE02864.1"
FT                   /translation="MARTTFSGREVVKALTRHDFEPAGRTGSHVQLRYEHPETDEVRTV
FT                   TVPMKSDIPTGTLQSIAKQSGAKDFHSWCEWIEQTL"
FT   gene            complement(237992..238198)
FT                   /locus_tag="HVO_0267"
FT   CDS_pept        complement(237992..238198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0267"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03842"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZL3"
FT                   /protein_id="ADE03842.1"
FT                   /translation="MFRKLRNHDGTPLIALDKNELEMDGVLENGTAPEGKQMHVQRLDE
FT                   GVYVVRNVTDGGIAELPESIPHR"
FT   gene            238338..238736
FT                   /locus_tag="HVO_0268"
FT   CDS_pept        238338..238736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0268"
FT                   /product="homolog to virus structural protein HGPV1-VP2"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04962"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZL4"
FT                   /protein_id="ADE04962.1"
FT                   /translation="MEFDPEDAAALVATFIGTTAMAGIASWSLFDVTLSDVAFQLAGND
FT                   VTLATLLTLGALGVTILTNDNAELSTLHQQAKDLDNYYYYSIVASVGLLVGWVFFGDVS
FT                   SFVQSQDLWGVGYVAVSLTAQMAIGWML"
FT   gene            238733..238948
FT                   /locus_tag="HVO_0269"
FT   CDS_pept        238733..238948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0269"
FT                   /product="homolog to virus structural protein HGPV1-VP3"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02868"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZL5"
FT                   /protein_id="ADE02868.1"
FT                   /translation="MNLDLDDLDLETVAIIGAGVGSLDAGLSAATDITLLSDLLGGSLE
FT                   TGLIAVGAAGGVVIADKLGLVEVFES"
FT   gene            238945..239475
FT                   /locus_tag="HVO_0270"
FT   CDS_pept        238945..239475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0270"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03358"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZQ0"
FT                   /protein_id="ADE03358.1"
FT                   /translation="MRRGRATLALVGLLVAAVAAVAFVGLGAATVTTDSANFTSVGNDS
FT                   LANQTIDVTNDTRSLYVELDNDTATASEPVEVAVFEVDADGNETEVDRVQISAADGTTE
FT                   LYEFDALDPTNVSTYRVEVLGTASAIDSSALDVGTVAAVSSGGGFLGGSSGGIGIGAIA
FT                   VVGIGGYLALKED"
FT   gene            239482..241095
FT                   /locus_tag="HVO_0271"
FT   CDS_pept        239482..241095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0271"
FT                   /product="homolog to virus structural protein HRPV1-VP4"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03515"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZQ1"
FT                   /protein_id="ADE03515.1"
FT                   /translation="MLRLASTYAAVGLSVAAAYLAGVHGDHHAAAIVAAVAVLFVALRL
FT                   SFGDVLRLGALDADRVKVKARQLGTLAAVSLVVTTVATSGVVPGASPVGDASAEWVDCS
FT                   LSDPLLGAAFNTLTGTDTGCRWESGEQIDYENVSKTDAYASALGIADASESYTTTTSNF
FT                   LEDTRSVAWSKAKITIVNELNNGSTVSQAKVAANQTVAEYYTGVQRNVIADWNAKTYTL
FT                   GYLHTESGLALTPDGFSHITEWDNKTYTLSDGSTQTLRAMDYSTNGDYHVAPETTIMPR
FT                   STADPGITTMGSIQAEDPSDGSTTHVLSAVAYAEILDNTYNQSNQIQANVDEYADDAYA
FT                   QYQAGDINTSDLLDPTTIASQAATDYNSTGYYSFAAVQLASLGASGDLNASHTIETGDG
FT                   TTLNGTLYYTGDDAPAGGWVTNETYTVSNFSGTFYVAAQQQDGNGSIVDLSTYENFTIV
FT                   DAVNTRTGESLNATQPETYIYDSTNASALADEIDRLRDLRAEYEQAGGSGGGGGIGIGT
FT                   EDRLIIAGAIVALILVATRN"
FT   gene            241129..241704
FT                   /locus_tag="HVO_0272"
FT   CDS_pept        241129..241704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0272"
FT                   /product="homolog to HGPV1-ORF5"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04739"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZQ2"
FT                   /protein_id="ADE04739.1"
FT                   /translation="MRRTIITLVILIAVVSPALVGTVAAQESTNSTTTTAPSTTPEATQ
FT                   TIELSPTTRIKSWSFSNGTFSLVVEADIPTRIAITDAGELSRILSEGDGAAAGKARVRR
FT                   MTLTPGTTVVKFRAESVGDASAITVSSSNADGIVAIRSDAIKTGNPPVEYGTVQTLLAS
FT                   TAVAAAGGTFLWVRKKRNEKQLEVEREW"
FT   gene            241698..242492
FT                   /locus_tag="HVO_0273"
FT   CDS_pept        241698..242492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0273"
FT                   /product="homolog to HGPV1-ORF6"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02457"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZQ3"
FT                   /protein_id="ADE02457.1"
FT                   /translation="MVNDWVKLGAVGAVFAYFGGYQFPEWAPLAASGLVIAGIGALFAT
FT                   GKINDLLPDPPRVRLVQVNANSDDPLACWSLSPDKFAEMQVEWGPLYPHEQAHGDVYEC
FT                   YAYDPSSNVAVGTWRRSLPGSSLVGRHDTDDVLDVVGELRGDLEPAARRGQELRQALPA
FT                   IVRRVKHDTMEAQNAALDPSAPMITDQPTVDEIITSELPEELRPGRLQNGDLRDLLEAA
FT                   GDQDDNRGDWGDGLGMVFDDDLADDALEPVPTDPLVNDGGNR"
FT   gene            242489..243640
FT                   /locus_tag="HVO_0274"
FT   CDS_pept        242489..243640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0274"
FT                   /product="homolog to virus protein HRPV1-VP8"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04378"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZQ4"
FT                   /protein_id="ADE04378.1"
FT                   /translation="MSGRKQGDSAVYAAAQGREFLRGALRDKSNEYIREFAGMIDDPDV
FT                   LDFLNRYCSIYEERGKNFLETHVGRHVVRSAATSMADRAYREGNVSQLQGMVGLTNQKR
FT                   DGSEAIVEAAKRLADEGAIYLVLGPPGAGKTAFALDVARVFGSLTGGTVLANVAWDGAD
FT                   RVTTSSGSMLDAMGSTDGQVLQLIDEAGQSLTSRGAEAAITDEFVKSLKYVRKKEDGDT
FT                   YAKRGSVLLIGHTRKDTAAEIRRLASGAFVKPTRNDPGRVVFLDSEGGADSFEEAAEFT
FT                   GVTDTREKYDEHEASHFSVTLDGGDDDQDDSPDPNQIRWESAVATVIKACKPWDEENGM
FT                   SYPDAAELVIFGDSWVGNRVREWKRGDHRDIVSSPEGDFEWRR"
FT   gene            243876..245228
FT                   /locus_tag="HVO_0275"
FT   CDS_pept        243876..245228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0275"
FT                   /product="ISH5-type transposase ISHvo11"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03584"
FT                   /db_xref="GOA:D4GSU1"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSU1"
FT                   /protein_id="ADE03584.1"
FT                   /translation="MGSMTYSPPDSVIVDRIQRAFPSDELRERARATNLVQRERKFDIV
FT                   ALFYTLSFGFAAGSDRSLQAFLERYVEMADCDELSYASFHDWFEPGFVALLREILDDAI
FT                   ENLDTGREDLNGRLERFRDVLIADATIVSLYQDAADIYTATGDHQAELKLHLTESLSTG
FT                   LPTRFRTTDGTTHERSQLPTGEWVADALILLDLGFYDFWLFDRIDQNGGWFVSRVKDNA
FT                   NFEIVEELRTWRGNSIPLEGESLQAVLEDLQRQEIDVRITLSFERKRGSGASATRTFRL
FT                   VGLRNEETDEYHLYLTNLAREDYSAPDIAQLYRARWEVELLFKELKSRFGLDEIKTTDG
FT                   YIIEALIIMAAISLMMSRVIVDELRSLEARQREGEAAADADSSASRLPRRRCSLAVERH
FT                   GHLIQLYLMIELGYELPDLDELLLWASRNPNPHRDRLREQVERGEFGFDRY"
FT   gene            245331..246683
FT                   /locus_tag="HVO_0276"
FT   CDS_pept        245331..246683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0276"
FT                   /product="ISH5-type transposase ISHvo11"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03319"
FT                   /db_xref="GOA:D4GQA9"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:D4GQA9"
FT                   /protein_id="ADE03319.1"
FT                   /translation="MGSMTYSPPDSVIVDRIQRAFPSDELRERARATNLVQRERKFDIV
FT                   ALFYTLSFGFAAGSDRSLQAFLERYVEMADCDELSYASFHDWFEPGFVALLREILDDAI
FT                   ENLDTGREDLNGRLERFRDVLIADATIVSLYQDAADIYTATGDHQAELKLHLTESLSTG
FT                   LPTRFRTTDGTTHERSQLPTGEWVADALILLDLGFYDFWLFDRIDKNDGWFVSRVKDDA
FT                   NFEIVEELRTWRGNSIPLEGESLQAVLDDLQRQEIDVRITLSFERKRGSGASATRTFRL
FT                   VGLRNEKTDEYHLYLTNLARESYSAPDIAQLYRARWEVELLFKELKSRFGLDEIKTTDG
FT                   YIIEALIIMAAISLMMSRVIVDELRSLEARQREGEAAADADSSASRLPRRRCSLAVERH
FT                   GHLIQLYLMVELGYELPDLDELLLWASRNPNPHRDRLREQVERGEFGFDRY"
FT   gene            246714..247094
FT                   /locus_tag="HVO_0276A"
FT   CDS_pept        246714..247094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0276A"
FT                   /product="homolog to HGPV1-ORF9"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0276A"
FT                   /db_xref="UniProtKB/TrEMBL:L9UEE6"
FT                   /protein_id="AOP12807.1"
FT                   /translation="MNRSRKAARYGRLAEEAARRIYDLDADHASWHDAHTSDGRPVETK
FT                   AAMLNRADGTEGRFRIFEDYHERLVRHDGLYVFIPYRARGRGIQVVDARSVEASKLRFK
FT                   FYGAGGHRESQQVKIHPRRVFG"
FT   gene            247254..247859
FT                   /locus_tag="HVO_0277"
FT   CDS_pept        247254..247859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0277"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02435"
FT                   /db_xref="GOA:D4GZQ7"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZQ7"
FT                   /protein_id="ADE02435.2"
FT                   /translation="MDADFTIIPIVENPVVNKGETVRIQLFVSGSGSHSKHKLYINYSY
FT                   ENLLDTSEPKNGSIGFFKMPITTDSGGINISSQELPPNASYFYEPSRFGTATGKMTGET
FT                   PDGQVPVRVSEATADGYPPMWVELNISSEATPGDYGIPITFTHYDESTVAVTKETPTFH
FT                   VNTWAEKHRTKIELVGVIAALIAFFAFLIQALDVIGWI"
FT   gene            248186..249184
FT                   /locus_tag="HVO_0278"
FT   CDS_pept        248186..249184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0278"
FT                   /product="ISH18-type transposase ISHvo9"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03701"
FT                   /db_xref="GOA:D4GQ46"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:D4GQ46"
FT                   /protein_id="ADE03701.1"
FT                   /translation="MYLGIDLHKRYAQVAVMDLEGEIVEEVRVKNANLDDLAQRYAGSR
FT                   AVIEATSNYYHVYDTLAEYLDVTVAHPGKLTLIARSDKKTDRVDAKELARLLRLNSVPQ
FT                   SYVPTDEIREARALVRGRQTLVEDRTKFANKIHGLLADNGITQTVKPLSVEGREFLREL
FT                   SLPSPWDSLLDSYLDVVETLTEQMTQLEAAIEERAGSLKETQLLMTIPGVSYYSALLVY
FT                   AELGEIDRFDGHKEVVSYMGLNPTIRESGDSRIEGGISKRGSGRVRWILVQSAYSAVYT
FT                   CKDAYLSTFFHRLNRRMNSKKAIVATARKLLVSMYYMLVREEVYDPPGVSA"
FT   gene            complement(249749..251479)
FT                   /locus_tag="HVO_0279"
FT   CDS_pept        complement(249749..251479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0279"
FT                   /product="homolog to HGPV1-ORF14"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04325"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZQ9"
FT                   /protein_id="ADE04325.1"
FT                   /translation="MTAAPFIDPQPHEGDVHLIFDEYGLKPYFALDSVRKDYDGWQTTG
FT                   KPTRKVSWRNQTWHLAYDYDVQPIDPRDHEDYQLQTVPLFRIYFVADDSLYDDEPADQS
FT                   ARTTGGTMTIRPRWPDMTKDGKPVRGIPNLGGPYLDVQIQASNIDHHLYHDLVQTAMEA
FT                   FGVSRRYFQTPHEMSNVQDLAVYVRLSREHSGAIYAPDGPIARTHSVMTSGMSGYRMHK
FT                   EDHRKIPGYYVSTHITDERAGDIIRGHRLGKEAKHYYPLNPEQFDEDHPLYNPKVEVSL
FT                   QTSITDETVYWSDLDDALRELDETLLNYLSWAGLTTRADDEVFESDVHFDAESETRRSR
FT                   RLVDCPLPEIEDEQEHVVMRIWGDMKTSDRDFTRSLIEDGGTPTREELAERTGWSYRTV
FT                   RRYVNRCEGIVADAAGKLEIGSKHMQNMLLSRVRAAAENFETAMEDAVMTAADAAAGRR
FT                   RSEWSEIKNRYAARVVEHDCRRDEIHVEYRPTDWENRTDMLRDIKRAARDRWTSLRRVT
FT                   VTYHDHLGGEHTTILSDLQLTTGNITNLDVRSVREKVESVDWEAWKAGLPQPTEDRDDT
FT                   "
FT   gene            complement(251603..251728)
FT                   /locus_tag="HVO_0280"
FT   CDS_pept        complement(251603..251728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0280"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02827"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZR0"
FT                   /protein_id="ADE02827.1"
FT                   /translation="MPTTFVRASTLYNVESRAVVRHPAFDATDEDVRRSIGGDAS"
FT   gene            complement(251728..251961)
FT                   /locus_tag="HVO_0280A"
FT   CDS_pept        complement(251728..251961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0280A"
FT                   /product="small CPxCG-related zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0280A"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03657"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZR1"
FT                   /protein_id="ADE03657.1"
FT                   /translation="MLLESQSDASSCRYCGSHVTRDFRRVYGDSNNHVHRCRECDTLIR
FT                   LQRGSGAGLSVSVPDPQHACGRHGGSPEGRSK"
FT   gene            complement(252026..252098)
FT                   /locus_tag="HVO_3017"
FT   tRNA            complement(252026..252098)
FT                   /locus_tag="HVO_3017"
FT                   /product="tRNA-Pro"
FT   gene            complement(252148..254004)
FT                   /gene="arsB1"
FT                   /locus_tag="HVO_0282"
FT   CDS_pept        complement(252148..254004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsB1"
FT                   /locus_tag="HVO_0282"
FT                   /product="transport protein (probable substrate
FT                   arsenite/antimonite)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04250"
FT                   /db_xref="GOA:D4GZR2"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZR2"
FT                   /protein_id="ADE04250.1"
FT                   /translation="MVAITPDILVVFAVILVALAFFATEPVPVDVTAIGVMVSLMLIQP
FT                   ASEALASAGMLGAPIVLFESYPGDALSGFANTATLTVLAMFILSEGVQRTGIIQLLGAK
FT                   ISTFTGDSELRQLGATVGVVGPISGFINNTAAVAILLPMVTDLAERGRTSPSKLLLPLS
FT                   YASMFGGMLTLIGTSTNILASDVYSRITGEAPFSMFEFTALGAVVMAVGVVYLMTIGRR
FT                   LTPGRIEPRRDLTEEFEMAGYLTEVVVREDSPLVGQQVQRALVETEFDVDLLQLIRGES
FT                   VFLEPLGPKEIQPGDVFTLRTDRNTLVELLDVEGLDLVPATVTEDELELADRGQNLVEV
FT                   VVAPGSALVGESLASASFRQRYDATVLALRRGGELIRRRMDNLPLRVGDTLLVQATVES
FT                   IERLDNNRNFIVAQEIERHDYRESKIPVAVGIVAGVVALAALGFLPIVVAALLGALAMV
FT                   ATKCLRPTELYDAVQWDVIFLLAGVIPLGIAMENSGAAGLLAELVVMTGDYLPLIAVLG
FT                   VFYFVTALLTNVISNNASVVLMIPVAIEAAATLGADPFSFVLAVMFAASTAFMTPVGYQ
FT                   TNLFVYGPGGYKFTDYIRVGGPLQLLLGVVTTIGVAYFFPLT"
FT   gene            complement(254076..256130)
FT                   /gene="ashA"
FT                   /locus_tag="HVO_0283"
FT   CDS_pept        complement(254076..256130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ashA"
FT                   /locus_tag="HVO_0283"
FT                   /product="archaea-specific helicase AshA"
FT                   /EC_number="3.6.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04075"
FT                   /db_xref="GOA:D4GZR3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZR3"
FT                   /protein_id="ADE04075.1"
FT                   /translation="MSKQVTRVDTLFLHQTGDDYLVVARRDGKRVLRGKLELKETNAGP
FT                   RPLRFLVTRKGEDSPRDPSQFVELARSAARIRISQQTPKDGRDELKEMLDGYQLEALTV
FT                   RTCRRCAVNGRYSPITDDTAIKAEHEHICRDCAVQELEGELSFAGGLTQAAQERLEELL
FT                   YETGDLTRITNLLQGELDPDLTKFDTISATTEDVELVETNTLDLHPNLKSMLTERFDTL
FT                   LPVQSLAIDNGLLDGDDQLVVSATATGKTLVGELAGINRMLNDDGKMLFLVPLVALANQ
FT                   KHEDFKERYGHLGKVTIRVGASRINDDGNRFDPNADVIVGTYEGIDHALRTGKDLGDIG
FT                   TVVIDEVHTLKEEERGHRLDGMIARLKHYCESRADRREGYGGAQWIYLSATVGNPKWLA
FT                   QNLRANLVEYEDRPVPIERHVTFADGQEKPRIENRLVRQAFDSKSSKGYRGQTIIFTNS
FT                   RRRCHEIARKMDYNAAAYHAGLDYGQRKRVERQFANQDLAAVVTTAALAAGVDFPASQV
FT                   IFDTLAMGIEWLSVQEFSQMLGRAGRPDYHDKGVVYLLVEPDASYHNTMEMTEDEVAFK
FT                   LLKGEMEEVRTVYDQSSAVEETLANIVVAGTKAKALNNRMLGELPTTHAVGKLLEWGFI
FT                   DGLDPTPLGLAVTRQFLSPKEAFAILDGIRKGSSPYKIVADLELDEEGR"
FT   gene            complement(256281..256670)
FT                   /locus_tag="HVO_0284"
FT   CDS_pept        complement(256281..256670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0284"
FT                   /product="cupin 2 barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02562"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZR4"
FT                   /protein_id="ADE02562.1"
FT                   /translation="MSDSRPEPVVKRSADIEYEAVGAADGMSKGVLVSEADGAPNFAIR
FT                   RFVLDPGASVPKHTNEVEHEQYVLSGRYVVGIGDEEYEVEAGDSLLIPAGVVHWYRNES
FT                   DAEGAFLCAVPNGDDAIELAADADA"
FT   gene            256758..257930
FT                   /locus_tag="HVO_0285"
FT   CDS_pept        256758..257930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0285"
FT                   /product="M50 family metalloprotease"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03252"
FT                   /db_xref="GOA:D4GZR5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR016483"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZR5"
FT                   /protein_id="ADE03252.1"
FT                   /translation="MRGIRIGSVFGIPIKLDLTFLIVLPLFAWLIGSDVTNLAAIVNDL
FT                   FGSTIDGAAISAGSMQWVLGSAAAIGLFAGVLLHEFGHSLVAMRYGYEIESITLWLFGG
FT                   VARFKEIPEDWKQEFTIAVAGPVVSVAIGVASYAGFLLLPESQAPAQFVLGYLALVNVS
FT                   LAVFNMLPGFPMDGGRVLRALLARNRPHAKATQMAAEVGKVFAFLLGLFGLFFNLFLVA
FT                   LAFFIYMGASGEAQQTVLKATFQDVVVRDIMTGRENLDVVDEKTSVAELLERMFVERHT
FT                   GYPVLRNGDLVGMVTLDDARGVKEVERDAFRVDDIMSDELTTITPDADAMDAIALMQER
FT                   GVGRLPVVDEAGELVGLVSRSDLVTAFNIIRSRGSLDAMPRSDAGLAQLR"
FT   gene            complement(257951..258775)
FT                   /locus_tag="HVO_0286"
FT   CDS_pept        complement(257951..258775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0286"
FT                   /product="CinA N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03942"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZR6"
FT                   /protein_id="ADE03942.1"
FT                   /translation="MQIAILTVGNELLAGDIENTNATWLARRLTEGGATVARIQTVPDD
FT                   HEVIAETVADWAAAFDAVLVTGGLGGTPDDITMEAVAAGLDRAFVVNEEAAAQVESTIA
FT                   AILERRPDIDFDLEPEWYASMPADAEVLPNEEGLAPGCRAGNVYVLPGIPDEMKPMFEG
FT                   IAERFAGDVESRECYADAPEGAVARELGVVAERFGVGVGSYPNSGGPTRVKLTGGDPAA
FT                   LDDAMAWFRSNATVDLYESEAAVETAREAEAGGEERSQIGRDDGRLGSRDGE"
FT   gene            complement(258948..259067)
FT                   /locus_tag="HVO_0287"
FT   CDS_pept        complement(258948..259067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0287"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05106"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZR7"
FT                   /protein_id="ADE05106.1"
FT                   /translation="MRTQLRADNSVFDRIRDAILNRGDPEDNEDPVGPTVPTG"
FT   gene            259521..259982
FT                   /locus_tag="HVO_0289"
FT   CDS_pept        259521..259982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0289"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02659"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZR8"
FT                   /protein_id="ADE02659.1"
FT                   /translation="MAITDKIYLKNHRQIVSQLDTNIPKRVFSGATLEILYSGEGLAKV
FT                   DDATRDRLLDFAQDFLDCENSDDIYTGYPERQFIEYLLELRAQGLGPDAIVDVMSDDYM
FT                   VYAYPGDVLSFLDDSVRTLESVEALADVEGDREMRDEARRAKQDLVGPR"
FT   gene            complement(260022..260435)
FT                   /locus_tag="HVO_0290"
FT   CDS_pept        complement(260022..260435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0290"
FT                   /product="CopG domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03543"
FT                   /db_xref="GOA:D4GZR9"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZR9"
FT                   /protein_id="ADE03543.1"
FT                   /translation="MGNKNKTISFRVNEDAFETLREIAEERDISLSAVFRDYVDTLVAH
FT                   DGQVQVVPKHELEKLREGEDESFPPTVEVPKSFIREHERLELEAEHLREQLEEHKGYVN
FT                   YLREQVENDHDDVEEVIQLEDLDTGDEPSFRLG"
FT   gene            complement(260600..261190)
FT                   /gene="rpap3"
FT                   /locus_tag="HVO_0291"
FT   CDS_pept        complement(260600..261190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpap3"
FT                   /locus_tag="HVO_0291"
FT                   /product="rpa-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02615"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZS0"
FT                   /protein_id="ADE02615.1"
FT                   /translation="MSSNEIPTREVARRVFAQEFNDAGYTFKESDDERAPVYLLLPTGE
FT                   SANRVFLVGTLTEKEDVGEDNEYWRGRIVDPTGTFFVYAGQYQPEAASALRDLDAPAYV
FT                   AVVGKPRTYETDDGSINVSVRPESITEVDAATRDRWVTETADKTLDRIAAFDEEGDEYA
FT                   RMAREHYDLDPEEYKRAAIAALESLEQADELSA"
FT   gene            complement(261191..262126)
FT                   /gene="rpa3"
FT                   /locus_tag="HVO_0292"
FT   CDS_pept        complement(261191..262126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpa3"
FT                   /locus_tag="HVO_0292"
FT                   /product="replication protein A"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03265"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZS1"
FT                   /protein_id="ADE03265.1"
FT                   /translation="MTDLRTHAAEIADQFSDHLDVSADEVEERLESLVTEYRVPVDEAR
FT                   RSVVNSYLDEAGIERDELAGGSGGNEQTLLNDIDEDEQWVDVRAKVVELWEPRSESIAQ
FT                   VGLLGDDSGRMKFVSFTTSELPELEEGKSYALGNVVTDEYQGNFSVKLNRTTSITELDE
FT                   EIEVGDDSTSVEGALVDSQSGSGLIKRCPEEGCTRVLQNGRCSEHGSVEGEFDLRIKAV
FT                   VDDGDEVHEVIFNREMTEELTGIELDEAKQMAMDALDTTIVEEEMRGDLVGYYYRVTGP
FT                   TLGRYVLANEVERLREPADAEELLIKARSM"
FT   gene            262298..262579
FT                   /locus_tag="HVO_0293"
FT   CDS_pept        262298..262579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0293"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04241"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZS2"
FT                   /protein_id="ADE04241.1"
FT                   /translation="MDDRLESIIRSAARSAGKRYEEAKRAYRDGRDPSPTHSLPRDAEG
FT                   RAKIVCRRHAEHRAVAVDAKGRPACFDPDHPDCQGCVDDIREGMVETW"
FT   gene            262634..263638
FT                   /gene="manC"
FT                   /locus_tag="HVO_0294"
FT   CDS_pept        262634..263638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manC"
FT                   /locus_tag="HVO_0294"
FT                   /product="mannose-1-phosphate guanylyltransferase"
FT                   /EC_number="2.7.7.13"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04872"
FT                   /db_xref="GOA:D4GZS3"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZS3"
FT                   /protein_id="ADE04872.1"
FT                   /translation="MDRPLVALVLAGGTGTRLYPASRSDRPKQFLPLGGDRSLLAETVA
FT                   RADFADHVVVSTRPAFTDDIADHAPDAEVVVEPAAKDTGPALVYATHRIAASYDDPVVV
FT                   VLPSDHHVGDGFAEAMTSGARVAADTDSLVAFGVEPTRPETGYGYIEPGADRDDARDLA
FT                   AFHEKPDAETAARYVDQGYLWNAGMFAWTPEALFSAARDSPLSPLLDALDDGDADAGFA
FT                   AVEGVSIDYAVMERAADAAVVPADFEWDDLGSWDALERIVDADEDGNVALGDDPVFVDA
FT                   ADNVVATDGATVSLVGVSDLAVVAWGDRVLVVPKEEAQKVREVVSRLKRKEMF"
FT   gene            263680..264327
FT                   /locus_tag="HVO_0295"
FT   CDS_pept        263680..264327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0295"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04876"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZS4"
FT                   /protein_id="ADE04876.1"
FT                   /translation="MGDRHLPNRRQRVEQLLTQYECLQSEKQDLIDQQSRRIQGLMAAI
FT                   AAVIGYALYAGHLVYLGMVPILIGLVFVEVILTHNQMLFVAKHLAVIEAALAGSSDSPF
FT                   RHERVRGGVFGDERGRGRWLALADVPHLFQLALGVVAYGCFAVISTRPVAWERYGGTVP
FT                   SVVGIDLNADLVGAALLVYFAGLLLVGLSHLALRSRVHRGVAASVSPSKIAP"
FT   gene            complement(264341..265126)
FT                   /locus_tag="HVO_0296"
FT   CDS_pept        complement(264341..265126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0296"
FT                   /product="putative oxidoreductase (short-chain
FT                   dehydrogenase family)"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02956"
FT                   /db_xref="GOA:D4GZS5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZS5"
FT                   /protein_id="ADE02956.1"
FT                   /translation="MELGLDGDTVVVTASSAGLGRASAAALADEGANVVVCGRDPERLA
FT                   ATESELGDLDGDVLGVETDITNKGDVEALVEAAVEEFGGVDHVVTSAGGVPPGGFADLT
FT                   EREWYGAFDMLVMSAVWTVRAARPHLEASDVGTITCITSTSVKEVIDDLILSNAVRRGV
FT                   IGLVKSLSRELAPGVRVNAVLPGAHETSRIEELVEAAVERGDHDTYEEGLDSWSDGIPL
FT                   GRVGDPRELGDVVAFLASDRASFVTGACVPVDGGRLRSA"
FT   gene            complement(265238..265732)
FT                   /gene="tfx"
FT                   /locus_tag="HVO_0297"
FT   CDS_pept        complement(265238..265732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tfx"
FT                   /locus_tag="HVO_0297"
FT                   /product="Tfx-type DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03929"
FT                   /db_xref="GOA:D4GZS6"
FT                   /db_xref="InterPro:IPR004645"
FT                   /db_xref="InterPro:IPR018384"
FT                   /db_xref="InterPro:IPR029291"
FT                   /db_xref="InterPro:IPR036657"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZS6"
FT                   /protein_id="ADE03929.1"
FT                   /translation="MSDAGRDDETVPDVDQLLDRAGFDPETSVLTRRQAEVLALRERGV
FT                   RQSTIADFLGTSRANVSSIEASARANVEKARETVTFVDALTAPVRVEVPTGSDLYDVPK
FT                   QVYDACDEAGVKVNQTAPDLMKIVSDAAGDAVEGREIKEQLFVGVTSDGRVRVRRHADG
FT                   V"
FT   gene            complement(265809..266291)
FT                   /locus_tag="HVO_0298"
FT   CDS_pept        complement(265809..266291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0298"
FT                   /product="TRAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04472"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZS7"
FT                   /protein_id="ADE04472.1"
FT                   /translation="MSDCPLADDCPSFSERIAGMGCQYYGDRGGAEWCDHYERPISELK
FT                   QQPVKPGEEVIVTVEDIHESGAGVGRTEDGFIVFVDGLLPDARAIVRIDRVKGSHARAK
FT                   KIVERLPLDPEAEGDEAGETSGAGESTGADAKSKGSGRDGPKRPEALGSRDNFWGE"
FT   gene            266382..267068
FT                   /locus_tag="HVO_0299"
FT   CDS_pept        266382..267068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0299"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03468"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZS8"
FT                   /protein_id="ADE03468.1"
FT                   /translation="MAERVPEFALLIGVFLGLSATVSAAVLSGALFRPLLFGAAVCYPF
FT                   AAFGVLRSEDPSEALPPRVVLGLGVAIGLLTAAAAVLERATVEPLDGVFAAVVVSLPPV
FT                   AYAVRFGADVNPLSPVQSLACCAVVGTAFLALAPRLGTTSALLGFVLGLSGALYADARG
FT                   FRPTHRQQRAGIAAGVFVGVAVAAAGVATGLPLGSTTATAVAAALTPSLSVALARNRRQ
FT                   PHRFRS"
FT   gene            complement(267117..268112)
FT                   /locus_tag="HVO_0300"
FT   CDS_pept        complement(267117..268112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0300"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02805"
FT                   /db_xref="GOA:D4GZS9"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040087"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZS9"
FT                   /protein_id="ADE02805.1"
FT                   /translation="MISKGCEQCAMGGKMVLFVYGYCDQRDCFYCPLGENRKNVTDVYA
FT                   NERKVESDADVIEEAKRMDALGSSITGGEPQEALDKTCRYISLLKDEFGEDHHIHLYTG
FT                   ITGGRENMRRLAEAGLDEIRFHPPLELWGDMHGTEWEDILYIAREEGLTPAFEIPGIRA
FT                   EPEFLDFLDEGAAEFCNINEFEMSDGNYRRMQEKGYELQDGHMSAVDGSKEAILDEMGD
FT                   HERVYFCTSVFKDAAQHRNRLKRMARNLRRPFDEVTDDGTLVYGKTYTPAERFIELGVP
FT                   DEFYSIKSNHVEVAWWLLEEMIEDGDVDDGEIVEQYPTYDGTVVERTPLA"
FT   gene            268220..270109
FT                   /locus_tag="HVO_0301"
FT   CDS_pept        268220..270109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0301"
FT                   /product="receiver/sensor box histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03966"
FT                   /db_xref="GOA:D4GZT0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZT0"
FT                   /protein_id="ADE03966.1"
FT                   /translation="MSLGSVVRAEGPVRVLLVDDTESAADTMSALSGCDRLDVAAVDAP
FT                   TAAVDAHAESPFDCIVTEFEFDGTGGLDALLRVRELPNPPPVILFTRLDSEETVREAVA
FT                   AGVADVVDKRPTDAQIAVLAHRISKAVAAARQSTELDELHAWLRVVAEQSLVGLYVIRD
FT                   GRVAFVNEYLSNLLGYDTDEVVGRPITEFVVEEDRTIVEESLRNRSHGSVESMSYTVRV
FT                   RDYADELTALEITGQRTTVDGEPVVVGTAMDVTARLESERLLRRSERLTSQIISSLPDM
FT                   VFISEPTEFDIVYINDQFESVWGRDVSLLYDDPNSFLDLIHVDDRDQLTRAIDEMFVDI
FT                   RDGAVDDQYEFEFRFVPEGSERIHWATARAVPLLGENGDVTNILGVISDLTERISHERE
FT                   LAQQNARLDAFARVLSHDIRGPLAVAQGRLELARELDDDSHLDHVERAHRRITDVVEDV
FT                   LSLARDERSVLDATEVSLADAAATGWEMCSSNADHVRCEIGELPVVEADESRTTRLFEN
FT                   LFRNALQHARNGRAGAADRGDEPTDLVIRVGALPSRRGFFVEDNGPGIPASIRDRVFDA
FT                   GFSTKDGDGNGLGLGIVRQIADSHGWAVRVVDGAAGARFEVLFDPVGEAGAAE"
FT   gene            270240..271373
FT                   /locus_tag="HVO_0302"
FT   CDS_pept        270240..271373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0302"
FT                   /product="DUF373 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03166"
FT                   /db_xref="InterPro:IPR007254"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZT1"
FT                   /protein_id="ADE03166.1"
FT                   /translation="MLLVLCVDLDDDLGRKTGLSTPVVGRQRVEDAAVALATADPEDSD
FT                   VNVLFQGIQVHDELLESEDEEVEVAAVTGLEGSDVKANRAIGDEIDTVLASLSTGEPVH
FT                   AIVITDGAQDESVLPVIRSRVPIDGVRRVVVRQAQNLESMYYTMKQVLADPETRGTILV
FT                   PLGILLLIYPFVTIASFFDVPGAVVLGLISALLGLYTLFRGLGLESAVDEAADRARNVL
FT                   YAGRVTIITYVAAAALLVVGGVRGVELLETVSESVAGDPPAGLVLATLVHGAVEWFAAA
FT                   GITSSLGQVTDEYLHDRFKWRYLNAPFYVLAIAIVLYALSGFFLPEGVVGVQTFYLPGL
FT                   AVALTVGTLLGVLSTLTFAVAESRYPTGSDGENEQPA"
FT   gene            complement(271412..272254)
FT                   /gene="idsA2"
FT                   /locus_tag="HVO_0303"
FT   CDS_pept        complement(271412..272254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="idsA2"
FT                   /locus_tag="HVO_0303"
FT                   /product="bifunctional short chain isoprenyl diphosphate
FT                   synthase"
FT                   /EC_number="2.5.1.10"
FT                   /EC_number="2.5.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02292"
FT                   /db_xref="GOA:D4GZT2"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZT2"
FT                   /protein_id="ADE02292.1"
FT                   /translation="MEYLERRVTMVNDRLEEVVSAVEPSELADQLDHVALAGGKRVRPA
FT                   VTILACEAVGGTPEDAVDFAVGVELVHNASLVVDDIIDRSDIRRGTPSAWAEYGYGPAI
FT                   IASDGLLGEAFALLSSSDRATRIVAESMVELGEGEATELVAVPSNEAEYMQLAHRKTGA
FT                   LFRAAAELGAVAASGDAHVVEAFGDYAARVGVAFQIRDDVLDATADAEELGKPTGQDAE
FT                   MGRPSLVQVTDLTPEEANRRARKQADEALSALDDSGVDDSEPLEYLRDLAEFVIVRES"
FT   gene            complement(272558..273511)
FT                   /gene="etfA1"
FT                   /locus_tag="HVO_0304"
FT   CDS_pept        complement(272558..273511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="etfA1"
FT                   /locus_tag="HVO_0304"
FT                   /product="electron transfer flavoprotein alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03917"
FT                   /db_xref="GOA:D4GZT3"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZT3"
FT                   /protein_id="ADE03917.1"
FT                   /translation="MSDVLAVVEHRRGSLRDVSFELVTAGSDLVGDTGGDLHLAIIGGD
FT                   VDAFAGELSLAGVDAIHTVAEGDEFNHDVTVQAVEALAEELDPTYVLMGNTVNGLDYAP
FT                   AVAERLDRPLVTDAIGLENDGGLVVTREMYASKVESTVEVDADRAAVTVRPGEWDATEE
FT                   PGEPAIEAFSFDLDESRVRSRVTGFEEVGSGDVDIADADVLVSVGRGIEEEENIELVQE
FT                   LADALGATLSSSRPIVDNGWLPKDRQVGQSGKVVTPKFYIAVGISGAVQHVAGMKGAEN
FT                   IVAINTDPDAPIFDIADYGIVGDLFDVVPELIEQFE"
FT   gene            complement(273508..274305)
FT                   /gene="etfB1"
FT                   /locus_tag="HVO_0305"
FT   CDS_pept        complement(273508..274305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="etfB1"
FT                   /locus_tag="HVO_0305"
FT                   /product="electron transfer flavoprotein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04543"
FT                   /db_xref="GOA:D4GZT4"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZT4"
FT                   /protein_id="ADE04543.1"
FT                   /translation="MKILVTVKEVAEVEEDFELDGLRVADQYLDYDLNEWDEYAVEEAV
FT                   QIAEESDDDVEVVAVTIGPERSEETIRMALAKGVDRAVRVWDDALDGVDLLDVAAKTRL
FT                   LSAVVEDEDPDLVLTGVQANDDSFGATGVSLASAIGFEWAAVVNALDLDADGGVANVRR
FT                   ELEGGVEELTEVDLPAVLTIQTGINEPRYASLRGIRQAQSKEIKPLALSDLGLDAAAVE
FT                   SDLVLTDVYEPETESDATYFEGDAGEQAADLATVLREKGVGAQ"
FT   gene            complement(274375..275553)
FT                   /locus_tag="HVO_0306"
FT   CDS_pept        complement(274375..275553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0306"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04838"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZT5"
FT                   /protein_id="ADE04838.1"
FT                   /translation="MRSAVLIVALLTIVAGVAVPVTATDVAAAGTQSADAVAGVPDTDV
FT                   TDSSADADETATLAKLGGGPRAAQQTTLERSPETEVSIQLRADRSANWRVETRYELETQ
FT                   NETAAFEEFAREYEQGTVDAGPDAAFFERVSQTAAEQTGRSMAVQNATRRGYVENETGV
FT                   LVLTFTWTNFLEQTDEGLRLGDALSADDDGTWLTSLRSNQNLTIQTPPGYAVSDTNLPL
FT                   ENNALVVEGPRTFESIDQLTVTYVSTGPERAIPWTLVGGGAVVLAVLVAGVVLFTRRRP
FT                   SGAEPAGASVSSEPRQEPTPEPTDESAPDDGEEHDEVDVDLDLLSDEERVELLLERNGG
FT                   RMKQANIVKETGWSDAKVSQLLSAMADEERVEKLRLGRENLISLPDEDEDEE"
FT   gene            275700..277091
FT                   /locus_tag="HVO_0307"
FT   CDS_pept        275700..277091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0307"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03351"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZT6"
FT                   /protein_id="ADE03351.1"
FT                   /translation="MKALPLVVVMLLVASPVLGAVGPTDGSSRSPALDGATHAQVESPS
FT                   NETIHVLDIPSSELVRSTVEAHHVDLGPSLDFSALRAGGRIQTGASLERIESASDDSTR
FT                   QQLILDELNGIEQRAIALQSAQRSVIERFNDDNLTARELLIELARIDAEARALNERRVA
FT                   LRDVTSRTSDFSISSGRLAALERELDTFTGPVRTHAVAVMTGEADAARFSVRTSETGVV
FT                   LSVVADGEYVREAYRADLRDRDQRTVTYEEALDIVAENYPTIYSSRTAQNGTNVISAGD
FT                   SHRVRINYNYGQLTAYVDTGSGRVFKESQTRPLRSISTTATATGVRDGLALTVDRTYPG
FT                   GPLRIQLNESETGDPVDANVTIGLEASQESTLLGHTGSDGTLWTVSPSAPYTVTVIKGN
FT                   SAVVLTADPTPTPTLAANPTDTENDTSPTVTSTPTESIESPGPSRTVPQGAPGDSPTVG
FT                   SPTVG"
FT   gene            277131..277613
FT                   /locus_tag="HVO_0308"
FT   CDS_pept        277131..277613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0308"
FT                   /product="DUF1628 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03956"
FT                   /db_xref="GOA:D4GZT7"
FT                   /db_xref="InterPro:IPR012859"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZT7"
FT                   /protein_id="ADE03956.2"
FT                   /translation="MPCQFRRSTRGSSVLIGSVLLIGLVVVVAAAVGAAAFDAADASPT
FT                   PTRPTALSLGVSGDTLSLTHEGGAPLDVDSLAVRISVDGESLAHQPPVPFFSASGFRPG
FT                   PTGPFNAAADPRWTVGETATLKLAGTNDPTIEPGATVTVRVFDGDTPVAALEATAS"
FT   gene            complement(277680..278303)
FT                   /gene="menG"
FT                   /locus_tag="HVO_0309"
FT   CDS_pept        complement(277680..278303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menG"
FT                   /locus_tag="HVO_0309"
FT                   /product="putative demethylmenaquinone methyltransferase"
FT                   /EC_number="2.1.1.163"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03531"
FT                   /db_xref="GOA:D4GZT8"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031164"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZT8"
FT                   /protein_id="ADE03531.1"
FT                   /translation="MGVLENKARARLFYKYLSKVYDRVNPFIWNEEMRDEALEMLDIQQ
FT                   GDRVLDVGCGTGFGTEGLLRYTDDVHGLDQSIHQMQKAWEKFGKHDEVRFYRGDAERLP
FT                   FAEDSFDVIWSSGSIEYWPNPVTALEEFRRVVKPGSKVLVVGPDDPKSGVFQKLADAIM
FT                   LFYDEEEADRMFEAAGFVDIEHHILQRQPGSPRAIVTIARAPEE"
FT   gene            278458..278790
FT                   /gene="atpH"
FT                   /locus_tag="HVO_0310"
FT   CDS_pept        278458..278790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /locus_tag="HVO_0310"
FT                   /product="A-type ATP synthase subunit H"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03790"
FT                   /db_xref="GOA:D4GZT9"
FT                   /db_xref="InterPro:IPR014275"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZT9"
FT                   /protein_id="ADE03790.1"
FT                   /translation="MPRQEVLERIKTAEQEADDIVEEAEAEREELVAEAREEADEIRSE
FT                   AEEEAAELESERLQEGRADIETERERILEEGEDARDELVAEAEDHIDDAVEFAIGKFEE
FT                   AVDAQT"
FT   gene            278777..280978
FT                   /gene="atpI"
FT                   /locus_tag="HVO_0311"
FT   CDS_pept        278777..280978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpI"
FT                   /locus_tag="HVO_0311"
FT                   /product="A-type ATP synthase subunit I"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03135"
FT                   /db_xref="GOA:D4GZU0"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZU0"
FT                   /protein_id="ADE03135.1"
FT                   /translation="MLRPEQMSKVSVTGSKGVMPEVIETVHDLRLLHVTEYDGSWQEEF
FT                   GFETGSPIEGAESASDKLVTVRSLKSILGVEDTDSGRQRIVPDDALGEPLEEIRAEVNE
FT                   LDDRRSELENELRAVDEEIDAMEPFVDLGLDLDLLSGYETLQVVVGQGKVEPVERAVVD
FT                   ADDISAYEIFSGERTHAVFGRPVDGADEMALADALVGVEFATLEVPDASGSPEEHIRDL
FT                   EQQKRETESKLETVESELHDTAVEEGEFLLAAEERLAIDVQKTEAPLSFATTENAFVAE
FT                   GWIPTERYNTFAGTLKDEVGEHVAVEELERAEFSRDGHDHAREDVTETGGTAAVTDGGT
FT                   VSMSNDDPPVVQKNSGAVKPFEILVQAVNRPNYHELDPTIILFLTFPTFFGFMIGDFGY
FT                   GVIYTAIGFFLYSKFEDGALKSMGGVTLAAGLFTTLFGILYGEIFGFHLITQYFWEGML
FT                   GLSHPPIEKGLSPATSEWALGWLTVSVAVGIFHINVGYILDFFENYELHGAKEAVLESG
FT                   SWILMLNGLWIWIFSDALGGVPPEFLFTTFAADGLIPLGFSGFSFTVGWIGLGLYFLGA
FT                   GLLGTAELAELVEFAAPLSNVLSYTRLGAVLIAKASMAFAVNLLVFGVYVDDHGGWHFG
FT                   LGGMPDAAALEAAGTVSYHGHEVTEILFGGIFHTGAAGVVGGLLVLVVGHLVVLALGVT
FT                   SAGLQAVRLEYVEFFNKFFEGGGRAYNPFGYDREFTTED"
FT   gene            281153..281410
FT                   /gene="atpK"
FT                   /locus_tag="HVO_0312"
FT   CDS_pept        281153..281410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpK"
FT                   /locus_tag="HVO_0312"
FT                   /product="A-type ATP synthase subunit K"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05035"
FT                   /db_xref="GOA:D4GZU1"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZU1"
FT                   /protein_id="ADE05035.1"
FT                   /translation="MIEAIEPLMTALQSEAASSPAITADAAAALSVGIAAFAAGYAERG
FT                   IGSAAMGAIAEDDDLFVNGLVLTVLPETLVILALVVVFAA"
FT   gene            281432..282016
FT                   /gene="atpE"
FT                   /locus_tag="HVO_0313"
FT   CDS_pept        281432..282016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="HVO_0313"
FT                   /product="A-type ATP synthase subunit E"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04461"
FT                   /db_xref="GOA:Q48329"
FT                   /db_xref="InterPro:IPR002842"
FT                   /db_xref="InterPro:IPR038495"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48329"
FT                   /protein_id="ADE04461.1"
FT                   /translation="MSLDNVVEDIRDEARARAEDIRQDGQEQADEIVAEAEADAEELLE
FT                   SRKADVEQQLEREREQALSSAKLEAKQARLSARRDVLQRVREQVERELAELEGDRREEL
FT                   TRSLLDAAAVEFEDADEVSVYGRADDEELLSSILEDYDGYEFAGERDCLGGVVVEGSNS
FT                   RVRVNNTFDSVLDTVWEDNLKEVSARLFDDQ"
FT   gene            282013..283059
FT                   /gene="atpC"
FT                   /locus_tag="HVO_0314"
FT   CDS_pept        282013..283059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /locus_tag="HVO_0314"
FT                   /product="A-type ATP synthase subunit C"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03564"
FT                   /db_xref="GOA:Q48330"
FT                   /db_xref="InterPro:IPR002843"
FT                   /db_xref="InterPro:IPR014272"
FT                   /db_xref="InterPro:IPR035067"
FT                   /db_xref="InterPro:IPR036079"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48330"
FT                   /protein_id="ADE03564.1"
FT                   /translation="MSTTGGSNPEYVIARVRARRSALFGDEEYRKLVRMGPAEIARFME
FT                   ESEYEAEVNALGSRFSGVDLIEYALNQNLAKQFNDILDWADGRLYDLIARYLRKFDAWN
FT                   VKTVIRGLYSGASREEVESDLIRAGEFDDRLISRLLDAGEIEEVVSVLSGTIFGDGLAA
FT                   AYEEYEEVGVLVPLENAVDRAFYEQLLDDLVVGEEAKQYREFLEAEIDFRNARNALRIA
FT                   RSGADLDPVDYFIEGGTLFRATELASLATSPDELVSKIRDSRYGDRLSAALSDLEAADS
FT                   LIGFERALDAALLEYADTLGYVFPLSVTPIVSYILAKEREVDNIRAIARGREAGLDPDA
FT                   IEAELVIL"
FT   gene            283056..283376
FT                   /gene="atpF"
FT                   /locus_tag="HVO_0315"
FT   CDS_pept        283056..283376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /locus_tag="HVO_0315"
FT                   /product="A-type ATP synthase subunit F"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02550"
FT                   /db_xref="GOA:Q48331"
FT                   /db_xref="InterPro:IPR008218"
FT                   /db_xref="InterPro:IPR022944"
FT                   /db_xref="InterPro:IPR036906"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48331"
FT                   /protein_id="ADE02550.1"
FT                   /translation="MSQEIAVIGSPDFTTGFRLAGVRKFENVPDEAKDDELDEAVTRTL
FT                   EDEDVGIIVMHEDDLDHLSRNARQSVERSIEPTLVTLGGSGGASGLRDQIKRAIGIDLM
FT                   DE"
FT   gene            283383..285143
FT                   /gene="atpA"
FT                   /locus_tag="HVO_0316"
FT   CDS_pept        283383..285143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="HVO_0316"
FT                   /product="A-type ATP synthase subunit A"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04665"
FT                   /db_xref="GOA:Q48332"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005726"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022878"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031686"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48332"
FT                   /protein_id="ADE04665.1"
FT                   /translation="MSQATQDSVREDGVIASVSGPVVTARGLDARMNDVVYVGDEGLMG
FT                   EVIEIEGDLTTIQVYEETSGVGPGEPVESTGEPLTVDLGPGMMDAIYDGVQRPLDVLES
FT                   KMDSAFLDRGVDAPGIDLDEKWEFEPTVSEGDEVAPGDVVGTVPETVTIEHKVMVPPDF
FT                   GGGEVVAVEEGEFSVTEAVVELDSGEEITMHQEWPVRQARPAAEKKTPREPLVSGQRIL
FT                   DGLFPIAKGGTAAIPGPFGSGKTVTQHQLAKWADADIVVYVGCGERGNEMTEVIEDFPE
FT                   LDDPKTGNPLMARTCLIANTSNMPVAARESCIYTGITIAEYYRDMGYDVALMADSTSRW
FT                   AEAMREISSRLEEMPGEEGYPAYLAARLSEFYERAGYFTTVNGEEGSVSVIGAVSPPGG
FT                   DFSEPVTQNTLRIVKTFWALDADLAERRHFPAINWNESYSLYQEQLDPWFVENVEDDWA
FT                   EERQWAVDVLDEENELQEIVQLVGKDALPEDQQLTLEIARYLREAYLQQNAFHPTDTYC
FT                   SPEKTYGILTAIHAFNDEAFKALEAGVPVEEIQAIEAAPRLNRIGVQEDWEAYIEDLKA
FT                   EITEQLRELY"
FT   gene            285148..286554
FT                   /gene="atpB"
FT                   /locus_tag="HVO_0317"
FT   CDS_pept        285148..286554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="HVO_0317"
FT                   /product="A-type ATP synthase subunit B"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03880"
FT                   /db_xref="GOA:Q48333"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005724"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48333"
FT                   /protein_id="ADE03880.1"
FT                   /translation="MKEYQTITEISGPLVFAEVDEPIGYDEIVEIETPQGETKRGQVLE
FT                   SSEGLVAIQVFEGTSGIDRNASVRFLGETLKMPVTEDLLGRVLDGSGQPIDGGPEIVPD
FT                   ERRDIVGAAINPYSREYPEEFIQTGVSAIDGMNTLVRGQKLPIFSASGLPHNDLALQIA
FT                   RQATVPEDEESGEESEFAVVFGAMGITQEEANEFMEDFERTGALERSVVFTNLADDPAV
FT                   ERTVTPRLALTTAEYLAFDKDYHVLVILTDMTNYCEALREIGAAREEVPGRRGYPGYMY
FT                   TDLAQLYERAGRIQGRDGSVTQIPILTMPGDDDTHPIPDLTGYITEGQIYIDRDLNSQG
FT                   IRPPINPLPSLSRLMDDGIGEGLTREDHADVSDQMYAAYAEGEDLRDLVNIVGREALSE
FT                   RDNKYLDFAERFEAEFVNQGFDTDRSIEDTLDIGWDLLSTLPKSELNRIDEELIEDYYE
FT                   DDAESVEAEA"
FT   gene            286684..288660
FT                   /locus_tag="HVO_0318"
FT   CDS_pept        286684..288660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0318"
FT                   /product="receiver/sensor/bat box HTH-10 family
FT                   transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05145"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR007050"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR031803"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZU7"
FT                   /protein_id="ADE05145.1"
FT                   /translation="MDATSSPTRVLAVVGPAVDRERLVDVLSPLSVSVAPSVDAAGRRA
FT                   EAESVDCVVLGTDRLAHVNAVHGALAVPLVVVVPPDGDLSAATARDAGAADVVPVVDSN
FT                   LFERLPERVESAVAWRRRGAAAASKITEDLKEQAIDEAPVGITVADCSLPDRPLVYVNE
FT                   AFETMTGYSADAALGRNCRYLQGPNTDPERVAELRRAIEAEESASVELLNYRANGETFW
FT                   NRVDVAPLSGSDGEVTHYVGFQTDITERVRAEAAAERYAARVDEERARLQTLVEHIEGL
FT                   LADVTSALVRAESRQELEAAVCDRVTAAGSFDCAWVGHCDLSPAVIVPNERAGTDTEFL
FT                   DGLEISRSNPDDPTARAAETRTVQSADVGDGSVSAETLVPFGSVIAVPLVHSGTLYGVL
FT                   TVYTDVAELDDQVRVVFGTLGRAVGAAIDAFESRRSLLSDERLELELEVRDETQPLVRL
FT                   AVAGDCELSYRGSAQHDDGTVSLFVSTHPATEFGEADTDLDGLRSVDVLPRGDDAELYE
FT                   LTFDDGSLLHLVADAGGRLVDLEVDRLGCRLTVIISDRVAGRALLDDLQTVAANAELRS
FT                   VTNRSEPPEARREFVASVTDDFTDRQQSALQLAYLGGYFEWPHAVTGEELAETTGVSRA
FT                   TFHQHLHAAERKLISRFFDSNPY"
FT   gene            288859..289566
FT                   /gene="atpD1"
FT                   /locus_tag="HVO_0319"
FT   CDS_pept        288859..289566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD1"
FT                   /locus_tag="HVO_0319"
FT                   /product="A-type ATP synthase subunit D"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03808"
FT                   /db_xref="GOA:D4GZU8"
FT                   /db_xref="InterPro:IPR002699"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZU8"
FT                   /protein_id="ADE03808.1"
FT                   /translation="MAEDVKPTRKNLMAIEDRIELSERGHDTLEQKRDGLIMEFMDILD
FT                   QAQDVRANLNQDYERAQNKINMARAMEGDVAVRGAASALKEYPEITTQSKNIMGVVVPQ
FT                   IESSRVKKSLDQRGYGLLGSSARIDEAADAYEELLESIILAAEVETAMKKMLEEIETTK
FT                   RRVNALEFKLLPELYENQEYIEQKLEEQEREEIFRLKKIKAKKEEEEKEERAAEKAAAE
FT                   ADADADAEAATAD"
FT   gene            289648..290031
FT                   /locus_tag="HVO_0320"
FT   CDS_pept        289648..290031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0320"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03029"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZU9"
FT                   /protein_id="ADE03029.1"
FT                   /translation="MSCPDCDGDLAVFAVPEPLESHAPEAALTVGLCADCLRLHSTEAP
FT                   PSDGASRPLAGALPDGDAGAAVALLVGMLDSLALNRAGIVDCVEFAERSGTDVHLTLDR
FT                   LQQTATAPHFDVARRQRQLDAFL"
FT   gene            complement(290089..291333)
FT                   /gene="arf1"
FT                   /locus_tag="HVO_0321"
FT   CDS_pept        complement(290089..291333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arf1"
FT                   /locus_tag="HVO_0321"
FT                   /product="peptide chain release factor aRF-1"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02901"
FT                   /db_xref="GOA:D4GZV0"
FT                   /db_xref="InterPro:IPR004403"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005141"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="InterPro:IPR020918"
FT                   /db_xref="InterPro:IPR024049"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR042226"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZV0"
FT                   /protein_id="ADE02901.1"
FT                   /translation="MSSDAEEASEDRRKYEFKKVIEDLREYEGSGTQLVTIYIPEDKQI
FT                   SDVVEHVITEHSEASNIKSKQTRTNVQDALTSIKDRLRYYGNFPPDNGIVMFSGAVDAG
FT                   GGQTTMVTKVLESPPEPIQSFRYHCDSNFLTGPLEDMLMDKGLFGLIVLDRREANVGWL
FT                   KGKRVEPVKSASSLVPGKQRKGGQSAQRFARLRLEAIDNFYQEVAGMANDLFVPKRHDM
FT                   DGILVGGPSPTKDEFLDGDYLHHELQDLVVGKFDVAYTDESGLYDLVDAGQDALADQEV
FT                   IKDKKQMEEFFEKLHRGNESTYGFEATRKNLVMGSVDRLLISEDLRKDIAVYDCGGQEE
FT                   YELVDHRHDTPTHECDDGSEAELKDREDVIEWLMDLADQRGTETKFISTDFEKGEQLYD
FT                   AFGGIAGILRYSTGV"
FT   gene            291490..293214
FT                   /gene="minD4"
FT                   /locus_tag="HVO_0322"
FT   CDS_pept        291490..293214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minD4"
FT                   /locus_tag="HVO_0322"
FT                   /product="MinD/ParA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04990"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR010224"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZV1"
FT                   /protein_id="ADE04990.1"
FT                   /translation="MARVYAVASAKGGVGKTTSTANLGTTLAMAGHDVVVVDGDLGMPN
FT                   LAGALGVDPDGATLHDVLTGEAAVETAVYDGPAGLSVLPGSNALEAFATANAKELEPVI
FT                   STLEASYDIVIIDTGAGLSDDTFVPLKLADEVILVSTTEREALGDTEKTRQLADRIGAD
FT                   VVGVVLTRVDQSKPNADVVASLLDTGVIAVVPESPAIREALSTRDPVVVHSPDSIATAG
FT                   YRALAEALTGTPVPVPGLDDETDEADATPEPADAADPEPNPEPAPDSDFVEDSGDGVDD
FT                   GAGPAATPDLDSGSDSVADPDAAAVADEDRATADPELESEAEPNVEAEPEGESTVETEP
FT                   EAEPNAETEPEPAVDSDTDDDLAALIPFSASTAEEPDDPAEPDPTDGADASESAADPAV
FT                   DSAVDPGDDAPADPLAADASDDPVLADSDPVGDEETDTDPLAADLDAVTRGTPAADEET
FT                   VAVADDEVVSDVDADTDSADADPLAEDTAADESRSASSASVEGADAPGADEPLVAEAEP
FT                   DAAEAESDATEADPDADDSPEDDEEGVYTTSLVEEVESFDDDERDEKKKGFLSRFLG"
FT   gene            293254..293391
FT                   /locus_tag="HVO_0323"
FT   CDS_pept        293254..293391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0323"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04178"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZV2"
FT                   /protein_id="ADE04178.1"
FT                   /translation="MAESESVPFWWIVLFLVLALGSGAAVVFSVGGSLISGAVALPLFF
FT                   "
FT   gene            complement(293437..295200)
FT                   /gene="argS"
FT                   /locus_tag="HVO_0324"
FT   CDS_pept        complement(293437..295200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="HVO_0324"
FT                   /product="arginine--tRNA ligase"
FT                   /EC_number="6.1.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04201"
FT                   /db_xref="GOA:D4GZV3"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZV3"
FT                   /protein_id="ADE04201.1"
FT                   /translation="MFRQFREEVETALSAALSSLDLPTDDLGVEEPPEDVPATLASSVA
FT                   FRLAGVVGAPPPKIAADIAEELSVEGYDYLAAVDTQGPYVNFHVSDAYYDDTLDAAASD
FT                   EAYGRLPATGDSVVVEHTSANPTGPVHVGRTRNPVIGDAVANLLDFAGNDVDRHYYVND
FT                   AGRQMAVFTWAYETFDEDDLESEPARERVEYDLVRYYRKGNAFLEEADPEEVERAEAEI
FT                   TEILQGIEEGDEETYARVETVVDQVLGGMRECLERLPAEFDEFVKETRFMFDGSTRDLA
FT                   ERLKETDHAVYEEDAWQLELDDYGFEKNLVFLRSDDTSLYTTRDLAHHEWKFDNYDRAV
FT                   TVLGEDHKLQSGQLRAALDILGNDVDKLENVIYSWVNLPGGETMSTRKGTGVMLDDLLD
FT                   EAIDRARDEVETRLEGRTRDDDLDEADIDRIARQVGIGAVRYDIVSKQPTKTITFEWDQ
FT                   ALNFEAQSAPYIQYVHARCCGIADEAATAGLDASEADPAVLTTDAERDLLATIARFPAV
FT                   VETAADDLEPHTVATFARELAEVFNTFYRECPVLDADEEVGAARLALVEASRNAVANAL
FT                   AIVGVEAPESM"
FT   gene            295413..295565
FT                   /locus_tag="HVO_0325"
FT   CDS_pept        295413..295565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0325"
FT                   /product="small CPxCG-related zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02594"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZV4"
FT                   /protein_id="ADE02594.1"
FT                   /translation="MSQCNHCDAFVSNNFVRVFGDEDGNVYACPSCSANAGISQVSSER
FT                   RASSL"
FT   gene            296025..296738
FT                   /gene="ribK"
FT                   /locus_tag="HVO_0326"
FT   CDS_pept        296025..296738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribK"
FT                   /locus_tag="HVO_0326"
FT                   /product="riboflavin kinase, CTP-dependent"
FT                   /EC_number="2.7.1.161"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04702"
FT                   /db_xref="GOA:D4GZV5"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023470"
FT                   /db_xref="InterPro:IPR023602"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039063"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZV5"
FT                   /protein_id="ADE04702.1"
FT                   /translation="MSESAVAAAVGYDELATLKLVALDGGRSGPVKLSCSGVANRLDVS
FT                   NQTASRRLQRLEEADFIDREVVSDGQWITITDAGESALRQEYADYRRIFETPSVVVLEG
FT                   QVTGGMGEGRHYISLSGYMKQFKDRLGYEPFPGTLNVRLDDDAVRARAGMTALDAVPID
FT                   GWEDDERTFGPATCYAASVTVGGDSYEPVHIIVPERTHHDESQLEIIAPDKLRDELDLD
FT                   DGDAVTVRVEEAEYE"
FT   gene            296735..297424
FT                   /gene="ribB"
FT                   /locus_tag="HVO_0327"
FT   CDS_pept        296735..297424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribB"
FT                   /locus_tag="HVO_0327"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /EC_number="4.1.99.12"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03822"
FT                   /db_xref="GOA:D4GZV6"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZV6"
FT                   /protein_id="ADE03822.1"
FT                   /translation="MSRTAESTGDFDAVSRVLDAFRAGEPVLVHDFDDREGETDLVYPA
FT                   GAVGSADVARMRNDAGGLVCVALPNDVSESLGLPFMDDVLDHPAASSHDLAYDSRSSFS
FT                   FTVNHRDSFTGITDRDRAMTISRLAPVAEAARAGEYDADDFGGEFRAPGHVHLLRGAPN
FT                   LLSDRQGHTELGLALADEAGISPAVVVCEMLDDETGAALPKDAARDYADRHGFAFVDGD
FT                   GLIDELV"
FT   gene            complement(297455..298345)
FT                   /locus_tag="HVO_0328"
FT   CDS_pept        complement(297455..298345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0328"
FT                   /product="GalE family epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03310"
FT                   /db_xref="GOA:D4GZV7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZV7"
FT                   /protein_id="ADE03310.1"
FT                   /translation="MSLESVAVTGGTGNLGPTVVAHLRASGYTVTNLSRHSESSLADHD
FT                   YRVSALDPGDLTAALSDVDADAVVHLGTISTPTNDPGHRVFESNVQSTYVVLEVAAALG
FT                   IDRVVVASSMSAIGGSFEPDPARIDFLPVDESHRATPSNPYGLGKYVAEQTAAGFVRRA
FT                   DAPETVASLRFPWMPSEEEGRQTFAEADRSLSGLRDAGHFHTARNTLFSYLGREDAARL
FT                   VRRALEADFAGHEVFWAAAADTSTTVESATLASEVYPDAETRESLSGHEALVSTEKAKR
FT                   LLGWEPTWSWRDGRA"
FT   gene            298435..299373
FT                   /gene="ilvE"
FT                   /locus_tag="HVO_0329"
FT   CDS_pept        298435..299373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /locus_tag="HVO_0329"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /EC_number="2.6.1.42"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03987"
FT                   /db_xref="GOA:D4GZV8"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZV8"
FT                   /protein_id="ADE03987.1"
FT                   /translation="MGFDEMDVSTIWQSGEYKDWEDATVHVLTHGLHYGTGVFEGVRAY
FT                   DTDRGPAIFRWEEHLERLYQSAKPYDMEIPYTREELTEATLEVIRRNDLDGGYIRPIAF
FT                   YGYDSLGVSPKDNPTEVAIAAWPWGTYLGEDALENGVDVMVSSWRKHASSQIPTNAKTT
FT                   GLYVNSMLAGEEARRNGYVEAIVLNKEGNVAEGPGENIFMVRDGKIYTPGLSQSILDGI
FT                   TRDTVITLARERGYEVDDSATISRGELNTADELFFTGSAAEVTPIRKVDNVVIGEGTRG
FT                   PVTEELQSAFFDLVERRTDDHEEWFTYVDEQ"
FT   gene            complement(299452..300096)
FT                   /locus_tag="HVO_0330"
FT   CDS_pept        complement(299452..300096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0330"
FT                   /product="DUF502 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05088"
FT                   /db_xref="InterPro:IPR007462"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZV9"
FT                   /protein_id="ADE05088.1"
FT                   /translation="MSSWRRDFASGLVVLVPLIVILYILAFFYNGITSIPYVATVLSTD
FT                   GTVTPLSEALGFIISIIIFLLLVLSVGYLMRTTAGRLLESGLDAAMNKVPLVRIVYNAS
FT                   KLAVETALTGTEDLQKPVRLETWPGIRMTAFKTGKTTKDGKVIVFMPTAPNITTGFVME
FT                   VDPEDIEETGEKVEEALTRVLSAGFAEQDHVDEFNIEVTEESGDGRVPSNE"
FT   gene            complement(300176..301015)
FT                   /gene="fadM1"
FT                   /locus_tag="HVO_0331"
FT   CDS_pept        complement(300176..301015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadM1"
FT                   /locus_tag="HVO_0331"
FT                   /product="proline dehydrogenase"
FT                   /EC_number="1.5.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02795"
FT                   /db_xref="GOA:D4GZW0"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR008219"
FT                   /db_xref="InterPro:IPR015659"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZW0"
FT                   /protein_id="ADE02795.1"
FT                   /translation="MIPPIASRFVAGESAAGALDHARRMNDDGVAVILNLLGEHYAERA
FT                   PADEDAAAYVDLVEDIASTGIDACVSVKPSQIGLDAGDHVFEENYRRIAEAADEHGVFL
FT                   WCDMEDHETTDVTLDAFEELAREFDGGMGLCVQANLKRTPDDLERLADVPGKIRLVKGA
FT                   YDEPAAVAHKQKSAVNEAYKELLAYLFREYDGGIAVGSHDPEMIAYAHDLGAEYDRDYE
FT                   VQMLMGVREDAQRDLAADGVEVWQYAPYGDKWVSYFYRRVRERKENALFALRAVVGV"
FT   gene            301142..301684
FT                   /gene="carS"
FT                   /locus_tag="HVO_0332"
FT   CDS_pept        301142..301684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carS"
FT                   /locus_tag="HVO_0332"
FT                   /product="CDP-2,3-bis-(O-geranylgeranyl)-sn-glycerol
FT                   synthase"
FT                   /EC_number="2.7.7.67"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02261"
FT                   /db_xref="GOA:D4GZW1"
FT                   /db_xref="InterPro:IPR002726"
FT                   /db_xref="InterPro:IPR032690"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZW1"
FT                   /protein_id="ADE02261.1"
FT                   /translation="MVVSLVATAFWAMLPAYVPNNAAVLAGGGRPIDGGRTWGGRRVLG
FT                   DGKTWRGTAAGTLAGTLLAVVLNAAAPAASGALGVSLPTFPLAAGFGLALGAMLGDIGA
FT                   SFIKRRSGRERGAAFPGLDQLDFVVGALALAFVAAPGWFAATFSLPVLAVVLVMTPVLH
FT                   VVTNVGAYLLGLKNEPW"
FT   gene            301751..302281
FT                   /gene="pyrE2"
FT                   /locus_tag="HVO_0333"
FT   CDS_pept        301751..302281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE2"
FT                   /locus_tag="HVO_0333"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04404"
FT                   /db_xref="GOA:D4GZW2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:D4GZW2"
FT                   /protein_id="ADE04404.1"
FT                   /translation="MANAALIEALRAADAVQFGEFELSHGGTSSYYVDKYLFETDPRCL
FT                   KLIAEAFAERVADDDKLAGVALGAVPLVAATAVETNKPYVIARKKAKEYGTAKRIEGAL
FT                   DEGEEVVVLEDIATTGQSAVDAVEALREAGAVVDRVVVVVDRQEGAAELLADHDIALES
FT                   LLTAEDLLADADG"
FT   gene            302356..303069
FT                   /gene="apt2"
FT                   /locus_tag="HVO_0334"
FT   CDS_pept        302356..303069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apt2"
FT                   /locus_tag="HVO_0334"
FT                   /product="purine phosphoribosyltransferase (adenine
FT                   phosphoribosyltransferase, xanthine-guanine
FT                   phosphoribosyltransferase)"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04072"
FT                   /db_xref="GOA:D4GZW3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZW3"
FT                   /protein_id="ADE04072.1"
FT                   /translation="MNRAEKAALQLQAVSVLRMLKETRTYDELAELTGLPAGDLNRYVN
FT                   GHVLPGVERAREVVEGVGRDALADELEARVRFDDEGYVDNSGVVFDQSFLDLVAPVAAN
FT                   ALDLERPDVILTAATDGITLGAAMASYFGARLAYAKKSKETAVEDFIESRQRLASGIEL
FT                   TYYLPASAIDDGERVLVVDDLIRSGETQELLLDIALQADADIAGVFALIAVGDEGTNRA
FT                   RELTDAPVGALSSFD"
FT   gene            303256..304668
FT                   /gene="uraA3"
FT                   /locus_tag="HVO_0335"
FT   CDS_pept        303256..304668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uraA3"
FT                   /locus_tag="HVO_0335"
FT                   /product="xanthine/uracil permease family transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04626"
FT                   /db_xref="GOA:D4GZW4"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZW4"
FT                   /protein_id="ADE04626.1"
FT                   /translation="MGLSETLANYFDVHKHGSTVRTEILAGITTFLTMSYIVVVNPSLL
FT                   TDQPYIEGVDGIAIAGYTPGEVQSMLAVVTILAAAIATTVMAFYANRPFAQAPGLGLNA
FT                   FFAFTVVGALGVPWQTALAAVFIEGLIFIALTAVGAREAIIKVFPEPVKMAVGTGIGLF
FT                   LAIIGLQAMGIVVNDNSTLVTMGNLASNPIAIVSIVGLFFTFALYAANVPGSIIIGIVG
FT                   TSLLGWGLTASGVVSAEAGLVANSSAATYDITPLAGAFISGFGNVEAFSFALIVITFFF
FT                   VDFFDTAGTLVGVGQAGGFLNDDGDLPDIDKPLMADAVGTTAGAMLGTSTVTTYIESAT
FT                   GVEEGGRTGLTALVVALLFLGSLAIVPLATAIPQYASHIALVVIGVVMLRNVVDIEWDD
FT                   LTFTIPAGMTILVMPFTYSIAYGIAAGIVSYPLVKVAAGEYDDVSAGQWALAVAFVLYF
FT                   VVRTSGMLQAQV"
FT   gene            304921..306147
FT                   /locus_tag="HVO_0336"
FT   CDS_pept        304921..306147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0336"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02506"
FT                   /db_xref="GOA:D4GZW5"
FT                   /db_xref="InterPro:IPR010262"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZW5"
FT                   /protein_id="ADE02506.1"
FT                   /translation="MSVQGYTFQGNTNPKKPARVVSVGERGSLQWTYDDSVNGNAWFFD
FT                   VDPLPNGNLLVSSPRGTDTVVFELDPDTRERVWEQRFDMEDTHDVDAFGEDELLIANMR
FT                   EWNDSAGVSEDRIVVYNRTTDEITWEWYFKNHFPADTDGGYNADWSHVNDVDYIGDGRL
FT                   LLSPRNFDQAIVVDMESKDIVERLGTDDDYDVLNEQHNPDWLVSENGTPTMLVADSGNN
FT                   RVVEYAKEDGEWVRTWSVGKNTLNWPRDADRLPNGNTLIVDTLNHRVIEVTPTGEVVWE
FT                   YYATWGPYDAERVAHGDESSGPTIRDLNASGSYPITGSANITAGGDGSVGFVSRVQSTF
FT                   AGTPLEEPMSGLSTRLSHVLPWLRPVWMTPWDLFWAACAVGVGITATAGELYLMRQRLL
FT                   DAVRGLFGR"
FT   gene            306250..306504
FT                   /gene="grx1"
FT                   /locus_tag="HVO_0337"
FT   CDS_pept        306250..306504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grx1"
FT                   /locus_tag="HVO_0337"
FT                   /product="glutaredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03322"
FT                   /db_xref="GOA:D4GZW6"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZW6"
FT                   /protein_id="ADE03322.1"
FT                   /translation="MSDLILYELQGCPYCAKVKDKLSDLDLEYESRMVPSAHAEREEVE
FT                   EVSGQTGVPVLVDEEHGVEGMPESDDIVDYLEETYGSAA"
FT   gene            complement(306563..307537)
FT                   /locus_tag="HVO_0338"
FT   CDS_pept        complement(306563..307537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0338"
FT                   /product="cro/C1 family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02531"
FT                   /db_xref="GOA:D4GZW7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR020886"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZW7"
FT                   /protein_id="ADE02531.1"
FT                   /translation="MSRSALVGNVAAMLQDAGFVVSDRIAIRPKSFDLAARRGEDLLLL
FT                   KILGNIDAFDGVTGSEMRRLGSYLDATPLVVGLRTRDEDLKPGVVYFRHGVPVLNPDTA
FT                   MDLFVEEVPPLIYAAPGGLYVSLDGDVLAEERQERGWSLGQLATELGVSRRTVSKYENG
FT                   MNASIEVAIHLEELFDRPFSNPVDVLTGAEDVRDAEPTPDDPDVDPDDEHVLSVLTRAG
FT                   FTVHPTARAPFKAVSEDAGRKKETNVLTGHSPFTRSAEKRAQIMSSLGEITRTRSVYFV
FT                   EEQQKRESVDGTGIVSCEELAAIDDPDEIRDLIRERTRDPAES"
FT   gene            307680..308948
FT                   /gene="tiaS"
FT                   /locus_tag="HVO_0339"
FT   CDS_pept        307680..308948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tiaS"
FT                   /locus_tag="HVO_0339"
FT                   /product="tRNA(Ile2) 2-agmatinylcytidine synthetase TiaS"
FT                   /EC_number="6.3.4.22"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03297"
FT                   /db_xref="GOA:D4GZW8"
FT                   /db_xref="InterPro:IPR013696"
FT                   /db_xref="InterPro:IPR024913"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZW8"
FT                   /protein_id="ADE03297.1"
FT                   /translation="MTVIGLDDTDSRTLGMCTTYLATLVAEAVEARGGTVERRLLVRLN
FT                   PAVEHKTRGNAALAIHTDLPAGAAFDLAREELDRWAVLDDDRTSPGVVVAPGSPDTVST
FT                   AVADFARDAVRDFHDLDDAVALAERSGFLTEGWHGGRGRIGALAAVGAWAAFDEWTYEH
FT                   ISYREFHRCGTPREVDVDSVFDAADAAYPDAWDTVDREEGEGVCVPNAPGPILHGIRGD
FT                   DADTVREVAAAIDSEPVDRSATFRTNQGTDAHLRDGVVSDLRDGRAYRVAGTVASDPET
FT                   RRGGHVFFDLEAGDAVVAVAAFEPTKRFRNRVRALRVGDAITACGEVGDGTLKLEKFAV
FT                   RDLVRTEPATPVCPDCGRTMKSAGRNQGYRCRDCGTDAPGKVERAVDRDLEPGWYEVPP
FT                   CARRHIAKPLVRGGFDAATHPER"
FT   gene            complement(308973..309416)
FT                   /locus_tag="HVO_0340"
FT   CDS_pept        complement(308973..309416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0340"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04807"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZW9"
FT                   /protein_id="ADE04807.2"
FT                   /translation="MLDMFRSDTRAIEGLPVRLVVALVVGVASMSVMLNMLSGVQGLAT
FT                   SELDVKPTPDVVGPGEQALDFTVVDHEGNPVEGATVIVKSGTAEIDGVATAKSDDGGSA
FT                   TVNVDAELGANREDGTLVVDVKPPAGESFVDRRENTNVLVVQD"
FT   gene            309492..310541
FT                   /locus_tag="HVO_0341"
FT   CDS_pept        309492..310541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0341"
FT                   /product="DUF87 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04969"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZX0"
FT                   /protein_id="ADE04969.1"
FT                   /translation="MHTIGRKSDEEGPACRLGCYRARDGSDGATVGLDVNRPHAAVVVG
FT                   KRGSGKSHTLGVMAEGLARAAGVAPVVIDPMGVFCGLTESPIDATVHDSPRVRADALPP
FT                   SAWPELLGLDPTAPAGSLVWRLAAEEDSLVAMRGAVDDDDAAPETRRAAANHLALADSW
FT                   DVFHPEGLDPRSLCGSSPDVLDLSGLEATPASAVVRVVARGLYDARVAGSVPRIPWLLL
FT                   DEAHAFAGGLADPALRTLLTRGRAPGVGVVLATQRPSALPEVAVSQADLRVVHRLTAGP
FT                   DVSAMAAADPTYFDESLRARLPRERGCALVVDDTTETVHDVRVRPRETPDGGATPRAVS
FT                   EPGSSETIE"
FT   gene            310562..310897
FT                   /gene="crcB1"
FT                   /locus_tag="HVO_0342"
FT   CDS_pept        310562..310897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crcB1"
FT                   /locus_tag="HVO_0342"
FT                   /product="putative fluoride ion transport protein CrcB"
FT                   /note="overlaps another CDS with the same product name"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02883"
FT                   /db_xref="GOA:D4GZX1"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZX1"
FT                   /protein_id="ADE02883.1"
FT                   /translation="MDRSELALVALGGFAGATLRYAVSVAIPGAGGTLAVNVLGSFALG
FT                   TFITSVSSHRAQLFFGTGLLSSFTTYSTFAVQTASLSPVGGALNVGANYALGFAAAALG
FT                   LTFGGRR"
FT   gene            310894..311250
FT                   /gene="crcB2"
FT                   /locus_tag="HVO_0343"
FT   CDS_pept        310894..311250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crcB2"
FT                   /locus_tag="HVO_0343"
FT                   /product="putative fluoride ion transport protein CrcB"
FT                   /note="overlaps another CDS with the same product name"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03773"
FT                   /db_xref="GOA:D4GZX2"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZX2"
FT                   /protein_id="ADE03773.1"
FT                   /translation="MTPSLLSAVLVGVGGMGGAVARHTVDQRVVGKWSTVTVNVLGSVA
FT                   LGFIVTASVGDAAATLAGTGFCGAFTTFSSFAVGVAELAEAGDYDTAARYAFGTLVAAL
FT                   VGVAIGGAMGGLVG"
FT   gene            complement(311653..311725)
FT                   /locus_tag="HVO_3018"
FT   tRNA            complement(311653..311725)
FT                   /locus_tag="HVO_3018"
FT                   /product="tRNA-Asp"
FT   gene            complement(311755..311827)
FT                   /locus_tag="HVO_3019"
FT   tRNA            complement(311755..311827)
FT                   /locus_tag="HVO_3019"
FT                   /product="tRNA-Asp"
FT   gene            312095..312322
FT                   /gene="rpoH"
FT                   /locus_tag="HVO_0346"
FT   CDS_pept        312095..312322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoH"
FT                   /locus_tag="HVO_0346"
FT                   /product="DNA-directed RNA polymerase subunit H"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04484"
FT                   /db_xref="GOA:D4GZX3"
FT                   /db_xref="InterPro:IPR000783"
FT                   /db_xref="InterPro:IPR020609"
FT                   /db_xref="InterPro:IPR035913"
FT                   /db_xref="InterPro:IPR039531"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZX3"
FT                   /protein_id="ADE04484.1"
FT                   /translation="MVDVSQHKLVPEHTKLDDEAVEDVLQEYNVEKTNLPKIKLKDPAL
FT                   PEDAEPGDVIKIVRNSRTTDKAVVYRLVIE"
FT   gene            312319..313884
FT                   /gene="rpoB2"
FT                   /locus_tag="HVO_0347"
FT   CDS_pept        312319..313884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB2"
FT                   /locus_tag="HVO_0347"
FT                   /product="DNA-directed RNA polymerase subunit B''"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05023"
FT                   /db_xref="GOA:D4GZX4"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZX4"
FT                   /protein_id="ADE05023.1"
FT                   /translation="MNRQARREVSRKYFSEERLAEHHFRSFNAFLERGMMDVVEEKATI
FT                   ETDIGDKEGEEPVYVELGGVRVETPRVREADGSEELLFPQEARLRNITYSAPVFMEMSI
FT                   VRGGEEEEEVVVDTAETKVGRMPIMVGSSKCNIAELSDEDLVEIGEDPVDPGGYFIVNG
FT                   SERVLMTSEDLAPNKILAEYDTKYGDEIQVAKTFSQRRGYRALVLCERNREGLLEVSFP
FT                   SVSGSVNFVTLVRALGLESDEEIVHRVSDDPEIVKFMLENLEEAEVQTQEQAIEALGKR
FT                   VAGGQGKNYQLKRANYVIDRYLLPHLHEEGAEEEEVRMNKAYYLCRMAEACFELALQRR
FT                   DSDDKDHYANKRLKVSGDLMKDLFRTALNKLARDVKYQLERANMRNRNLTVNTVVRSDV
FT                   LTERLEHPIATGNWVGGRSGVSQLVDRTDYMGVLSHLRRLRSPLSRSQPHFEARDLHAT
FT                   QWGRICPSETPEGPNCGLVKNFAQAMELSQNVEDEQSLKRELASMGVEGIPGIDSVDAA
FT                   PADD"
FT   gene            313886..315715
FT                   /gene="rpoB1"
FT                   /locus_tag="HVO_0348"
FT   CDS_pept        313886..315715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB1"
FT                   /locus_tag="HVO_0348"
FT                   /product="DNA-directed RNA polymerase subunit B'"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02778"
FT                   /db_xref="GOA:D4GZX5"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007646"
FT                   /db_xref="InterPro:IPR007647"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019969"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZX5"
FT                   /protein_id="ADE02778.1"
FT                   /translation="MAQAQREAKVYVNGSLVGTHPDPNQLAAQIREARRRGDVSQMVNV
FT                   SVKERTREVIINADAGRARRPLIVVEDGEPLLDDDHVEALDNDELDFDDLVERGLVEFI
FT                   DAEEEEDIYVAVDEDELNEDHTHLEIDPQLIFGIGAGMIPYPEHNASPRITMGAGMMKQ
FT                   SLGLPAANYRIRPDTRQHLMHYPQLSMVKTQTTEQIGFDERPAAQNFVVAVMSYEGFNI
FT                   EDALVMNKGSVERALARSHFFRTYEGEERRYPGGQEDRFEIPSQDVRGARGEDAYSHLD
FT                   EDGLVNPETVVDENSVLLGKTSPPRFLEEPDDMAGLSPQKRRETSVTMRSGESGVVDTV
FT                   TLMEGEDGSKLAKVSVRDQRVPELGDKFASRHGQKGVVGHLAPQEDMPFTADGVVPDLV
FT                   LNPHALPSRMTVGHVLEMLGGKVGALEGRRVDGTAFQGENEEELRSALEERGFMSSGKE
FT                   VMYSGVTGEKIEAEIFVGIIFYHKLYHMVSNKLHARSRGPVQVLTRQPTEGRAREGGLR
FT                   LGEMERDTVIGHGAAMVLQERLLDSSDKEKVYISADTGMVAVEDRDQRRIYDPVTGDED
FT                   NIHEIEISYAFKLLLDEMVALGVRPRIELKDAV"
FT   gene            315722..318652
FT                   /gene="rpoA1"
FT                   /locus_tag="HVO_0349"
FT   CDS_pept        315722..318652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA1"
FT                   /locus_tag="HVO_0349"
FT                   /product="DNA-directed RNA polymerase subunit A'"
FT                   /EC_number="2.7.7.6"
FT                   /note="overlaps another CDS with the same product name"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03457"
FT                   /db_xref="GOA:D4GZX6"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012758"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZX6"
FT                   /protein_id="ADE03457.1"
FT                   /translation="MSMQTPKEIGSIQFGLMDPETYRDMSATKVITADTYDDDGYPIDM
FT                   GLMDPRLGVIDPGLQCRTCGQHSGSCNGHFGHIELAAPVIHVGFTKLIRRLLRSTCREC
FT                   GRLSLTDEEADEYRDKLGRTKELGDDWSDVMKSAVRQARKANRCPHCGSPQHDIKHEKP
FT                   TTYYEVQNVLAGDYSERIAEAMQPDPDDEDDEGVDPVTLANETGLDAERVNQVLAGEFR
FT                   PVGDDRKALEKALDLDLTEEDMNKLMPSDIRDWFEDVPDEDLVTLGIDPDRSRPEWMIL
FT                   TVLPVPPVTARPSITLDNGQRSEDDLTHKLVDIIRINQRFMENREAGAPQLIIEDLWEL
FT                   LQYHVTTFIDNEISGTPPARHRSGRPLKTLSQRLKGKEGRFRGSLSGKRVNFSARTVIS
FT                   PDPTLSLNEVGVPDRVASEMTQTMNVTERNVDEARQYVRNGPESHPGANYVRRPDGRRL
FT                   KVTEKNCEELAEKVELGWEVNRHLVDGDIVIFNRQPSLHRMSIMAHEVVVMPYKTFRLN
FT                   TVVCPPYNADFDGDEMNMHALQNEEARAEARVLMRVQEQILSPRFGENIIGAIQDHISG
FT                   TYLLTHDNPEFVETQALDLLRATRVDTLPEPAGENEGGQPYWTGQQIFSELLPDDLNME
FT                   FTSKVGDTVSIEDGQLVQGTIDEDAVGAFGGEIVDALAKDYSKTRSRIFINEIASLAMR
FT                   AIMHFGLSIGIDDESIPDEATAQVDEAIDAAYDKIQELIEIYEAGELESLPGRSVDETL
FT                   EMKIMQRLGKARDSAGEIAEDHFEEDNPAVVMSKSGARASMLNLTQMAGCVGQQAVRGE
FT                   RINRGYEGRTLSHYQKGDLSAEAHGFVENSYRAGLTPREFFFHAMGGREGLVDTAVRTS
FT                   KSGYLQRRLINALSELEAQYDGSVRDTSGTIVQFEFGEDGTSPVKVSSDDETPIDVENI
FT                   ADRILTSEFSSDEEKERFLGERAPPTNLSEHAEPRVDARAGVESDD"
FT   gene            318645..319904
FT                   /gene="rpoA2"
FT                   /locus_tag="HVO_0350"
FT   CDS_pept        318645..319904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA2"
FT                   /locus_tag="HVO_0350"
FT                   /product="DNA-directed RNA polymerase subunit A''"
FT                   /EC_number="2.7.7.6"
FT                   /note="overlaps another CDS with the same product name"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02867"
FT                   /db_xref="GOA:D4GZX7"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR012757"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZX7"
FT                   /protein_id="ADE02867.1"
FT                   /translation="MTDTDATADYEFVDDAIVDVVESKELSRRLKDRIYQTIEEREGVT
FT                   LDQAGEIAQAVEARYLDTRVDPLDPVGTVSAQSIGEPGTQMTMNTFHYAGVAEIDVTQG
FT                   LPRLIELVDARKTPDTPMMTVYLEDEYANNRELAHQVVWNIESTKILALGDISTNVADM
FT                   VVQVNLNDETLLERWPTYDDEGVVASEIAETIEDALGIKTRREGTLIEFGPESPSYRRL
FT                   LQLVEELRDIVFKGIEEVSRVVIRKENNEDTDEEEFVLYTEGSAFGDALAIEGVDASRT
FT                   TSNNIHEVHKQLGIEAAREAIIDETMNTLREQGLDDVNIRHLMLVADIMTNDGTIESIG
FT                   RHGISGSKDSVLARAAFEVTVNHLLDAAIHGEEDDLDGVIENVIVGKPIAIGTGDVDLR
FT                   MGSLDVEDADANAAPEPSDD"
FT   gene            319907..320326
FT                   /gene="nusA"
FT                   /locus_tag="HVO_0351"
FT   CDS_pept        319907..320326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="HVO_0351"
FT                   /product="transcription elongation factor NusA"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04965"
FT                   /db_xref="GOA:D4GZX8"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010212"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZX8"
FT                   /protein_id="ADE04965.1"
FT                   /translation="MKVTLSDTARRFIALFEEETEATAHDCLVFDDRVVFLVAAGDMAT
FT                   AIGPGGRTVQSVERQLGRTVELVEDADTPEAFVASALAPAAVRHVTLSRQNDTVAYVEV
FT                   AEADRGVAIGASGKTIDTARELARRHYDIDDIQLT"
FT   gene            320381..321157
FT                   /gene="mscS6"
FT                   /locus_tag="HVO_0352"
FT   CDS_pept        320381..321157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscS6"
FT                   /locus_tag="HVO_0352"
FT                   /product="mechanosensitive channel protein MscS"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05001"
FT                   /db_xref="GOA:D4GZX9"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZX9"
FT                   /protein_id="ADE05001.1"
FT                   /translation="MSSIRPSVGVAAGQLDPTQFADYEELASATAGFAVAAVVVYLVGR
FT                   LLLVPGVTRLVSARNRNNPTLQSATETYAHAVVIGALISGLFLVADPDFNVGDWISWPG
FT                   GEGVVEAVDFRVTRVRTVNNETISVPNTELTTNALTRPYGRERYRLTERVDIAYADDAE
FT                   LALRELVETAREDDRVLDDPEPTARIVEFAGSSVGLQTEFWVGSPMDANLVDVRSQYRR
FT                   RVKRRFDEEGLTLGPASGREVSGRLDVDLVGGRDGE"
FT   gene            321385..321813
FT                   /gene="rps12"
FT                   /locus_tag="HVO_0353"
FT   CDS_pept        321385..321813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps12"
FT                   /locus_tag="HVO_0353"
FT                   /product="30S ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04190"
FT                   /db_xref="GOA:D4GZY0"
FT                   /db_xref="InterPro:IPR005680"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022863"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZY0"
FT                   /protein_id="ADE04190.1"
FT                   /translation="MANGKYAARKLKQDRQKRRWSDSEYARRERGLGKKSDPLEGAPQG
FT                   RGIVLEKVGIEAKQPNSAIRKCVRVQLIKNGKQVTAFCPGDGAISFIDEHDEVTIAGIG
FT                   GAKGRAMGDLSGVNYKVEKVNGVSMIELVRGNAEKPVR"
FT   gene            321816..322430
FT                   /gene="rps7"
FT                   /locus_tag="HVO_0354"
FT   CDS_pept        321816..322430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps7"
FT                   /locus_tag="HVO_0354"
FT                   /product="30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03303"
FT                   /db_xref="GOA:D4GZY1"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005716"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR026018"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZY1"
FT                   /protein_id="ADE03303.1"
FT                   /translation="MSESDAPEPESPASSEEAKENALLFGVWDVSEMEYTDPSMSRYIK
FT                   ATPIAHTMGRHASKQFQKSEISIVERLINRLMQTEDNTGHKQKTSKIVKDAFEIVNERT
FT                   EENPVQVLIRAVENAGPREETVRLKYGGISVPQAVDVAPQRRVDEALKFIAQGTLSGSY
FT                   KTTTTAAEALAQQLIGAADYDVQTYAISQKEEKERVAEAAR"
FT   gene            complement(322539..323294)
FT                   /locus_tag="HVO_0355"
FT   CDS_pept        complement(322539..323294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0355"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02460"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZY2"
FT                   /protein_id="ADE02460.1"
FT                   /translation="MDLRVVGGAPADPFLSAADLFETEFELSYPVFVRVRDDPDSRTWA
FT                   GHYQDHHVLNISRQAATSAMARELALHELSHMARNEEGHVSHYQSTREAVFLALAGRTV
FT                   ERRKLAHCYQIANHCKDIYADDLTLSVAPADKLVQFLESQLAAALADRPQASGRPGSRL
FT                   VTAGSDPEITAVNAGFALALVERHDLVESDHRLYDLAHAAGDDAPSVSLETFKEHFRTL
FT                   ADDPSKSEYRRTLVDVVKRYVVNPRMAAD"
FT   gene            323485..325668
FT                   /gene="tef2"
FT                   /locus_tag="HVO_0356"
FT   CDS_pept        323485..325668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tef2"
FT                   /locus_tag="HVO_0356"
FT                   /product="translation elongation factor aEF-2"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02495"
FT                   /db_xref="GOA:D4GZY3"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004543"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZY3"
FT                   /protein_id="ADE02495.1"
FT                   /translation="MGRRKKIVQECEKLMDKPEQIRNIAIAAHVDHGKTTLSDNLLAGA
FT                   GMISDETAGQQLAMDTKEDEQERGITIDAANVSMTHEWEGENHLINLIDTPGHVDFGGD
FT                   VTRAMRAVDGALVVVDAVEGAMPQTETVLRQALREGVKPALFINKVDRLINELQEGPEE
FT                   MQKRLVDVISDVNELIRGMTEEKDYDWTVSVEDGTVAFGSALYKWGVSMPSMEETGISF
FT                   GDIMELERGGDRQELHERTPLSDVVLDMVAEHFPNPLDAQPRRIPTVWRGDSESDLARQ
FT                   MREVDDDGEVVFMATDISMDPHAGEIATGRLFSGTIRKGQELYVSGTAGKNRVQSVGVF
FT                   MGGEREELDRGVPAGNIAAVTGLRDAIAGSTVSSVEMTPFESIEHISEPVITKSVEAER
FT                   MDDLPKLIQTLQQVAKEDPTIRIEINEDTGEHLISGQGELHLEVITQRIRDNQGIPVRT
FT                   GEPIVVYREQVQGESHEVEGVSPNRHNKFYITAEPLSQDIVDSIKLGEISMDMPELERR
FT                   EALQEAGMDKDTSQNVEHIHGTNILIDDTKGIQHLNETMELVIEGLEEALDDGPLAAEP
FT                   VQGTLLRLHDARLHEDTIHRGPAQVIPATRDAVHRALIAGQVKLLEPIQNVRIDVPSEY
FT                   MGSASGEIQGRRGRVDDMYQEGDLMVIEGIAPVEEMIGFSSDVRSATEGRASWNTENAG
FT                   FRVLSDNLQREKIMEIRERKGMKLELSQAIDYI"
FT   gene            325966..326535
FT                   /locus_tag="HVO_0357"
FT   CDS_pept        325966..326535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0357"
FT                   /product="ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04787"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZY4"
FT                   /protein_id="ADE04787.1"
FT                   /translation="MSAQDLDGESDAEADGSGEMPKPHTIRLELVDEPGQLLAALKPIS
FT                   DNGGNLLSIFHERGSLTPRGHIPVEVDLECPPDRFARIVEALRDAGVNVIRAGAEHFGE
FT                   EVMVILVGDIVDSDLSDTLHRIESSADATLQDLSLSAREGTDEASSARLRLAVRSGRVD
FT                   ETFGVVRDIAAEKELHVVEPLAEGSQ"
FT   gene            326532..327485
FT                   /gene="hom1"
FT                   /locus_tag="HVO_0358"
FT   CDS_pept        326532..327485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hom1"
FT                   /locus_tag="HVO_0358"
FT                   /product="homoserine dehydrogenase"
FT                   /EC_number="1.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04130"
FT                   /db_xref="GOA:D4GZY5"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR022697"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZY5"
FT                   /protein_id="ADE04130.1"
FT                   /translation="MSLRLAVLGAGAVGGSVLDLAGDYGHEVVAFADSSSSVVDPDGLD
FT                   PSAVHDRKEREGVVGGADPEAVFDVDYDVLVEATPTTLGDAEPGFSHVERALADDRHVV
FT                   LANKGPVAERYADLRALEAESGGTVQFEAAVGGAIPILSTISDLGAPHVTAARGVLNGT
FT                   ANFILSRMAAEGLDYEHVLAEAQDLGVAEADPTFDVDGIDAALKFVILANVLSDGETEY
FT                   ALDDAAVEGIRNVPGTALDLAAEDGRTVRLIGEATADGVRVAPRLIPQGSALSVTGTQN
FT                   IVQLETKHAGQLNISGRGAGGPETATAVLSDVSRLE"
FT   gene            327676..328941
FT                   /gene="tef1a1"
FT                   /locus_tag="HVO_0359"
FT   CDS_pept        327676..328941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tef1a1"
FT                   /locus_tag="HVO_0359"
FT                   /product="translation elongation factor aEF-1 alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03669"
FT                   /db_xref="GOA:D4GZY6"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004539"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZY6"
FT                   /protein_id="ADE03669.1"
FT                   /translation="MSDKPHQNLAIIGHVDHGKSTLVGRLLFETGSVPEHVIEQHREEA
FT                   EEKGKGGFEFAYVMDNLAEERERGVTIDIAHQEFDTDEFYFTIVDCPGHRDFVKNMITG
FT                   ASQADNAVLVVAADDGVAPQTREHVFLARTLGIGELIIAVNKMDVVDYSEDKYKDVKEQ
FT                   VNKLLKQVRFNSDDATYVPISAFEGDNIAERSDNTSWYDGDILLEALNNLPAPQPPTDA
FT                   PLRLPIQDVYTISGIGTVPVGRIETGTLNPGDNVSFQPSDVGGEVKTVEMHHEEVDQAG
FT                   PGDNVGFNVRGVGKDDIRRGDVCGPADDPPKVAETFKAQVVVMQHPSVITAGYTPVFHA
FT                   HTAQVACTIESIDQKLDPASGEVAEENPDFIKSGDAAIVTVRPQKPLSIEPSSEIPELG
FT                   SFAVRDMGQTIAAGKVLEVNER"
FT   gene            328944..329252
FT                   /gene="rps10a"
FT                   /locus_tag="HVO_0360"
FT   CDS_pept        328944..329252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps10a"
FT                   /locus_tag="HVO_0360"
FT                   /product="30S ribosomal protein S10a"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03816"
FT                   /db_xref="GOA:D4GZY7"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR005729"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZY7"
FT                   /protein_id="ADE03816.1"
FT                   /translation="MQQARVRLAGTSPEDLDDICDDVREIANKTGVNLSGPIPLPTKTL
FT                   EVPARKSPDGEGTATWEHWEMRVHKRLIDLDADERALRQLMRVQVPNDVSIEIVLED"
FT   gene            329507..329581
FT                   /locus_tag="HVO_3020"
FT   tRNA            329507..329581
FT                   /locus_tag="HVO_3020"
FT                   /product="tRNA-Ala"
FT   gene            329856..330458
FT                   /locus_tag="HVO_0362"
FT   CDS_pept        329856..330458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0362"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03609"
FT                   /db_xref="GOA:D4GZY8"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZY8"
FT                   /protein_id="ADE03609.1"
FT                   /translation="MQYLDFKRERDEATTSWERGDPVAALVERTGPTTYLVTLPGGETH
FT                   AVEYGKERGTRVGGCDCKGFEFRDDEDSPCAHLCVLRKAEWSHNHFGDAAGRDVTDDPI
FT                   TAHDTAEHVAPNATEPEPDLVADGGEDFPRQNCRRCGAVSPDGEAPPPAECSEGTTDDP
FT                   EHEWTDAPDLVADGGDIVEAPTTGHDGRVFGRPEDQL"
FT   gene            330643..331095
FT                   /locus_tag="HVO_0364"
FT   CDS_pept        330643..331095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0364"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03857"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZY9"
FT                   /protein_id="ADE03857.2"
FT                   /translation="MSRMKTERTESTTVTVRVDEDLKEDYTSALDGSISDDIRSHMEEV
FT                   ARTVRDESDNNLPDDEILRDGYLALRRTAEAYDPNGRRIDVTTAISKVAERAGIPKDAV
FT                   RRRVLKPLIRDDYVELDWGEIIIYQPEEVNASANRASPTKGKSTSS"
FT   gene            complement(331092..331232)
FT                   /locus_tag="HVO_0363"
FT   CDS_pept        complement(331092..331232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0363"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03637"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZZ0"
FT                   /protein_id="ADE03637.1"
FT                   /translation="MDGSVTLSPLELLAVAALPLSAISGVLKAQIQRRFGQQKKTDDDS
FT                   S"
FT   gene            complement(331222..331422)
FT                   /locus_tag="HVO_0365"
FT   CDS_pept        complement(331222..331422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0365"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02532"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZZ1"
FT                   /protein_id="ADE02532.1"
FT                   /translation="MSELTDLILQTTDPVTALLLLGVAALVLWVRQDLHEDLRIIRGRV
FT                   RRVEDWAVATDGGVEEDDDGR"
FT   gene            complement(331415..331801)
FT                   /locus_tag="HVO_0366"
FT   CDS_pept        complement(331415..331801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0366"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04667"
FT                   /db_xref="GOA:D4GZZ2"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZZ2"
FT                   /protein_id="ADE04667.1"
FT                   /translation="MPDTNGTGTFGDGSNNWLGGIDDFVSDPGQAVRDPYDTVAGAADA
FT                   AALNFDEGVGGLVSLFDDEAGNTAGPGGTPWIEDPQDGQASNPTRGTGLAAKVWIVVAV
FT                   VVGLVLLYLLRPLLEIIAGVVGDE"
FT   gene            complement(331803..332225)
FT                   /locus_tag="HVO_0367"
FT   CDS_pept        complement(331803..332225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0367"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04929"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZZ3"
FT                   /protein_id="ADE04929.1"
FT                   /translation="MSGPLGLDWVDNSEEWDPSDPAVLATVREHGGDTFADRIHLLGDG
FT                   RLRQQVLMDGDPFASTYFDIDSSLASTSESDDGETSVGGGSSPGGSSSPSADTDDSTEN
FT                   APGVGWLLDGDGSRRNFIALGVAAAVAIGAVVFGGG"
FT   gene            complement(332222..332788)
FT                   /locus_tag="HVO_0368"
FT   CDS_pept        complement(332222..332788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0368"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04137"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZZ4"
FT                   /protein_id="ADE04137.1"
FT                   /translation="MIIDPDESGGGVPGGSESIPGNSDDDDDNTIDTGDYLDDDGGTGG
FT                   YGSIGDDDGLDPGNSESGMPGGGDPANDAVSPDPNENSDGDEVTVNPDGSVSIDEDRLS
FT                   GGYESVEDVVDEVRNIVGGGSSETPQVGEITALEEQLRNLRESLTGMGESTGDSSSGGL
FT                   LAAGAAGVAVVVAIGAAVLAGGDDK"
FT   gene            complement(332788..332943)
FT                   /locus_tag="HVO_0369"
FT   CDS_pept        complement(332788..332943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0369"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03683"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZZ5"
FT                   /protein_id="ADE03683.1"
FT                   /translation="MEIPDFPGPRSAEEGETYRFEFGDESEHLTVIEMTVGDDGDVTLT
FT                   TTEVDD"
FT   gene            complement(332943..333431)
FT                   /locus_tag="HVO_0370"
FT   CDS_pept        complement(332943..333431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0370"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02824"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZZ6"
FT                   /protein_id="ADE02824.1"
FT                   /translation="MPGRAPWGQSGTKGSGETLAVNNRPTIVTKSFGQTATVAAGSKQT
FT                   TNIYAPEGKVWKVIGMELEAPNPGGDGSGDHFFYVWSAGHVRMMNGGGPDDDAVYWRNS
FT                   TWSVNSAAPQDTAASLNALTNLKATESKSIRITYNGNNLTADQTGHREIKFVFEEVSY"
FT   gene            complement(333431..333871)
FT                   /locus_tag="HVO_0371"
FT   CDS_pept        complement(333431..333871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0371"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03522"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZZ7"
FT                   /protein_id="ADE03522.1"
FT                   /translation="MGILSKLTTDERRETPHIQDEVPADTTGHEVAWVAPADCTVEQLS
FT                   LWAVPGSEDALQLRPVIRRIRGDPDNPESAEDTDIPSYGGGEQFVTGEPDGDRYHVNAE
FT                   MRKGDRIVIITDNKSTDYAYRFRALPTVDYLGGIRRVIGGVF"
FT   gene            complement(333882..334388)
FT                   /locus_tag="HVO_0372"
FT   CDS_pept        complement(333882..334388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0372"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02656"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZZ8"
FT                   /protein_id="ADE02656.1"
FT                   /translation="MPGTLSYNEDLAELDGDVRPIRGSDLDQDTVKAGAEVTVYREKVP
FT                   QDKDLWFGAGGKDRESADSSPMHADIVATGNGSGTEGDTISGTLYAAITDSDGRAMFTR
FT                   KLGDLELLAEYASESPTERPLMYSLAPYATAGRHIEFRIDADSNSDGKEIDPANSDVML
FT                   YRSSL"
FT   gene            complement(334392..334589)
FT                   /locus_tag="HVO_0373"
FT   CDS_pept        complement(334392..334589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0373"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03795"
FT                   /db_xref="UniProtKB/TrEMBL:D4GZZ9"
FT                   /protein_id="ADE03795.1"
FT                   /translation="MTKVPLELLGIEVDTDDPGESAQNLGLGVIGVTLTMAVVGAGAYL
FT                   YNTARQKAGVTDDDVNIPGV"
FT   gene            334719..334901
FT                   /locus_tag="HVO_0374"
FT   CDS_pept        334719..334901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0374"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03246"
FT                   /db_xref="UniProtKB/TrEMBL:D4H000"
FT                   /protein_id="ADE03246.1"
FT                   /translation="MIGYPTLVLGTLVAYLRASDETRPFVKGAFGIGILGECGALSGAV
FT                   HFTQSGVSMLGGLIA"
FT   gene            334898..335359
FT                   /locus_tag="HVO_0375"
FT   CDS_pept        334898..335359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0375"
FT                   /product="small CPxCG-related zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05086"
FT                   /db_xref="UniProtKB/TrEMBL:D4H001"
FT                   /protein_id="ADE05086.2"
FT                   /translation="MNGSKEPQNPTDQQCEHCGLFYAAQGIHNHRPGCPLRDWDTMIQP
FT                   LDGAGEPAGERGSVPDSDPANPPESGDIEVSDTQKAMTDGGNPIHGAPEPVTDGGKDTE
FT                   EVDGCPDCGSDDYVDADAVLRARNPSAKNTAVLTQYDRVCIECGEAYDA"
FT   gene            335352..335792
FT                   /locus_tag="HVO_0376"
FT   CDS_pept        335352..335792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0376"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04406"
FT                   /db_xref="UniProtKB/TrEMBL:D4H002"
FT                   /protein_id="ADE04406.1"
FT                   /translation="MPEDGETPSPPSPGDTFVRDAGVPNMGATANHAAAEGAPAEESVG
FT                   SSSTLRDMVLSTEPKRSLDEIESPWAPERGGPKRVFRGFQKMGDIDGMPAGFDVVVGLA
FT                   ETAVLILDHVEEQNDGDQSDDAGQNDEDLDDDLAPLAGVGGA"
FT   gene            335789..336409
FT                   /locus_tag="HVO_0377"
FT   CDS_pept        335789..336409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0377"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04279"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4H003"
FT                   /protein_id="ADE04279.1"
FT                   /translation="MTMQAYHTVVTGDSGGGKTTLLREMQAEFPGLSIWVNFTNTDGIT
FT                   GRDLDDAATVRSVGEARASDATRLNWVTDSPLETARQARTVAHEYHEATGFPTQVIFDE
FT                   AQNVLPDGEVESDNPVKRMLHEDRDKGLKVVIATQDPSDLDYTPIKQCKFWVWVGEWAV
FT                   FHDGFLRYFSIPRDDLPTEPYQYVVFDKRMNVLHRAETQEAYA"
FT   gene            336406..336630
FT                   /locus_tag="HVO_0378"
FT   CDS_pept        336406..336630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0378"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03672"
FT                   /db_xref="UniProtKB/TrEMBL:D4H004"
FT                   /protein_id="ADE03672.1"
FT                   /translation="MNTHFRFGGTRVYLQPVEDDETDVVDALRTLAEWLSEDVVSWWTY
FT                   DVPPESQIQDPLTTDAKKALVISWGESRE"
FT   gene            337199..337783
FT                   /locus_tag="HVO_0379"
FT   CDS_pept        337199..337783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0379"
FT                   /product="integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02488"
FT                   /db_xref="GOA:D4H005"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D4H005"
FT                   /protein_id="ADE02488.1"
FT                   /translation="MKMQDYESKDGKKVWLSRSEVDTLLDVADGTEQRVAFALGARCGL
FT                   RVAEVVEVTPDDVVDTEVGKFLRVWEGKGSKYRETPIPTDLAATIAAVGDYRDESSDTP
FT                   VVDRTTRTVRNWVTKAGDQLVEETEDVGWSFLGPHDLRRTWGTLLVGAEVEPGLVMEWG
FT                   GWEDWETFREHYLGAYSLEAQARGMGKIEWL"
FT   gene            complement(338106..338621)
FT                   /locus_tag="HVO_0379A"
FT   CDS_pept        complement(338106..338621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0379A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0379A"
FT                   /db_xref="GOA:A0A1C9J6T2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C9J6T2"
FT                   /protein_id="AOP12808.1"
FT                   /translation="MTHNGGPQVDEGGLGNTPSGNFRVQQDELEWEDLPPEAKQQIIEM
FT                   SAAEISERLAKEEVLFHAVNPLDSGLSKVQNPDFYSEVAKSFSEQQLGVIGENIQPHDL
FT                   VTDTEEVDMTAQSSLSRVLDIALLDHPVATLYALGIVTFMLAFYLQSILIALAGAAILI
FT                   VTALHYAD"
FT   gene            complement(338611..339210)
FT                   /locus_tag="HVO_0379B"
FT   CDS_pept        complement(338611..339210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0379B"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0379B"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C9J6T3"
FT                   /protein_id="AOP12809.1"
FT                   /translation="MEYLEITGKRAGPRIRDAADIPGEFGIEYGTVPSSFAEKDAREIS
FT                   EEDLKGTDLTWEKFKPVSDFVNLASGSDIIEGLPWYYEILFEYTGDHPIEVGFNRVEQT
FT                   QHIAGGARLSSTAEYEPLEIVPGESHTYQFDLPSPSVDGIMQIEIQPSTDDVDRLRFRD
FT                   DDGSENAKHSQVLRVNENESLRQLYQLSSEGHKDDS"
FT   gene            complement(339578..339793)
FT                   /locus_tag="HVO_0380"
FT   CDS_pept        complement(339578..339793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0380"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04758"
FT                   /db_xref="UniProtKB/TrEMBL:D4H006"
FT                   /protein_id="ADE04758.2"
FT                   /translation="MSTAYDTDGSGSRNISLKVGDDFVEDFDRAIKRGQLNGELPMDMS
FT                   RSEAIRRLMKMAIEDPSLLASEEDED"
FT   gene            339904..340089
FT                   /locus_tag="HVO_0381"
FT   CDS_pept        339904..340089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0381"
FT                   /product="CopG domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04146"
FT                   /db_xref="GOA:D4H007"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:D4H007"
FT                   /protein_id="ADE04146.1"
FT                   /translation="MEVSVNVSISMPPEMLEKIDENARAHGKSRAAYVRHLIQQAPDSP
FT                   FETPELQLTDEPPAEA"
FT   gene            340199..340432
FT                   /locus_tag="HVO_0382"
FT   CDS_pept        340199..340432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0382"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03509"
FT                   /db_xref="UniProtKB/TrEMBL:D4H008"
FT                   /protein_id="ADE03509.1"
FT                   /translation="MSDDSFDVKLVVTRGTGSQDKEKMQVEVSADSLEELDEKVNGARE
FT                   RLREWADDIRTIQPDGRRRHDDAQTELGGASA"
FT   gene            340429..340620
FT                   /locus_tag="HVO_0383"
FT   CDS_pept        340429..340620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0383"
FT                   /product="HTH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02855"
FT                   /db_xref="GOA:D4H009"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D4H009"
FT                   /protein_id="ADE02855.1"
FT                   /translation="MSAQTNLGTFTAGLSPAETDAYLAVDEGDETPTEFARRTGRDPST
FT                   VRTLLYRARRKLDKRGGA"
FT   gene            340617..340787
FT                   /locus_tag="HVO_0384"
FT   CDS_pept        340617..340787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0384"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04570"
FT                   /db_xref="UniProtKB/TrEMBL:D4H010"
FT                   /protein_id="ADE04570.1"
FT                   /translation="MTDLEIIAQIGEAWDSETAREVNNNLDDDDLGIIHDISRSGAHYL
FT                   VRWPDETEGDE"
FT   gene            340784..341785
FT                   /locus_tag="HVO_0385"
FT   CDS_pept        340784..341785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0385"
FT                   /product="XerC/D-like integrase"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03940"
FT                   /db_xref="GOA:D4H011"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D4H011"
FT                   /protein_id="ADE03940.1"
FT                   /translation="MTDLEPLSPEEGVTRFLRHREPSVRDSTLQNSRTRLNHFLDWCEE
FT                   VGIENLNDLSGRDLADFVAWRRGDIAPITLQKQLSTVRAALGFWADIEGVEDGLRERVH
FT                   APELPDGAEARDVHLSADRAESILDYLDRYQYASREHVIMALLWRTGMRRGALRALDVG
FT                   DLHADDHAVELVHRPETDTALKNGTKGERWVYLGPEWFEVVDEYAATNRHDVVDDHGRR
FT                   PLITSKYGRPTGDTIYKWVGKLTRPCEYGDCPHDRERATCDAVGSDGYPSRCPSSRSPH
FT                   AVRRGHITAYLNREVSPETISERSDVSLDILYQHYDARTPREKMNVRIQNLP"
FT   gene            complement(342265..342510)
FT                   /locus_tag="HVO_0385A"
FT   CDS_pept        complement(342265..342510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0385A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0385A"
FT                   /db_xref="GOA:A0A1C9J6T5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C9J6T5"
FT                   /protein_id="AOP12810.1"
FT                   /translation="MDVPPKDFMLGRSSAWSSRSVLVIVSFPSIGFAAVVSRFLGISSP
FT                   NSIVELLYFISTYCTLLAISMFSSYFAAYQLGIGRQ"
FT   gene            342850..343224
FT                   /locus_tag="HVO_0386"
FT   CDS_pept        342850..343224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0386"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03207"
FT                   /db_xref="UniProtKB/TrEMBL:D4H012"
FT                   /protein_id="ADE03207.1"
FT                   /translation="METRRGEPPSDPTALFRAIVSKLRETRRGVHQHRMAQALLQRDAN
FT                   GSRLVGLAADTQRAVFFNPASRTLELIPFDREGTHEERAEVLSRRLSDPSSWVEANAAG
FT                   LSWVHPHFRWVCGLDDAGRS"
FT   gene            343321..343560
FT                   /locus_tag="HVO_0387"
FT   CDS_pept        343321..343560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0387"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03748"
FT                   /db_xref="UniProtKB/TrEMBL:D4H013"
FT                   /protein_id="ADE03748.1"
FT                   /translation="MNDEELDELRSSLTPYESNGGVTTYQNTVSIACPACEKPFDDLVV
FT                   CENDYNSLELSMMLDLCVTQHDGDVLLFTHKQEE"
FT   gene            complement(343699..345018)
FT                   /gene="vacB"
FT                   /locus_tag="HVO_0388"
FT   CDS_pept        complement(343699..345018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vacB"
FT                   /locus_tag="HVO_0388"
FT                   /product="homolog to ribonuclease R"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04214"
FT                   /db_xref="GOA:D4H014"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D4H014"
FT                   /protein_id="ADE04214.1"
FT                   /translation="MSDDAQAYAGTAEGQGPVEIDAELARHLQNKREELFEEFEIRDAF
FT                   PPEVLSEARARTDGVHEEIEDELEHRKDLRDLTTWTTDPVDAQDFDDALSIRENEETYT
FT                   LWVHIADVTHYVHPGSEMWAEAVKRGNTVYLPAYTIHMLPPALAETVCSLVPEEDRLAH
FT                   TVEMEIKKDTLSFESIDIYKSVIHSNERLTYTQCENRLEDPDLPLHEENALVFDLADQL
FT                   HEQRKEDGSLVLNPSRDRAHTIIEECMLKANKAVTHELMWNRGVEAMYRVHPQPTPDQW
FT                   DKALREITELDGVSIQSTSWDEPRKAVNDALESANSRTLNKIQRAVLKVMPRAKYMNDP
FT                   FGGHYALNFDIYGHFTSPIRRLSDLINHWIVHENDVPEDLVELCDRASDRQKDAETAER
FT                   LYKQFLQEVGLDPYAVNNRGIVTVDDDGEVIDENGLPPQE"
FT   gene            complement(345139..345441)
FT                   /locus_tag="HVO_0389"
FT   CDS_pept        complement(345139..345441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0389"
FT                   /product="small CPxCG-related zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04638"
FT                   /db_xref="UniProtKB/TrEMBL:D4H015"
FT                   /protein_id="ADE04638.1"
FT                   /translation="MWRSRTNRDRNRVVCIACGDAVLRSAAREYDKEGNRWERHGKRFE
FT                   HLCKSCYRGLCHQPREELEGLLGDIEERGISDEEFLLRYFDAVKERYESPGERGR"
FT   gene            345603..346082
FT                   /locus_tag="HVO_0390"
FT   CDS_pept        345603..346082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0390"
FT                   /product="PUA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02338"
FT                   /db_xref="GOA:D4H016"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR016437"
FT                   /db_xref="InterPro:IPR022430"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="UniProtKB/TrEMBL:D4H016"
FT                   /protein_id="ADE02338.1"
FT                   /translation="MKVKSRHHLRSDEIDALCDSIESSLGVALAGDAFEAVEFADADYE
FT                   VVLVDGEPAVMYVDDQPFLTVKGANQFPPTTNVVTVDAGAVSFVSSGADVMRPGITEAD
FT                   ESIEAGDLVVIAEETHGKVLAVGRALEDGADLVGDSGKVVESIHHVGDDLFEFSV"
FT   gene            complement(346125..346805)
FT                   /locus_tag="HVO_0391"
FT   CDS_pept        complement(346125..346805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0391"
FT                   /product="DUF1028 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02585"
FT                   /db_xref="InterPro:IPR010430"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D4H017"
FT                   /protein_id="ADE02585.1"
FT                   /translation="MTFSICVREPYVDADGDDQHRFGVAVTTRLPGVGALCPFATEHGA
FT                   VATQALTNVGLGGKGMDYLEDGLAVDDALQALLNADDGRAERQLHGVGSEATFAFTGDD
FT                   CLGWAGHREGDAYTVAGNLLTGEAVVDATADAYERTAGGDEPLAKRLIDALGSGHAAGG
FT                   DKRDDLAIQSAAVVVTSTEDREMEPYYNDLRVDATETPLRDLRETFSMAREGYEAALEK
FT                   YAEA"
FT   gene            347026..347382
FT                   /gene="sepF"
FT                   /locus_tag="HVO_0392"
FT   CDS_pept        347026..347382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sepF"
FT                   /locus_tag="HVO_0392"
FT                   /product="putative SepF protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03140"
FT                   /db_xref="GOA:D4H018"
FT                   /db_xref="InterPro:IPR007561"
FT                   /db_xref="InterPro:IPR012426"
FT                   /db_xref="InterPro:IPR038594"
FT                   /db_xref="UniProtKB/TrEMBL:D4H018"
FT                   /protein_id="ADE03140.1"
FT                   /translation="MGIMSKILGGGGSRTTEDYVELDLDDFDTARGDAGLSVHIAEIGG
FT                   QQDVIAIKDAVYDGNLVIADITRHTTSDSTMEHIIDDLRQVAREVDGDIVQKGDDQIVI
FT                   TPTGISISRQKLNG"
FT   gene            347502..350453
FT                   /gene="uvrA"
FT                   /locus_tag="HVO_0393"
FT   CDS_pept        347502..350453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="HVO_0393"
FT                   /product="UvrABC system protein A"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03898"
FT                   /db_xref="GOA:D4H019"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:D4H019"
FT                   /protein_id="ADE03898.1"
FT                   /translation="MSKDYIEVRGAEEHNLKNLDVRIPRETFTVVTGLSGSGKSSLAFD
FT                   TVYAEGQRRYIESLSAYARNFLGQMDKPKVEAVEGLSPAISIDQKNGANNPRSTVGTVT
FT                   ELHDYLRLLYARVGTQYDPITGAEVGEQSAQDMVDQILELPEGTRAKVVAPVVRDQKGE
FT                   FKDLFSDLVSEGYARVEVDGEEFDLSFETPDLDKNYDHTIDVVVDRVKVAPEARSRIAD
FT                   SVETALEEAGGVLKLIVPDPPADLPFASNTRSTGSLAGEGDDRLVVEFSEELGNPNSSF
FT                   RFSEIETRSFSFNSPHGACPECEGLGKAKEVDPDLVVTDPSKPLKHVFEPWSYNRTYYR
FT                   RQLDNVADHFGVSVDTPFEELSDEVQDAFLFGTSEDVVFEWTTKNGTRHKEHPFEGVVG
FT                   NLERRHVETDSDRTRDHIEEFMAVTTCPDCNGSRLKEQSRHVRVGGTTLPEVNRMTIAG
FT                   ALEHFEGLEADLSERHRTIAQEILKEIRARLGFMTEVGLEYLTLDREAATLSGGESQRI
FT                   RLATQVGSGLVGVLYVLDEPSIGLHQRDNDKLLNTLEGLRDLGNTLIVVEHDEETMRRA
FT                   DEIIDMGPGPGKRGGEVVAQGDFDDIVAADDSITADYLSGRKDIDVPESRREGDGELVV
FT                   RGARQHNLDDLDVPIPLETFTAVTGVSGSGKSTLMHEILYKGLARRMNDNTSVDPGEHD
FT                   AIEGYDDIETVRLIDQSPIGRTPRSNPATYTGVFDYVRELFAETKLSKQRGYEKGRFSF
FT                   NVKGGRCEACKGQGNVKIEMNFLSDVYVPCEECNGARYNAETLDVTYKDKTIADVLDME
FT                   VDEALDFFEANSQIRRRLQLLHDVGLGYMQLGQPSTTLSGGEAQRVKLAEELGKKQTGD
FT                   TLYLLDEPTTGLHKEDERKLIEVLQRLVDNGNTVLVVEHELDLVKNADHIVDLGPEGGA
FT                   GGGTIVASGTPEEIAANPDSHTGRYLRDYLPDVDEEGPRSDRRKPAKVTNDDD"
FT   gene            350591..351007
FT                   /locus_tag="HVO_0394"
FT   CDS_pept        350591..351007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0394"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04427"
FT                   /db_xref="UniProtKB/TrEMBL:D4H020"
FT                   /protein_id="ADE04427.2"
FT                   /translation="MSRILKTSGFLGLATMMVVGLYQYTLLESGGVPSWLVGGHAHLGV
FT                   LSILAVVMGFAVDAFALTGRLRAAVSGLFVVGQWLLPLTIWVGVGFGLTFLIPTTFLWG
FT                   VCLIVSMLIMAWQAWVSEPTTPGEMPGPASPADD"
FT   gene            351178..352194
FT                   /locus_tag="HVO_0395"
FT   CDS_pept        351178..352194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0395"
FT                   /product="WD40/YVTN domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05058"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:D4H021"
FT                   /protein_id="ADE05058.1"
FT                   /translation="MQLYAAANGAVLAVAGSPDDSTTRRRLGEHRIECVAADPRAPDRA
FT                   FCGTFDAGVFRTTDGGASWHAVGTDALPESVTSLAVSPAAPDVVYAGTEPSAVFRSRDG
FT                   GETWAELAPLSALDSASSWAFPPRPHTHHVRWIEPDPTDADRLFVAVEAGALVRSFDGG
FT                   ETWQDRVASSKRDTHSMATHLDRPGRVWVAAGDGYAETDDAGETWTTPTAGLGHGYCWS
FT                   VAIDPADPESVLLTAASGPMRAHRVESAAAYLYRRRDSPDDEGDGDESWDRLDETGLPT
FT                   GSGATRAVLAAGRTGGECYAANDRGLYRTTDFGDSWDRIEVPWDGTRRTAAGLAVVA"
FT   gene            352270..353352
FT                   /locus_tag="HVO_0396"
FT   CDS_pept        352270..353352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0396"
FT                   /product="FAD-dependent oxidoreductase (homolog to
FT                   geranylgeranyl reductase)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02798"
FT                   /db_xref="GOA:D4H022"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D4H022"
FT                   /protein_id="ADE02798.1"
FT                   /translation="MYDFAVVGVGPAGARFARRAADAGYDVLALEKGEVGTPLACSGHV
FT                   STDIWEYVPDEARDRLFQNRIYGANFRVGGPNSKAYPFYKQSEVSNVIDRVELDRTLAD
FT                   CARDAGADVREGHTVTAVEELDDRVRLTVSVAGEAGTVQFEAKMVAGCDGPTSRVRRAL
FT                   DLPEPSETLHGVLAFDPDPDDGDFVDVHLTVPRFFAWRIPRGDAGVEYGLAAPPGAEVN
FT                   EMFDALTSTYDVETEHFCSGAIPIGPPDRTTTRRAFLVGDAAAQTKPFTGGGILYGMTA
FT                   ADIAASTIDPDDPETLSAYESAWRDELSREIRLGHLVRRCYSFPEWLQRVGLRSLSGEI
FT                   GVHMDKPSSFFSREHLKKLL"
FT   gene            complement(353383..354480)
FT                   /locus_tag="HVO_0397"
FT   CDS_pept        complement(353383..354480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0397"
FT                   /product="homolog to glycine cleavage system protein T"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05028"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:D4H023"
FT                   /protein_id="ADE05028.1"
FT                   /translation="MTLVADIHEAHGATFETRGGIEVVSHYGRPGRTHRAVRNGVGVIE
FT                   HGYGVVVVEGEDRVDYVDNAVTDTVPDEDGEGVYALLLDPDGRIETEMYVYNAGERLLI
FT                   FTPRDRAEPLVEEWGSKTFLQRVKIRDASDEFGVFGVHGPQSTEKVASILSGAGAPEPE
FT                   LSFVRGSIGGELGVTVVASDNPTGEEGYDVICRAKDAEDVLDALLFYGNPSVPVGYRTW
FT                   DSLTAEAGTPLFESELRGNVPNVAGVRNALDFDKGCFVGQELVSKIENRGRPSRRLVGF
FT                   RADALPDSGAEVSADGESVGTVTRAVESPMLDAPIGFALVDYGLDTDALKVAVDGDRVE
FT                   ATRESLPFVEGSAVSARLPTYPGEN"
FT   gene            complement(354646..354945)
FT                   /locus_tag="HVO_0398"
FT   CDS_pept        complement(354646..354945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0398"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02766"
FT                   /db_xref="UniProtKB/TrEMBL:D4H024"
FT                   /protein_id="ADE02766.1"
FT                   /translation="MRARREFRNRRDIEVAVLDALVDRHDEGMTVFELRAAVDADIDTI
FT                   EEALSALKDESLIVVEEADTGVLIHADERVVPDPSEAVEEDASLFERLRERFGL"
FT   gene            355050..356090
FT                   /locus_tag="HVO_0399"
FT   CDS_pept        355050..356090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0399"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03450"
FT                   /db_xref="UniProtKB/TrEMBL:D4H025"
FT                   /protein_id="ADE03450.1"
FT                   /translation="MGLTCRLLGHSYGDAETEREREERGDEVVVSIREIQVCSRCGHEQ
FT                   VISENKEVTAIRTPEEVGMTEGEVETAAAGFEPADPQPGVSDAEDAAIETAPDAETRAE
FT                   ADAATAAETDADATPGPAAKQPTEAASADTPDAQPADQPGDQPAASADAGTADAGTADA
FT                   PPVTDDGIILDDDEEQSATRDRTQWPDEVDEVETDDPTPPADGDDAEFIDADAEAGVET
FT                   DAEAEPEGSQTRERGAWPDAPGDDEGWNAQPDDGEPVSVSFGGGLTPENNGSSSQQANG
FT                   QYVEAEGEDDFVRADESNVGNEAPDDAVEYYCPNCGHARGASSSSMRAGDICPECKKGY
FT                   IAERES"
FT   gene            356161..356541
FT                   /locus_tag="HVO_0400"
FT   CDS_pept        356161..356541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0400"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04095"
FT                   /db_xref="InterPro:IPR040713"
FT                   /db_xref="UniProtKB/TrEMBL:D4H026"
FT                   /protein_id="ADE04095.1"
FT                   /translation="MKEYKMRRGETLEERIPDMEATVEDYFGPITGTEEFKGSDLYVVG
FT                   EPKNPVFTRIVAGAVKYSGKKDKLAVNFEEADPADLAPEDLEAAGEAVSAKNDFLLEAT
FT                   GRDAKSRRDSMKRAVEDDAPDV"
FT   gene            356734..357192
FT                   /locus_tag="HVO_0401"
FT   CDS_pept        356734..357192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0401"
FT                   /product="UspA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03272"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D4H027"
FT                   /protein_id="ADE03272.1"
FT                   /translation="MAIETILLAVGAGDAERIDRLAEETIDVAGPTGATVVIGHVFTKD
FT                   EYDDALDNLDFDITAEEVSADDVARRHATVRELTRRFDDADIDYVIHGRVGHHGEKLVE
FT                   LAGEVDADRLVVGGRKRSPTGKAVFGSVAQEVMLEASCPVTFVRADTK"
FT   gene            357270..357947
FT                   /locus_tag="HVO_0402"
FT   CDS_pept        357270..357947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0402"
FT                   /product="DUF124 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03403"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:D4H028"
FT                   /protein_id="ADE03403.1"
FT                   /translation="MDHTIDYRPSFALLTVSLDEGESLRSEAGAMVSYSDGIDIETNAK
FT                   GGLFGSLKRSVLGGESFFQNTFSARQAGEVSFAPPLPGDIVHHGLEDETLYVQSGSYIA
FT                   SDPALDLDTSFGGAKTFFGSEGLFLLKLTGTGDSFLSSYGAIHEVELGEGERYTVDTGH
FT                   IVAFDETTSFSVERVGGLKSTLFSGEGLVCTFTGPGTVWIQSRSMDSFLSWLIPKLPTN
FT                   NSA"
FT   gene            358032..359000
FT                   /gene="glcK"
FT                   /locus_tag="HVO_0403"
FT   CDS_pept        358032..359000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcK"
FT                   /locus_tag="HVO_0403"
FT                   /product="glucokinase"
FT                   /EC_number="2.7.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04537"
FT                   /db_xref="GOA:D4H029"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:D4H029"
FT                   /protein_id="ADE04537.1"
FT                   /translation="MAYYVGVDLGATNVRSVVGDDDGTVLGEARDNTPRGPTGIAVTEA
FT                   VLGVVREACAEAGIDPSDAVAAGIGAIGPLDLAEGAVENPANLPDTIDRIPLTGPLSVL
FT                   LETDEVYLHNDTNAGVIGERFHSDRNPDDMVYLTISSGIGAGVCVDGHVLAGWDGNAGE
FT                   VGHLTLDPHGFMTCGCGHNGHWEGYCSGNNIPKYARELHEEDPVDTALPISDPDFSAVD
FT                   VFEHAGDDEFADHIISQLGHWNAMGVANIVHAYAPLIIYVGGAVALNNPDLVLEPIREQ
FT                   MSEMVMSNIPEIQLTTLGDEVVVEGALASAMTGGTGDRSRL"
FT   gene            359447..361420
FT                   /locus_tag="HVO_0405"
FT   CDS_pept        359447..361420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0405"
FT                   /product="NifU C-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02310"
FT                   /db_xref="GOA:D4H031"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR013211"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/Swiss-Prot:D4H031"
FT                   /protein_id="ADE02310.1"
FT                   /translation="MDRRQFLRTVGASALAVSTAAVVGSRPATAHPGPFEPLGRIDIDG
FT                   AKEAVVSADGETVFVAATSGYAVVDISAPERQELLAERRDPLSDREDGPFRGLYDAKLD
FT                   GDTLLVVGPANPIPGAPAGVLVVDVSDPATPEEIAFHETEFPIHNCFAADGRAYLTAND
FT                   GDRNPLVVLDIDSGDELGRWSVVDADDRWADVPPSMRSVHDVWVHDRVAHVALWDAGTW
FT                   LVDLSDPASPWVLGAVSPGDPEEIAALTPRGRNRERRTPPGNHHYVATDDAGDLLGVGV
FT                   ESWAIEVDRDDGTTELVGGPSGVELWDVTDPANPERRSTIEPPASPDPTLGGVWTTAHN
FT                   FDFRDDRLYTSWYRGGVKRHDVSDPTDPVELAWWRDPERASFWTAQYAYPFADEGVFVA
FT                   SSRGVGDASPALYTFPDHAGDQRDPPTLRAEPTTEPLVNTPTPTPSPSGNETAASASET
FT                   ESSTSTTDAPGFGLGVGAAALGVAGWLVRVTSGATESDRRSRPRASTGTPHRVVPASNL
FT                   SRTTEIAFLSPAGASGEPFHSNPWGSKHRSMSDESESLKERVETWMVGQMPIIQMHGGN
FT                   SVVRKADAESGEVVVELGGACAGCGISNITAQNIQSDLIMTFDEITDVQVKVPSSGDHG
FT                   SSTVEGGRGGELQYGDEGPGHF"
FT   gene            complement(361646..363052)
FT                   /gene="aubA"
FT                   /locus_tag="HVO_0406"
FT   CDS_pept        complement(361646..363052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aubA"
FT                   /locus_tag="HVO_0406"
FT                   /product="RNA-binding protein AU-1"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03113"
FT                   /db_xref="GOA:D4GRU7"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR007295"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016730"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR035930"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRU7"
FT                   /protein_id="ADE03113.1"
FT                   /translation="MRVRVRGIYATALTSVFLDDGHDVVQASGPIRERFDAEFDSSDHD
FT                   VSVETTRNRQGVGATGAPEAVATATERLSDLGIDTFAWDDPAPTGAVFDARVTDTLGGG
FT                   AVCDLGETEGYLSYGDIDGRVEVGDEVRVQVVESAPPWASRRAELTGEVRAVAGLATLD
FT                   PDSEGVRVDTRDEAAARELAGMSDLLGGDPPEGWGIRWHRDAVDADMSALNDALDRAAE
FT                   VAAELDDALSEPVDAPRAVAAPTATTWVWFGRETRFELDAQRRAVETTMPGHHRTKAAS
FT                   QKASAGVDLAEALCESVGDGEFPFGVVTAQFGPLEGDDVEIGHGKPDGRLITLGSGEVT
FT                   DRDPEGTVELRRGMTGGGTYDALGVDRESGDVAVTKFREGRWWYPTVYRDADGGVKGTY
FT                   VNICTPVECFPDQIRYVDLHVDVVKHADGTVERVDDDELDEAVEAGHISEELAEKARSV
FT                   ASSLESALSG"
FT   gene            complement(363049..363423)
FT                   /locus_tag="HVO_0407"
FT   CDS_pept        complement(363049..363423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0407"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04319"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRU8"
FT                   /protein_id="ADE04319.1"
FT                   /translation="MHFDPREQAALREVGLDTDDLRAASDLVSDAVESDADAIAAFFGD
FT                   GGTVYSDMEMAHSATDVQEHVVDHVDLYTHGAELRGYLKFDSWGVPIEGGRVLSEGKVE
FT                   LTLGPTVDARVTFARDADEL"
FT   gene            363561..364598
FT                   /locus_tag="HVO_0408"
FT   CDS_pept        363561..364598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0408"
FT                   /product="PrsW family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05107"
FT                   /db_xref="GOA:D4GRU9"
FT                   /db_xref="InterPro:IPR026898"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRU9"
FT                   /protein_id="ADE05107.1"
FT                   /translation="MDQQDPVEQASDGSDDLYDIATWEERTSVDGLAVALYRLLVASTR
FT                   VVVILAALLILVGIGGLSALTDPQVGALTLLSALPALALAGYVYYSDVTQNEPLSMLVV
FT                   TFLLGVLTATFAAILNSLLSNVGQTIAGEFQLALGFLGSVVFYFLVVGPVEETVKLLAV
FT                   RLYAYSHDSFNAVIDGAVYGAMAGLGFATIENALYITRNLSSSGLDVGSGGVGIIAAGG
FT                   TITAVRALAGPGHVIYSAIAGYYLGLAKFNKENAGPIVIKGLILAALVHATYNSTVGLG
FT                   STVIAGITGLGGLAAFLVYVIIYDGVFGLYLIGKLRRYSQAYHSAHASGPSAASFSSER
FT                   TEFED"
FT   gene            complement(364649..365260)
FT                   /gene="ribE"
FT                   /locus_tag="HVO_0409"
FT   CDS_pept        complement(364649..365260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribE"
FT                   /locus_tag="HVO_0409"
FT                   /product="riboflavin synthase"
FT                   /EC_number="2.5.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04973"
FT                   /db_xref="GOA:D4GRV0"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRV0"
FT                   /protein_id="ADE04973.1"
FT                   /translation="MFTGIVEGPGEIVAVTDTDGGRRLRIRTDLAFDDLHHGQSIAVSG
FT                   VCLTVEAFGDDWFEVFLAAETIEKTYLGDAVEGDRVNLERALAADDRFDGHIVQGHVDG
FT                   TTTVTNVERVGDDWFFEFDLPESLANYVVQKGSVCLDGISLTVADRREGTFAVAIIPTT
FT                   YDLTTLSEKAVGDPIHVEVDVVAKYVESMLDGYAERLVVE"
FT   gene            complement(365957..366595)
FT                   /gene="arsB2b"
FT                   /locus_tag="HVO_0411"
FT   CDS_pept        complement(365957..366595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsB2b"
FT                   /locus_tag="HVO_0411"
FT                   /product="arsenite transport protein C-terminal domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04689"
FT                   /db_xref="GOA:D4GRV2"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRV2"
FT                   /protein_id="ADE04689.1"
FT                   /translation="MTSEVADEFIEDNGGLSPTAFRAFAVVAAVIGLAALGVVPIAIAA
FT                   LGGVAAMVSLGCLSASDAYDAVSWNVIFLLAGVIPLGRALQLTGGVALISEFVGVAATY
FT                   LPVIAVVAAFYLLTGLLANVITPVASVVLLLPVAIDTAFGLGADPFGFALAVTFGGSTA
FT                   FMTPIGYQTNLMVYGPGGYRFTDYLRVGAPLQLLLAVVTTAGIALIWGV"
FT   gene            complement(366592..367695)
FT                   /gene="arsB2a"
FT                   /locus_tag="HVO_0412"
FT   CDS_pept        complement(366592..367695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsB2a"
FT                   /locus_tag="HVO_0412"
FT                   /product="arsenite transport protein N-terminal domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04065"
FT                   /db_xref="GOA:D4GRV3"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRV3"
FT                   /protein_id="ADE04065.1"
FT                   /translation="MVAVTSGMLVVFALVVVTMALFVTEAAPTDVTAIGVIVALVVLEP
FT                   WTRVGLQTGLSGFSSAATITILSMYALSEGVRQTGAIRVLGDAVASFTNGSESRLLAAV
FT                   VGLTGPIAGVVNNTPVVAVFVPMVSDLADQANVSPSKLLIPLSYASMLGGTLTLVGTAT
FT                   NLVASEAYAEATGLPPFSMFTFTPLGALVFVVGAGYLLAVAPRLLPERIEPGNRTGNYG
FT                   VEPFLARVLVPARSPLVGIPAGEVSDDTYRDLNVDILDVLRGGEHFIAADSDREVAARD
FT                   ILTVRGDPATIRRFCDLAGLRSLPRASVTDAELDRPDRVALVELVVPRESGLVGETVGG
FT                   ARLRERYDATVLAVRRRGISATAATSS"
FT   gene            367843..368085
FT                   /locus_tag="HVO_0413"
FT   CDS_pept        367843..368085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0413"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03454"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRV4"
FT                   /protein_id="ADE03454.1"
FT                   /translation="MRLGIMEMVGLAATLIFAIPVGGFGLTLLADGRTAFGGAMLLLAV
FT                   LMVALPKFLTMPQDLPSLAAEKVVGGVAKEPDNEE"
FT   gene            complement(368086..369234)
FT                   /locus_tag="HVO_0414"
FT   CDS_pept        complement(368086..369234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0414"
FT                   /product="peptidase M24 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02777"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRV5"
FT                   /protein_id="ADE02777.1"
FT                   /translation="MRWSPRGGDAIDAAVSERDAVGFVAVSRGADPTSRYLTGREFDCD
FT                   LVFVRVDGETHLRVPSTVEPPSLPVASVRVDDRPPGTAAAAVLAEHGASDGTVLAPRTV
FT                   PHDAALHLESAGYDLASTPAVEAARAVKDDAERDAIEAAQRAATRGVGRAAAILSAATV
FT                   EEADDGDDNGDDEQSVLHWDGAPLSTERLRRQVNATLAAEGVDAAGATTVRAGPRGDGG
FT                   GGEPVELRPGEPIVVSVGPRGPTGYRGALARTFVVDPDGGWERRAHVACDAARKVSLAE
FT                   ADPGDDAGFLGSELRAETAAFGFSMADEVTRDVGGGIGLAAREDPPLDGDRELVAGNVL
FT                   RVRAAVTHADHGRVELTDVLVVGDDGPRLLGGAPTGLDPSRW"
FT   gene            complement(369241..371091)
FT                   /gene="uvrD"
FT                   /locus_tag="HVO_0415"
FT   CDS_pept        complement(369241..371091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrD"
FT                   /locus_tag="HVO_0415"
FT                   /product="repair helicase UvrD"
FT                   /EC_number="3.6.4.12"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05005"
FT                   /db_xref="GOA:D4GRV6"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRV6"
FT                   /protein_id="ADE05005.1"
FT                   /translation="MSESDVTVTRLFGGPGSGKTTALLDKVEEILEQDGVTIRDILVVS
FT                   YTRAAAAEVRDRLAERLDINPRSLKGNVSTMHAKAYELLSLSRNDVVGESDKQEFCEDY
FT                   GVEFEDEYGGAGRRTARSTTIGNKVIATSQWLQRTRRDVSDWYDVPFQWNVEEVRLPPE
FT                   VDPNAQEGNKYTPTWPSDDDRIDIPEAIRAWRAYKGEHGLVGFADMLERVKQRALVPNV
FT                   DYLVIDEFQDITTLQYDVYEEWKPHMRGVLIAGDDDQVVYAWQGADPNLLLDAERDNDE
FT                   ILPNSYRLPSNVLNVVNREIRHIDKRQEKDLKPRKEGGAVEAVESPSMLELARNVRYTV
FT                   EKDEGTVMVLFRARYQMFQFIDEFLPSGIPFSTLTDQRMWTDRLTQYVRAVEALDAEEP
FT                   VNGLEARRLADMLQDSAFGTNDRDDLFDAIDDRQEEVGVDDITNIEFTPKEIKNFAPFA
FT                   PDSSSASDMVRKVTSFQRKSVNAYFGGGYEEMDPSRVRVGTIHSAKGREADHVFMATDL
FT                   TEKVVEQMAASVSDEELEARGIEEFTATTSPVPLITDNERRVFYVGMSRARERLIVLEN
FT                   LVTGAPTLPISVLLHNEIREEPAQGLVDDAQELPAPEPEA"
FT   gene            complement(371250..371426)
FT                   /locus_tag="HVO_0416"
FT   CDS_pept        complement(371250..371426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0416"
FT                   /product="small CPxCG-related zinc finger protein"
FT                   /note="similar to protein from lactococcus bacteriophage
FT                   (isolate 7-9)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04413"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRV7"
FT                   /protein_id="ADE04413.1"
FT                   /translation="MASAPSDDLFDQFLTDRGHETEPARWDRSYNKLQCPDCGALHDMG
FT                   AATCSVCGWVPEA"
FT   gene            complement(371518..373026)
FT                   /gene="cxp"
FT                   /locus_tag="HVO_0417"
FT   CDS_pept        complement(371518..373026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cxp"
FT                   /locus_tag="HVO_0417"
FT                   /product="metal-dependent carboxypeptidase"
FT                   /EC_number="3.4.17.-"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03798"
FT                   /db_xref="GOA:D4GRV8"
FT                   /db_xref="InterPro:IPR001333"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRV8"
FT                   /protein_id="ADE03798.1"
FT                   /translation="MAQSPTEDASPYDQLLQKYKRIANVENAGGILSWDQQVMMPDEGT
FT                   PARSQQMSALSALSHELLTDDEFGELLDSAEADDPTDEQADVLRELRRDYERAARVPND
FT                   LVEKISAASSEAIPAWKQAKAEDDFETFAPHLEKHVELKRQYAEHIDPDRDPYEVLFED
FT                   YEPCLPLEQAEEILAEVREVLVPMIEDIRESDVDLAVDAFEGEFPEEDQETLVRDALST
FT                   LGYPWERGRLDTAPHPFSSGTQFDARVTTRYDESDVLGSLFSTVHEFGHALYTLGLPDE
FT                   HYATPLGENRNLSVHESQSRLWENHVGRSRAFWRHFLPTLEDRFPEVDATVEEAYEAAN
FT                   QVYDDNLIRVEADELTYHLHIVIRFELERELIAGDLAVEDVPEAWNDKYEEYLGIRPDT
FT                   DSEGCLQDIHWAYGNFGYFPTYSLGSIMAAQLFSAAEEDIDDLDGKLADGEFGDLREWL
FT                   RENVHRHGRRYETNDLVKRATGEAFAADDFLDYVESKYGALYDL"
FT   gene            complement(373221..374717)
FT                   /locus_tag="HVO_0418"
FT   CDS_pept        complement(373221..374717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0418"
FT                   /product="homolog to haloviral protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03339"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRV9"
FT                   /protein_id="ADE03339.1"
FT                   /translation="MNETEEVLSPEYVAGLLDATGRVQFNIHSQPDNKFTVRPSLRIRT
FT                   YESTARRDVLGMFLDSQSYDSTRFVDGDYSISYFLLDQHSELQQLDEYLAGHSAQLANE
FT                   LAFVTSLSDNQFGGQLLTAEDVYQLLITRDELRHGWRPRGRNHTTPQDFSDEYDVRPSR
FT                   VDSLPLPDGRCRSGYSEKWFAGLFDGICRYRASIAQTDEVRIGYTMYPIARMHLTGVSK
FT                   QLVDYALDYCESTGIDYGNSSTRHDFQVYFTAHQNVRKIIETLLPHSIVLRQHSELMLE
FT                   SILPRFEEDVHTTKTGFYKLLCDCLYVGDRTGGPFRKREYNPSYFEEIWSDELLLQENR
FT                   DEDTKTRQRTDPFPREDFDPVQVEPELYEDIGRYQTVLDRVRRDREVVNELKRLYDDKC
FT                   QVCGTTLLRNDGTRYSEVHHIVPLGEPHSGPDKRSNMLVLCPNHHTDFDNGVVSVSPES
FT                   LELEHTHTSALSDRQLAVDSDHHISTELLRYHNEEIVGEQ"
FT   gene            complement(374824..375918)
FT                   /locus_tag="HVO_0419"
FT   CDS_pept        complement(374824..375918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0419"
FT                   /product="peptidase M20 family protein (homolog to
FT                   succinyl-diaminopimelate desuccinylase)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02885"
FT                   /db_xref="GOA:D4GRW0"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRW0"
FT                   /protein_id="ADE02885.1"
FT                   /translation="MDELRDLTETLVSVPSHEDETAAGDAIEAWLREETDADVARDDAG
FT                   NVVARVNPGVGESLALVGHHDVVPPADRQTTDSGDYVVETRDGRLYGRGAADMKGAVAA
FT                   SMLAFRDAAADADSEVAFASFVGEEIGGEGVRAALDDGFELDYAVVAEGSTNYSGPNRT
FT                   DVAVAHRGRRASTLVASGTACHASGPERGENAVYRATDAVDVVRGLSVPDAEVLDHPVS
FT                   GSIAVTEIDGGSAWNVIPDRCEVTLDERTVPGGFADLARTAELEGVEWVVEQDLPPMAC
FT                   DDADFAERVLDAARSVHEARSDAEPEQTTKPHATDAGWLAQAGTTCVVYGPSEPGEAHT
FT                   KDESVSLDVLARCYETYRALVANW"
FT   gene            376085..377716
FT                   /gene="mpcT"
FT                   /gene_synonym="htr14"
FT                   /locus_tag="HVO_0420"
FT   CDS_pept        376085..377716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mpcT"
FT                   /gene_synonym="htr14"
FT                   /locus_tag="HVO_0420"
FT                   /product="transducer protein MpcT"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04622"
FT                   /db_xref="GOA:D4GRW1"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRW1"
FT                   /protein_id="ADE04622.1"
FT                   /translation="MRLVSTYERLLWGSMDALGISGSVERKVVAAVAIQFVVSLAQAAL
FT                   PWVATGALRLELSALLLFGAGLAFVNTIIITRKDIVSPIESISSAAAGVAAGDLSVRPP
FT                   DVSGTDEVARLADDFGAMHDHLCVVASQAGALADQRFDDPALDENLPGEFGDALDRMQR
FT                   DLADYTRNLQHLVEAFAEATSRAQAGDLTATIDTDDWGVDDERYEEVAATYNDLVRTLS
FT                   STIGEVQSFAQEVSEMSSTAREHVRRADAASEEVAASVTEISDGAGTQTEHLQTVSDEL
FT                   NTLSATVEEIAASADEVATTAETASDRGEVGRAAATEAMEELDTVEARIARTADAVAEL
FT                   TESIEEIDEIAAFIDHVGSQTDLLAINAAIEAAHAGEAGDGFGVVAQEVKSLAEETRDS
FT                   ADEVSGLIADITEHSEETLADVREMNRQVADSLETVTEAIGEFETIVDMVTDIDASVAE
FT                   VSAATDQQAESAADIAARVDDVANISEETAGQSRTVVETAQEQSESIGDLADQTEVLSS
FT                   QAADLDHLVESFEVVDGERAVAPGDD"
FT   gene            377834..379714
FT                   /locus_tag="HVO_0421"
FT   CDS_pept        377834..379714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0421"
FT                   /product="arNOG04375 family protein (homolog to PilT-type
FT                   ATPase)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02861"
FT                   /db_xref="GOA:D4GRW2"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRW2"
FT                   /protein_id="ADE02861.1"
FT                   /translation="MKIVPDTSAVIDGRVSERVDDGTYEGADVLVPEAVVSELESQAND
FT                   GRDTGWEGLSELQRLAEFADDGVIDLNYVGRRPSSGETKGAGEGDIDALIRDIATERSA
FT                   TLLTSDVVQAEVAKAKGVSVEYVEAAVRGSGGLIIERFFDDQTMSVHLKTDTRPKAKRG
FT                   AVGEMHYQPIADEPTDEATMKEWADDIVNSARAATDGFVELSEPGMDIVQFRDYRIAVA
FT                   RPPFADGIEITAVRPIVKTELDDYEFADELRDRLAERQRGVLIAGSPGAGKSTFAQAVA
FT                   EFLNDSDYAVKTMEKPRDLQVGPDITQYTALGGDMAKTADSLLLVRPDYTIYDEVRKTE
FT                   DFSVFSDMRLAGVGMVGVVHATRAIDALQRLVGRVELGMIPQVVDTVVYIEDGEVHTVY
FT                   DVRTEVKVPEGLFAEDLARPVIQIRDFESGTPEYEIYTFNRQVVTVPLGEGGEEKESGV
FT                   SRLAKQEIEREIRSIARGHVDVDLQGQNRAVVYVEEDDISYVIGKGGGRISDVEDRLGI
FT                   DIDVRTHDEKPSSSGQHAGANAGGQSGASASAGGADEGVVVTPEVTSRHVVVRMDGHVG
FT                   ETVEVRADGEYLFTATVGRGGDIQVSRGSAIAEELENAIDRKQQITVVPA"
FT   gene            complement(379829..380122)
FT                   /locus_tag="HVO_0422"
FT   CDS_pept        complement(379829..380122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0422"
FT                   /product="NP_1176A family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03863"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRW3"
FT                   /protein_id="ADE03863.1"
FT                   /translation="MAGTEEESLDDLPPSAKLVFKVLEYNGPLTQKGIVEESMLSARTV
FT                   RYALERLEGIGIVDEDVYFADARQNLYQLTDLAPQQAQAKADGGKEKACCAE"
FT   gene            380247..380561
FT                   /locus_tag="HVO_0423"
FT   CDS_pept        380247..380561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0423"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03018"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRW4"
FT                   /protein_id="ADE03018.1"
FT                   /translation="MATETQTGLSSHIRGVTVTTLACLAGIAAAVVSGAVVGTSPEAAT
FT                   NQLAVGILGALVLIQFPVLRVVGVDVNGFGAKDYLYVVFMTFALWFITFAILLTSGVQL
FT                   "
FT   gene            380564..382378
FT                   /locus_tag="HVO_0424"
FT   CDS_pept        380564..382378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0424"
FT                   /product="ABC-type transport system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02553"
FT                   /db_xref="GOA:D4GRW5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007209"
FT                   /db_xref="InterPro:IPR013283"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034348"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRW5"
FT                   /protein_id="ADE02553.1"
FT                   /translation="MADDSIAVVDLDRCSPDRCSYECSNFCPPNRTGKECITLRGEDAE
FT                   QGGPDQVRISEEICLGETCGICVEKCPFDAIEIINLPSELDEEPTHRYGENAFSLYGLP
FT                   VPEAGSVTGILGPNGIGKTTAVRALAGEMVPNLGNYDDDPTWEAVLDRFRGTELQNYVE
FT                   QVRDGEVSIARKPQYVDQIPKQFDGTARELLEATDERGALDSYIDRLDIGPVVDNDIET
FT                   LSGGELQRVALAATLARDRDFYFLDEISPYLDIGQRVTAARLIRELAEDEDRAVLVVEH
FT                   DLAILDLLADTLHVAYGEPGAYGVITDPKSVRNGINEYLKGYLSNENMRIRPEAITFEE
FT                   HAPRETTKAEPLVEYPDLAKSYGDGEFSLEVESGTIYNGEVLGVVGPNGIGKSTLAQLF
FT                   TGDLTPDAGDLDFALDISYKPQYIEIDQPMRVDAFLSSITDQFGSSYWNTEIANPLQLN
FT                   RIMERNLTDLSGGERQRVAIAACLSQDADLYLLDEPSAHLDVEQRVQATSAIRRYAENH
FT                   DATVMVIDHDIYMMDLLADRLMVFDGEPSIEGHASKPQEMRDGMNDFLSDLDITFRRDE
FT                   RTQRPRINKPDSQLDREQKRAGEYYYAE"
FT   gene            382515..383456
FT                   /locus_tag="HVO_0425"
FT   CDS_pept        382515..383456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0425"
FT                   /product="glyoxalase domain protein (homolog to
FT                   catechol-2,3-dioxygenase)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02764"
FT                   /db_xref="GOA:D4GRW6"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRW6"
FT                   /protein_id="ADE02764.1"
FT                   /translation="MTNDSPSDGSLTDDTHLDRVALRVGSLDRVVPFYRDVVGLAVERE
FT                   RDGSRAVLSAGETPVVVLDEDSDAPERGRREAGLFHLAVRVPDRGALGDVLARARTRAS
FT                   DTGATLSGASDHLVSEALYFRDPEGNGVEVYRDRPREEWPWTDDRRVSMDTLPLDLGAL
FT                   ADDAAGDEVAPAGTDLGHVHLEVTNVPRSRDFYVDALGMRVRDEGYPGAAFVAAGEYHH
FT                   HVGLNSWNTRSAPAGGSRGIEWFEIVVPDAATLDAVRESLVDAGHEIEQDGSDESGSGD
FT                   GDATDAADASTATESLVLSDPDGIGVRVVRSR"
FT   gene            383511..383993
FT                   /locus_tag="HVO_0426"
FT   CDS_pept        383511..383993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0426"
FT                   /product="UPF0098 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04712"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRW7"
FT                   /protein_id="ADE04712.1"
FT                   /translation="MIASDSSERRRGLTPRSPAFDDGCPIPRPHGYAAANESPPLRIGG
FT                   VPPGTASLALVMDDPDAVKPAGEVWDHWFVWNVAPETDAIAAGETPPGAVEGTNSYGER
FT                   GYGGPNPPDGEHTYRFLLYALDAPLDLDAGATKADLKRAIAGHVVAETKLAGSYAL"
FT   gene            complement(384018..385076)
FT                   /gene="rtcA"
FT                   /locus_tag="HVO_0427"
FT   CDS_pept        complement(384018..385076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rtcA"
FT                   /locus_tag="HVO_0427"
FT                   /product="RNA 3'-terminal phosphate cyclase"
FT                   /EC_number="6.5.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04447"
FT                   /db_xref="GOA:D4GRW8"
FT                   /db_xref="InterPro:IPR000228"
FT                   /db_xref="InterPro:IPR013791"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR017770"
FT                   /db_xref="InterPro:IPR020719"
FT                   /db_xref="InterPro:IPR023797"
FT                   /db_xref="InterPro:IPR036553"
FT                   /db_xref="InterPro:IPR037136"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRW8"
FT                   /protein_id="ADE04447.1"
FT                   /translation="MRRLDGRNGGGQPLRTALALSLVTGESFEMTNVRGNRSTPGLKAQ
FT                   HVACVSVAAAVSNAAVEGGEVGSSTLRFSPDRVRTDPVEVAVGTAGSATLVCETVLPAA
FT                   VALDDPLSLTVTGGTDVRWSPPADYHRHVKRPLCSRFGVEFGVSVPRRGFYPAGGGRLS
FT                   LRIEPAEPTPLALDRRADPDELRVYSVESGSLAAAAVAERQVEGVRDALAEAGVDLPVR
FT                   AAVSSVESDSPGSVVVAVARGEDDERAGDGSESVVAGFDAYGERGTPAEAVGSRAAASF
FT                   LDWLGGDAPVDRHMADQLLVWVALAGGRLRIPAVTDHVRTNLDVIRAFGYDVTLLVGDD
FT                   GDGAVVESDGGR"
FT   gene            complement(385077..385526)
FT                   /locus_tag="HVO_0428"
FT   CDS_pept        complement(385077..385526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0428"
FT                   /product="UspA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03411"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRW9"
FT                   /protein_id="ADE03411.1"
FT                   /translation="MNFVVAVDGSAAADRALDHALSMLEPLGATVTIVHAVEPQVLVEG
FT                   GEGPVAGVAGTGDRIVAESLEDAESRAERVLNAAAERAADAGVDAATELLYGDPVEAIP
FT                   TYADEADADGIFVGHRGLSKRYEGLVGSVAKELVERASCPVTVVR"
FT   gene            complement(385608..386129)
FT                   /gene="amzA"
FT                   /locus_tag="HVO_0429"
FT   CDS_pept        complement(385608..386129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amzA"
FT                   /locus_tag="HVO_0429"
FT                   /product="archaemetzincin"
FT                   /EC_number="3.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03615"
FT                   /db_xref="GOA:D4GRX0"
FT                   /db_xref="InterPro:IPR012091"
FT                   /db_xref="InterPro:IPR012962"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRX0"
FT                   /protein_id="ADE03615.1"
FT                   /translation="MLVDIVPIGDISAAVKREASAGLRSVYDCDVTVQSNQAIPEGAFD
FT                   RSRNQYRAEQFIELASRIGRGEKNIGITEKDLYYRRRNYVFGLAYLNGNGSVISTYRLQ
FT                   TTSDGGITNKPAEEVLSDRVRKEVVHEIGHTLGLEHCDNNKCVMSFSPTVREVDVKEEN
FT                   LCGTCSRLVH"
FT   gene            386169..386621
FT                   /locus_tag="HVO_0430"
FT   CDS_pept        386169..386621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0430"
FT                   /product="UPF0146 family protein"
FT                   /note="similar to Vng2609c"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02938"
FT                   /db_xref="InterPro:IPR005353"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRX1"
FT                   /protein_id="ADE02938.1"
FT                   /translation="MKKSLRDALVGQLSGYDRAVEVGVGREPSVAAALAARGVDVVAVD
FT                   VHDFPVPDGVSFVRDDVFARADAADLGPYAAAEVVYALNVPVELHRPAAEVARRADADF
FT                   LFTTLGYDEPSVPVSRESLPGETLYVAERGRRDQRARRDSPGRSQE"
FT   gene            386653..387507
FT                   /locus_tag="HVO_0431"
FT   CDS_pept        386653..387507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0431"
FT                   /product="HAD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03629"
FT                   /db_xref="GOA:D4GRX2"
FT                   /db_xref="InterPro:IPR006438"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRX2"
FT                   /protein_id="ADE03629.1"
FT                   /translation="MHADAVVLDIDGVLVDVADSYRRAIVESVDRHYGTTISRDEVQLF
FT                   KDAGGFNNDWELTYAAALSVLAAREADLSVAAFTGEIEARGGGLDAAKATVEALLSEPS
FT                   VVFDEWDPEALRETFQALYLGSDLYRDLEDGDPPFEAPGYIHDEPVLLRPETLDALGDR
FT                   ELGVVTGRPAAEADIALDRVALDVADDHRFTMDDWEEGKPHPAALVTVAERLGADSVVF
FT                   VGDTLDDVKTALNADAADPERVYYGVGVLSGGLTGDDGRQKFSEIGAAAVVEDVNEVPD
FT                   LLD"
FT   gene            387557..387772
FT                   /locus_tag="HVO_0432"
FT   CDS_pept        387557..387772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0432"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04226"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRX3"
FT                   /protein_id="ADE04226.1"
FT                   /translation="MGHLRAFVVTLLALDALVVVVGTYLLPPDPFAQLVLVGPLLLLAP
FT                   VVAWWLVYRDGFERVQALVESDGGGR"
FT   gene            387864..388532
FT                   /gene="npdG"
FT                   /locus_tag="HVO_0433"
FT   CDS_pept        387864..388532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="npdG"
FT                   /locus_tag="HVO_0433"
FT                   /product="F420H2:NADP oxidoreductase"
FT                   /EC_number="1.6.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02489"
FT                   /db_xref="GOA:D4GRX4"
FT                   /db_xref="InterPro:IPR010185"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRX4"
FT                   /protein_id="ADE02489.1"
FT                   /translation="MRIALLGGTGDIGEGLALRWAYHTDHEVIVGSRDPDKARAKADEY
FT                   ETELSSRGRDVKVNGFTNEMAADRASVVVLAVPPYHVSDTVEAVSDSLSEGDVLVTPAA
FT                   GMKRDDDGFHYHPPKAGSVTALVADAAPDDVPVVGAFHNLAAGRLADLDADLGIDTLLV
FT                   ADDEDAKETVRLLAEGIDGLRALDGGGLANAPEIEGITPLLINVARNNDGLHDLGIRFK
FT                   "
FT   gene            complement(388563..389816)
FT                   /locus_tag="HVO_0434"
FT   CDS_pept        complement(388563..389816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0434"
FT                   /product="major facilitator superfamily transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03740"
FT                   /db_xref="GOA:D4GRX5"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRX5"
FT                   /protein_id="ADE03740.1"
FT                   /translation="MSRLFGGDEPSVEFVAGSLIAGVFFGGVGAGVAFPTLPTLGPIIG
FT                   ITPFVVGLILSANRFTRLVVNTPAGQILDRMGTRRPMIAGFVVQGLSPFGYVLGLNPGP
FT                   IPLDSATVFLLSRACWGVGSAFVFVGAFSTITHVTSDGNRGKWVGYMRGGQSLGFPAGL
FT                   VVGGLVTDAFGYATAFAVAGYAGLFAALVAISVLPDVKTDVTAASSLREVPRLVSADIR
FT                   IFTVGTVNFAVRFLFSGVLLSTAVLYATANDISLGGLSGAGVSGVVMAVGVVASSVTTL
FT                   VVGRYSDRLSNRAALTLPALGVLAAGFTLLALVPTLPSTLAGVALIGVGVGGSNPPLLA
FT                   YLGDLSPADDVGKLGGVYNVFGDSGSTLGPLVAVPLAEVVGFRVEYLACVALVVVVGLL
FT                   VARTLYGEAATVPGSELS"
FT   gene            complement(390051..390353)
FT                   /gene="hisE"
FT                   /locus_tag="HVO_0435"
FT   CDS_pept        complement(390051..390353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisE"
FT                   /locus_tag="HVO_0435"
FT                   /product="phosphoribosyl-ATP pyrophosphatase"
FT                   /EC_number="3.6.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04356"
FT                   /db_xref="GOA:D4GRX6"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRX6"
FT                   /protein_id="ADE04356.1"
FT                   /translation="MDADTPTDEVLDELFATIESRKADLPEDSYTTTLFTHEKGENYVL
FT                   EKLGEETTETILAAKDDDGEELLYESADLVYHLLVLLSMKDASLDDLRDELKARF"
FT   gene            complement(390432..391040)
FT                   /gene="pdxT"
FT                   /locus_tag="HVO_0436"
FT   CDS_pept        complement(390432..391040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxT"
FT                   /locus_tag="HVO_0436"
FT                   /product="pyridoxal 5'-phosphate synthase subunit PdxT"
FT                   /EC_number="4.3.3.6"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03933"
FT                   /db_xref="GOA:D4GRX7"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRX7"
FT                   /protein_id="ADE03933.1"
FT                   /translation="MTTLRAGVVAVQGDVSEHADAVERAAEAHGVDAEIVEIRSDGLVP
FT                   DCDVLLMPGGESTTISRLLEREGIADEIRAHVEAEKPVLATCAGLIVASRDAKDDRVTT
FT                   LDLLDATVDRNAFGRQVDSFEAPLDVAGLDSPFPAVFIRAPLIDEVGEGVEVLAEWDGN
FT                   PVAVRDGPVVGTSFHPELTPDSRLHDLAFFDELAVEIDA"
FT   gene            complement(391096..391260)
FT                   /gene="secG"
FT                   /locus_tag="HVO_0437"
FT   CDS_pept        complement(391096..391260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secG"
FT                   /locus_tag="HVO_0437"
FT                   /product="protein translocase subunit SecG"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02280"
FT                   /db_xref="GOA:D4GRX8"
FT                   /db_xref="InterPro:IPR016482"
FT                   /db_xref="InterPro:IPR023531"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRX8"
FT                   /protein_id="ADE02280.1"
FT                   /translation="MSKGQNSGGLMSSAGLVRYFDAEDRNAIRVNPKTIFAAGALFGIG
FT                   VLVLNSLAF"
FT   gene            391499..391768
FT                   /gene="trxA1"
FT                   /locus_tag="HVO_0438"
FT   CDS_pept        391499..391768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA1"
FT                   /locus_tag="HVO_0438"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03104"
FT                   /db_xref="GOA:D4GRX9"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRX9"
FT                   /protein_id="ADE03104.1"
FT                   /translation="MTVRLLDFYADWCGPCKTQDPILDELEGDYETVEFVKVDVDEEQD
FT                   VANQYQVRSLPTLIVENDDDGIVDRFVGVTQRDDIESALSQAGA"
FT   gene            391882..392028
FT                   /gene="rpl40e"
FT                   /locus_tag="HVO_0439"
FT   CDS_pept        391882..392028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl40e"
FT                   /locus_tag="HVO_0439"
FT                   /product="50S ribosomal protein L40e"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04126"
FT                   /db_xref="GOA:D4GRY0"
FT                   /db_xref="InterPro:IPR001975"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR023657"
FT                   /db_xref="InterPro:IPR038587"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRY0"
FT                   /protein_id="ADE04126.1"
FT                   /translation="MASDAATKRTLEKQICMRCNARNPQKAKQCRKCGYKHLRPKSKER
FT                   RAA"
FT   gene            complement(392044..392424)
FT                   /locus_tag="HVO_0440"
FT   CDS_pept        complement(392044..392424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0440"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04923"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRY1"
FT                   /protein_id="ADE04923.1"
FT                   /translation="MATDAVTEPSDDLTRLHYVGVALAAVTGVIHLVLGAGALAANPAD
FT                   PLGIAFVGAAGGFAAGIVGVLRGDERRRSRVVLLGIPFTAGQVVLYVALNWPNIFGIGG
FT                   VADKLVQLALLAVLFALYRRDA"
FT   gene            complement(392426..393052)
FT                   /locus_tag="HVO_0441"
FT   CDS_pept        complement(392426..393052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0441"
FT                   /product="beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03096"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRY2"
FT                   /protein_id="ADE03096.1"
FT                   /translation="MEVIPVTADAETFTCNAYLVLGERTVLVDAGTMSGVEDVVAEHTD
FT                   DLDAVVVTHQHSDHVGELGAVVERFDPDVYAYADHPLRTHELGDGDHVEMGDESFEVVY
FT                   TPGHADDHVSLVSGRSLFSGDVFVYNDGAFDDGSFGRTDMPGQSRERLISSLHTLLDRL
FT                   PSTVEALYAGHGDPFENEAGGDTVRDALERAIERAERREPKYPEA"
FT   gene            393182..393352
FT                   /locus_tag="HVO_0442"
FT   CDS_pept        393182..393352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0442"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04460"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRY3"
FT                   /protein_id="ADE04460.1"
FT                   /translation="MGFGSYDESEQGDQNVDFDEEDGVTTSEEKHEGEVDFEIGASNDE
FT                   LLDRLQEIKDE"
FT   gene            393349..393960
FT                   /locus_tag="HVO_0443"
FT   CDS_pept        393349..393960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0443"
FT                   /product="UPF0215 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04888"
FT                   /db_xref="InterPro:IPR002802"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRY4"
FT                   /protein_id="ADE04888.1"
FT                   /translation="MKSGSRALGVAESSPGAARAPTDDADDAHFSTDPSPESVLCGAVV
FT                   RADRVVDGLAFETCAVGGDDATDAIASLYDSLDREDVRYLLVSGIAPAWFNLVDIDRLA
FT                   AALDRPVLSVSFEESEGLEPALTEQFSGAALDRRLATYRAAPPRRPVEVNGETVFVRAA
FT                   GCDGDEAAQVVRGFTPTGGRPEPIRVARMAARAARRFAGD"
FT   gene            393985..394581
FT                   /gene="udg3"
FT                   /locus_tag="HVO_0444"
FT   CDS_pept        393985..394581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="udg3"
FT                   /locus_tag="HVO_0444"
FT                   /product="uracil-DNA glycosylase"
FT                   /EC_number="3.2.2.27"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04913"
FT                   /db_xref="GOA:D4GRY5"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRY5"
FT                   /protein_id="ADE04913.1"
FT                   /translation="MEHMEGLCVTGCERCPELVDSRSRIVNGVGPDDADLLFLGEAPGA
FT                   KEDEGGEPFVGRSGSVLDDALREAGLARADVRITNCVRCRPPDNRDPTSDELSNCRGYL
FT                   ARELELVDPELVVTLGKVPSQHLLDRGVAITNESGSVVDARVGDASYRVLLSVHPAATL
FT                   YDRSQREGFFETIARAADLSGLADSADGQASLGDF"
FT   gene            complement(394719..395684)
FT                   /gene="phnE1"
FT                   /locus_tag="HVO_0445"
FT   CDS_pept        complement(394719..395684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnE1"
FT                   /locus_tag="HVO_0445"
FT                   /product="ABC-type transport system permease protein
FT                   (probable substrate phosphate/phosphonate)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02812"
FT                   /db_xref="GOA:D4GRY6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005769"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRY6"
FT                   /protein_id="ADE02812.1"
FT                   /translation="MSTDTDRIEDALRNIQIAKRVRLLFSIVVLVLFAWFFTNALSEVG
FT                   FSIGEIVEYWPEFTDALGDFFPPGTLFGVIPFVDVSQYWAFIQERNLLLQFQDGNPVLG
FT                   AVFVTFAMGFVGTVLGIPGALILGVLGSERVTPYPFNFIFRGTMSVIRAIPALVWALIY
FT                   IPLGGVSPFTATLAIGTDTMGNLGRLFTDALEEVEDGPIEAIESTGANSPQKVVFGMLS
FT                   QVFTPFIAWTMYILEINVRIGVTMGLIGGGGLGQVLQTQRGLFRYTNMMATILVIFMLV
FT                   VSVEFVSQRVRSYIRGNEEGTSLLKLIVEFPQRMARSIWE"
FT   gene            complement(395674..396477)
FT                   /gene="phnC1"
FT                   /locus_tag="HVO_0446"
FT   CDS_pept        complement(395674..396477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnC1"
FT                   /locus_tag="HVO_0446"
FT                   /product="ABC-type transport system ATP-binding protein
FT                   (probable substrate phosphate/phosphonate)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04015"
FT                   /db_xref="GOA:D4GRY7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012693"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRY7"
FT                   /protein_id="ADE04015.1"
FT                   /translation="MSTIEVTNLSKSYGDVTALDDVSFTIPDGEFVVVLGQSGAGKSTL
FT                   LRCLNGITRPTSGSITIDDANVMGPRNDVAMIFQQHYILGQMSAYSNALTGALGRTSFL
FT                   GSLLGLYDGDDKQEALRALETVGLLDEANQRAGKMSGGQQQRVGIARALVQNPNLLLAD
FT                   EPVASLDPASAETVMRYIRDAADERDLTTIASLHQVNIAREFGERFIGMKDGQIVFDGY
FT                   REDFDVDVIDRIYGDIETKAIREEQADEPPENNAAATSGARSHEY"
FT   gene            complement(396573..397619)
FT                   /gene="phnD1"
FT                   /locus_tag="HVO_0447"
FT   CDS_pept        complement(396573..397619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnD1"
FT                   /locus_tag="HVO_0447"
FT                   /product="ABC-type transport system periplasmic
FT                   substrate-binding protein (probable substrate
FT                   phosphate/phosphonate)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04762"
FT                   /db_xref="GOA:D4GRY8"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRY8"
FT                   /protein_id="ADE04762.1"
FT                   /translation="MASRREFIRTAGITGVAGLTALSGCTGGDDSSEATTTTTESGASS
FT                   ETEATTTSTTTESSPESIMFALTPAESDVDVEAQYQPLFNYIESEVGVTVESTVAADYA
FT                   AVLQALDSGQADIADAAPAIAIQGGNEGITEVIGIRIAYGASRYFSLITTTPDSDIEEL
FT                   TDLEGETVAFADRLSTSGSLFPLSMLSTAGLDTGGAPDGNPVDFEAQFSDHSTARETLI
FT                   NRDDVVAAGTGAFSTAPHVPEDQFPEQFLDMSAENDGDLGTASPELQLLSCSDPIPRAP
FT                   ILGRTDMDQGLYDDIEEALLNVTEDDLINEDLEDDQQLWFTGVDQGSVDDYAPVQEVLD
FT                   ELGVTLGQ"
FT   gene            397884..398543
FT                   /gene="hisH"
FT                   /locus_tag="HVO_0448"
FT   CDS_pept        397884..398543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisH"
FT                   /locus_tag="HVO_0448"
FT                   /product="imidazoleglycerol-phosphate synthase subunit
FT                   HisH"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04772"
FT                   /db_xref="GOA:D4GRY9"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRY9"
FT                   /protein_id="ADE04772.1"
FT                   /translation="MSTTQPPEETLADVVMVDYGLGNLRSAMRGLERAGANVVISDDPA
FT                   DFDDADGIVLPGVGAFSEGMENAGPFREPLAEAAADGTPVFGICLGMQMLLTSSEEADH
FT                   AGEGEVEGLDFIPGRNVRFDEGQKVPHMGWNELNVQRDHPLVEGVDGEYAYFVHSYYAD
FT                   PDDEGAVVASTDYGVAFPAVVANEAGTVFGTQFHPEKSGETGLTILRNFVEFCAER"
FT   gene            398598..399404
FT                   /gene="pheA"
FT                   /locus_tag="HVO_0449"
FT   CDS_pept        398598..399404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheA"
FT                   /locus_tag="HVO_0449"
FT                   /product="prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02290"
FT                   /db_xref="GOA:D4GRZ0"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRZ0"
FT                   /protein_id="ADE02290.1"
FT                   /translation="MQAVTLGPAGTYSHRAARAVADDVAFRESVTSIVQAVADGSFERG
FT                   VVPIENSIEGSVTESLDAVANSDVSVVQEIVTPIRHALLAQSANFDVVASHSQALAQCR
FT                   TYLEENYPDAKLEAVASTARGVERARADPTVAGIGHPDNVGDDLEIIAEDIQDQSSNAT
FT                   RFLVIGPESARSDAGGKSSLVVYPNANYPGLLLELLEAFAERDINLSRIESRPSGNRLG
FT                   DYLFHIDADAGLYEERMQGALEEVEGIASNGWVRVLGSYDTRHVLY"
FT   gene            399548..399955
FT                   /gene="hsp20A"
FT                   /locus_tag="HVO_0450"
FT   CDS_pept        399548..399955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsp20A"
FT                   /locus_tag="HVO_0450"
FT                   /product="Hsp20-type molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03143"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRZ1"
FT                   /protein_id="ADE03143.1"
FT                   /translation="MQRNPFDEIEDLFDRMGRSFEESGIGRFQDISLDVVDDEAIEVVA
FT                   DLPGFEKDDLDVSVSGRRLTIAADREESSEVDDEQYVRRERSQRSVSRTITLPAEVVRD
FT                   EVTASYKNGVLTVTLPKAEPAGDDSTEIDIE"
FT   gene            400072..400515
FT                   /gene="hsp20B"
FT                   /locus_tag="HVO_0451"
FT   CDS_pept        400072..400515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsp20B"
FT                   /locus_tag="HVO_0451"
FT                   /product="Hsp20-type molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03087"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRZ2"
FT                   /protein_id="ADE03087.2"
FT                   /translation="MMRRTNPFDDFEELFERMSRQFDEMGRQFDRSGMMAQVRHEMAID
FT                   VTDHDGEIVVTVDLPGYEKSDIALSVANRTLTVEATRELDAERADGEYLRRERRHESAR
FT                   RTIRLPETVDENGASASYHNGVLTVTLPKHDAEPDDSRRIDID"
FT   gene            400730..403606
FT                   /gene="leuS"
FT                   /locus_tag="HVO_0452"
FT   CDS_pept        400730..403606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="HVO_0452"
FT                   /product="leucine--tRNA ligase"
FT                   /EC_number="6.1.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04478"
FT                   /db_xref="GOA:D4GRZ3"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR004493"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR020791"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRZ3"
FT                   /protein_id="ADE04478.1"
FT                   /translation="MDYDPQELEARWRERWSESGRYEADPDADADDATFVTVPYPYPSG
FT                   GMHIGHARTYTVPDVYARYRRQQGDNVLFPIAWHVTGTPIIGAVERLQNREEKQLSVLT
FT                   DTYNVPEDTLSDLESPMGWARYFIEEHYKKGMQSLGLSVDWRREFTTNNERYSKFVEWQ
FT                   YRTLRDRGRLEKGLHPVKFCTNEEQPVTTHDLLEGENAEFQEYTLVRFGWERDGGDVVV
FT                   PMATLRPETVHGVTNAYIDPEATYVVAEVDGETWFVSDYAADKLEYQARDVEILETVEG
FT                   AELVGQTVENPVTGDDVLVLPADFVDADNATGVVMSVPAHSPDDYVALQEAKADADYLE
FT                   SFGIDPADVADIEPIPILDIDSEDDTYGEIPAESAVENRGIESSDDPALEKATKDLYNK
FT                   EFHAGRLKEFYGDYAGGLVEEVRDDFKADGVEAGQFDVMQEFSEVVVCRCGGDVVVAEQ
FT                   DTWFLSYDDEDWKELAHDVADGLDAIPENTRDEYHHTIDWLNGWPCIRNYGLGTRLPWD
FT                   DQFVIEPLSDSTIYMAYYTIAHRLQEIPTEELTQEFFDALFYGPDAVDDAPEKALDLRE
FT                   EWDYWYPVDYRFSGNDLITNHLTFYQFHHGELFDEPQWPRGIVIMGMGLLEGEKMSSSK
FT                   GHVVLPGEAIGEYGADTVRFFLLNSAEPWQDYDWRDDLVGSVHDQLERFWNRAQEIITD
FT                   PGPDDQPDLETVDRWLLSKLQDTVRDVTTAMDEAETRSASQAAFYNFEESLRWYRRRTD
FT                   LDRPAAKWTLRTVLETRLRLLAPFIPFMTNELHEQLTGTPAEDAPWPEPDESFEDESVE
FT                   LEERQVERLTEDVRDIIDVTDSDPDTIRVYVAADWKRDVFETVVDNGDNVGAIMGQVMQ
FT                   DPDLRERGNDVNDLVQDLVDQTRGRDESTLRAQLELDEADTYERAADFLAREFDAAVEV
FT                   FAEDDDDIVDPGDRASKAIPFRPAVHLE"
FT   gene            403730..403948
FT                   /locus_tag="HVO_0453"
FT   CDS_pept        403730..403948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0453"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05097"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRZ4"
FT                   /protein_id="ADE05097.1"
FT                   /translation="MSEDDSSSLARKAYHTVTPGSHMRPDSEMDSIGWTMFLILVVLLV
FT                   PFLPFIAIVYVLSKVFGYLNAQRGPSP"
FT   gene            complement(404006..405001)
FT                   /gene="ala"
FT                   /locus_tag="HVO_0454"
FT   CDS_pept        complement(404006..405001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ala"
FT                   /locus_tag="HVO_0454"
FT                   /product="alanine dehydrogenase"
FT                   /EC_number="1.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02785"
FT                   /db_xref="GOA:D4GRZ5"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR028609"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRZ5"
FT                   /protein_id="ADE02785.1"
FT                   /translation="MRKTLLLNKDDVHENVQMPELISAIEDAFAAYESGDAQMPPKSYI
FT                   DLPQYNGDFRSMPAYLDAGDWDAAGIKWVNVHPDNGDKYDLPTVMGTMIYSDPENAFPL
FT                   ALLDGTELTMLRTGAAAAVATDHLAVEDASSMGIVGAGVQSYTQLRAISEVRDIEEVVV
FT                   SDLDEERVADFIDAFEDEFDIRAGSIEEAASCDVLSTVTPVESPIVPREAVGDHTHINA
FT                   MGADAEGKHELADEVLLDAKLVIDDHAQTTHSGEINVPYHDGVLTDDDIYGAIGDIVLG
FT                   NLDGRTDADGISVFDSTGLAIQDVAAAHVAYEHAFENDNGYAFDLLGLAE"
FT   gene            complement(405300..406973)
FT                   /gene="ths2"
FT                   /gene_synonym="cct2"
FT                   /locus_tag="HVO_0455"
FT   CDS_pept        complement(405300..406973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ths2"
FT                   /gene_synonym="cct2"
FT                   /locus_tag="HVO_0455"
FT                   /product="thermosome subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03416"
FT                   /db_xref="GOA:O30560"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012714"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:O30560"
FT                   /protein_id="ADE03416.1"
FT                   /translation="MSQRMQQGQPMIIMGEDAQRVKDRDAQEYNIRAARAVAEAVRSTL
FT                   GPKGMDKMLVDSMGDVTITNDGVTILKEMDIDNPTAEMIVEVAETQEDEAGDGTTTAVA
FT                   IAGELLKNAEDLLEQDIHPTAIIRGFNLASEKAREEIDDIAERVDPDDEELLKKVAETS
FT                   MTGKSSELNKELLADLIVRAVRQVTVEANDGSHVVDLENVSIETQTGRSASESELLTGA
FT                   VIDKDPVHDDMPVQFDEADVLLLNEPVEVEETDIDTNVSIESPDQLQKFLDQEEAQLKQ
FT                   KVDQIVDSGADVVFCQKGIDDLAQHYLAKQGILAVRRTKKSDIRFLKNITGAAVVSDLD
FT                   SIEAAVLGRASVRRDEAGELFYVEGIGDDVHGVTLLLRGSTDHVVDELERGVQDALDVV
FT                   ASTVADGRVLAGGGAIEVELASRLRNYADSVSGREQLAVEAYADALELVPRVLAENAGL
FT                   DSIDTLVDLRAAHEDGQVRAGLNVFTGEVEDAFDAGVVETAHAKEQAVASASEAANLVL
FT                   KIDDIIAAGDLSTGGDDDEEGGAPGGMGGMGGMGGMGGAM"
FT   gene            complement(407159..407551)
FT                   /locus_tag="HVO_0456"
FT   CDS_pept        complement(407159..407551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0456"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03242"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRZ7"
FT                   /protein_id="ADE03242.1"
FT                   /translation="MHHRANYATVFIGSHLHPEGETLDLDWADDAGDETETFEFDVPTD
FT                   DPREPYLGIQAFDVGEYGHEIRINGDPLSGFDIPPGDGWQYWVDTVTGASLVEGTNTIR
FT                   VVRDDEGNDAFAVGTVTVHWKEPVEE"
FT   gene            complement(407615..407797)
FT                   /locus_tag="HVO_0457"
FT   CDS_pept        complement(407615..407797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0457"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04237"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRZ8"
FT                   /protein_id="ADE04237.1"
FT                   /translation="MPDTKTGREKKGLNKRTQLTERLYERELSVLDGDDDEPPLDAASD
FT                   DADGEFLADELPEDD"
FT   gene            complement(408343..408423)
FT                   /locus_tag="HVO_3021"
FT   tRNA            complement(408343..408423)
FT                   /locus_tag="HVO_3021"
FT                   /product="tRNA-Ser"
FT   gene            complement(408453..408659)
FT                   /locus_tag="HVO_0458A"
FT   CDS_pept        complement(408453..408659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0458A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0458A"
FT                   /db_xref="UniProtKB/TrEMBL:L9UM12"
FT                   /protein_id="AOP12811.1"
FT                   /translation="MARRVRSALAWGAASLLLVGVLAQGAVLLGLGIDASFGVVAAVAV
FT                   ASGVAVASVTYVIEPRLERKGRA"
FT   gene            complement(408661..409047)
FT                   /gene="ridA1"
FT                   /locus_tag="HVO_0459"
FT   CDS_pept        complement(408661..409047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ridA1"
FT                   /locus_tag="HVO_0459"
FT                   /product="enamine/imine deaminase"
FT                   /EC_number="3.5.99.10"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04640"
FT                   /db_xref="GOA:D4GRZ9"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D4GRZ9"
FT                   /protein_id="ADE04640.1"
FT                   /translation="MKRVIETDEAPAAVGAYSQATTNGSLLYTAGQIPLTPDGELLDDE
FT                   DIATQTTQSLDNVMAILAEAGADATDVLKTTVFLADIDDFDEMNETYATYFDEEPPARS
FT                   AVEVGNLPKGVGVEIEAVAVVDEE"
FT   gene            complement(409132..409338)
FT                   /locus_tag="HVO_0460"
FT   CDS_pept        complement(409132..409338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0460"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02558"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS00"
FT                   /protein_id="ADE02558.1"
FT                   /translation="MATLPNTEPTAESLTKPLTLLGLGLVVVSVAVAGFALRDGDVVTA
FT                   LGMGLLFASGVLTTGISLSGKSV"
FT   gene            complement(409378..410376)
FT                   /gene="cydB"
FT                   /locus_tag="HVO_0461"
FT   CDS_pept        complement(409378..410376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydB"
FT                   /locus_tag="HVO_0461"
FT                   /product="cytochrome bd ubiquinol oxidase subunit II"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03593"
FT                   /db_xref="GOA:D4GS01"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS01"
FT                   /protein_id="ADE03593.1"
FT                   /translation="MTDYGAFATDPLFGLPLQELWFGLVFFILGMFLFLDGFDFGVGAI
FT                   FATRDDDEERETLLAAIGPFWDGNEVWLVVFGGALFAAFPAVYANLFSRHYLLMFAILG
FT                   ALILRGLAPEMYEQRHDEAWQTWWGRAFVVGSVSAPFFLGVFAAHWLLGVESLLSLPGV
FT                   VVGLAVVALTVVAGVGFLAMKTRGSLQRDVADYGPRAMAAYLALVVVTLGYLIAVRPDL
FT                   GVLAPIPLALVVVSLAAAAGYLLALRGGRYTLAFGAVPVLVFAFVALVATLMFPLADPA
FT                   TGLTVADAIISVLPLNIMSVASALLLPLVFTYFGILYSTFSGPIETGESYS"
FT   gene            complement(410369..411793)
FT                   /gene="cydA"
FT                   /locus_tag="HVO_0462"
FT   CDS_pept        complement(410369..411793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydA"
FT                   /locus_tag="HVO_0462"
FT                   /product="cytochrome bd ubiquinol oxidase subunit I"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02521"
FT                   /db_xref="GOA:D4GS02"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS02"
FT                   /protein_id="ADE02521.1"
FT                   /translation="MLDPVIASRLQFALTTIVHIIFPVMSMGLAPFLIYFTWKDIRTDD
FT                   PVYEQLRRFWTKIFAVSFVVGTVTGIVLEFEFGTNFAAFSTAAGELFGGPLATEGMMAF
FT                   MLEATFLGVFVFGREKVSDALYMVSAVAVGLGTWLSAVWILVANSWMQTPRGYELARES
FT                   GQLVVSLVDPIAAYANPRFPWMFVHMQNAAVLSVALFMAGVAAYHVWQRGISADDDRED
FT                   ARFWRKTLKIALVVLLVTAPFQAIHGDAYGRHVYETQPQKFAAMEAVWETDSYVPEYIF
FT                   AIPTSLDGITDPRAKELFGIGIPGGASWLASGGDPQAEITGLNEFDTEAPPVAIVFWSF
FT                   RLMVAAGFWFILLAFWAGYRWWADELYEDDLLHKAFVGSSLLGIFAVEVGWIVTEVGRQ
FT                   PWVIQGVLRTSEGVSPGLTSFEATLTLVGFAVVYTGLLALYTYVIRRIIREGPPSVDET
FT                   EAGAEAAAPAGVTGDD"
FT   gene            412138..412344
FT                   /locus_tag="HVO_0463A"
FT   CDS_pept        412138..412344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0463A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0463A"
FT                   /db_xref="UniProtKB/TrEMBL:L9UM07"
FT                   /protein_id="AOP12812.1"
FT                   /translation="MTLLWQAVHVGISVLGVAYLAFPARIHTFGFEFLRRSPSEESGAS
FT                   DAPVWLYRGIGALLVFIGATGLV"
FT   gene            complement(412389..413600)
FT                   /gene="ilvA1"
FT                   /locus_tag="HVO_0464"
FT   CDS_pept        complement(412389..413600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvA1"
FT                   /locus_tag="HVO_0464"
FT                   /product="threonine ammonia-lyase"
FT                   /EC_number="4.3.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04862"
FT                   /db_xref="GOA:D4GS04"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005789"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS04"
FT                   /protein_id="ADE04862.1"
FT                   /translation="MLTLDDVRAARERVEAVARRTPLEYSHTFSEMTGAEVYLKLENSQ
FT                   RTGSFKIRGATNRITTLSDEEKAAGVVTASAGNHAQGVALAASRAGVNSKIVMPEYAPI
FT                   SKVKATERYGGDVVLYGNDYDEAQTKAHEIEESEGRTYVHAFDDEYVMAGQGTIGLEIA
FT                   EDCPDLDTVVVPIGGGGLISGISTAIKEQYPDARVIGVQAEQASSAADSLNKGSIQTID
FT                   EVDTIADGIAVRRIGDKPFEVIRERVDEVVTVSDEEIAVALTYLLERSKTLVEGAGAVA
FT                   LAALVFQKFDYEEGEVVVPALCGGNIDMNTLTTVVMRGLVETGRYLKIRTELKDRPGSL
FT                   EQLIEIIAAEKANIYAVRHDRTSRKIALNATEVEIDLEMRGPDHVESLLEELRDAGYDV
FT                   EVLD"
FT   gene            413956..415347
FT                   /locus_tag="HVO_0465"
FT   CDS_pept        413956..415347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0465"
FT                   /product="MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04175"
FT                   /db_xref="GOA:D4GS05"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS05"
FT                   /protein_id="ADE04175.1"
FT                   /translation="MNLGRLRRVWKRIFSLAWPVMAEQTAQTAMRTVDVAVTAALSPAA
FT                   VVAIGLADLYARFPLRIGLGLGGGAIALSSQDTGSGADANRSEAISTALLLAFLAGIPF
FT                   LIFGFTLGGAAIDAFPASERAVALGTTYLAVIFATSPARLVSLVGSRSLQGVGDTRTPM
FT                   LVNVFANVVNIGLSVGLGFGLVGLPALGVLGVGLATSTANVLSAGLLLVALARPASPTS
FT                   LVRPRDRTVAGQLVRIATPRVGEGIAAELAEFPFNALLLGFGDAVNAGFQIGRRVYQQV
FT                   ASPLARGYNVAASVLVGQALGAGDSETARYQGGAVALLSVVTVGGIGLLLAAFTEPIVG
FT                   LVGSGGGTDLDWAVKFAVAYGLAAPGLALFVGLSGSLQGAGATRIPFVARLTGVFGFFV
FT                   GLSYLLVEGFGYGPLGARIGIVLSFTWMGLFALVAFSYADWAGHADSLMVERGSVGVDD
FT                   VGEDD"
FT   gene            complement(415459..416598)
FT                   /gene="citZ"
FT                   /locus_tag="HVO_0466"
FT   CDS_pept        complement(415459..416598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citZ"
FT                   /locus_tag="HVO_0466"
FT                   /product="citrate synthase"
FT                   /EC_number="2.3.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03756"
FT                   /db_xref="GOA:D4GS06"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR011278"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/Swiss-Prot:D4GS06"
FT                   /protein_id="ADE03756.1"
FT                   /translation="MSGELKRGLEGVLVAESKLSFIDGDAGQLVYCGYDIEDLARDASY
FT                   EEVLYLLWHGALPTGEELDAFSDELAAHRDLDDGVLDVARELAEQDESPMAALRTLVSA
FT                   MSAYDESADFEDVTDREVNLEKAKRITAKMPSVLAAYARFRRGDDYVEPDESLNHAANF
FT                   LYMLNGEEPNEVLAETFDMALVLHADHGLNASTFSAMVTSSTLSDLYSAVTSAIGTLSG
FT                   SLHGGANANVMRMLKDVDDSDMDPTEWVKDALDRGERVAGFGHRVYNVKDPRAKILGAK
FT                   SEALGEAAGDMKWYEMSVAIEEYIGEEKGLAPNVDFYSASTYYQMGIPIDLYTPIFAVS
FT                   RAGGWIAHVLEQYEDNRLIRPRARYTGEKDLDFTPVDER"
FT   gene            416899..418107
FT                   /gene="pchB"
FT                   /locus_tag="HVO_0467"
FT   CDS_pept        416899..418107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pchB"
FT                   /locus_tag="HVO_0467"
FT                   /product="PhoU/TrkA-C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02377"
FT                   /db_xref="GOA:D4GS07"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS07"
FT                   /protein_id="ADE02377.1"
FT                   /translation="MNPEDIEYEPVSVKAVLAEMKDTAELLIDLSYSAVLHANDDLAAE
FT                   VLDLEERMDILQLQARMSLMMAARSPEDAEELAPVLGVVGAAEKISDAAGDIAKVVIED
FT                   IGLPDAIRAALPEAVETTIRCELTDESPYAGRNLGDINMETETGVRVVAIHRAGEWVTN
FT                   PDHETTLRAGDVLLLRGRDDGLHTVHEAATGLRYDPPDVPEPTIEDLERAVDSIVLMKD
FT                   MSELAVDLAYGAVLFDSEGVAEEVEELEAEVDALKSRFEAWTLRAASRVEDPVSLRGLV
FT                   QLAGATEMISDAALEIAEGVLRGIDAHPVVAAAVKESDEVIIRLRVAPASDLAEATLGD
FT                   RRVKSETGMRVIAVRRAGGREWVVSPGSETRLHGGDLIIAKGTRAGAERLGELVGDERE
FT                   FDE"
FT   gene            complement(418158..418448)
FT                   /locus_tag="HVO_0468"
FT   CDS_pept        complement(418158..418448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0468"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04523"
FT                   /db_xref="GOA:D4GS08"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS08"
FT                   /protein_id="ADE04523.1"
FT                   /translation="MTDDVPERPPTGGLVQALDVPRNAAIGAAVGLALAVVAYLFRVLE
FT                   LFGPFAGTREYPILGPEGWFLLLAFVLASATALLVATVLTLVSAYRLSKTL"
FT   gene            418546..419502
FT                   /locus_tag="HVO_0469"
FT   CDS_pept        418546..419502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0469"
FT                   /product="AstE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04101"
FT                   /db_xref="GOA:D4GS09"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS09"
FT                   /protein_id="ADE04101.1"
FT                   /translation="MITLGTASAAPGEMDVGRLEVGESRDGGSVGLPVAVINGASSGKT
FT                   LYMQAASDGDELNGVGVIQRVVPQLDPADISGAILVVGIVNYHAFQVAQHRNPIDDTKM
FT                   NRAYPGDERGTSSERIAAATFAAARDADLIVDLHQGSTSRMIDEVRVRCGRHHRMHAKC
FT                   LRLAKTFGCGYVLDQKGPDGQLARAGPDAGIPTIDPELGGCVGWDEESIEKGVRGVHNV
FT                   LRGYDFLDGDVELKAQTRARGFDQYGSPVGGLVRFKRDLGERVSAGDVVFEVADVFGTL
FT                   KARVTADHNGIFWRARRLPQVASGEYVCSVGIDLDTY"
FT   gene            419599..420702
FT                   /gene="thrC1"
FT                   /locus_tag="HVO_0470"
FT   CDS_pept        419599..420702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrC1"
FT                   /locus_tag="HVO_0470"
FT                   /product="threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03056"
FT                   /db_xref="GOA:D4GS10"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS10"
FT                   /protein_id="ADE03056.1"
FT                   /translation="MTTPPDLPARLRLACDSCGETYDAWRWRCACGEPLDFAADPTPSA
FT                   ATPDDADLDYRDGLWAFDDFLPTEPRASLGEGMTPLVDAAEWEASFKLEYVFPSGSFKD
FT                   RGATTMLSLASELGVERVVEDSSGNAGAAVATYAARAGIDAEIYVPASVKPSKVRAIER
FT                   AGAKPVRIEGSRQAVTDACVEAVEADDAWYASHAWNPAFFAGTATVAYEIAAQRDWSVP
FT                   DAVVTPLGHGTLFLGAYRGFRALYEAGWTDRMPELYGAQAAGYSPIADARHHTADETND
FT                   VADGIQILDPVREAEIHEALDATGGDAIALSADAVEDELDRLHRHGFYTEPTCAVAPAA
FT                   LRELRLSGVLDRDADVVVPLTGSGLKS"
FT   gene            complement(420720..422078)
FT                   /locus_tag="HVO_0471"
FT   CDS_pept        complement(420720..422078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0471"
FT                   /product="uncharacterized protein"
FT                   /note="similar to lin2587"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03574"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS11"
FT                   /protein_id="ADE03574.1"
FT                   /translation="MTPPLPTREQLPDDLLERANWVGWRTQLCDGEETVVPRSATDGGP
FT                   ASATDDSTWATFDEALACAREGRVDGVGFAFTDDDPFVGIELENCRDAETGATDEWARA
FT                   LVDRLDSYTEVTPSGTGFRVIVRGTLPSGSARAGGLELSDVTRFRPVTGDCADGAPAAV
FT                   AERSDALATVHGAYFETDPEPSPSVDAVAPAASIDSVNPDAPNSDRAPADARLDEISGP
FT                   GNDLTDDEVVRRASNAVNGVAFTRLWRGDASGYDDRDEADAALCSMLAFWTAGDARQMC
FT                   RLFRDSGLFRPTWDEVVHADGSTYGARTVRRAIRETSEFYDPSGWSSAVRRSATQSDDD
FT                   RHRDRHRHPNRNRRDDDVVTDPARRPPASPGASPGDGRGGFDRLDELRARLDEVVDENE
FT                   RLRDELDAERERRRDLEARAGDRNVRAEARAGVENAGRGWSLVGWLRSWRALR"
FT   gene            complement(422204..422479)
FT                   /locus_tag="HVO_0472"
FT   CDS_pept        complement(422204..422479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0472"
FT                   /product="DUF2892 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02738"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS12"
FT                   /protein_id="ADE02738.1"
FT                   /translation="MEKNVGGYDRIARAVLGPVLIVVGAASLAGFLTIAAGTLGLVIAV
FT                   AALLVGAVLATTAVTQKCPPNDLLGVDTYEGATATETESAGKPRAQ"
FT   gene            422618..422818
FT                   /locus_tag="HVO_0473"
FT   CDS_pept        422618..422818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0473"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05094"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS13"
FT                   /protein_id="ADE05094.1"
FT                   /translation="MPRLSFLLPGEDDTIGRFLTLTLVIYAVISGFEILGVLWAMCLAM
FT                   AVWTLATAIQGFRYGYLEGAT"
FT   gene            complement(422870..423604)
FT                   /gene="pimT"
FT                   /locus_tag="HVO_0474"
FT   CDS_pept        complement(422870..423604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pimT"
FT                   /locus_tag="HVO_0474"
FT                   /product="protein-L-isoaspartate O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03024"
FT                   /db_xref="GOA:D4GS14"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS14"
FT                   /protein_id="ADE03024.1"
FT                   /translation="MDNSVLRDDMVDGLEHSLELLPEAVSIAMRSVPRHEFVTDSPYQN
FT                   RPTEHRDTNTTILAPTTVARLLAALDPQPDDEVLVVGAGVGYTAAVLAEIVGDARVHAV
FT                   DITRSLVYEARENLQRAGYGGVLVDCRDGAEGLADYAPFDRILVEASAVRPPARLLAQL
FT                   ADGGRLVMPKGVGEQTLVAVEDGEVAESFGPLSFKPLLVDGEQTGSIVRNRTRREDPEY
FT                   EGRGWHAGHGWEQDWIDWGGSG"
FT   gene            complement(423626..424564)
FT                   /locus_tag="HVO_0475"
FT   CDS_pept        complement(423626..424564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0475"
FT                   /product="homolog to S-adenosylmethionine-dependent
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03665"
FT                   /db_xref="GOA:D4GS15"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS15"
FT                   /protein_id="ADE03665.1"
FT                   /translation="MPTRDRSQSSVESLALLWAARESGVIDALTTSAGTAEAVADTAGI
FT                   DPRAARIAVEALAAMGFIKRVGDEYEITNRALGFLAKRDVRSIGRLPHALDRFSLYADL
FT                   PETMATGEPPAFPDDWLRNRLGAHDATEESVVRACVTAAVRAAPDATRVLDLGGASGVF
FT                   AREFVARGRDVTLVDDAETVEVARPLLSRAGVDLVAGDPADPPVSGVELVFAGDAFAGR
FT                   DPDDARALVAGAFDALEPGGAAVFVDSLHGRCSTDATAGRAVNALAAGRGDLHDEETVR
FT                   SWVESAGFDGCTVRDVPGTDLQAVVGERAVD"
FT   gene            complement(424661..425317)
FT                   /locus_tag="HVO_0476"
FT   CDS_pept        complement(424661..425317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0476"
FT                   /product="UCP015877 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04268"
FT                   /db_xref="InterPro:IPR012041"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS16"
FT                   /protein_id="ADE04268.1"
FT                   /translation="MSLPDAGERVPLSCPTCSPDEPTVHEVLKPGGHSTVRCTECSHVH
FT                   KEKVEIPDETEMNVVVSQDGDSVSTEVPVPVGTTIEVGDEFIVDTPEAIQLVRITGIEV
FT                   GPEQRADEAEVADVKTVWTRVVDNVAVNVTIHPKDGKREDTRSVTVNVPGDYEFVVGET
FT                   EAFGDEEVEIEGLVVRSDAPEYRHGKLDHPGDMVYAKDAKRVYARDQTSTAWSAW"
FT   gene            complement(425456..426415)
FT                   /gene="pepB3"
FT                   /locus_tag="HVO_0477"
FT   CDS_pept        complement(425456..426415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepB3"
FT                   /locus_tag="HVO_0477"
FT                   /product="aminopeptidase (homolog to leucyl aminopeptidase
FT                   / aminopeptidase T)"
FT                   /EC_number="3.4.11.-"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04886"
FT                   /db_xref="GOA:D4GS17"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS17"
FT                   /protein_id="ADE04886.1"
FT                   /translation="MTEADADLRAASETAVRQCLDLQPDESLVVVTDDKRERIGEALYE
FT                   VAGEVTDDATIVRYPPGNQHGEEPPAPVAAAMQACDAFLAPTTKSLSHTRARGDACDAG
FT                   ARGATLPGITEEVFVTGLDADYDAIYDHSAAMLDAVGGADELRVTTEKGTDITFVRGDR
FT                   EWLADTGAIAEAGSFSNLPAGEIFLSPASATGTYVVDGTMMPHGLLDEGRELRFEVEDG
FT                   YVTEISDDDIREQVEAAAEEVGDDAYNLAEIGIGTNVGVTDLVGSVLLDEKAAGTVHIA
FT                   VGDDAGIGGDTDAPLHLDGIIREPAVYADGEEVDLPQP"
FT   gene            426605..427672
FT                   /gene="gap1"
FT                   /locus_tag="HVO_0478"
FT   CDS_pept        426605..427672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gap1"
FT                   /locus_tag="HVO_0478"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase (NAD(P))
FT                   (phosphorylating)"
FT                   /EC_number="1.2.1.59"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04891"
FT                   /db_xref="GOA:D4GS18"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR006436"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS18"
FT                   /protein_id="ADE04891.1"
FT                   /translation="MIRVGVNGYGTIGKRVADAVHAQPDMELIGVAKTQPNFEAHTAGE
FT                   RGYPMYAAIPERSPLFSEAGVDLAGEVDELVAKADIIVDCTPSGIGAENRELYETHHTP
FT                   AIFQGGEDADVADVSFNARANFDAARDADYVRVVSCNTTGLSRIIAPLEAEYGVEKVRA
FT                   TLVRRGGDPGQNSRGPINDILPNPIEIPSHHGPDVKTIFPGLEIDTLGLKVPATLMHVH
FT                   ALNVTLEDDVTGAHVRQLLEGENRVYVIPEGMGIDGAGKLMDFALDAGRPRGDMWENCV
FT                   WGESIGVNGRDLYLFQAIHQQSDVIPENVDAIRAMFDTEDQQDSMALTDRTLGIGISGD
FT                   PSGFSEQARAEFADD"
FT   gene            complement(427742..428230)
FT                   /locus_tag="HVO_0479"
FT   CDS_pept        complement(427742..428230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0479"
FT                   /product="MJ0936 family phosphodiesterase"
FT                   /EC_number="3.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03225"
FT                   /db_xref="GOA:D4GS19"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041802"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS19"
FT                   /protein_id="ADE03225.1"
FT                   /translation="MKLGAVSDTHDNLDYVEAAVSHFESEGVDAVVHCGDIVAPFSAAP
FT                   FDADFDFHAVRGNNDGEWALREAVESFGTYHGDFAHLTLDGQEIAVYHGTEAGLVDALV
FT                   DSGTYDFVLRGHSHERVVEHRGATTHINPGGLPIPGADDAFHVAVVDLDTGNVASRSL"
FT   gene            428338..428637
FT                   /locus_tag="HVO_0479A"
FT   CDS_pept        428338..428637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0479A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0479A"
FT                   /db_xref="UniProtKB/TrEMBL:L9UP26"
FT                   /protein_id="AOP12813.1"
FT                   /translation="MSDDPNRHGDDIPDDEPTAATDSDGLVLETGDHGTVFTGAVLVGV
FT                   TTYSAAHTLAVRAAGSFPDGGLLTAVLTLGVFATGVGLLVDGAAGLVAKRDADL"
FT   gene            complement(428646..429851)
FT                   /gene="pgk"
FT                   /locus_tag="HVO_0480"
FT   CDS_pept        complement(428646..429851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="HVO_0480"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02369"
FT                   /db_xref="GOA:D4GS20"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS20"
FT                   /protein_id="ADE02369.1"
FT                   /translation="MFKTLDDLDPEQRVLVRLDLNSPVEDGEVQDNRRFDRHAETVREL
FT                   AEAGHRVVLMAHQGRPGGDDFVSLEQHADILASHIDREVGFVADTYGDDAIAAIDALEA
FT                   GDVLLLENTRMCDEELPEEDPEVKADTEFVRTLAEHVDAYVNDAYSAAHRSHASLVGFP
FT                   LVLPAYAGRVMQTEYEANSSIATREFDGQVTMVVGGTKATDVIDVMNNLGDKVDQFLLG
FT                   GIAGELFLRAAGNDVGFDLEGMDFFDDQWEANRETIESLLDERGDQIKLAVDLAYEDET
FT                   DDRGEIAVANITEKDRAYLDVGSMTVDEYDPIIRDSEAVFVKGALGLFEDERFAVGTTG
FT                   VLRAIAETDCFSVVGGGDTSRAIGMYGMDEADFGHVSIAGGAYIRALTGAPLAGVEALK
FT                   QD"
FT   gene            complement(429927..430979)
FT                   /gene="gap2"
FT                   /locus_tag="HVO_0481"
FT   CDS_pept        complement(429927..430979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gap2"
FT                   /locus_tag="HVO_0481"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase (NAD)
FT                   (phosphorylating)"
FT                   /EC_number="1.2.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03163"
FT                   /db_xref="GOA:D4GS21"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS21"
FT                   /protein_id="ADE03163.1"
FT                   /translation="MSEKSYLSAGENVDESDVVRVALNGFGRIGRNIFRAVLDNPKVEL
FT                   VAINDVMDFDDMAYLAKYDSVMGRLDGVERDGDSLSIGGTSVSLYNVQSPAELPWGELD
FT                   VDVALECTGIFRTKEDASAHLEAGADKVVISAPPKGDEPVKQIVYGVNHDEYDGEDIVS
FT                   NASCTTNSVTPVAKVLDEEFGIENGLLTTVHAYTGSQNLIDSPHAKQRRGRAAAENIVP
FT                   TTTGAAQAATEILPQLDGKLDGMAIRVPVPNGSLTELVVRLEDKPSVEEINDAFRAAAD
FT                   SGPLAGVLGYTDDEVTSRDILGLPFSSTVDLNTTNQVNDGGLYKILTWYDNEYGFSNRM
FT                   LDVAHFVTHQ"
FT   gene            431247..431609
FT                   /gene="hsp20C"
FT                   /locus_tag="HVO_0482"
FT   CDS_pept        431247..431609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsp20C"
FT                   /locus_tag="HVO_0482"
FT                   /product="Hsp20-type molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05167"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="InterPro:IPR040612"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS22"
FT                   /protein_id="ADE05167.1"
FT                   /translation="MVRDDRDDPFDNIFDEIERMMNDMTGGDAGFASETHIDMYDEGST
FT                   LRLVADLPGVDKDAIDLKCDGETLTISAAGDRREYDERIRLPARVDEHSASATFNNGVL
FT                   QVTFDRAEDSAAIDVE"
FT   gene            complement(431634..432506)
FT                   /locus_tag="HVO_0483"
FT   CDS_pept        complement(431634..432506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0483"
FT                   /product="ATP-grasp fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03039"
FT                   /db_xref="GOA:D4GS23"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS23"
FT                   /protein_id="ADE03039.1"
FT                   /translation="MLRLAVTTSSETFERMRGPLGNRGIDVGHLRAKEFALDLSTPPAE
FT                   SFDVGFVYPTRPMEGGVVTARHDVPWVNTREDVLTSRNKAGVIAALERAGLPVPRSVCV
FT                   SNPSDESDLLDAVESAGLDYPVVVKPNSTTRGVGIAKAHDPDSLSGHADVLGLVHDFRA
FT                   TGDKSFLIQEWLPEARDYRAMVLDGEVVGAVERRLSDGARDGGRWKHNVHRGAEAVGVT
FT                   LPKSHRELVESVADELGIRYLGVDLLESDGRVVVSETNARPTIDDDAKYDDGFFDRLAA
FT                   LVERVAKKS"
FT   gene            complement(432592..433122)
FT                   /gene="rpl16"
FT                   /locus_tag="HVO_0484"
FT   CDS_pept        complement(432592..433122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl16"
FT                   /locus_tag="HVO_0484"
FT                   /product="50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03558"
FT                   /db_xref="GOA:D4GS24"
FT                   /db_xref="InterPro:IPR001197"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR022981"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS24"
FT                   /protein_id="ADE03558.1"
FT                   /translation="MSDKPASMYREITNPAYTRREYITGIPGSKIAQHNMGDLQADPED
FT                   YPVQISLKVEEEVQIRHGSLESARLSANRLMLKHAGEKQYKMILRKFPHHVIRENKQAT
FT                   GAGADRVSDGMRQSFGKVVGTAARIPKGETVFTIYCDVEDAETAKDAFRRAYNKMSPPC
FT                   RIVVDRGEELLVA"
FT   gene            433283..433930
FT                   /gene="guaAa3"
FT                   /locus_tag="HVO_0485"
FT   CDS_pept        433283..433930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaAa3"
FT                   /locus_tag="HVO_0485"
FT                   /product="glutamine amidotransferase (homolog to GMP
FT                   synthase subunit A)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04341"
FT                   /db_xref="GOA:D4GS25"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS25"
FT                   /protein_id="ADE04341.1"
FT                   /translation="MLLVCDCMPADGPAYFTDALADLALDGREGAVHSIPADGLPTLSD
FT                   VDAVVLTGSTAGVYETDGRPWLDDARLLARDLVARELPTLGVCFGHQLVNDALGGTVEA
FT                   GDQRRGITDVNLDDDPLFDGVSGRIPMVHGDYVVAPGDRMETVASADYYDHLATRHEDA
FT                   PVWTVRYHPEFTAGLLDRIADDFGWPDDDADRDFDDVTADRTLENFVAAGLD"
FT   gene            complement(433931..434725)
FT                   /gene="nucS"
FT                   /locus_tag="HVO_0486"
FT   CDS_pept        complement(433931..434725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nucS"
FT                   /locus_tag="HVO_0486"
FT                   /product="endonuclease NucS"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03566"
FT                   /db_xref="GOA:D4GS26"
FT                   /db_xref="InterPro:IPR002793"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS26"
FT                   /protein_id="ADE03566.1"
FT                   /translation="MTVNTLHRPTHRDALVHLEAAFERGDMMTIFGRCTVDYDGRATSE
FT                   LGPGDRLVVLKPDGSILVHTDEKRTPVNWQPPGCTHSASVRDGRLRVRSTRTSPDERLD
FT                   VQFERVEQCSAYAVNDRSDLELVGSEEDLRQHILSDPDVLEPGFEPLETERQSDAGAID
FT                   IFGEDAAGVPVVVELKRRRVGPSAASQLRRYVDALHREFGDDEPIRGVLVAPSVTERAG
FT                   DMLDREGLEFVALDPETGEPPVEEDEGEAEESEKADDADADA"
FT   gene            434848..435303
FT                   /locus_tag="HVO_0487"
FT   CDS_pept        434848..435303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0487"
FT                   /product="FMN-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04422"
FT                   /db_xref="GOA:D4GS27"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS27"
FT                   /protein_id="ADE04422.1"
FT                   /translation="MAPDFAQHNRIEMPAEEIDRLLREEGVGVLSLADDGVAYGIPLSF
FT                   GYDADRGRLYFVFLRPGESSKKAEFAERTARASFTVWNAPSRDQWESVVVDGELHQVDD
FT                   GDWDRVRDALEDNAWYPTLFSETEPMQDILGWELRIDSRSGLQRRRA"
FT   gene            435432..435830
FT                   /locus_tag="HVO_0488"
FT   CDS_pept        435432..435830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0488"
FT                   /product="HTH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04958"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS28"
FT                   /protein_id="ADE04958.1"
FT                   /translation="MNTSSASAVEQSLTRNSRRSHVLSDPSSALSALSDGDSRRILAAC
FT                   DEAPRTAQECAELCDVPLSTVYRKLDLLTEASLLDERLRVQTATHHPREFATNFDTLSF
FT                   SFDDAGVSLAFRQIATDGGEDGAEGRSR"
FT   gene            435901..436059
FT                   /locus_tag="HVO_0489"
FT   CDS_pept        435901..436059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0489"
FT                   /product="small CPxCG-related zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02456"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS29"
FT                   /protein_id="ADE02456.1"
FT                   /translation="MSATTTDDYEFTCSQCGEGFAVNGGMRAAVLERGCPICGSPVSAD
FT                   AFDPCPA"
FT   gene            436184..436330
FT                   /locus_tag="HVO_0490"
FT   CDS_pept        436184..436330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0490"
FT                   /product="small CPxCG-related zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03324"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS30"
FT                   /protein_id="ADE03324.1"
FT                   /translation="MSDSADYTFVCPECAESMLVNDSMRDAPLENGCVVCSAALTTDAF
FT                   SAT"
FT   gene            436448..436909
FT                   /locus_tag="HVO_0491"
FT   CDS_pept        436448..436909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0491"
FT                   /product="FMN-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03930"
FT                   /db_xref="GOA:D4GS31"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS31"
FT                   /protein_id="ADE03930.1"
FT                   /translation="MSLDQQTELSPDEIREVLSRHETGVLSLAKADEPYAIPISYGYDG
FT                   ESGRFYLRLVSTPESEKRQFLTSSPRARLVVHESNDGSYRSIIAEGTLERVDPDELTVE
FT                   RIVQYGKAKRPLFEIWGETKRDLDIQLFELDPETLGGRAVELDAPESDQ"
FT   gene            437012..437659
FT                   /gene="boa1"
FT                   /locus_tag="HVO_0492"
FT   CDS_pept        437012..437659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="boa1"
FT                   /locus_tag="HVO_0492"
FT                   /product="HTH-10 family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04983"
FT                   /db_xref="InterPro:IPR007050"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS32"
FT                   /protein_id="ADE04983.1"
FT                   /translation="MPAGIRATVEFDSPSVCPVASVAHSTDSVVDSVSTSVVSTPGEVS
FT                   VSEFVLEADDPPDASALEPIFSYGSKHLYRYTHDGSADCPCECLGEFGCPVDRYFAQRG
FT                   SLTLVFHAADYEQLQAVIGELRDRFPGLDIKRLVRSPTGDAPGDSVFVDRGKLTTRQLE
FT                   VLQTAYDMGYFERPRGANATEVAAELDINQSTFSEHLAAALTKLLGDVLEEG"
FT   gene            437774..438166
FT                   /locus_tag="HVO_0493"
FT   CDS_pept        437774..438166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0493"
FT                   /product="HTH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS33"
FT                   /protein_id="ADE02881.1"
FT                   /translation="MSQASLPFDFRSATAASEPRVVDDHDEVDALFSLLEDDDCRRILD
FT                   ATDGIARSASELSEACDLPLSTTYRKLDPLVDAGLLSKRLRISRSGTHTAEYERTVDDV
FT                   TVSVTPSGVEVRVSHRDVAQSASVTA"
FT   gene            438284..439078
FT                   /locus_tag="HVO_0494"
FT   CDS_pept        438284..439078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0494"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02731"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS34"
FT                   /protein_id="ADE02731.1"
FT                   /translation="MYSNRIPVLLIAVLVLLAGCAGGADVAPAADADDTDTPTDGGGSA
FT                   DTGASSDGDDFELSDPERLLRDAGSFTVSWSYTGVETAVTREFAADLDAERSYSRTTST
FT                   TDGQSDAGGVEQYVADGVTYVRVGGDDEATYTSYEGSTEVLAAAIALSQARAYGADDDL
FT                   TFAGTETFDGASVERYELSAANEALILAGSAAAQGEPGTLEVTSFEYVVLVDEDGLSRH
FT                   ESWSFSGRMDDGSEVSGSWEYSLTGVGSTTVEEPAWLDEARA"
FT   gene            complement(439239..439312)
FT                   /locus_tag="HVO_3022"
FT   tRNA            complement(439239..439312)
FT                   /locus_tag="HVO_3022"
FT                   /product="tRNA-Phe"
FT   gene            complement(439362..440087)
FT                   /locus_tag="HVO_0496"
FT   CDS_pept        complement(439362..440087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0496"
FT                   /product="DUF2270 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04833"
FT                   /db_xref="InterPro:IPR014470"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS35"
FT                   /protein_id="ADE04833.1"
FT                   /translation="MSDDGELEPPAGMDDTHIGAGVFDETMGPGSSFAHLYRGEIHRMK
FT                   SWRERLDRTSNWAITLMAGILTWSFSAQTHPHYLILLGVVTLSIFLSIEARRFRAYDIW
FT                   RSRVRLIQQNVWAYALDPDGGVLDENWREKLGEDYRTPNMKIPFEEALAHRLRRVYLPL
FT                   FLVMLAAWVIQLTTYTDGTTPVGSAGIGGVPGNIIVAFVAGFYATLLGISFRPREWHVN
FT                   GELIPSDVTGWEESEYGGS"
FT   gene            complement(440257..440451)
FT                   /gene="cspA1"
FT                   /locus_tag="HVO_0497"
FT   CDS_pept        complement(440257..440451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspA1"
FT                   /locus_tag="HVO_0497"
FT                   /product="cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03870"
FT                   /db_xref="GOA:D4GS36"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS36"
FT                   /protein_id="ADE03870.1"
FT                   /translation="MAKGKVDFFNDTGGYGFISTDDADDDVFFHMEDVGGPDLEEGQEV
FT                   EFDIEQAPKGPRATNVTRL"
FT   gene            complement(440611..440805)
FT                   /gene="cspA2"
FT                   /gene_synonym="cmi9"
FT                   /locus_tag="HVO_0498"
FT   CDS_pept        complement(440611..440805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspA2"
FT                   /gene_synonym="cmi9"
FT                   /locus_tag="HVO_0498"
FT                   /product="cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03706"
FT                   /db_xref="GOA:D4GS37"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS37"
FT                   /protein_id="ADE03706.1"
FT                   /translation="MAKGKVDFFNDTGGYGFISTDDADDDVFFHMEDVGGPDLEEGQEI
FT                   EFDIEQAPKGPRATNVTRL"
FT   gene            complement(441236..441309)
FT                   /locus_tag="HVO_3023"
FT   tRNA            complement(441236..441309)
FT                   /locus_tag="HVO_3023"
FT                   /product="tRNA-Phe"
FT   gene            complement(441371..442039)
FT                   /locus_tag="HVO_0500"
FT   CDS_pept        complement(441371..442039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0500"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03382"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS38"
FT                   /protein_id="ADE03382.1"
FT                   /translation="MGTRRLIRALGLAGIGVVGTYLLAVRPWHRRWGTTDDEATGWLPG
FT                   DDFAGDADVSSTRAITIMAPARAVWPWLVQLGQGRGGFYSYERLENLFGLQIHNADRIL
FT                   PQHQRLDVGDEIRLGPPGSGAPSFRVAFVDTERCLVLSAPGWETGESRATWSFALHEVV
FT                   PGATRLVVRFRGRSETLRERAVNRLVVEPVQFTMERKMLKGIRSRAERARASATGGRHR
FT                   "
FT   gene            complement(442085..442483)
FT                   /locus_tag="HVO_0501"
FT   CDS_pept        complement(442085..442483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0501"
FT                   /product="VanZ family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04927"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS39"
FT                   /protein_id="ADE04927.1"
FT                   /translation="MNPITRLRENPRWAAVALGCALGVFAASVAPTPPGSLAPMGPLGV
FT                   VGLDKWVHAAGYAGLGFAFASAVRARGRDEVAAAVLAAGAFGAGIELVQAVLPYRSFGV
FT                   ADAGANLAGAVLGGVVWVAAVRVADARG"
FT   gene            442587..442790
FT                   /locus_tag="HVO_0502"
FT   CDS_pept        442587..442790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0502"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04628"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS40"
FT                   /protein_id="ADE04628.1"
FT                   /translation="MSLLPRWFTSKNFAVQLVILALVLDPVGFVGGYLLGPSLGVDPLV
FT                   GGAFGLVAASVPMSLLVMQRSV"
FT   gene            complement(443018..443091)
FT                   /locus_tag="HVO_3024"
FT   tRNA            complement(443018..443091)
FT                   /locus_tag="HVO_3024"
FT                   /product="tRNA-Val"
FT   gene            443185..443682
FT                   /locus_tag="HVO_0504"
FT   CDS_pept        443185..443682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0504"
FT                   /product="DUF192 family protein"
FT                   /note="COG1430"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04057"
FT                   /db_xref="InterPro:IPR003795"
FT                   /db_xref="InterPro:IPR038695"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS41"
FT                   /protein_id="ADE04057.1"
FT                   /translation="MTSRARTALLVVAVVVAVASVAYLTNPAVVPGSTDGYERTTLTVV
FT                   DDETGETLATVNARVADTRAKRFTGLSDTESLAENEGMWFVHDSSGTYAYVMRDMDFPL
FT                   DIVFVAENGTITRIHHAELDPEGTSESDLTRYRGTGKYVLELPYGYTNETGIDAGDRVE
FT                   VE"
FT   gene            443723..443992
FT                   /locus_tag="HVO_0505"
FT   CDS_pept        443723..443992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0505"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04856"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS42"
FT                   /protein_id="ADE04856.1"
FT                   /translation="MTAHVAALSELEGWRAEEFAARVHYRGADDAYSIEYYEPSDCVLY
FT                   WKVKGDGEVAVPVGRDTVPDPLRERVRQDLVEAGVDPEVEDRVV"
FT   gene            444097..446034
FT                   /locus_tag="HVO_0506"
FT   CDS_pept        444097..446034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0506"
FT                   /product="ABC-type transport system ATP-binding/permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03789"
FT                   /db_xref="GOA:D4GS43"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS43"
FT                   /protein_id="ADE03789.1"
FT                   /translation="MSPETDDDPFEDQRERVDNPMRRLFAEYGRENTFEFVVGVLASVA
FT                   ARVLDLMPPVILGLAIDAIIRQETSFAAGFPVLPEAWITPYVPATRDGQFLLAVGIIVF
FT                   SFTAGAVFHWLRNWGWNAYAQQIQHDVRTDTYDRMQLLNMDFFADKQTGEMMSILSNDV
FT                   NRLERFLNDGMNSFFRLFVMVVAIAVVLLSYNWQLALVALLPVPLIALFTWKFVDIIQP
FT                   KYADVRSSVGKLNSRLENNLGGIQVIKTFNAESHESDRVDGVSMDYFDANWDAINTRIK
FT                   FFPALRILAGIGFSLTFVVGGLWVINGQGPGPFTGDLEIGEFVTFILLTQQFVWPLAQF
FT                   GQIINMYQRAHASSARIFGLMDEPARLAEQPDAPDLAVSEGRVEYDDVTFGYGDGETVV
FT                   EDISFEVDGGETLALVGPTGGGKSTILKLLMRMYDPDEGHVNIDGQDVRDVTISSLRES
FT                   IAYVSQETFLFYGTVRDNITYGTFDADDEAVVAAAKAAEAHEFISNLPEGYDTKVGERG
FT                   VKLSGGQRQRVSIARAILKDPDILVLDEATSDVDTETEMLIQRSLDELTADRTTFSIAH
FT                   RLSTIKDAEQIVVLEDGRIVERGAHDDLLSEDGLYAHLWGVQAGEIDQLPDEFVERAAR
FT                   RQAEVDAGDD"
FT   gene            446078..446800
FT                   /gene="cre1"
FT                   /locus_tag="HVO_0507"
FT   CDS_pept        446078..446800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cre1"
FT                   /locus_tag="HVO_0507"
FT                   /product="creatininase"
FT                   /EC_number="3.5.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03369"
FT                   /db_xref="GOA:D4GS44"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS44"
FT                   /protein_id="ADE03369.1"
FT                   /translation="MRLSEATWTEVADLDGDLALLPVGSTEQHGPHAPLGTDALNAESV
FT                   AEVGADAFDGEVVVGPTIPVSVAEEHRAFDGTLWVSPDTFRAYVRETIESLAHHGFDRV
FT                   VVVNGHGGNIDALAELCRRVSRTGDVYAVAFTWFDAVGDHSSDMGHGGPLETALLRHTH
FT                   PELVREDRIDEARDGGADRWGEWVSGVNLAHDSDEFTDNGVVGDPAKGDADRGAELESL
FT                   AADSLASLLDAVESRKLD"
FT   gene            complement(446839..447285)
FT                   /locus_tag="HVO_0508"
FT   CDS_pept        complement(446839..447285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0508"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03137"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS45"
FT                   /protein_id="ADE03137.1"
FT                   /translation="MSQSTLGDDDLFGEAAAEMRADVEEHLGEARSALPDPDDVWEADA
FT                   DNVLGVLNGLRSSLDVEGAAEHVRQAKKWYVIGQRAEAFDDPEDLEAAIEELEALIEMV
FT                   EEAHELVGELTNTMPQLRGALTDAAEAAEAASADEDEDEDEEEE"
FT   gene            complement(447374..447841)
FT                   /locus_tag="HVO_0509"
FT   CDS_pept        complement(447374..447841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0509"
FT                   /product="NUDIX family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02294"
FT                   /db_xref="GOA:D4GS46"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS46"
FT                   /protein_id="ADE02294.1"
FT                   /translation="MTRPRSAARGLLVRDGELLAIQYRTDGEDWYVAPGGGQQRGESLA
FT                   ETVRREVYEETGYEVAVGSLAYVRDFVPSTHYEDRDDGHQVDHFFWCERVGDEPDDPTE
FT                   RDSVQVGVRWLPLDELGEVRFFPGPLGDRLRSGDSDEMGDARGAVYLGDVD"
FT   gene            complement(447838..448179)
FT                   /gene="mptD"
FT                   /locus_tag="HVO_0510"
FT   CDS_pept        complement(447838..448179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mptD"
FT                   /locus_tag="HVO_0510"
FT                   /product="dihydroneopterin aldolase, archaeal-type"
FT                   /EC_number="4.1.2.25"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04188"
FT                   /db_xref="GOA:D4GS47"
FT                   /db_xref="InterPro:IPR007181"
FT                   /db_xref="InterPro:IPR027508"
FT                   /db_xref="InterPro:IPR036839"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS47"
FT                   /protein_id="ADE04188.1"
FT                   /translation="MVTDPQTACFEAGIKFGTLYHQFAGTPVSPDSARSLERAMAEAIE
FT                   NQPHCESVSVHILDDALDAELAGSTADYTELTGRFMEVEMEIDYEGVRVRTEMEMEDGY
FT                   PLMKIVSVE"
FT   gene            448281..449069
FT                   /gene="azf"
FT                   /locus_tag="HVO_0511"
FT   CDS_pept        448281..449069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="azf"
FT                   /locus_tag="HVO_0511"
FT                   /product="glucose-6-phosphate 1-dehydrogenase (NAD)"
FT                   /EC_number="1.1.1.388"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03728"
FT                   /db_xref="GOA:D4GS48"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR032884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:D4GS48"
FT                   /protein_id="ADE03728.1"
FT                   /translation="MDQPVLLTGAGGRVGQAILGHIGDAYDWRLLDREPLSDEKIPDSV
FT                   DSTEVYVADVTDETAVRNAMDGVHAVIHLAGDPRPEAPWDSVLRNNIDGTQQMFDAAVD
FT                   VGVEKFAFASSNHAVGAYETTDRTPDMYRPHHEFRLDGTELPRPSNLYGVSKAAGETLG
FT                   RYYHDHHDISVVNVRIGNLTQHHPPKEYERGQAMWLSYRDCGHLFECCIEADYDYEIVY
FT                   GISDNDRKYYSIDRARAVLGYDPQDNSAEFTFEGEPLDEA"
FT   gene            complement(449134..449559)
FT                   /locus_tag="HVO_0512"
FT   CDS_pept        complement(449134..449559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0512"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04773"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS49"
FT                   /protein_id="ADE04773.1"
FT                   /translation="MAATAARRIALLLTVVTLLLVSLAPWGPIETRSFEHLSPVVYWGF
FT                   NAFLILLGLGSFATAYRLWSGNTDALLVAVVAGVLYIAVYGLDLAGIFPTSPDAMPPLL
FT                   FAIEVVDTALAVVLVVYSYWVWNRANPHRGRGETRTS"
FT   gene            449668..450342
FT                   /locus_tag="HVO_0513"
FT   CDS_pept        449668..450342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0513"
FT                   /product="HTH-10 family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03991"
FT                   /db_xref="GOA:D4GS50"
FT                   /db_xref="InterPro:IPR007050"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS50"
FT                   /protein_id="ADE03991.1"
FT                   /translation="MRYTTLRLGWDDTELHPLTEAFTDDAGVTIESLHYVNSVDDGGYT
FT                   ELSRLRGDLDAAREILDSISEVRAFDVSAAGIAYIHYESSPLMDRLLAVVFDHAVVLTW
FT                   PVTFARPNGNLSAQLTLLGTEDALSHAIATIPAEIDVSLVRTGRYEASVHDPLSSLTDR
FT                   QREVLDVAVRAGYYEVPREATHREIAAELAVAPGTVSEHLQRIEANLVSALVGATGADG
FT                   EP"
FT   gene            complement(450349..450960)
FT                   /locus_tag="HVO_0514"
FT   CDS_pept        complement(450349..450960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0514"
FT                   /product="DUF309 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03283"
FT                   /db_xref="InterPro:IPR005500"
FT                   /db_xref="InterPro:IPR023203"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS51"
FT                   /protein_id="ADE03283.1"
FT                   /translation="MDDSLRAGVAIYNAGAYRAAHGAWESKWLSLERDTDDERFLHGLI
FT                   QFTAAVHHARDGNDSGAVGLARSAREYLDGLADDYRGVDLAGVRESLARLEADPGVAAD
FT                   PPALRLDDRVVTYDDLDFDAVAVAAETLAEELDGYDESVVADAVGYAHEEVADGEQTQF
FT                   TAMVFDFVRNEAQRGLVFQRLSEHVRRRRRREDDVSGLFD"
FT   gene            451105..451329
FT                   /locus_tag="HVO_0515"
FT   CDS_pept        451105..451329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0515"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03567"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS52"
FT                   /protein_id="ADE03567.1"
FT                   /translation="MTQSPVCIRCGEQYLFTRAYKGNYCRDCHGSWAAKPRSEEAPRPR
FT                   PQRSRTTSSVRRREDDERSPGLEPPYDEA"
FT   gene            451494..452177
FT                   /locus_tag="HVO_0516"
FT   CDS_pept        451494..452177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0516"
FT                   /product="SGNH-type esterase (homolog to rhamnogalacturonan
FT                   acetylesterase)"
FT                   /EC_number="3.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02638"
FT                   /db_xref="GOA:D4GS53"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR037459"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS53"
FT                   /protein_id="ADE02638.1"
FT                   /translation="MSSESITVHLVGDSTMADKEAHERPETGWGMPFADRFDDAVTVAN
FT                   HARNGRSTRTFLEEGRWRPVARQLTETDYVFVQFGHNDEVPSKEQHTTEAAFVDNLRKF
FT                   VGETREQGATPVFLTPIARRQFDDGGVPKDTHRAYADLTRTVALDRDVPLIDMDERTRA
FT                   LLAELGPDASTALYNHLEPGEHSNYPEGIADDTHFSEHGARRMADVVLGGVAELDLGLA
FT                   AHVES"
FT   gene            452571..453080
FT                   /locus_tag="HVO_0518"
FT   CDS_pept        452571..453080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0518"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05187"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS54"
FT                   /protein_id="ADE05187.1"
FT                   /translation="MNRRALLLGTAGLCASLAGCASGGDAAEGSTASTGTETGTASPTA
FT                   TGTSRRPRLVGRSFTPVRADACSADGGALASETETGVSVVGCVTGATDCSIARLARADY
FT                   DAASDTATLVVETVERADAENCAESPVVRGYEATLRFESGLPGRAVVVHDDADGRREVA
FT                   RIDMDA"
FT   gene            453269..454720
FT                   /gene="rpa2"
FT                   /locus_tag="HVO_0519"
FT   CDS_pept        453269..454720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpa2"
FT                   /locus_tag="HVO_0519"
FT                   /product="replication protein A"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04299"
FT                   /db_xref="GOA:D4GS55"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS55"
FT                   /protein_id="ADE04299.1"
FT                   /translation="MGVIREVYDDLDTDVEFEEFEAAVNDKVEQMGGLADEETAAMLIA
FT                   HELRDEEVNGIADIEPGMEDVKFLAKVVSIGEVRTFERDGEDEDGRVVNIEVADETGRI
FT                   RVSLWDEMAAGAKENLEVGTVLRIGGRPKDGYNGVEVSASKVEEDLDAEVDVQVLDSYR
FT                   VEDLALGLSDVNLEGKILDAGTVRTFDRDDGTEGRVSNLSVGDPTGRVRVTLWDERADL
FT                   AEELEPGQSVEVVDGYVRERDGSLELHVGSRGAVEPIDEDIEYVPETTDIGSLELGQTV
FT                   DIAGGVIEADGKRTFDRDDGSEGQVRNIRVKDGTGDIRVALWGEKADADVDLADYVVIT
FT                   DAEIKEGWQEDLEASAGWRSSVAVMDEAPEGAAGTDAGGSAPTPPSDEGLGAFSGDGSS
FT                   DDTSAANGGSSSDASAAESTGEAVEFTGTVVQAGTPVILDDGTQTKTVDTDADLGLGDE
FT                   VTVSGTETDGRISAESVEVHTGAQQ"
FT   gene            454913..455344
FT                   /gene="hstA"
FT                   /locus_tag="HVO_0520"
FT   CDS_pept        454913..455344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hstA"
FT                   /locus_tag="HVO_0520"
FT                   /product="archaeal histone"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04545"
FT                   /db_xref="GOA:D4GS56"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS56"
FT                   /protein_id="ADE04545.1"
FT                   /translation="MSVELPFAPVDAIIRQNAGELRVSAGAAEALARRIQDRGAELAID
FT                   AADRATADGRKTLMAEDFGVQQVVDRDELSLPIAPIDRIARLRIDDRYRVAMDARIALA
FT                   DILEDYAVNVADAAVKLAHHADRRTVQSEDIETYFSLFE"
FT   gene            455344..456357
FT                   /gene="hda1"
FT                   /gene_synonym="hdal"
FT                   /locus_tag="HVO_0522"
FT   CDS_pept        455344..456357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hda1"
FT                   /gene_synonym="hdal"
FT                   /locus_tag="HVO_0522"
FT                   /product="HdaI-type histone deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04125"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS57"
FT                   /protein_id="ADE04125.1"
FT                   /translation="MQFGYSETCLDHDTGPRHPETADRLRAIRRGLAKRHGVEYVDASP
FT                   AEKSTVAAVHDDGYVDEFHEFCRDGGGNWDPDTVAVEASWDAALTSAGLAEWAARAALD
FT                   GDDGRNTPFSLGRPPGHHAVEDDAMGFCFFNNAAVAAQAVIDDGLAERVAIFDWDVHHG
FT                   NGTQDIFYDRGDVFYTSIHEDGLYPGTGEVDETGEGDGEGSTLNVPLHAGAGDADYVYS
FT                   FDEAIAPAVERFDPDLFIVSAGFDAHRHDPISRMRVSTEGYAMLTECVQELCEETDAAI
FT                   AFVLEGGYGLDTLSEGVATVHETFDGRIAMDPEEDPDEKNVELVDDVRAAHGLGAK"
FT   gene            complement(456336..457715)
FT                   /gene="cca"
FT                   /locus_tag="HVO_0521"
FT   CDS_pept        complement(456336..457715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cca"
FT                   /locus_tag="HVO_0521"
FT                   /product="tRNA adenylyltransferase, CCA-adding"
FT                   /EC_number="2.7.7.72"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03282"
FT                   /db_xref="GOA:D4GS58"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR008229"
FT                   /db_xref="InterPro:IPR011068"
FT                   /db_xref="InterPro:IPR015329"
FT                   /db_xref="InterPro:IPR042090"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS58"
FT                   /protein_id="ADE03282.1"
FT                   /translation="MTNSDLAAVVAAVRERIDPDEAERRALADAAAALESRVYDALADL
FT                   PVDADALQVGSTARGTWLSGDRDIDLFVRFPADLDREELEAYGLEVGHAVLPDGHEEYA
FT                   EHPYVKGDYDGFDVDLVPCYDVPSASDIRSAVDRTPFHNAYLTERLDDDLAADVRVFKR
FT                   FLKGIDAYGSDLRTEGFSGYLAELLVVGHGGFEPLLRAAADWSPQVEFDPEDHGTRRFS
FT                   DPLVVIDPTDPERNVAAVCSAENVARLQHYARDLLSDPRESLFFRPDPPALDADGVRSH
FT                   LDRRGTTAVAVVFDCPDLVDDQLYPQLRKSLTGVADGLDRRGFDVFRRAAFADTDGEGQ
FT                   GEAALFAELSVAERPAVERHEGPPVHVRQHAEGFYGAYEDREDHYGPFLDGDRYVVERE
FT                   REFTTAAGFLESDALFDVALGKHVESTLREDGYDVLVGGDVAALAEAFGAELGRYFAPR
FT                   P"
FT   gene            457852..457924
FT                   /locus_tag="HVO_3025"
FT   tRNA            457852..457924
FT                   /locus_tag="HVO_3025"
FT                   /product="tRNA-Asn"
FT   gene            458021..458095
FT                   /locus_tag="HVO_3026"
FT   tRNA            458021..458095
FT                   /locus_tag="HVO_3026"
FT                   /product="tRNA-Met"
FT   gene            458267..458407
FT                   /locus_tag="HVO_0525"
FT   CDS_pept        458267..458407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0525"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02786"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS59"
FT                   /protein_id="ADE02786.1"
FT                   /translation="MSRARRETNLWRYVRYVCGSCKAWCLVDHAERAAMPSSGTTGAAP
FT                   T"
FT   gene            458677..459087
FT                   /locus_tag="HVO_0526"
FT   CDS_pept        458677..459087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0526"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02988"
FT                   /db_xref="GOA:D4GS60"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS60"
FT                   /protein_id="ADE02988.1"
FT                   /translation="MIDPKHAEFVESVMNGEDDSEPESFRRASLSSEWRLEAIIDRDGE
FT                   EHLPGGGGVDMAPLKLPVQRVLQETRLQYTLQKGEMWRCSECNVGIYQTEWMARHLVEQ
FT                   HGLDRPESADHVLHVEDYFDKDRECMRHPGCG"
FT   gene            complement(459341..459817)
FT                   /locus_tag="HVO_0527"
FT   CDS_pept        complement(459341..459817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0527"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05122"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS61"
FT                   /protein_id="ADE05122.1"
FT                   /translation="MNGDLCHQVNLATEEVVKVLELSQLVQDVTPRQIRSKIIAIGGKP
FT                   VEEIEAHYEILKTGGPANAGARFTQFPKKVLWGDFHKYISESYANYTPRIRDQLRVKQT
FT                   LGYYIDARDPHRPVEGKMLSACSAIEMLALWHAREDCISEKTDPKIKNLIKNWT"
FT   gene            complement(460194..461360)
FT                   /locus_tag="HVO_0528"
FT   CDS_pept        complement(460194..461360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0528"
FT                   /product="ISH3-type transposase ISH51"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04818"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS62"
FT                   /protein_id="ADE04818.1"
FT                   /translation="MSNNQQTDDEIHEDQLLNFLVNSLDEEVALSLAENAELDAEDIYE
FT                   VLVGACADGTSVSTLCERSEDAPHENSVLYHLRTKFGLETLEQVGNMLLQKDVLDVLPQ
FT                   QVEVCADLHLRPYYGDEDDTDGLYHSQAKRGTTAFHAYATLYARVKNKRYTLAVRRLED
FT                   GDTASSVLAEFLGILDGLDLGVKAVYLDREFYDSKCLTLLQAHNHAYVMPIVRWGRTIK
FT                   QELSEGWSRVIQHSLTAKLDGHSWTVEFPVYIDCTYQNGRYDEHGVARHGYAADAPFID
FT                   SPRDARYHYAKRFGIEASYRLSEQSIATTSTQNPVVRLLYVVVSLLLQNVWRYLHWEYV
FT                   ATPRRGGRRLWEWSFKEFINMVRRAAWTALAVRRAVPANRPPDDRFSR"
FT   gene            461409..461756
FT                   /locus_tag="HVO_0529A"
FT   CDS_pept        461409..461756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0529A"
FT                   /product="homolog to pHK2-ORF2"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0529A"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1C9J6X5"
FT                   /protein_id="AOP12814.1"
FT                   /translation="MSFDDFEETQVEDDYDDGVEEIKFDVDEPVIGVIVDIEVYLYCPC
FT                   PFAESESRQPRRELARLSLSQRLRCPRSRQLFNFPAFVADSDDEPTVGGRRLRPGALSD
FT                   SLRLLNSESRR"
FT   gene            461838..463211
FT                   /gene="tsgA1"
FT                   /locus_tag="HVO_0530"
FT   CDS_pept        461838..463211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsgA1"
FT                   /locus_tag="HVO_0530"
FT                   /product="ABC-type transport system periplasmic
FT                   substrate-binding protein (probable substrate sugar)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04026"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS63"
FT                   /protein_id="ADE04026.1"
FT                   /translation="MSRDSQSNDNRLSRRQYVAGAGALATMGLAGCSGGGGSNDGGDGS
FT                   TTEAGGDGSTTEAGGDGGDGGSSAPVEVLHGWTGGDGAAAAEALEAAFNEAYPDVGLDM
FT                   NPIGGGGNQNLDAVVANRLQSDDPPGAFANWPGPNLLRYEGVLGSVDDVWEENNFEEVM
FT                   IDEAVELHQQGGSYRAVPLGSHRLNCLFYNVSVVDEAGIDVDSLNSPSALIDAFETVQS
FT                   ETDAVPMTHAMSGTWTTTQLWGAVMLAVNGYQPYMDFLNGEGSESAVRSAFETTAEMLE
FT                   NYISDDAASLNLTASNQNIINGNAAFIHQGNWAAGAFRNAENFAYDEDWGFKTFPGTEG
FT                   MYTLHMDSFLYPADNPTPEASKTWAAFVGSPEAQIAFNQYKGSIPTRTDVSMEEFGPYL
FT                   QETAEDFANAEYRPPNLQHGLGVPSETMTALNEVISSEFTGPYNVDAATQGFLDAVSN"
FT   gene            463222..464286
FT                   /gene="tsgB1"
FT                   /locus_tag="HVO_0531"
FT   CDS_pept        463222..464286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsgB1"
FT                   /locus_tag="HVO_0531"
FT                   /product="ABC-type transport system permease protein
FT                   (probable substrate sugar)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02852"
FT                   /db_xref="GOA:D4GS64"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS64"
FT                   /protein_id="ADE02852.1"
FT                   /translation="MSNFYQRVRRAITPGSADDQRVNDAGGERDAVRTDGGVVNEDSRS
FT                   PDSESGSLDRLAAGIDGLLGSDFLESSIFWVPPFLLMGLFVYGAVIWNFLISLTDYQRF
FT                   ANAPDYSNLDFEMYTRALADSGFIDAAVNTFILLVAFTAGTLAVGLILAILIDRGIRFE
FT                   NSFRTIYLLPMSLSFVVTAQFWLWIYNYNNGIANRVIGLVGVGPISWLGNQTIVLWAVI
FT                   FALMWQFSGYAMVVYLAGLRAIPDEHYEAAKVDGASTLKMYWRVIIPQLKGATISAAVV
FT                   LMVFGMKAFDFLYSLVGGYRPPNGADILATKMVREAYANLNWAYGAAIAIVLFAMALGV
FT                   IGPYLVYEYRRNNL"
FT   gene            464283..465227
FT                   /gene="tsgC1"
FT                   /locus_tag="HVO_0532"
FT   CDS_pept        464283..465227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsgC1"
FT                   /locus_tag="HVO_0532"
FT                   /product="ABC-type transport system permease protein
FT                   (probable substrate sugar)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04951"
FT                   /db_xref="GOA:D4GS65"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS65"
FT                   /protein_id="ADE04951.1"
FT                   /translation="MTDDTLRTDGGTATFTARLRRNVEQMTIEDAGLYVVLLLAAGFYL
FT                   VPIESGLVTSIKTGTAIVETAPFAPPGPSGFTLEKWQAAVEALLRGIGNSMLYAVPATV
FT                   ISAFVGSITAYGLTIPDWKQSYKALVLALIIAGIFIPYQAVLVPLTQFWSQWAQLTDLL
FT                   SFVWALGVPNDYVGIVELVVTHVAYGIPICTLLFRTYYKTMSEEMIESARLDGATLRRV
FT                   YRRIVFPLSGPMFAVVLIYQFTQIWNDLLFTLVLVSTESSPAAPVVLILAGLGTSLEGQ
FT                   DFALRMAGAFFAALPTLAVYIFFGDEFAEGVAA"
FT   gene            465348..466499
FT                   /gene="tsgD1"
FT                   /locus_tag="HVO_0534"
FT   CDS_pept        465348..466499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsgD1"
FT                   /locus_tag="HVO_0534"
FT                   /product="ABC-type transport system ATP-binding protein
FT                   (probable substrate sugar)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05135"
FT                   /db_xref="GOA:D4GS66"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS66"
FT                   /protein_id="ADE05135.1"
FT                   /translation="MATLELDSITKTFQDGDDEIVAVDDISMSIDDGEFLVVVGPSGCG
FT                   KSTTLRMIAGLETITSGTISLGDRVINDVASQDRDIAMVFQSYALYPHMTVRQNMSFGL
FT                   EESTDLPDDEIGRMVSETADLLDIPSLLDRKPSDLSGGQQQRVALGRAIVRDPEVFLMD
FT                   EPLSNLDAKLRAQMRTELQRLQDDLGVTTVYVTHDQTEAMTMGDRIAILDGGELQQIAT
FT                   PLECYHEPANQFVASFLGEPSMNFFDVTREGDRLVGDSFEYPVGAEIRDDIGDVTDLVL
FT                   GIRPESVELVEAASGDHDFEMTVDVVEPMGDENTLYLYFEPDADPETAETLVATTDGLT
FT                   RISPGETVVAQIPEEAIHFFDGRTGEALHNRSMEEAAQQIDLG"
FT   gene            complement(466545..467234)
FT                   /locus_tag="HVO_0535"
FT   CDS_pept        complement(466545..467234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0535"
FT                   /product="DUF4013 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04321"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS67"
FT                   /protein_id="ADE04321.1"
FT                   /translation="MSDVFVDALRYPFADRARVDGTATCLVALLVGGTLLRLAARLWPD
FT                   LTFLAPALAAVVPLVVFLGLVGGVLAGDGFPPLATTETLRLAGRVVGVASVYLFPAAVT
FT                   VVAVGYVTATGSIPAVLTGVTTAMLATVALLVTVVCAYLFPAATAVSVHEGLRAGLRRD
FT                   ALRGAASGTYFFAWVGAAVLVVLAWSALAATISRSVAALLALGWCAYAHVAAAALVAEG
FT                   VGRTTPW"
FT   gene            467702..468232
FT                   /gene="dpsA1"
FT                   /locus_tag="HVO_0536"
FT   CDS_pept        467702..468232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dpsA1"
FT                   /locus_tag="HVO_0536"
FT                   /product="ferritin"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03169"
FT                   /db_xref="GOA:D4GS68"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS68"
FT                   /protein_id="ADE03169.1"
FT                   /translation="MSTQKSVLKEAGSVGDNPVRLDTEKAEQIIEALNTDLADAYVLYH
FT                   QLHKHHWNVEGAEHLRIHEFLQEAYEEVEEAADEIAERLQSIGGVPHASMPALSEAATV
FT                   EPEDEDVYDIRTSLSNDLEMYGDIIESYREHIELAAGLGDHTTAHMLREQLIEIEEHAH
FT                   VIDHYLEDDTLVQ"
FT   gene            complement(468354..468521)
FT                   /locus_tag="HVO_0537"
FT   CDS_pept        complement(468354..468521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0537"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02298"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS69"
FT                   /protein_id="ADE02298.1"
FT                   /translation="MAAGTQSNSESVSEPDRPDSPEISVCKGGPGKSVFMESGNSDGWI
FT                   SSDVTIDVTR"
FT   gene            complement(468630..469064)
FT                   /locus_tag="HVO_0538"
FT   CDS_pept        complement(468630..469064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0538"
FT                   /product="SirR/DtxR family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03142"
FT                   /db_xref="GOA:D4GS70"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS70"
FT                   /protein_id="ADE03142.1"
FT                   /translation="MIGAPQYLLTLYIAEREDDEESPISPGYVADALDRSPPAATERLQ
FT                   NLDAKGLVDYEPYEGATLTAEGRDAAADLYDTYQILSRFCRDVLGVNDHEGEAMQLVGN
FT                   VSPTVAERLSATLLRGDGDRDGARQAAGSESTSSPDNPAS"
FT   gene            complement(469061..469891)
FT                   /locus_tag="HVO_0539"
FT   CDS_pept        complement(469061..469891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0539"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02307"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS71"
FT                   /protein_id="ADE02307.1"
FT                   /translation="MFGGADVVADCAADVRDALDRVASEREQVLAKRRAVERFERRVRK
FT                   LAAQSARPPAGTTRATACGTASVAAATRRDDAADEGRRRVRELFAETIRPHSVSDVSES
FT                   EPLAVTIREEFGPEVATALSPDAGSRFTPAAKEAVVSAATERQRGLDGMCRALDGEERS
FT                   LRAALAVLDECEDWVARADETPLSELGFDALRRRHETLAGHREACDRLVRERQRHLNGA
FT                   THHTAAVEVDHRFLATYLYEDRATDYPVLAAATRVDDSCADCQRAVRDHLVRRV"
FT   gene            complement(470089..470577)
FT                   /locus_tag="HVO_0540"
FT   CDS_pept        complement(470089..470577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0540"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03251"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS72"
FT                   /protein_id="ADE03251.1"
FT                   /translation="MVTVTPSVRPTWTDLARRGLATAAVASVANALLLTLVLGTGLVEP
FT                   FAPLSYPPVVFLSAAGAVAATLVYGLLTGRVTDADRTFFRVAVAVLVASFLPDIGLLYV
FT                   DPGATVPGVLVLMLMHVVVAAVCVASLTELGWGVPKGTDRTGPKSDRATAVRALFRMP"
FT   gene            complement(470736..473552)
FT                   /gene="citB2"
FT                   /gene_synonym="acnA"
FT                   /locus_tag="HVO_0541"
FT   CDS_pept        complement(470736..473552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citB2"
FT                   /gene_synonym="acnA"
FT                   /locus_tag="HVO_0541"
FT                   /product="aconitate hydratase"
FT                   /EC_number="4.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02554"
FT                   /db_xref="GOA:D4GS73"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS73"
FT                   /protein_id="ADE02554.1"
FT                   /translation="MSDTETLDAIREFEHDGTTYKMADLTVLEEQGLCELDRLPVSIRI
FT                   LLESVLRNVDGDIVTEEDVRNAASWEPDVPNVEVPFTPSRVVLQDLTGVPAVVDLAALR
FT                   SAADRAGEDPKLVEPEVPCDLVIDHSVQVDFFGTPDAYEKNVELEYERNAERYKALKWA
FT                   QNAFDNFSVVPPGTGIVHQVNLEHLGRVVHDREWRGDRWLLPDTLVGTDSHTPMIGGIG
FT                   VVGWGVGGIEAEAAMLGQPITMKLPEVVGVRLDGELPEGATATDLVLHVTEQLREVGVV
FT                   DRFVEFFGPGVGNLSVPDRATISNMAPEQGSTISAFPVDEATLDYLELTGREPEHIELV
FT                   REYLESQGLFGEQHPEYTETVDVDLSAVEPSLAGPKRPQDRVAMGDMKTHFRNLLYGEF
FT                   EDDVADVDEEAIVRWLGEGGGGGDDGELAGDGGTLTETPEAAPEEPDLGELTKRVEVDL
FT                   GGETVEIGHGSVVVSAITSCTNTSNPSVMVAAGLLARNALEKGLDVPEYVKTSLAPGSR
FT                   VVTEYLKKAGLLPHLEALGYDVVGYGCTTCIGNAGPLPEPIESAIDEHGLWTTSVLSGN
FT                   RNFEARIHPKIRANYLASPPLVVAYGLAGRMDIDLETDPLGTDDDGNAVYLADIWPDAD
FT                   EIRETIHDSVDPSMFREKYAEVFEGDERWEALEAPTGDVYDWDDESTYIREPPFFTDFP
FT                   LEKPGVSDIEDARCLLTLGDTVTTDHISPAGPFGSKLPAGQWLVDNGVDPVDFNTYGSR
FT                   RGNHEVMMRGTFANVRIENQMLDDVEGGYTIHHPPGEETTVFEASQRYREEGTPLVVLS
FT                   GVEFGTGSSRDWAAKGTDLLGVRATIAESYERIYRDNLVGMGVLPLQFEDGDSWESLGL
FT                   DGSEQFDIRGLDDGLDVNDELTVVATKDDGTEIEFDVTAQVGTPAAVTYVEHGGILHYV
FT                   LRRLLTEN"
FT   gene            complement(473683..474102)
FT                   /locus_tag="HVO_0542"
FT   CDS_pept        complement(473683..474102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0542"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04498"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS74"
FT                   /protein_id="ADE04498.1"
FT                   /translation="MEADRRLLREARERLDGWTYTARDRAYRELFAGDDAAVTAEERQL
FT                   LDEVDAELAGDGDDGLWGTDEYAVVMGHPKNHPISVVCTRHPEIPSSWSRGGESLTEPE
FT                   REQFNDLLWDYCERVRRYVQDEVDEFVGVAGVPEE"
FT   gene            complement(474201..474461)
FT                   /gene="trxA8"
FT                   /locus_tag="HVO_0543"
FT   CDS_pept        complement(474201..474461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA8"
FT                   /locus_tag="HVO_0543"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03889"
FT                   /db_xref="GOA:D4GS75"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS75"
FT                   /protein_id="ADE03889.1"
FT                   /translation="MSDAVPIVIYTRTECHLCDEAEATVREVADEVDVTVDIDLVNVDS
FT                   DEELREKYGERVPYVYVDGRPAFKFRVDADRLGEKLTAARE"
FT   gene            474717..476132
FT                   /locus_tag="HVO_0544"
FT   CDS_pept        474717..476132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0544"
FT                   /product="major facilitator superfamily transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03025"
FT                   /db_xref="GOA:D4GS76"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS76"
FT                   /protein_id="ADE03025.1"
FT                   /translation="MTVDTDAPEADGRNRFVYVTAALAALNGLLFGFDTGIISGAFLYI
FT                   RDAFTMTPLVEGIVVSGALAGAALGAALGGYLADRWGRRRLILVSAVVFFVGSLVMAIA
FT                   PTVEVLVVGRLIDGVAIGFASIVGPLYLSEIAPPKIRGSLVSLNQLAVTVGILSSYFVN
FT                   YAFADGGQWRWMLGTGMVPAVILAVGMVFMPESPRWLVEHDRESKARDVLSRTRTDDQI
FT                   RAELAEINETIEAEDGGLLDLLEPWMRPALVVGVGLAVLQQVTGINTVIYYAPTILEST
FT                   GFESSASILATVGIGVVNVVMTVVAVVLIDRRGRRPLLSVGLAGMTLTLVALGAAFYLP
FT                   GFSGFVGTVATGSLMLYVAFFAVGLGPVFWLLISEIYPLKVRGTAMGVVTVFNWVANLA
FT                   VSLAFPVMVAEITTAGTFWVFAALSAVALAFTYRFVPETKGRSLEAIESDLRENVLGGS
FT                   PDGSSAGTVSDDD"
FT   gene            476452..476949
FT                   /locus_tag="HVO_0545"
FT   CDS_pept        476452..476949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0545"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05138"
FT                   /db_xref="UniProtKB/TrEMBL:D4GS77"
FT                   /protein_id="ADE05138.1"
FT                   /translation="MATTSEPGLSETRIHEVLSNDRRRMAIEYLQDSDLTLRELSERIA
FT                   EAETGESPPPRNIRQSAYVSLQQTHIPKLAELDIVNYDEESKVVSLAEAGDVTVYMEVV
FT                   PEGELSWSEYYAALAALGIVLMIAVAVGVPVISAVGAPGLGSLVFAVLGGSAVYQRWTQ
FT                   ED"
FT   gene            477060..477224
FT                   /locus_tag="HVO_0546"
FT   CDS_pept        477060..477224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0546"
FT                   /product="small CPxCG-related zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04555"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSE3"
FT                   /protein_id="ADE04555.1"
FT                   /translation="MRDAPDPAGPPTVCDDCGARHSFRRRFVTGGGWRTVYRCSECGSR
FT                   ASSDGDGDE"
FT   gene            complement(477273..477917)
FT                   /locus_tag="HVO_0547"
FT   CDS_pept        complement(477273..477917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0547"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02395"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSE4"
FT                   /protein_id="ADE02395.1"
FT                   /translation="MEVTTAGRFRVYRSPRDGDELLLLELPDERVDWTDPAVETDADDA
FT                   YSPTYVPRTGYDGDLEARVSALEPGNEIEATLRWDDGDPRFEELSVRDRTRFRFVGAAT
FT                   GLFEAARETWRATGDGEAIGSRVTYGTDGDPNAVLYVFAKQPGARDLFDEFGDGVVPVD
FT                   PLLDRLDDETDAPDAPREMFVLRPLDEEFVLVAIALDREGLFARTMRDTYC"
FT   gene            complement(478045..479526)
FT                   /gene="nhaC1"
FT                   /locus_tag="HVO_0548"
FT   CDS_pept        complement(478045..479526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaC1"
FT                   /locus_tag="HVO_0548"
FT                   /product="putative NhaC-type sodium/proton antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03260"
FT                   /db_xref="GOA:D4GSE5"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSE5"
FT                   /protein_id="ADE03260.1"
FT                   /translation="MATLSFEPLTYDDIPEAERPSLAQALVPVVGMLVFLSVGVIWLGL
FT                   DPQLPLLWGIILTGAVGRYWLGLPWTRLSAGIRDGINMGLSALLILLVVYMLISTWTAA
FT                   GTIPALIYYGLDFLSPAVFLPVATLLSAVVTFAIGSSWTTAATLGVAFIGIGSGLGMPD
FT                   AMTAGAVLTGAYTGDKVSPFSDTTNLAAAVTNTELLTHVRTMRVGTAIALAISLVAYAA
FT                   LGLTASGSIPAGRVAEMQAAIAGSYAVTPLVFAPLVVTFVLALRGYPALPSIVAGVVAG
FT                   TFTQLFVQGPVSVDTFVGAWNVAFAGTAPSTGVETVDSLLASDGLLGSAWTMTVILASL
FT                   SLGGILERTGCIAVLAHHLRRVLTSVASLTVGTAASSLAMNAIAADQYMSIVVPGMSFR
FT                   GLYDDFDLESRNLSRAIESAGTTTSALIPWGTGGAYMADVLGVPTLQYAPYYFLGFLSP
FT                   LILVAIGLSGWRVTEQGSDTDAGLRGAVASFGDDD"
FT   gene            complement(479663..480625)
FT                   /gene="kdgK1"
FT                   /locus_tag="HVO_0549"
FT   CDS_pept        complement(479663..480625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdgK1"
FT                   /locus_tag="HVO_0549"
FT                   /product="2-keto-3-deoxygluconate kinase /
FT                   2-keto-3-deoxygalactonate kinase"
FT                   /EC_number="2.7.1.178"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04815"
FT                   /db_xref="GOA:D4GSE6"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSE6"
FT                   /protein_id="ADE04815.1"
FT                   /translation="MTALVTFGETMLRLSPPRGERLETARELEVQAGGAESNVAVAAAR
FT                   LGRDAAWFSKLPDSPLGRRIVSELRSHSVDTDGVVWTDDADARQGVYYLEHGASPRPTN
FT                   VVYDRADAAVTTLETGEFDLDAVRDAEVCFTSGITPALSETLSETTADVLDEAQNAGTT
FT                   TAFDLNYRTKLWSPDEAAEVYRDLLDSVDLLFAAERDAATVLGRDGDAESVARGLADDY
FT                   DIETVVVTRGEEGSLAVSDGAVSEQGVYETETYDAIGTGDAFVGGFLAKHLDGGSVTES
FT                   LEWASATASFKRTVEGDIAVVTPEDVERVVAEEGDGISR"
FT   gene            complement(480714..481016)
FT                   /locus_tag="HVO_0550"
FT   CDS_pept        complement(480714..481016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0550"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03329"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSE7"
FT                   /protein_id="ADE03329.2"
FT                   /translation="MNPLVVLGVCFGPLVLVVSYLFTAATGPSVPPWADAAGQAIRLYG
FT                   TVAAVVVGPLALHADRLDLARESDWVPSPVYYLIAVPFLSIPIAFIYLVRRLTAA"
FT   gene            complement(481150..483357)
FT                   /gene="mutLb"
FT                   /locus_tag="HVO_0551"
FT   CDS_pept        complement(481150..483357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutLb"
FT                   /locus_tag="HVO_0551"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02498"
FT                   /db_xref="GOA:D4GSE8"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSE8"
FT                   /protein_id="ADE02498.1"
FT                   /translation="MSDIKQLDEKTVQRIAAGEVVERPASVVKELFENSLDADATRISV
FT                   AVDAGGVEGVRIRDDGVGMSEEDLELAVREHTTSKIGDIEDLEAGVGTLGFRGEALHTI
FT                   GAVSRLTIRSKPRGGDVGTELQYEGGEVESIRPAGCPKGTVVEVDDLFYNTPARRKFLK
FT                   TTATEFDHVNAVVTHYALANPDVAVSLEHDDREVFATEGRGDLQSTVLSVYGREVAESM
FT                   VPVDHDAPGVSVSGLVSHPETTRSTRDYLSTFVNDRYVTDRVLREAVLDAYGGQLDADR
FT                   YPFAVLFVEVAPDAVDVNVHPRKMEVRWDDEAGVKREVTEAVEDALLSHGLVRSSAPRG
FT                   RSKADEAAIEPGSSGDDATQLDPHEVRESEPDGETDDDADPPSARDVQSAREARESGAR
FT                   ADSTATDDADTDTTPATERNSGAGSGDPAAGDDSGASAETTESSGPTSVPSSAPPTPPR
FT                   EYDLAPGPETTEQSSLSTDDGSESRSTPDEASSVDSGADDNAPRSPPSRIAAPTTQRDL
FT                   SGEEADLSPEFDSLPSMRIIGQLSDTYIVAETDEGLVLVDQHAADERVNYERLRGEVEG
FT                   DTPTQALAEPVDLELTAREAALFEEYREALAQVGFHAGRTGERTVSVRTVPAVFDAALD
FT                   PELLRDALTAFVREEVDGGRKTVDAVADELLSDLACYPSITGNTSLREGSVLDLLAALD
FT                   DCENPYACPHGRPVIVEFDRDEIASRFERDYPGHGGRRREE"
FT   gene            complement(483354..486128)
FT                   /gene="mutS1b"
FT                   /locus_tag="HVO_0552"
FT   CDS_pept        complement(483354..486128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutS1b"
FT                   /locus_tag="HVO_0552"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04510"
FT                   /db_xref="GOA:D4GSE9"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSE9"
FT                   /protein_id="ADE04510.1"
FT                   /translation="MTTQGIVGQFLSLKEETDADLLAMQCGDFYEFFADDAETVGRELD
FT                   LKVSQKSSHGSSYPMAGVPLNDLTPYLKALVERGYRVAVADQYETESGDLRREVKRVVT
FT                   PGTLLETSRADAQFLAAVVTDGDGVGLAFSDITTGQFLVTEAATVDDAAAELYRFAPVE
FT                   VLPGPELRSDDETLSRLREATDASFSLFATEAFAPGRARHAVREQFGASTVDSVGLDSD
FT                   LATRAAGGVLAYVEETGAGVLRSMTRLQVYHPSDLLELDATTQRNLELTETMHGDRSGS
FT                   LFDTIDHTVTSPGGRLLREWLTRPRRDRDELARRHDAVESLASAALARERVREVLDGAY
FT                   DLERLASRSASGSAGASELLSVRDTLSVLPALADAIEGTELADSPLAEVVSRPDRDAAA
FT                   DLRTDLADALAEDPPKTVTQGGLFQTGYDDELDDLIERHESAKSWLDTLADREKRDHGL
FT                   SHVTVDRNKTDGYYIQVGKSVADQVPDHYRQIKTLKNSKRFVTEELEEKEREILRLEEA
FT                   RGDLEYELFEDLRERVARHAELLQDVGRTIAEVDALASLATHAAGNGWTRPELTEAGAL
FT                   DIEAGRHPVVETTTDFVPNDLRMDDERGFLIVTGPNMSGKSTYMRQAALITLLAQVGSF
FT                   VPARSATVGVVDGIYTRVGALDELAQGRSTFMVEMQELSNILHSATEDSLVILDEVGRG
FT                   TATYDGISIAWAATEYLHNEVRAKTLFATHYHELTSLADHLDRVANVHVAADERDGDVT
FT                   FLRTVVDGPTDRSYGIHVADLAGVPRPVVDRAGDVLDRLREEKAIEAKGSGTSEPVQAV
FT                   FDVGSGQMKVAEAGDSGGDGDDSAGSGAPANGATGTGAAGNGSVDAAAAVEGSAEADRA
FT                   GTGSDSEAEAALDPETEAVLDELQSTDVNDTSPLDLMAKVQAWQSKLDGGDGE"
FT   gene            486347..487591
FT                   /gene="basB"
FT                   /locus_tag="HVO_0553"
FT   CDS_pept        486347..487591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="basB"
FT                   /locus_tag="HVO_0553"
FT                   /product="chemotactic signal transduction system
FT                   periplasmic substrate-binding protein BasB"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04414"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSF0"
FT                   /protein_id="ADE04414.1"
FT                   /translation="MTVRYDRRTFLRTAAGAVGLGSLSGCVGTFGTESGEPVRFGAMLP
FT                   VSGSLEQVGTHGKRAAEQAVEDINGAGGVLGRPVELTTVDTEGSASVATDGYASLADAG
FT                   VVGFVGGLVSDVSLALAPKAADDAVMEMSPASTNPRLSDAGRADGRKFFGRTVPSDSLQ
FT                   ATAMAKILDAPQYADADRVALLTVDGAFGSDLGTALGDQLDAEVVTEVSYDPSAEAFGG
FT                   VIDEVFADSPDAVGFVSVPGQERGVLDAYGASDHEAPWVFSAGLFDGEIPPYYEGFYSA
FT                   SLSSVRTDGYFHLTQRLSDIAPLQPYAANAYDALFLMATAAEYAGEASGPAIADALQTV
FT                   SGGTGHTVSVGEFDRVRTLVDAGRELNYQGASSGVDLTEALEPLSSYLVERVRNGSVEQ
FT                   VELLQRQFFESGGGR"
FT   gene            487588..490083
FT                   /gene="basT"
FT                   /gene_synonym="htr3"
FT                   /locus_tag="HVO_0554"
FT   CDS_pept        487588..490083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="basT"
FT                   /gene_synonym="htr3"
FT                   /locus_tag="HVO_0554"
FT                   /product="transducer protein BasT"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03602"
FT                   /db_xref="GOA:D4GSF1"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSF1"
FT                   /protein_id="ADE03602.1"
FT                   /translation="MNPFSRLTSLLERALPNVIRRRYAAKFGVVLLLIAVVMGGAGAYI
FT                   HFDTKSVVESQTESQIRGAAATGAKSVSDWVTSKESTVSFLAESLADQPAGTSAADHQR
FT                   WLEGKLIQLSGDVRSLHYVDADTGAVVASTTDSATGQSLDSLSAPWTDDASALASSRSV
FT                   TVSAPYESGGEPVVAFVAPVSGANGAVVLTASLEAGSHQFESPYATGDTKVVTESGTIL
FT                   FDNRKASILDEYAAADGSSIEAIDAAMSGQTGYEVVSARTGMEPGEYAMAYAPITGTDW
FT                   VVTYHVPAERAFALQSHVTTNVMFLVAFAVGALFLVGATIGRGTARSLSVVARNADDIA
FT                   NGEVDGDLPNTARIDEMGRLYDSFESMQAYLTTVAGQAEALADKRFDDPVLDEDIPGSF
FT                   GESMGQTHTELEALITELEATAAEFSETMADAADGDLTRRMSEDADNDAMNEMARSFND
FT                   MADELEATVAEVVGFAETVAAASQEVTASSQEIERASRQVSESTQVMAEGAHEQRENLR
FT                   QTTSETSNLSATIEEVASSASELERTAQHTLEASEDGHEAAANAIDTIETVETQTSRTV
FT                   DRIEDLEGDMAEIGDIVELITDIAEQTNILALNANIEAARAGEAGEGFSVVANEVKELA
FT                   GETKSSAEEIEATIEEVQAKSAASVSEMRETRDAVDSGVDAVQTARDSLDTIVENVRET
FT                   TDGVDEISRTTDEQAASTEEVASMMDRVSDISDETAERAESVAAAAEEQTASLSEVSDG
FT                   ADRLATQSERLMSLVSEFTVDHDAADRDGARTGADTTPSAELDAPTTDGGFDGDGPDDD
FT                   GIDDDGPDRSADDRSDRLD"
FT   gene            490290..491960
FT                   /gene="htr15a"
FT                   /locus_tag="HVO_0555"
FT   CDS_pept        490290..491960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htr15a"
FT                   /locus_tag="HVO_0555"
FT                   /product="transducer protein Htr15"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02727"
FT                   /db_xref="GOA:D4GSF2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSF2"
FT                   /protein_id="ADE02727.1"
FT                   /translation="MDLLSRLAALVPGVGARTRTDGGAQADERGTVAAAAEQLHAGALL
FT                   DGVGTPVFVLDADGRVIAWNDPITTLTGVPAAEALGSEHVSELFYPDGRRAKTLADKVL
FT                   DDPRSANVVNGLDVVDEASRLYRDTSTMTDRHGAERHIAFTAQPLFEGDELVGVVEAVH
FT                   DRTDAVEKQRASEALVEEVSTTIGSLTAGDLSARASFTDDRGVLEDETLAVVSDLNEMA
FT                   TRFDRLASEVDATTADLGGAIQRAATAATDIESQVTEQADLLSTGAEEMQELSASMEEI
FT                   AATSDEVASAANQARVAAENGHEAGQSIRSATDQVIDISDELLDSVTELQQRMVVIEEV
FT                   VEVIAEVADRTNLLALNANIEAARAGEAGEGFSVVADEVKQLANQTHEHTEEIADSITE
FT                   IQEQADETVLASEQSHEQIQVASGEIEDVLASLSEIADAADSAANGITEVARATDSQAT
FT                   NIEEVTSTIQMAQEHATAAEASTTDITDATADQTVALDALADRVDALVGGDATAVEELD
FT                   AMDFDDAAGSADADADADSVRAATDGGSDDEFGGFQFDR"
FT   gene            492257..493255
FT                   /pseudo
FT                   /locus_tag="HVO_0556"
FT                   /note="transposase (ISH18) (nonfunctional)"
FT   gene            complement(493539..494351)
FT                   /gene="ubaA"
FT                   /locus_tag="HVO_0558"
FT   CDS_pept        complement(493539..494351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubaA"
FT                   /locus_tag="HVO_0558"
FT                   /product="SAMP-activating enzyme E1"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04227"
FT                   /db_xref="GOA:D4GSF3"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/Swiss-Prot:D4GSF3"
FT                   /protein_id="ADE04227.1"
FT                   /translation="MTLSLDATQLDRYSRHIIMDEVGPEGQGRLLSSRVVVVGAGGLGA
FT                   PAIQYLAAVGVGELVVVDDDVVERSNLQRQVVHCDDDVGTPKAESAAAFVRGLNPDVSV
FT                   EPVEARVDKSNVHEVVAGSDVVVDASDNFPTRYLLNDVCRFEGIPLVHGAIYKFEGQAT
FT                   TLVPDGPCYRCLFPEAPEPGTVPDCATTGVLGVLPGTVGCIQATEAMKLLLDEGEALDG
FT                   RLLFYDAMDMTFETVPYRTNPDCPVCGEGGVDSIEDIDYVESCAISLD"
FT   gene            494488..494841
FT                   /locus_tag="HVO_0559"
FT   CDS_pept        494488..494841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0559"
FT                   /product="rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03625"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSF4"
FT                   /protein_id="ADE03625.1"
FT                   /translation="MVAETTPDELREKLADDDELAVVDIRDPSSYTSGHIPGSENLPAA
FT                   TLGPEVFDREWPAEVVVSCYVGKSSKQVASVLDSNVDADVSSLRGGFDAWDGAVEDGTE
FT                   SEGEADLGPTSPF"
FT   gene            complement(494928..495119)
FT                   /locus_tag="HVO_0560"
FT   CDS_pept        complement(494928..495119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0560"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02946"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSF5"
FT                   /protein_id="ADE02946.1"
FT                   /translation="MVSIELSGPILVAAAVLGAVWIYRDAKRRAMDTADMWAVGFFVAF
FT                   VLLPVLGGLAVFVFYLRN"
FT   gene            complement(495226..495816)
FT                   /gene="rpl15e"
FT                   /locus_tag="HVO_0561"
FT   CDS_pept        complement(495226..495816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl15e"
FT                   /locus_tag="HVO_0561"
FT                   /product="50S ribosomal protein L15e"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04557"
FT                   /db_xref="GOA:D4GSF6"
FT                   /db_xref="InterPro:IPR000439"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR020925"
FT                   /db_xref="InterPro:IPR020926"
FT                   /db_xref="InterPro:IPR024794"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSF6"
FT                   /protein_id="ADE04557.1"
FT                   /translation="MARSFYSHIKEAWKTPKEGKLAELQWQRKQEWRNQGAIERIERPT
FT                   RLDKARELGYKAKQGIIVVRVSVRKGGARKQRHKAGRRTKRQGVNRIGRRKSIPRIAEE
FT                   RASRKHPNLRVLNSYGVGQDGSQKWQEVILVDPEHPAIQNDDDLNWICDDTHEGRAFRG
FT                   LTNAGKKNRGLQNRGKGTEHNRPSIRAGNGRGK"
FT   gene            complement(496045..497121)
FT                   /gene="malG"
FT                   /locus_tag="HVO_0562"
FT   CDS_pept        complement(496045..497121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malG"
FT                   /locus_tag="HVO_0562"
FT                   /product="ABC-type transport system permease protein
FT                   (probable substrate maltose)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03934"
FT                   /db_xref="GOA:D4GSF7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSF7"
FT                   /protein_id="ADE03934.1"
FT                   /translation="MSVISDIAAELAADARTAAMAPVESVKDAKYTLEGIREGRVSPAT
FT                   VLKTAGITLGAAVVVALLLFPLYWVAVGAFSGTGASLYSSSGIRLWPADPTIEPFLWVI
FT                   GDLIVPSYRISLGLGGYEVFLQTPELTFLDVSQYGVTETSEFKRFFANSLTVAIPTVLL
FT                   AMCLIVPSAYALSRRQFIGRSKVLYGYVLFTQIGGGLGVALLIALYALFVQFGFNDSKL
FT                   ALSAYYAATAVPFNTWLLKTYMDGIPVSYEEAAMIDGAPSWKIVTEIILPLSKAGLATV
FT                   FIFTFLTGWTEFVVAQTLLSTDNYTLPVGLYSLVGRYSIPWARFSAFALTFAAPIMLIY
FT                   LFAQRYIEGGLSFGGMEG"
FT   gene            complement(497118..498053)
FT                   /gene="malF"
FT                   /locus_tag="HVO_0563"
FT   CDS_pept        complement(497118..498053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malF"
FT                   /locus_tag="HVO_0563"
FT                   /product="ABC-type transport system permease protein
FT                   (probable substrate maltose)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03263"
FT                   /db_xref="GOA:D4GSF8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSF8"
FT                   /protein_id="ADE03263.1"
FT                   /translation="MSVVDSAVERVADSPVVSKDDLPLLLVLPGLFVFLAFMLFPVLYL
FT                   VYLSFTNAEPATLFQGKEQWVGLANYVTVLSDGQFWNSMGVTWLFVATSVALKVLVGLG
FT                   IGLVVTGERVRGKRFMRALIIIPLGLPGIFTITIWRGIFSSAEFGLANQFLRMAGLDSI
FT                   AWLSERWMAFLAYNVTEAWLAYPFMVIITVSALQDVSEELHEAAMIDGAGFFARFLHVT
FT                   LPSIKRPVLFASILTAAASFQQFLIPYVFNQGGPSRTNELLIVYGYREAFRFQKYGEGA
FT                   AIMLVAVAVIGVFMMLNVKKGQLADGVDDA"
FT   gene            complement(498059..499357)
FT                   /gene="malE"
FT                   /locus_tag="HVO_0564"
FT   CDS_pept        complement(498059..499357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malE"
FT                   /locus_tag="HVO_0564"
FT                   /product="ABC-type transport system periplasmic
FT                   substrate-binding protein (probable substrate maltose)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02637"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSF9"
FT                   /protein_id="ADE02637.2"
FT                   /translation="MPMNRRTILKQLAGTTAVGALAGCVGVSETDSTQTSEQSGAEGDD
FT                   GSEETTAGAETESAGPSGTFTLWHQRAEAEKEALEANAETFTSETAHTAKPAEIADLRK
FT                   KTTSAIPAGQGAGMFDWAHDWTGEYYQNGFLSDQSDQLDVDLSVYTRPAQEAVQFDGAT
FT                   VALPYAAETVGLIYNREMVDEAPETIADMKAIMEEYHDPENWMYGLSYPLNAYFMSAWA
FT                   HAFGGYYFDESNVELGLSNEATLDGFQFILDNFVPYQPKDTGYDPQAAVFLEGNAPFAI
FT                   NGPWFLGDVRSNDIDAGIARLPSPEGDAEPEPYTTVKQLYFTSTLEGDEATAAASRAFA
FT                   EWYTTDTDVLSANAEEFGYIPVHKELASSSDLPEAVQGFSESVSLGTPIPTHPNMGDVW
FT                   GPLEDAFNSVKNGDAELESAFTKAEENIRSNWE"
FT   gene            499582..500721
FT                   /gene="malK"
FT                   /locus_tag="HVO_0565"
FT   CDS_pept        499582..500721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malK"
FT                   /locus_tag="HVO_0565"
FT                   /product="ABC-type transport system ATP-binding protein
FT                   (probable substrate maltose)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04764"
FT                   /db_xref="GOA:D4GSG0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSG0"
FT                   /protein_id="ADE04764.1"
FT                   /translation="MARLTLEALRKEYDRGRVVAVEDLSLDVEDGEFITVVGPSGCGKS
FT                   TTLRMVAGLESPSGGTIRIGGEDVTDQHARKRDVAMVFQNYALYPHKTVMQNMAFGLRM
FT                   STDLSKDERRERVRETAAMMGIEDLLDDKPDELSGGQKQRVALGRAIVREPDVFLFDEP
FT                   LSNLDAKLRTTMRTEIQRLQNELGITSLYVTHDQEEAMTMGDKIVILNDGKLQQVGRPK
FT                   DVYENPANEFVGGFVGSPSMNFLDVSVEREGDRLVLAGDSPFSYRLSESFSATLREATD
FT                   ATDLRVGVRPEDVVTASSGENVVDSTVGVVEPIGSDNYLHLDIGPDFIARVDSDVEPET
FT                   GETVGVTFDESDLHVFHPRTGESLLSRESKRRAAPTQQA"
FT   gene            complement(500782..502788)
FT                   /locus_tag="HVO_0566"
FT   CDS_pept        complement(500782..502788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0566"
FT                   /product="glycoside transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04380"
FT                   /db_xref="GOA:D4GSG1"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSG1"
FT                   /protein_id="ADE04380.1"
FT                   /translation="MQLRDALADYKRHADHPTRFPGERRTTSGLFSGLGDRLVHVETDG
FT                   SLRDFGYPLSGLWGVERSRFGVRPVGDDAGVHWFDEGASQSYAGDGALVVTDHETPHGD
FT                   VTQYDLAIDDGHVSRFETDADVELVAFVHFQPDGRDTLVGQLTHGDAVEAYHAEEHDFL
FT                   ASSPAFEHVEGRVPEGFDELLSEGEVELPRPRTDDCYEEGQLSGAVVGTVPFESGAAAV
FT                   GHLLTDDTETGREDALDRVRDLVARDLDDLRERAATEVEGAVPDHRESAAMRDDIRVLS
FT                   LLSGALGLRIAGPDFDPYYAYSGGYGYTWFRDDAEISTFLFESDERLDLGLDAWHERSA
FT                   RAYCRTQREDGSWPHRVWPFDGSLAPGWANARLESGDDADYQADQTGSVIAFLAAYHDR
FT                   CADDDLRTDIEETLSRALDSLDDTLDDDGLPVDCQNAWENMTGRFSHTAATFLEAYAAL
FT                   ALSGLDSALTDRAASRAREVYEGIDRLWSEGRDCYALRVADGELDDRYDSAALALASAH
FT                   RTYDRLEAVDDDRLDRLVRHVESVFDGLWHDPDDSEVKGLVRFEGDDWRMREQSSEKVW
FT                   TVSTAWGANTGVELAALLAAHDDDRAGTFADEGRALLDLVLPDGPLCTDEGYLAEQFFD
FT                   VGTPDSATPLGWPHALRLATLATLDADGAFDGE"
FT   gene            502893..505076
FT                   /gene="amyA1"
FT                   /locus_tag="HVO_0567"
FT   CDS_pept        502893..505076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amyA1"
FT                   /locus_tag="HVO_0567"
FT                   /product="glycoside hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03517"
FT                   /db_xref="GOA:D4GSG2"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSG2"
FT                   /protein_id="ADE03517.1"
FT                   /translation="MHHPGPPRVTTVGRPVELAPRAPERDATYRWRVLDAPAESAATVG
FT                   SGPVVHLAPDVPGTYHLELDAPDGRHEQTVRAFPDDRRPATMAVPAAALEPASPDEVAV
FT                   IGPFNDRLVGRDRPRRAGDDYVLDVDLPPGTHPFGFAPHDDLAEQVRGDVEVPGPGRPR
FT                   VRLDGRVGQENSDDLLVVADAETAPDAEEATLAVEFLFDGRDALDSSDCEVRDDRLRVP
FT                   VDTLRGVDSSEPVRVHAVAVQTTAESGESGEPYVRHSVLDTLVVDPGVVADEPGSGLAV
FT                   SRPADAPEWAHHATVYEVFVRSFAGETPDPTFDELARRVPYLESLGVDCLWLTPILESH
FT                   TTHGYHVTDYFDTASDLGSREDFEALVERCHDAGIRVVFDLVINHTSRDHPAFQFHSTG
FT                   VPGYEDHYARVPEREDPSEVDWGGPGAAEHYFNWTRIPNLDYDSPAVRSWMLDVVTEWA
FT                   AVVDGFRCDVAWGVPHGFWKEVRERVKADDPDFLLLDETIPRDPAYHETEFDAHYDTTL
FT                   YGALRAIGAGERPATALLDAVADARWHGFPDDAVQLRYIENHDEERYRSAVGDDALRAA
FT                   AAATFTLPGAPMIYYGQETGVADRRGTMRWYDADTDLVDFHRRLSRLRDAHEALRAGDV
FT                   EPVSASVAPAGDDGVEADRVVAFARDDGTDRLVVVLNFDGEPTTVELGAETAEIDLLTG
FT                   ERVGASGAAAGDGGVRVTVADAVVLRAIGDSSH"
FT   gene            505103..506152
FT                   /locus_tag="HVO_0568"
FT   CDS_pept        505103..506152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0568"
FT                   /product="TrmB family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03089"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR021586"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSG3"
FT                   /protein_id="ADE03089.2"
FT                   /translation="MDDRELADLLEQFGLSEKVVDTYLTLLELGEAKASQIADAAGVSK
FT                   RYVYSVSKELESRGFVEVNDHVVPTTIRPLPPMEVIESLSESVESMRPALEERYTATAR
FT                   DQERFEVIKSRVTVLKRIGELVGRAESEITLSLPYDVLDEVEDELRAARERGVLVSLVV
FT                   SGVEPHDDLALDGVASLVRVWHELMPTMLTVDSRTGLISPGEMVARSNSESQAIVFAQP
FT                   HLGPVIVGSFFGNYWPMAAEAYTTDPDPLPAMYHNFRHAVLQAALCERAGIDLDVTVSG
FT                   RMVHTDGPTELHGRVVDIRQGLLEPANNSFPVENAFVVETDEGTYSIGGQGAFVEDFEA
FT                   DAVEFTAAE"
FT   gene            complement(506363..507274)
FT                   /gene="rio2"
FT                   /gene_synonym="pkn1"
FT                   /locus_tag="HVO_0569"
FT   CDS_pept        complement(506363..507274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rio2"
FT                   /gene_synonym="pkn1"
FT                   /locus_tag="HVO_0569"
FT                   /product="RIO-type serine/threonine protein kinase Rio2"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05186"
FT                   /db_xref="GOA:D4GSG4"
FT                   /db_xref="InterPro:IPR000687"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015285"
FT                   /db_xref="InterPro:IPR030484"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSG4"
FT                   /protein_id="ADE05186.1"
FT                   /translation="MVRNVAGVMAELEPEDFYLLSGVEQGMRFSEWVNREKLPKNSGLT
FT                   AEEVDYRIDRCMTRELVERKTIQYVGYKLTVEGYDALALRTFAQRDTIQGFGAPLGVGK
FT                   ESDVFEVQSFKPLALKFHREGYTNFREVRRERDYTSENHHVSWLYTARKAAEREYEALE
FT                   TLFPEVSVPRPVDHNRHAIIMAKFDGVELAKAKLESEQVTGVLDLILSEMADAYAAGYV
FT                   HADMSEYNVAVGERGVTVFDWPQAVPTDHDNARELLARDAKNIVGYFRRKYPGEMPDEV
FT                   DIDALSDAIAGNEFESVDEFAV"
FT   gene            complement(507810..508865)
FT                   /locus_tag="HVO_0570"
FT   CDS_pept        complement(507810..508865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0570"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04778"
FT                   /db_xref="GOA:D4GSG5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR031623"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSG5"
FT                   /protein_id="ADE04778.2"
FT                   /translation="MNVSRLVSAGSLSLTGVALFVVVSNSVASVASDLAGLVAAAFGLI
FT                   ISVLFVAVGPVVYRSDLKTSHVARVAGWNLLGVAVTVFVLALIGSYQQAAGGTVSEPLF
FT                   SAAVVVGVSAVAHVLIGLNDVRRIRTRELSEQYKRSAVINRLVRHNLRHTAQLLLGWGD
FT                   RLATDGGDDETVRIGQRLKATGDDLGTMSDQVKTVTQLVDNDHGGETVDLRELLDPLVD
FT                   DRSAANPEATITVRGDGSAAVVGGKKLQIAFREIVDNALEHAGSAPTVEIAYERVGSEV
FT                   VVRIADDGPGIPDHQRELIEQNVEESDLAHGNGLGLWLSKWIVEAYGGELHLPPTDDGE
FT                   GAVVEFHLDAA"
FT   gene            complement(508914..509564)
FT                   /locus_tag="HVO_0571"
FT   CDS_pept        complement(508914..509564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0571"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04685"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSG6"
FT                   /protein_id="ADE04685.1"
FT                   /translation="MKFTRVALAATDPISLCEFYVETLGFAAVPGSQRSATAGETTLWF
FT                   ELGDTDPGHLAFTVAAAVDSVVAWLDDRAGVDVLDTDEGPSVRFDFLGCDSVYFEDPEG
FT                   NVIEYVCYDGDATGEFDPATDLRGATEVGMAVPDVASFVASLTEALGIEPLESFEGGDL
FT                   VFVGDRDARFVVSPVGRPWYPTDSEATVGPVSAQCDADGVFDPEGLPYRVNAE"
FT   gene            509723..510550
FT                   /gene="lpl"
FT                   /locus_tag="HVO_0572"
FT   CDS_pept        509723..510550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpl"
FT                   /locus_tag="HVO_0572"
FT                   /product="lipoate-protein ligase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05054"
FT                   /db_xref="GOA:D4GSG7"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSG7"
FT                   /protein_id="ADE05054.1"
FT                   /translation="MNDSQGSIADREWRVIREEVRPGPMQMALDEVAGETAAAGGPRTV
FT                   RVYSWVPSCLSLGYGQDPETVDWDYCDREGIDVTRRQTGGGGIYHDRHGDVAYSIAAPK
FT                   SELPGDLMDCYHLLCEPILDAIRAVGVDVNFVDDDVPVIWHPACYLRALHPAHDMVAAG
FT                   RKVAGNAQYRRRDAVVQHGSLTYSVDAETHLGVFEGHDVTPEAFRERVVGIDELADASR
FT                   EAFVAALTESLSEFVDAEEGAWTDDELDRAREKVDEKYRADDWVRRRPGSRSD"
FT   gene            510605..511480
FT                   /gene="apn1"
FT                   /locus_tag="HVO_0573"
FT   CDS_pept        510605..511480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apn1"
FT                   /locus_tag="HVO_0573"
FT                   /product="endonuclease 4"
FT                   /EC_number="3.1.21.2"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03203"
FT                   /db_xref="GOA:D4GSG8"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSG8"
FT                   /protein_id="ADE03203.1"
FT                   /translation="MQVGAHVSMSSSKVSSDDETPPHGNVANAVFRQVAFGGNCGQIFT
FT                   TSPQVWRDPDISDEEAELFREQTADKLSGPWVIHSSYLVNLCTPKDGLRQKSLDSMQTE
FT                   VDMADKLGIEYVNVHLGAHTGAGEQQGLDNAVSVLDDLDIPDGVTVLIESDAGSGTKMG
FT                   DDLAHLGYVLEESDQDLDVCLDTAHAFAAGYDLSTAEGVDETFAELDAEVGLEHLKCVH
FT                   LNDSKHECGTNKDEHALIGEGLIGEEGMRAFINHDAIVDDDVPLVLETPTEDGKGFAWN
FT                   IERVRELRAD"
FT   gene            511562..512362
FT                   /locus_tag="HVO_0574"
FT   CDS_pept        511562..512362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0574"
FT                   /product="putative S-adenosylmethionine-dependent
FT                   methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03419"
FT                   /db_xref="GOA:D4GSG9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSG9"
FT                   /protein_id="ADE03419.1"
FT                   /translation="MRRFSESYLRRTRDGMWDDSRAALGDLDLGGRTRILDVGCGTGEF
FT                   TRVLAEASEARVVGVDADTDLLSVASDRDSDIETVAGDATRLPFAAGSFDLVVCQALLV
FT                   NLPDPTAALSEFARVSSDLVATVEPDNAAVGVDSTVESEAALDRRVRDAFRDGVATDVA
FT                   LGDRVRGLFDDAGLSVVGTRRYHHRKLTEPPYDDHDVRSAAKKATGEGLDRHEADLRRG
FT                   LDDDSYESVRREWREMGREVVQQIRDGEYRRAEVVPFDVTTGRV"
FT   gene            complement(512426..513064)
FT                   /locus_tag="HVO_0575"
FT   CDS_pept        complement(512426..513064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0575"
FT                   /product="homolog to NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04243"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSH1"
FT                   /protein_id="ADE04243.1"
FT                   /translation="MNVLLLGASGRIGTRIANELLNRGHAVTGVSRSGEIDGVDDPDFS
FT                   AVAGDATDADQIARLAAGHDAVASALGPSDDESPEVLVEMLDAVVDGMRRASVDRLVWT
FT                   GGAGILNVGPDTRLIDSPEFPEEWKPVASAAIEAYGLLEDADDLEWTYVAPAAFIEPGE
FT                   RTGEFRTARGELVADEDGESRISMEDFAIAFADELESGDAVHEQLAVGY"
FT   gene            513213..513560
FT                   /locus_tag="HVO_0576"
FT   CDS_pept        513213..513560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0576"
FT                   /product="HxlR family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05032"
FT                   /db_xref="GOA:D4GSH2"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSH2"
FT                   /protein_id="ADE05032.1"
FT                   /translation="MSPHQNLEAKYEQCPVIKTLEEIGSRWRMTVIHVLREGDLRFNEL
FT                   KRATGANSQTLSRVLDDLQELGYVEREVEDGSPIAVYYSLTQKGEELLPAFDDISEWGE
FT                   KWMSEDGGAES"
FT   gene            complement(513578..513793)
FT                   /locus_tag="HVO_0577"
FT   CDS_pept        complement(513578..513793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0577"
FT                   /product="DUF2082 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02960"
FT                   /db_xref="InterPro:IPR018652"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSH3"
FT                   /protein_id="ADE02960.1"
FT                   /translation="MSPPPSADRDGCPKCGHSETEIDSIATTGGGLSKMFDIQNRQFTV
FT                   VSCANCGYSELYRGQSSGNFVDLFLG"
FT   gene            513869..514150
FT                   /locus_tag="HVO_0578"
FT   CDS_pept        513869..514150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0578"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03099"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSH4"
FT                   /protein_id="ADE03099.2"
FT                   /translation="MSVGGLVFFLFALLSIGAAVALYAGIQAETRDPPTMSREEAERRA
FT                   RDEGRRYNEQRGRGTDRRPSGGGRGDEFDPDADRTDDRGRNRDGDRDW"
FT   gene            complement(514211..514855)
FT                   /locus_tag="HVO_0579"
FT   CDS_pept        complement(514211..514855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0579"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03660"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSH5"
FT                   /protein_id="ADE03660.1"
FT                   /translation="MDRDAALDRVDAVVDAVESETLPVPVREVWVYGDVALGLDPLDRL
FT                   DVYVTKDILLRGDPDAAESFERSHGVKGVGKSVRAEWAREHPDLLRANANGYAAPEKCL
FT                   AAHLLPDEEPVHLEVCNASFEDNVTQRLKGAVEREAYEQILDPRGVCLYADGQRSSDAM
FT                   SKLRNGEFAFPTLSGALEMLGLEDDDAETAVEAMRAYRAEQTGTSVRGDVV"
FT   gene            514996..515961
FT                   /gene="tuc1"
FT                   /locus_tag="HVO_0580"
FT   CDS_pept        514996..515961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tuc1"
FT                   /locus_tag="HVO_0580"
FT                   /product="putative tRNA 2-thiolation protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04813"
FT                   /db_xref="GOA:D4GSH6"
FT                   /db_xref="InterPro:IPR000541"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSH6"
FT                   /protein_id="ADE04813.1"
FT                   /translation="MECDKCGRDAVMHAAYSGAHLCDDHFCASVEKRVRRRIREDNMLP
FT                   RDASPENPQTWVIGLSGGKDSVVLTHILDDTFGRDPRIELVALTIHEGIEGYRDKSVDA
FT                   CVELAEDLDIHHELVTYEDEFGVQMDDVVEKDPENMAACAYCGVFRRDLLERFADELGA
FT                   DKLLTGHNLDDEAQTALMNFFEGDLKQVAKHFDASIGDFEKRRDAGEFIPRAKPLRDVP
FT                   EKEVALYAHLKDLPAHITECPHSSEAYRGEIQQLLLKLEENHPGTRHSIMAGYEELAEL
FT                   TAREYRGEGRVDLNDCERCGSKTAGDVCRKCRLIESIEAV"
FT   gene            complement(516141..517343)
FT                   /gene="ftsZ2"
FT                   /locus_tag="HVO_0581"
FT   CDS_pept        complement(516141..517343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ2"
FT                   /locus_tag="HVO_0581"
FT                   /product="cell division protein FtsZ, type II"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02657"
FT                   /db_xref="GOA:D4GSH7"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/Swiss-Prot:D4GSH7"
FT                   /protein_id="ADE02657.1"
FT                   /translation="MQDIVREAMERDEAERQTQSSLEDSDDQFGDPRIVIVGAGGAGNN
FT                   TINRLYNIGVEGADTVAINTDKQHLKMIEADTKILVGKSLTQGLGAGGDPSMGERATEM
FT                   AQGTIKDVLGDADLVFVTAGMGGGTGTGAAPVVAKIAKEQGAIVVGMVSTPFNVERART
FT                   VKAEEGLENLRNEADSIIVLDNNRLLDYVPNLPIGKAFSVMDQIIAETVKGISETITQP
FT                   SLINLDYADMSTIMNQGGVAVMLVGETQDKNKTQEVVNDAMNHPLLDVDYRGASGGLVH
FT                   ITGGPDLTLKEAEGIASNITERLEAAANVIWGARIQDEYKGKVRVMAIMTGVQSAQVLG
FT                   PSTQKQADKSRQSIQSRESQQQHSGSEFDSSERAQTAQSGTWSDGGRDEVEKNNGLDVI
FT                   R"
FT   gene            complement(517346..517531)
FT                   /locus_tag="HVO_0582"
FT   CDS_pept        complement(517346..517531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0582"
FT                   /product="CopG domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03102"
FT                   /db_xref="GOA:D4GSH8"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSH8"
FT                   /protein_id="ADE03102.1"
FT                   /translation="MERVTLRIPKQQIEEVERMVETGEFPNRSEAIRSAVRDMLNEQVT
FT                   DKRQRESTSKRGWAKV"
FT   gene            complement(517744..518328)
FT                   /locus_tag="HVO_0583"
FT   CDS_pept        complement(517744..518328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0583"
FT                   /product="CopG/DZR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03791"
FT                   /db_xref="GOA:D4GSH9"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR025874"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSH9"
FT                   /protein_id="ADE03791.1"
FT                   /translation="MSKITFRADDALVERLDRLDTSKSEVMREALRQYLDELERDDGAD
FT                   DTAGLDGALSARVEELVDERLDERLPALVEEAAAARESERPTPSDLNVNINVDGSNGES
FT                   RVNAGVDTESTPSTVRKTRDELESGDADDPDMTCGQCGESVGPDHVYCPNCGEKTSHRV
FT                   FCECGDELRSDWAFCPDCGRRTPAADVLEQA"
FT   gene            518441..518514
FT                   /locus_tag="HVO_3027"
FT   tRNA            518441..518514
FT                   /locus_tag="HVO_3027"
FT                   /product="tRNA-Tyr"
FT   gene            518847..519830
FT                   /locus_tag="HVO_0585"
FT   CDS_pept        518847..519830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0585"
FT                   /product="putative oxidoreductase (aldo-keto reductase
FT                   family protein)"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03845"
FT                   /db_xref="GOA:D4GSI0"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSI0"
FT                   /protein_id="ADE03845.1"
FT                   /translation="MDSRPLGTTGFDVSEIALGTWQLGGSWGSVTNDEAYDAIEAALDA
FT                   GIDFLDTADVYGDGDSERRIGDVLADRDDDVTVATKAGRRLDPHEADGYNRENLERFVY
FT                   RSRDNLGVDSLDLVQLHCPPREVYYQPEVFDALSELRDAGKIDHYGVSVEKVEEGLKAI
FT                   EYDGVETVQIIFNPLRQRPAELFFREAARRNVGVIVRVPLASGLLTGALSADAEFAEND
FT                   HRNFNRHGEAFDVGETFAGIPFEDGLEAADSIQEVVPEGVSLAQFTLRWILSFDAVSTV
FT                   IPGSKTPEHIRDNVAAASLPPLSADQFERVEEVYNAYAREHVHHRW"
FT   gene            519896..520531
FT                   /locus_tag="HVO_0586"
FT   CDS_pept        519896..520531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0586"
FT                   /product="HAD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04752"
FT                   /db_xref="GOA:D4GSI1"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSI1"
FT                   /protein_id="ADE04752.1"
FT                   /translation="MAVTFDLFGTLVDAEYPSDPGSAVADALREYGVAVPDDWDDAYRE
FT                   VHIDAPEGAEVPLPAHVAAALRSRGVDSPDNAARRAVITAFDPEVTTRPGAVDAVAAAR
FT                   EAGAVGLLSNCSVPELVARTLIRSDLDRRGFDDITTSVACGWRKPHRQAFEAAARGLGV
FT                   DAAELLHVGDDPDADGGIEAVGGRFVNLRETTLESVAARLRAGEDPCP"
FT   gene            520522..521430
FT                   /gene="cbiB"
FT                   /locus_tag="HVO_0587"
FT   CDS_pept        520522..521430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiB"
FT                   /locus_tag="HVO_0587"
FT                   /product="adenosylcobinamide-phosphate synthase"
FT                   /EC_number="6.3.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02527"
FT                   /db_xref="GOA:D4GSI2"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSI2"
FT                   /protein_id="ADE02527.1"
FT                   /translation="MPVTAAAAVVAAAALDRGFAEPPARVHPVALLGRLVSPVDREWSR
FT                   PTLVGAVAAVALPALAAGVTAAVTWAATLVSPWLGAAVAALALFSTTSLRMLLDAAAAV
FT                   VSATADESDLDTARYELRALAGRDPSSLSAADIRSAAVESAAENLADGLVAPLLAFMLF
FT                   AAVSLPLAVGAAAWVKGVNTLDSMLGYRHKPVGRVPARLDDAVMWLPARVSAVLLAVVA
FT                   GAPATVARVGELARRPSSPNSGWPMATLAVLLETRLEKPGHYLLDGGPEAPDAATAARG
FT                   VRLVSRAGLAAFAVAGVVAWF"
FT   gene            521421..522185
FT                   /gene="cobS"
FT                   /locus_tag="HVO_0588"
FT   CDS_pept        521421..522185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobS"
FT                   /locus_tag="HVO_0588"
FT                   /product="adenosylcobinamide-GDP ribazoletransferase"
FT                   /EC_number="2.7.8.26"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04222"
FT                   /db_xref="GOA:D4GSI3"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSI3"
FT                   /protein_id="ADE04222.1"
FT                   /translation="MVLTALRGALGFLTRLPVGGDESNWDAFRRAPVAFPLVGYVVGAL
FT                   AALPLLLPLPIPTAAALYLVTLYLVTGVTHADGLADLGDAAVVHGDADRRLSVLKDSQT
FT                   GVGGLLAFGLTLVVLALGAFGLAGAGGRVGLTAAVAIALAAEVGAKAGMATLVCLGAPA
FT                   HEGLGSALVGENSSAGLLAVAVACLPVVALAPVTGGPAVVAALCCGPVVALLVRSWGRA
FT                   RLGGVSGDLLGATNELARAAAVHAGVVTWTLS"
FT   gene            522185..522778
FT                   /gene="cobY"
FT                   /locus_tag="HVO_0589"
FT   CDS_pept        522185..522778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobY"
FT                   /locus_tag="HVO_0589"
FT                   /product="adenosylcobinamide-phosphate guanylyltransferase"
FT                   /EC_number="2.7.7.62"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04217"
FT                   /db_xref="GOA:D4GSI4"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSI4"
FT                   /protein_id="ADE04217.1"
FT                   /translation="MCGGRGTRLDAPVEKPLVDICGRPMLDRVAAALRDSSVETVRAVT
FT                   SPHTPNTRDRAADLGLDPIEAPGDGYVSDLGFALARVSRPVVTVVSDLPLVAPEHVDAV
FT                   VSAADGGAATACVPVELKRDLGASVDDALVFDHEGTAVCPTGLGVVGPAAADATIDTDA
FT                   DTDTHSTMYLSTDTRLALNVNRPTDIELAEDRCE"
FT   gene            522769..523836
FT                   /gene="cobT"
FT                   /locus_tag="HVO_0590"
FT   CDS_pept        522769..523836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobT"
FT                   /locus_tag="HVO_0590"
FT                   /product="nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /EC_number="2.4.2.21"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04874"
FT                   /db_xref="GOA:D4GSI5"
FT                   /db_xref="InterPro:IPR002805"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSI5"
FT                   /protein_id="ADE04874.1"
FT                   /translation="MRVVLVAGTTETAKIPGISAAGAEPSLVGHTPSADAEIIEYGEPV
FT                   RSPVTPVSPTGCPTPAAVTRAVKQLTGFDVLTVDAGLAKPSAAPTIDVGARPGRDIRES
FT                   EPVPTAPGAFEAARRMGLALPEDELVIGETVPGGTTTALAVFRALGEEFPVSSSLPDNP
FT                   TSLKEEVVAEAFEASDVEPGFAAHKPRRAARYLGDPVLPVVAGLTVGALENGTDVTLGG
FT                   GTQLLAAAALARHAGANGDLTLATTSYLAEDVPELADAAEAFDLELTVTDPGFETHPLD
FT                   RYAAGEAKEGAGMGGALMLADRMGVLDDVEAATLDVLSTLDPEAVETGTGTAAADAGGA
FT                   DAGGVDADADIDDGP"
FT   gene            523826..524848
FT                   /gene="cobD1"
FT                   /locus_tag="HVO_0591"
FT   CDS_pept        523826..524848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobD1"
FT                   /locus_tag="HVO_0591"
FT                   /product="L-threonine-O-3-phosphate decarboxylase"
FT                   /EC_number="4.1.1.81"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02955"
FT                   /db_xref="GOA:D4GSI6"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005860"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSI6"
FT                   /protein_id="ADE02955.1"
FT                   /translation="MDPESVRAGSRVPHGGTTDPTVLDFSANTNPERPDGVEAVYREAF
FT                   DASTRYPDDDYADFRAAAGDYVGCVPEAVVPTAGGLEALRLAFEVTLSPGDTALVPEPS
FT                   FGEYDREIRLQGAEPVAVAHDAILDADPADHAVAVVCTPNNPTGELAPADDLRAFAARC
FT                   READTVLVVDEAFLDFTDEPSLAGEPGVVVARSLTKMFGLPGIRAGFAVATGDLGDRLA
FT                   VARRAWSLSTPAAAVGAYCMDDAEFVSRTRARVSAERERLRETLSDAFAVSPSDAPFLL
FT                   VDVGDRDVDAVVETARDRGVAVRDATTFPTLDSHVRVAVKRPDENDELLRALAAVADDV
FT                   "
FT   gene            524841..525578
FT                   /gene="cbiZ"
FT                   /locus_tag="HVO_0592"
FT   CDS_pept        524841..525578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiZ"
FT                   /locus_tag="HVO_0592"
FT                   /product="adenosylcobinamide amidohydrolase"
FT                   /EC_number="3.5.1.90"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04301"
FT                   /db_xref="GOA:D4GSI7"
FT                   /db_xref="InterPro:IPR002808"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSI7"
FT                   /protein_id="ADE04301.1"
FT                   /translation="MFETARRDGVCRLARPGTRWLSTGYAGGDSRADAAFNITVPEGWP
FT                   ETDLDAYVERRLSAAGFDERGPTLLTGVGQEHARRARFGPVEVVATAGVSNPAELPIDD
FT                   DPREWGDASDAPDAAAGDDRDDRDDPVGTVNVFVGTTRSLEPGALANLVAVAAEAKAAT
FT                   LLARCGAPGTTTDAVVAACDPAGDPATFSGSATEVGNAARVCVRDAVLASLGSRYDAGP
FT                   ISQGVDEANYGVVADDRATVAPI"
FT   gene            525678..526691
FT                   /gene="cobD2"
FT                   /locus_tag="HVO_0593"
FT   CDS_pept        525678..526691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobD2"
FT                   /locus_tag="HVO_0593"
FT                   /product="L-threonine-O-3-phosphate decarboxylase"
FT                   /EC_number="4.1.1.81"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04947"
FT                   /db_xref="GOA:D4GSI8"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSI8"
FT                   /protein_id="ADE04947.1"
FT                   /translation="MDPGSVSDVDHVTHGGTADHSLVDFSTGSNPEHPSGLAGVYESAL
FT                   ATARRDSLDDYSRFRVAAAEFVGCNPDEAIPAAGVIEALRLAVGVTVSPGDSVALPAPC
FT                   CGEYAREIRLQGGDPVHVPHDRLLETVDPAEHAAVILSYPANPVGTAYPRDELRAFIDD
FT                   CRRADTPVIVDETYLGFTRLPSTAGLDGVIALHSVTNVFGVPSLRAGFAAATGDLGDRL
FT                   SRARCTWVLSAPAVEVATFCLEQEAFLEATRNRVERERPRVIAGLDRLGYDPHPADSAL
FT                   VLFRADDVDCVLRETRRRGFAVRDARDYQGLDSHVRISVRRPDENDRLLDALAEAS"
FT   gene            complement(526838..526945)
FT                   /locus_tag="HVO_0594"
FT   CDS_pept        complement(526838..526945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0594"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02479"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSI9"
FT                   /protein_id="ADE02479.2"
FT                   /translation="MFRIVIQSFAFAVEDSTFAVYATLLTIAFIVYLNR"
FT   gene            527070..527843
FT                   /gene="minD2"
FT                   /locus_tag="HVO_0595"
FT   CDS_pept        527070..527843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minD2"
FT                   /locus_tag="HVO_0595"
FT                   /product="MinD/ParA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03336"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSJ0"
FT                   /protein_id="ADE03336.1"
FT                   /translation="MVEAFAVASGKGGTGKTTSTLALGMALAEEYDVTVIDADTGMANL
FT                   LFHAGLDDADVTLHDLLIDDHDAAVSDAVYERFGLSVVPCGTSLAAFEAADPGRLRDVV
FT                   AELAADTDVLLLDSPAALGSKSAVLPVVLADRIVVVLQPTVPSLSDGLKVQEYAHSYGT
FT                   DTAGVVFNRVRPDENVETIAEQAGRYFGGQTLASVPESDAVRAARREGKPLLAHAPDDP
FT                   AADAFREAAARLDVREGDGREVAERFKSAVVPERI"
FT   gene            527840..528424
FT                   /locus_tag="HVO_0596"
FT   CDS_pept        527840..528424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0596"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03367"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSJ1"
FT                   /protein_id="ADE03367.1"
FT                   /translation="MRIPRGELRRSRVVDDAAAVLRTVLDEELTGYVVFEPQDALLLGE
FT                   TTRGVVTFEDGVPVLAYDTEREVGGRDGLEGFAVTGPTRAAVHAVDAAELADAHEVEAF
FT                   RVPPGEPARVLAGDERLATKTLDAAPAARREESRDQSAVEAFLADADAIEEIRSEAREE
FT                   ARARASEWGLDDVLADDADESAAIDAGPDSR"
FT   gene            528489..528956
FT                   /locus_tag="HVO_0597"
FT   CDS_pept        528489..528956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0597"
FT                   /product="OsmC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04893"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSJ2"
FT                   /protein_id="ADE04893.1"
FT                   /translation="MSTEKSQTRNQTLTFAVAAAAESPTETRVSVRDFEFVVDEPESLG
FT                   GANAGPNPVEYVLGALAGCLNVTAHVVAREMDLDVRDLEIAIEGDLNPATFMGKREDGR
FT                   AGYQEIRVAVTADVDADAETIDAWLAAVEARCPVSDNLRNATPLALSFDRR"
FT   gene            529064..529795
FT                   /locus_tag="HVO_0598"
FT   CDS_pept        529064..529795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0598"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02858"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSJ3"
FT                   /protein_id="ADE02858.1"
FT                   /translation="MTVLRLLRLRRPADFADWYRIGAEYVHDVAAGMGFRVGDFESRVV
FT                   RATDAMRAGRTDLPPDLARSVAADLLADAAFCDPFCQWMPLWYELGLAAPCAYADYRLR
FT                   RVAEQYADDLPHLSVPRFSRPEDVYVDGRPATACVDGFAERFVLADAVLHLEWFVYVAR
FT                   ESGIFVPPLLVERTREQTVAYYAGRREELDPDVRSFQRLLFSDDEWVRRIADVYDLDSV
FT                   LFDYWERILAQERRRLSTFDG"
FT   gene            complement(530034..530474)
FT                   /locus_tag="HVO_0599"
FT   CDS_pept        complement(530034..530474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0599"
FT                   /product="DUF1486 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03723"
FT                   /db_xref="GOA:D4GSJ4"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSJ4"
FT                   /protein_id="ADE03723.1"
FT                   /translation="MASASAPTPTGNERIARRSPEEVASEGNVGLIDEICAEDVLDHSP
FT                   LGEVRGRDELKAQISGLKESFSDFSATVEDAITEGDTVAMRVTLRGTHDGAFMGIEPTG
FT                   KPIEVGNMVFTRIEDGVIAERWVQPDMLGMLTQLGAVEPPTA"
FT   gene            531046..531579
FT                   /locus_tag="HVO_0600"
FT   CDS_pept        531046..531579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0600"
FT                   /product="ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03679"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSJ5"
FT                   /protein_id="ADE03679.1"
FT                   /translation="MSEVHNDVQAYTLRLELVDEPGELLRSLQPIAERGGNLLSIFHER
FT                   GNVTPRGYIPVEVDIEATPDRFDNIVEGLSDAGINVIQAGTERYSERLTIIFSGHLIET
FT                   DLSDTLTQIEATRNATVTDISLSAPAGSIDVSSARFQLAAESGSTEDVLSAMRDIADEK
FT                   DLQLVEPLTVGGRA"
FT   gene            531576..532526
FT                   /gene="hom2"
FT                   /locus_tag="HVO_0601"
FT   CDS_pept        531576..532526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hom2"
FT                   /locus_tag="HVO_0601"
FT                   /product="homoserine dehydrogenase"
FT                   /EC_number="1.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03780"
FT                   /db_xref="GOA:D4GSJ6"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR022697"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSJ6"
FT                   /protein_id="ADE03780.1"
FT                   /translation="MRLCVLGAGAVGSAVVELAAEHGHVVTAFADSDSAVVDADGIDAD
FT                   AVLSKKREDGVVGDADPESVFDADYDVLVEATPTTLGDAEPGFSHVERALADDRHVVLA
FT                   NKGPVAERYADVRALEADSEGTVRFGATVGGALPILSTIEDVGPSRVSAVYGVLNGTAN
FT                   FVLSRMAAEGLDYEHVLAEAQDLGVAEADPAFDVDGTDTALKGVIVANVLAEGETEFTL
FT                   DDAEVEGIQELSGGMLDLAQEDGQTIRLIVEVADGSVRVGPRLVSANGAVAPSGAENAV
FT                   QIEADYCGRLGITGRGAGGPETASAVLTDVERLAD"
FT   gene            complement(532608..533351)
FT                   /gene="aroD1"
FT                   /locus_tag="HVO_0602"
FT   CDS_pept        complement(532608..533351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroD1"
FT                   /locus_tag="HVO_0602"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /EC_number="4.2.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03688"
FT                   /db_xref="GOA:D4GSJ7"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018508"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSJ7"
FT                   /protein_id="ADE03688.1"
FT                   /translation="MKLDESALAATTNDLTREVDARGVADLIEFRMDQADDPLEQLAAY
FT                   DGELPIIATNRARWFGGKASDTGRLDDLFSASRYDAVEFVDIELETVRAKEWLAHEFRE
FT                   NDVQLIISHHDFDETPDREVLDAIIEQCAEFGDVAKVAVYPQNQRDTLTLLEAVNDATN
FT                   RGIDVAGISMGELGSHTRVIGHLYGSKLGYAPLLADDNDYAPGQIPLEKLASLIELTKN
FT                   ERVDGQVIDTIRSEVSVPKELTLSD"
FT   gene            complement(533893..534561)
FT                   /gene="aroD2"
FT                   /locus_tag="HVO_0603"
FT   CDS_pept        complement(533893..534561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroD2"
FT                   /locus_tag="HVO_0603"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /EC_number="4.2.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04658"
FT                   /db_xref="GOA:D4GSJ8"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSJ8"
FT                   /protein_id="ADE04658.1"
FT                   /translation="MAANAYALAGVTETLTEAAAAEGIADYVEFRMDGATTPLDALDEY
FT                   DGSVPLIVSNRPEWAGGTAAESDRLETLAAAAAFAAVEMVDVELRTIRECGWLRDELRE
FT                   QDVELIVSHYDRHKKPQKTELLQIVSECNNYGDVAKLVVTAEEKTDSLALLQSFNTASE
FT                   RGMRVTGYALGEIGRHTRVIGVFYGASIAYAPIVSDERAPNDIDLEKLSYLVEWVSAAR
FT                   "
FT   gene            534891..535787
FT                   /locus_tag="HVO_0604"
FT   CDS_pept        534891..535787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0604"
FT                   /product="GalE family epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02526"
FT                   /db_xref="GOA:D4GSJ9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSJ9"
FT                   /protein_id="ADE02526.1"
FT                   /translation="MVTQQVLVTGPFGEAGEAILNHLAERDEYEFTYLDRTEHPEYETF
FT                   VADIADYEAIRPAFDGQDAVIHLAAQSDAGAAFEDIIEPNIMGTYNVLKAMEDAGVEKL
FT                   IYASSQRVMGLYEEDLAPDLYEEDYPSEYDPLRFTHETLPKPDGYYGASKMFGEHICRT
FT                   HARRDGAPSQVYSIRISSVRTEQYDHPYGDAERGVDRGDEHKVEDGEVWDQSQTGSWER
FT                   GSDEYEEMVKRLKATWTSQRDFAHLLECCLEDDSVTYDTFYAVSGNKARWFDTDHAKAV
FT                   LDYEPADDGSEWDSPPE"
FT   gene            complement(535848..536621)
FT                   /locus_tag="HVO_0605"
FT   CDS_pept        complement(535848..536621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0605"
FT                   /product="IclR family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03389"
FT                   /db_xref="GOA:D4GSK1"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSK1"
FT                   /protein_id="ADE03389.1"
FT                   /translation="MTNSTGSGSRRIQSVEQAFDIIRYLREVDGATLSETAEDMELPVS
FT                   TAHIHLATLVDTDYVVKVGSEYHCSLRFLEMGGAMRDGMALYRVAKPELDELKEQTGEH
FT                   TNVTVEQNGFAVQLYKAQSPESIDDDAPLGDHLYLHSTATGKAMLAKHSRDEVDRIVDR
FT                   RGLPALTDDTITDREALHEELEAIRDRGYSINRGEHYPGVCAVGTAIVSEPDDAVGAIS
FT                   ISGPMSRIEDGRIEEELGPALLNKKNIIELKIKQY"
FT   gene            complement(536843..537532)
FT                   /locus_tag="HVO_0606"
FT   CDS_pept        complement(536843..537532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0606"
FT                   /product="MenG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03361"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSK2"
FT                   /protein_id="ADE03361.1"
FT                   /translation="MHTIEPDVERPDRELVEAFEEIPSTIVSDVTGNIGLTMDAGLRPA
FT                   YDGVEMAGTAVTVKAAPGDNLIIHKAITLTEPGDVLIIDCDGYTDTGHVGELMCTSCQA
FT                   NGLAGLVIDGAYRDSREIAEMEFPVYGRGVNPQGPLKQDPGSVNVTVSVGGVSVDPGDI
FT                   VIGDDDGLAVIPRRGAEEVLERAHEKLSTEDSVREEVLKGEYLYELNGYDELFENLTIV
FT                   GPEDSIH"
FT   gene            complement(537737..538747)
FT                   /locus_tag="HVO_0607"
FT   CDS_pept        complement(537737..538747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0607"
FT                   /product="Bug domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04174"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSK3"
FT                   /protein_id="ADE04174.1"
FT                   /translation="MGDDTISNRSGRSALNRRNFIKAAGVGGVALSAGCLGSLSGEQEW
FT                   PSRPVEVISPWSAGGGADRTSRAVADAAENHTDVSWNVSNQTGGSGSVGMNAAANAEPD
FT                   GHTIGCTAPEIALFEHLGIADLSPDDITPIMQYTEFPAALVVSEDAEFSTLDEWISYGQ
FT                   DNTLQMANSGFGSSWHMAAAGIASEAGVNVEHISYEGAAPAMTAVVNGEVDCTAVGAAE
FT                   VAPQVQDGGLSALGVAFDQQVEALPNTPTLQDQGLDISIGSWLAHFAPAGIDDELKQQL
FT                   ADVYSAVYEDDSFVEFMENNNFIRVERGPDELQDFLDQQYEFYGNLVDELGIEEQ"
FT   gene            538994..540037
FT                   /locus_tag="HVO_0608"
FT   CDS_pept        538994..540037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0608"
FT                   /product="oxidoreductase (homolog to zinc-containing
FT                   alcohol dehydrogenase)"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04985"
FT                   /db_xref="GOA:D4GSK4"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSK4"
FT                   /protein_id="ADE04985.1"
FT                   /translation="MRGLAKTSREPGAMELVDVETPEPASNEVLIEVDYAGLCGSDAGI
FT                   YKFKSAFERMEMPTIIGHEYTGRVVERGEEASRFSVGERVVERPIRGCGECFQCQIGEE
FT                   SICQDAVLTGIDLDGAYAGYIAVPESALQSVPSNVEPKHAALVEPTAICTRAVIQNSRV
FT                   KAGDRVLVAGPGPIGLLCAQVAASQGAEVVVAGVGRDTNYRLPLAEELGYPAVNVEEDD
FT                   LSATQRELTGGVGFDVVFDTTGHPSGLPMAVEQVRKGGQIVLVGQTGETTMEFTPLVRA
FT                   EVDLQCTYGATFEDFERAFRLIGSGDVDHATFLDDRYRLTESEDAFEAFLAGETCKPVF
FT                   DVSVLRE"
FT   gene            complement(540257..540904)
FT                   /locus_tag="HVO_0609"
FT   CDS_pept        complement(540257..540904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0609"
FT                   /product="beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02880"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSK5"
FT                   /protein_id="ADE02880.1"
FT                   /translation="MSVSNATEGIDQIQFDHVRVLVLKDTPTGKTTLVDTGFDEDGEEL
FT                   VEILEREYGGVDRVIITHGDHGHHGGLPSVMEAFDPELVASANESKLHEAIDYEPDVTF
FT                   TDGDLLDGNIRVIEVPGHTKATSALLLEDRGILISGDALDGADRAGLPAGYLLPPPALF
FT                   NDDHKAAEINLYDLLQYDFETLLVFHGSHVFEDPKGKLDDFLVEREWDPRPE"
FT   gene            541192..541707
FT                   /locus_tag="HVO_0610"
FT   CDS_pept        541192..541707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0610"
FT                   /product="DUF1468 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02925"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSK6"
FT                   /protein_id="ADE02925.1"
FT                   /translation="MVIQKVGAVLDRIGLESVRSSPLSVFFILFSVVVVFFASQFPSGD
FT                   GVGPSFFPIAVSVGIIFFAGIDVLTGSETELEISEFDFKPAAVVAGFLVAYVLVMPHLG
FT                   FLVSTMVFMPVVLYYSNIHSKLLLAVLSIGFPIALFYIFGRIFLVRLPEGIIPVSRLLP
FT                   QLPLAVTF"
FT   gene            541707..543194
FT                   /locus_tag="HVO_0611"
FT   CDS_pept        541707..543194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0611"
FT                   /product="DUF112 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03768"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSK7"
FT                   /protein_id="ADE03768.1"
FT                   /translation="MVVEYIGQALVNLADPFILLLMVGGIFLGILMGSIPGMTATMTIA
FT                   VLLSFTFTMEPSQGMILLLGIYGGAVYAGSIPAILIRTPGTPSAAATIFDGHPLSQKGE
FT                   AGRAIRVSTIASFVGGVISVFALMFFSPVIADAALRFRSPEFFALAFFGLTIIVSVSGD
FT                   SLTKGMVSGLLGMLVATVGIDPVTGFHRFTFDIPELLTGVEFIAVMIGLFGIAEGLRKY
FT                   SQGINSGNDRVDQEITGVFPSLSDLRSIAPVSVGSGILGSFIGAIPGAGGDIAAFITYN
FT                   EATRWLKDSVPSFGEGNVRGVAAAESGNNASTGGALIPTLTLGIPGDSVSAILIGALLV
FT                   HDVNPGPGLYQEEPVLLYTIFVGFLLIYVFILIFGMLGANYWARLINIPKSHIWPVILV
FT                   LCVIGAIALRGNVFDAWIMLGAGVLGYAMRLRGYPLAPMVLGLILAPIAEENLRRSLVL
FT                   SGGSPTIFLTSPIALVIILLGLGAIALPAVRSIRANA"
FT   gene            543730..544161
FT                   /locus_tag="HVO_0612"
FT   CDS_pept        543730..544161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0612"
FT                   /product="UspA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03452"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSK8"
FT                   /protein_id="ADE03452.1"
FT                   /translation="MVVVAAVDRSGRSAHVVSEAASLAAAFDEAVHVVHALTRSEFIDL
FT                   GLTSAQAEEPKDMDEIRSAAAEMAEDSVSGLDVPYETVGLVGNPADEVIEYADGQDASY
FT                   IVVSPRRRSRTGKMLFGSVAQSILLNASCPVVSTLADEE"
FT   gene            544296..544943
FT                   /locus_tag="HVO_0613"
FT   CDS_pept        544296..544943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0613"
FT                   /product="beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04786"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSK9"
FT                   /protein_id="ADE04786.1"
FT                   /translation="MTVTAVADGVYTIQFDHVRVFVIEDRPAGTTTLVDAAFPDDGHEL
FT                   VSVLESEFGGVDRLVITHGDEGHFGGTPAVLDAFDPELLVPGGAKGFYDALDIEADRHF
FT                   RHDDVLDGGIRIVQVPGHTVANNGLLLEDDGVFIAGDVVEGSDRRGLPPGFLVPPAAQF
FT                   NDLSHEEAERNLVKLFDYDIETVLVSHGTHVDDDPLGKLDDWLIDRQWTLSY"
FT   gene            complement(545379..545921)
FT                   /locus_tag="HVO_0614"
FT   CDS_pept        complement(545379..545921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0614"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03962"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSL0"
FT                   /protein_id="ADE03962.1"
FT                   /translation="MNRFSRGSSDAAASGDDRGQLVLVSGAVVVVALLTLLVVHAQLGF
FT                   AGVTETAEAPPLDDIVETTEDAVELATAGVAGRYDWAERDAAVADFRSRLNPALTNVER
FT                   ARPGGVALTTNDSAASGWALRNCPDGPSREFGPCVADDGVVVQERAGETTVVAVLVDVR
FT                   IATPRSRTDLTVAARPN"
FT   gene            complement(545918..546391)
FT                   /locus_tag="HVO_0615"
FT   CDS_pept        complement(545918..546391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0615"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03128"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSL1"
FT                   /protein_id="ADE03128.1"
FT                   /translation="MRDRRGERSRRLRRHCAAADSTRTDDRGQLSLTVVEAVVATLFVL
FT                   AVAAGFALAPPAPTAESDALARQATDAASLVGSVPAEGPGTLLGVACGSPAEFDDRAAR
FT                   LHEVAAAGLPNGAFVSLRTEVGSVGRPPPETARVRTATAVVPRCTATLEVWYP"
FT   gene            complement(546384..547079)
FT                   /locus_tag="HVO_0616"
FT   CDS_pept        complement(546384..547079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0616"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02272"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSL2"
FT                   /protein_id="ADE02272.1"
FT                   /translation="MRSHGAARAQTTLAGLAVALVLVTAVTVGGVAAADRVLADAAGES
FT                   LEQHRAESAADALLTESPITRSDNGSDAVDLTLANETNATVLAAAVPPLRGAAFRVRID
FT                   GRTVAERGDPSSGYTVSRGAVGVNRRTVRRSINLSAEPNTTLTGRTNRTRLDVNPAPNT
FT                   TVQTIWVDDRVALHQPAGIEGQHVVGVSSRPDHEVRVETTGDEPSGSVDVSATAFDATV
FT                   VRIEVTVDA"
FT   gene            complement(547072..547644)
FT                   /locus_tag="HVO_0617"
FT   CDS_pept        complement(547072..547644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0617"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03112"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSL3"
FT                   /protein_id="ADE03112.1"
FT                   /translation="MADASEPSSVAPDDSGPVTPGTGGRAAERAVVPVVGKALEAAIVV
FT                   LFVGLLTTVLFGGVVPDHRAAVGHELADRTLAAATEQVETTAVVPESAVRGSRRVDAAL
FT                   PRAIRGSSYRIAYVPNATLATDPNVTAPALVLDHPNDAFDRRLPVTLPDSVSVSGAWDS
FT                   GNDCVVRVVVDDDDGTTLELANGRADA"
FT   gene            complement(547637..548350)
FT                   /locus_tag="HVO_0618"
FT   CDS_pept        complement(547637..548350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0618"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02258"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSL4"
FT                   /protein_id="ADE02258.1"
FT                   /translation="MSATRGQANVVGVALLLGVGVVAIGLLTASVGGLVDAQIASADAD
FT                   AAADGFSSFRDGVVAAANDSYPVRVTDGDLSRVNRTVRITSETRPTRTYDADGYVADLG
FT                   GHRVAFVGGAVVRGTGDSAALVTPVPVAFAGDAAFLTVPVLTADATDGGGLGSGAALRT
FT                   QTTRTVTDRPADGYAVAVETATPDAWERAFERRGFNTTRTDFDGDGTESVVATVPDERT
FT                   LTVARYDVSVVIDRG"
FT   gene            complement(548347..550266)
FT                   /gene="pilC1"
FT                   /locus_tag="HVO_0619"
FT   CDS_pept        complement(548347..550266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilC1"
FT                   /locus_tag="HVO_0619"
FT                   /product="type IV pilus biogenesis complex membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05195"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSL5"
FT                   /protein_id="ADE05195.1"
FT                   /translation="MTEFDAGADERRVGRVRSLSVLDRALYALFARHVDAGRHDRDRRR
FT                   YRGTDMRMSFDLYLARAYGLAWATGLFVAFPTALVALAVPDSTVDAVLDVLRAALPLFE
FT                   HVPIPVVPRLPVVGAFALAVAVATRRVVLAVAGQYLGWLATARRENIERTLPGAVRYLH
FT                   VLSSGSDGPRGMLRRVAETDAYGETAIAFRSVLNTASLTGNVNEGLRRVARDTPSEGML
FT                   APFLLKFREHAGQGSDALRNYLRMESRMLGHRQDRARERAEGFLELLAELFIVLLVLPS
FT                   LLVIVLTVMSVIAPGLSAPVATPLGQTTTRGVVVYSSAAFIVGVGLGASVLVAGLRPPD
FT                   QSVEYDRPAGALRVLDSTLSNPASAAAVFVFSGLVVAGVAAFVGADAVGVALAGYVAYA
FT                   APVGLVGVRRARLDDAKDRELKDFVHAVSGHVNLGRPFGEAVERVGRDVDLGPLDADVA
FT                   DLALNLRFTAPSSGTDVNLRTAALARFVDRVGTPMAEQTIGLVVGALDGGSDTGTVFDT
FT                   LQTEIGRLYHEKRALRSGLLVYVAVGWTTALLVVGITVAVNVHVFDGFAQLSTLSTGRS
FT                   FAINAGAVDLERDRYRMYVVTQATMLASGWFAGTASRGRYEALLHSAALVVACYLVYAG
FT                   VGLI"
FT   gene            complement(550263..552629)
FT                   /gene="pilB1"
FT                   /locus_tag="HVO_0620"
FT   CDS_pept        complement(550263..552629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilB1"
FT                   /locus_tag="HVO_0620"
FT                   /product="type IV pilus biogenesis complex ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04310"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSL6"
FT                   /protein_id="ADE04310.1"
FT                   /translation="MPTQGDNAGSESPTPTLEFGASSTSGAAGAVPAPVPPDDPRAWYA
FT                   PTVRSQYEVAPDTVVTISDADHGFDYAVREATLGARETDALETVRDHFSTVVRRRPLTR
FT                   EGAVSRAETGLSPKYRRIFDRLLDLTPTARRRVERHALSELRLLGAVTPLALDDRIEVV
FT                   DAGRGDGSERLVVHTEDFAPATTTFDSDVSFADRIAAERIDHYTVPFAGYDVDVVIYRD
FT                   RLLGDDRFATKYAVLEPDLVPGDAELIEECKERIWEANVNDVVADRIEFVRDRAREFLS
FT                   RRLTARNTRAWVDATSFRVRAALSEYGLALPPVDRRFAEDRLDDLVYYVLRDYVGEGVL
FT                   TVPIRDPHLEDVEANRVGERIKVIPRADVTGHGGLRVPTNLVFEDETEFTNVVTQLAAA
FT                   DGVELNASNPSAKVNLRPGAVGGDPASADTDETIRCAVALPVISEGGPHVSIRKQTGDV
FT                   LTPVDLVESGSVSTELVTLLWLCYEHHRVVLFSGATGVGKTTLMNAHMPFVPYDHRPIS
FT                   IDEGSREVHLPHETGVSLTTRDHESEFKRVTMADLMTEANYLNPDVEVIAEINTPESFA
FT                   TFAETLNTGHGVIGTTHAADIETLVNRVIEQGLPPYLLRELDLVVFPHKVDGERYVSEV
FT                   VELVPESEYDETWGRRGVIEKDGRTLHWNTVGRRTPDGSFDLSYEHPQLGDDHRRVGVR
FT                   LFHRIAEATDRDVEAVEREFHRKHRYVEYLVREQITDVDRLFGFLSDLRTDEAATVERV
FT                   RRRMAERDSADGDSAARGGVDDHTHHRDRDDEADP"
FT   gene            complement(552851..554593)
FT                   /locus_tag="HVO_0621"
FT   CDS_pept        complement(552851..554593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0621"
FT                   /product="sensor box histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03500"
FT                   /db_xref="GOA:D4GSL7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR031621"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSL7"
FT                   /protein_id="ADE03500.2"
FT                   /translation="MFGGAVGPQLLTQPVSLVVIIIGLMVTSGVVSGYVALFAWQRRSM
FT                   PGAIGLGVLALASGWWSSGYLLELIVADVALKLTLADLQWVGVLVAPIAWFFFAFSYAG
FT                   RDRFTARPSLCVLSVLPVIGLGAVWTNSLHHLMWTSVTVVPAVGRAITILQMEWGPLYW
FT                   VVLGYSYLLWLAGAVVILRTALDMPDIYRLQAITLVLGTLMPVLGNFATTLLELYGAAI
FT                   DMTPAAFTFAGLACTVAISRYELLESRPVPRWVARERVVETMADAVVVTDTKWRVTDVN
FT                   RAAARVLNDTADELKGRPVGDVIDEFSPDQRDTDQVTVRLGSSQRYFELRTSAFCDHHG
FT                   RDIGHALVFRDVTDRRLNLQQLEVMNRVLRHNLRTEANLLEGYANLVLDDIDGGEFDDA
FT                   RDHAKTLQDHAKTLVNISQKARKLGVTRGSDGNGDVQLHPAAVQIRAAADAVRTDFACA
FT                   NVRLVELPDRDVVCAPTLEPIVRELVENGVQHNGSSTPVVSVTAGWEDDELVIRIEDNG
FT                   PGINASELAAIDAHGETQLRHASGLGLWLVKWGVDQLGGTVVFHRREEGGTEVVLRIQA
FT                   VRSE"
FT   gene            complement(554747..555640)
FT                   /gene="ubiA3"
FT                   /locus_tag="HVO_0622"
FT   CDS_pept        complement(554747..555640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiA3"
FT                   /locus_tag="HVO_0622"
FT                   /product="UbiA family prenyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03241"
FT                   /db_xref="GOA:D4GSL8"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSL8"
FT                   /protein_id="ADE03241.1"
FT                   /translation="MRIVPTRLYGAVVHSSVFLGASTIAEVFVASALAGIGPNVALAVG
FT                   FLITVGIYNFDKLADLDADEENYAERTAFVAAHPRLYAGFSTLAVVGALWLAVRHGGVY
FT                   GLGLTLFPGVVAVFYSAPVVPLPSVDRLKDIFLVNTASVSLAWAVLVGFAPLAVAATAP
FT                   EYAAGAAVAAVWFFLRSAISVEVHNVRDVAGDAQNGVETLPTVIGVRRTQLSLYALELV
FT                   SVGLVWVAARAGVVPAWAPFALLPAVAYSTWITYALTETDRSIERLCTLRDAEGVLMAV
FT                   GVAVVAAAVGTGGTLA"
FT   gene            555767..556195
FT                   /locus_tag="HVO_0623"
FT   CDS_pept        555767..556195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0623"
FT                   /product="MoaD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04066"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSL9"
FT                   /protein_id="ADE04066.1"
FT                   /translation="MKIPTAERAETAATGETAATAERVETTVEVKLTGHVRSAAGTHRT
FT                   EFTFEGETLRAFLEAFFAAYDVRDLVIAEREADATTRGWARVDRPPGTWRKNPEGEQTQ
FT                   PYARVLVNGVFNENLDGFDTRLEDGDRVALMKPFLYCV"
FT   gene            556293..556805
FT                   /locus_tag="HVO_0624"
FT   CDS_pept        556293..556805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0624"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04857"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSM0"
FT                   /protein_id="ADE04857.1"
FT                   /translation="MASTPADDSTRERGPGEAFCRDCGAVIDARAEICPECGVRQRDPP
FT                   KSSVDSALDDLFEGGNPFVAAVLSAVFPGLGQLYNRELERGLVFAVGFLVATASVMVLI
FT                   GFFLAPAVWLYAVYDAYTRAELRAEELQRESGRDRETEVSVSEAAGDEAADHEEVDDEE
FT                   TDDDREE"
FT   gene            complement(556841..557266)
FT                   /locus_tag="HVO_0625"
FT   CDS_pept        complement(556841..557266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0625"
FT                   /product="DMT superfamily transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02876"
FT                   /db_xref="GOA:D4GSM1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSM1"
FT                   /protein_id="ADE02876.1"
FT                   /translation="MELAEVDSAALFGLITMVTWGIWIVVGNAASESMDPRTAAAISYL
FT                   VAALLAFGFIVVSDASLVVTARGGLLAGVAGLCTGVGLISMYIGFTHGSTTVVSTLGAM
FT                   YFVVAAVIGVVVLGENLTVTKLTGIAFAVLGIVLVTR"
FT   gene            complement(557375..557884)
FT                   /locus_tag="HVO_0626"
FT   CDS_pept        complement(557375..557884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0626"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03678"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSM2"
FT                   /protein_id="ADE03678.1"
FT                   /translation="MEEHPLSDEPGTWETVVAECESLADDYRERDWTVVVALPGDVVPV
FT                   PAAGDEVVEHVGLDVVVGDDVYPDLEAAVEGATFDEYEAFRAVSGGLVYLALVVRATDD
FT                   EVAVCLPLYYRLAESERMFSLLDGGETMRTKVHPLDPDKGVEFIHEDPNPLLPPDWDAD
FT                   LSDEFA"
FT   gene            558052..560748
FT                   /gene="dppDF2"
FT                   /locus_tag="HVO_0627"
FT   CDS_pept        558052..560748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppDF2"
FT                   /locus_tag="HVO_0627"
FT                   /product="ABC-type transport system ATP-binding protein
FT                   (probable substrate dipeptide/oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02844"
FT                   /db_xref="GOA:D4GSM3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSM3"
FT                   /protein_id="ADE02844.1"
FT                   /translation="MRNLLSLSDLRTQFSTGRGQVKAVDGLDLTVGEGETVGLVGESGS
FT                   GKSVTALSAMGLVDDPGEIVSGSVELESGRLAEEFREEYNNPAFVDGDVVNLVDAPEEA
FT                   LRAVRGRELGMIFQDPMTSLNPSLTVGEQVAESLRLHQYGGRRKDSWFNAVRELLPRIS
FT                   RDIDDEIVERTIEVLESVGIPEPGARVDEFPHEFSGGMRQRVLIAIALACQPRVLVADE
FT                   PTTALDVTIQAQILDLIDDLQEDLGMSVLMITHDLGVVAETCDRVAVMYAGEIVEEGPV
FT                   EEIFHNPSHPYTYTLIESLPSEDKERLTPIEGNVPDLIDMPEGCHFAPRCPWAQPECTS
FT                   GEIPYKQHGDDEVDHRSKCVLDDFDTSEYGGDAIEASTGTEPSDTPLLEVDGMQKYYEQ
FT                   ADGILDRFFGADDRSVKAVDGVDFTVYEGETLGLVGESGCGKSTAGRSLLHLTPPTGGR
FT                   VVFSGTDLSGLDSDELRAMRRDMQMIFQDPMSSLDPRMTVGQAIREPLDVHDLPESDPN
FT                   VRGEADVTVTGIDAERVSVTASDEIDAIVGSSNGVATAAVTVTVADGEVDVAVEERLRT
FT                   EVEVEREGDVVSGVTVRVTPGDSTSERRRRRVRQLLDAVGLEPGQYDRYPHELSGGQRQ
FT                   RVGIARALAVDPDFIVADEPVSALDVSVQAQILNLLEDLQERFGLTYLFIAHDLSVVRH
FT                   ISDRVAVMYLGEIVEVAATDELFDDPRHPYTQALLSAIPEPDPAAETDDRIILEGDVPS
FT                   PINPPSGCHFRTRCPQVIPPADLDIEQAAYREVMDLRQRVEREALDVETARDAALDAGD
FT                   PSAEAAVSADGGTADAVVDELRESHLSHSLSPELRGVVDRALERVVADDWDEAGEILRE
FT                   RFESVCERDAPELGEQTHPAACHLVDE"
FT   gene            560896..562620
FT                   /gene="dppA2"
FT                   /locus_tag="HVO_0628"
FT   CDS_pept        560896..562620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppA2"
FT                   /locus_tag="HVO_0628"
FT                   /product="ABC-type transport system periplasmic
FT                   substrate-binding protein (probable substrate
FT                   dipeptide/oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03762"
FT                   /db_xref="GOA:D4GSM4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSM4"
FT                   /protein_id="ADE03762.1"
FT                   /translation="MSQDGNDVSRRRFLTAAGAAAATAGLAGCSGGGGEDTTTESDETT
FT                   GEGETDQTETETEDGGSTPVLRYGRGSHSPTLDFQNSTSGEVAKVTEQLYDTLINFEPG
FT                   QSTLTQGLATEYSLEGQSASITLREGVMFHNGEEFTAEDFVATYRRFVDSDYEYYAGDD
FT                   YVSAYGPFTLGSWIDEIQVDGDYSMTIQLTQSYAPFLRNLAMFAASVHSLAAIEEYGTE
FT                   LSSNPVGTGPFQLSNLDDANERVRLEANSEYWGEGPNVDEVVFVTIGQNSTRAQALASG
FT                   ELDIIDGLGAQSSVQVENASNANLVRTEGINIGYMAFNMASREEFRDRRVRQAVSHAIN
FT                   TEAIVNEIYSGFATQASQPLPPNVLGHNDDIDPYPYDPEEAQRLLEEAGYGDGFSFELA
FT                   TFQNPRGYNPSPIQTAETVASNLGEIGIEVDINQQSFGPFLEYTAQGRHDACFLGWYTD
FT                   NADPDNFMYVLLHPQVEEGELTEGQDWVSFDAEGYNTSNRSAWANRDYMDLVEQGQSTY
FT                   DEAERESLYNEANQIAHDEAPWVYLDYADELRGVSNRVSGFQIAAISGPYLNLVSLN"
FT   gene            562646..563665
FT                   /gene="dppB2"
FT                   /locus_tag="HVO_0629"
FT   CDS_pept        562646..563665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppB2"
FT                   /locus_tag="HVO_0629"
FT                   /product="ABC-type transport system permease protein
FT                   (probable substrate dipeptide/oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03053"
FT                   /db_xref="GOA:D4GSM5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSM5"
FT                   /protein_id="ADE03053.1"
FT                   /translation="MISTRFVLKRLLLLVPVLVGVASLVFSILHLSPGDPALTIAGERA
FT                   SEEFVRQVEESLGLNDPIWVQYGRFLADAAQFQFGESFIIQRNTTVREVLANKLPVTLE
FT                   LALYGQLIGISLGIPLGILSAVKQDSITDHLTRIGALAGISVPIFWSGPLLILLFAQVL
FT                   GWLPTSGRISVLYNVEAIRVTGLVTVDTFLAGNWDMFVSAVRHMILPASVIGVYSMALI
FT                   SRMMRSSMLEVIRQDYMRTARAKGQGAKITVLKHGFRNAMIPVITVIGIQFGGLLGGAV
FT                   LTETVFAIGGIGTLLVEAIKVGDYPIVQGTVLTFAFLFTLVNLGVDITYSILDPRIEQ"
FT   gene            563662..564597
FT                   /gene="dppC2"
FT                   /locus_tag="HVO_0630"
FT   CDS_pept        563662..564597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppC2"
FT                   /locus_tag="HVO_0630"
FT                   /product="ABC-type transport system permease protein
FT                   (probable substrate dipeptide/oligopeptide)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03963"
FT                   /db_xref="GOA:D4GSM7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSM7"
FT                   /protein_id="ADE03963.1"
FT                   /translation="MSTESTTTNETATDVDQRGLVDRLTASPFVSRLLSNRLALAGIAI
FT                   IVAMVVIALYARLFLDLEVITQSQLGTNPNRAPPSLDYPFGTDGQARSLLPRVAYGAWY
FT                   AMLFGTVTVAASTVLGVGLGIVAAYYGDVTDNVIMRTMDVLLAFPSLLLALALVAIFPD
FT                   DLGLWRAVAALTLVYTPRFARVVRGAALTVLENEYIDATVALGAADPRVLVRHVLPNCL
FT                   APITVQSTLNFGLAIIDLAALSFLGFGAAAGTPSWGLMLSNGVSQGLLTGVWWWSFFPG
FT                   FFLALTVLGFNLLGDGMRDALDPRMREAVD"
FT   gene            564604..564999
FT                   /locus_tag="HVO_0631"
FT   CDS_pept        564604..564999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0631"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04821"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSN4"
FT                   /protein_id="ADE04821.1"
FT                   /translation="MSAPPDPTDAASPPVLERAATRLRLVGTAALAGALAVAVWLVARL
FT                   VVGDFSASVETTFAVGSLAFGFGLLGWSGAVALGRGIESMQAHLDTGAGWTEADARRAM
FT                   ARVLGFGLGVMLGATAVGSVASVFVAA"
FT   gene            complement(565023..567599)
FT                   /locus_tag="HVO_0632"
FT   CDS_pept        complement(565023..567599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0632"
FT                   /product="sensor box histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03168"
FT                   /db_xref="GOA:D4GSN6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSN6"
FT                   /protein_id="ADE03168.1"
FT                   /translation="MTVSEDASRNGARSARDASDEERILLAVRGARDRELLAGLLDAHE
FT                   VVVWERGREDEPQLPEFDLCIVDMATYSAVADALDERKADAGDRFVPVLLTVTQDEQRV
FT                   AARRLDDVPDDVLAVPAPSAVIRSRVESLLQTRRQSLQLALYRRAMDSATVGITITEAD
FT                   DDQPLTYVNDAFEEMTGYDRSEVIGRNCRFLQGDDTDPEAVETLHEAVDAGESAAVGLT
FT                   NYRKDGTPFWNDLKISPVYDDGELTHFVGFQTDATVRHALRNQLVNETQTLKQLFETSP
FT                   VGIVVLNEDEIIMRANESAQEILGLGRSVVLGQPYDAPEWELVGERGEPLDRGGLPFER
FT                   AREAGETVKGFEHGIEVGGDRRWVVVNAASLTGSGGECIGVIAVIEDVTEVKRQQRDRE
FT                   RLLDLFDQSQKIASVGAWEFNTRTGEVLFTSGLAELVGVDSRETFDLEEAFAFYHPEDE
FT                   PEARAAFGRLVATGEEQSVECRLETMDGETRWVNVRGVAARETDAAVYRGTVQDITERK
FT                   ARSEELERYERIVETTADPIHTLDDNLRFVLANSATADLLDCDPGELTGEHVSAVFGER
FT                   HAQALLEAIASLLSGDSAEETIETVVVDRGGAERQFQTTIAAKSSGGEFDGIVCVGRDV
FT                   TELRERERRLSVLDRVIRHNLRNKMNIAQAHAAMLLEAADDADVRESAAAIERAADELL
FT                   SIAETARKFSSALDPDVTERVQPQNVADRVRSVVEGAQLSYPGVTITVDAPENVRALAH
FT                   ATFELAVNELVDNAVAYGGDDVEIELSVAEADGAEQVTVRIADNGPGLPALERESLMSG
FT                   RESPLRHTNGLGLWFVRWTVTNSNGTMEIRDNEPSGTIIELRLPKA"
FT   gene            complement(567596..569050)
FT                   /gene="cirC"
FT                   /locus_tag="HVO_0633"
FT   CDS_pept        complement(567596..569050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cirC"
FT                   /locus_tag="HVO_0633"
FT                   /product="KaiC-type circadian clock protein CirC"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02759"
FT                   /db_xref="GOA:D4GSN7"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030665"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSN7"
FT                   /protein_id="ADE02759.1"
FT                   /translation="MTNLPPRLSTGVSGLDAVLDGGLVPNRTYMVRGESGAGKAIAGYH
FT                   FLTAGRENDEDVLFISFEESNADLRANAGTLGFDLSEVPVLDLSPSPEAFLDDEAYTML
FT                   SPSEVEGKSTTTELKEVIEEHHPDRVVIDPLSQLGRLSSDEYQFRRLVSSLLSYLKRSG
FT                   ATTLFTSQPSSGGTDETLAYLCDGSISLSRSDWGRSVRIEKFRGSDSQTGPHAMRIDGG
FT                   HGMRVFPRLVPDSHHHEFTIEPLSSGIDDLDALLGGGIERGSITLVSGPSGVGKSTTGA
FT                   AFARATAERGERAAVYLFEESKRSFRHRSESVGIPIDDLVDSGNLRVDAVEPLSLSTDE
FT                   FAQRVRAEVEANDTKFVLIDGTAGYQLSLTDERSDIRRELHALARYLKNMGVTVVLTEE
FT                   VQQVTGAFHASDNHVSYLADNILFIRYIEVRGEIRKAVGVLKKRFGGFEPTLRSFEIGR
FT                   DGITVGEPLDELRGILTGTPTWNEAE"
FT   gene            complement(569203..570429)
FT                   /gene="orc2"
FT                   /locus_tag="HVO_0634"
FT   CDS_pept        complement(569203..570429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orc2"
FT                   /locus_tag="HVO_0634"
FT                   /product="Orc1-type DNA replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04877"
FT                   /db_xref="GOA:D4GSN9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014277"
FT                   /db_xref="InterPro:IPR015163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSN9"
FT                   /protein_id="ADE04877.1"
FT                   /translation="MRRFERKQNVFTNKDALGESYKPERIEERDDEISEYMDALQPVVD
FT                   GWEPNNVFLYGNTGVGKTAVTEFLLEMLLEDVSQYDDVDLSVISINCKTLNSSYQVAVE
FT                   LVNELRPPGAVISSTGYPQQTVFKKLFQELDDVGGTVLIVLDEVDSIGDRDELLYELPR
FT                   ARSNGKLEDAKVGLIGISNDFKFHDQLDPRVQDTLCERELHFPPYQAPELQNILESRAE
FT                   VAIAEDACEEGVLNLCAALAARDSGSARQALDLLRLAGEHAENKDDERITLDHVDIARQ
FT                   KLEQERVVEGMRELTENGHFALLAVVSKAAHDETPCRMRDLYQEYLRLCNSAGIDPLAQ
FT                   RSVHNHLSDLRMLGILSAEENRTGSRGNYYSYALDVPFSSAMEALSDVLALDSVLDEIR
FT                   KTATQAEAA"
FT   gene            571195..572157
FT                   /locus_tag="HVO_0635"
FT   CDS_pept        571195..572157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0635"
FT                   /product="DUF4129 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03321"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSP0"
FT                   /protein_id="ADE03321.2"
FT                   /translation="MDRSALRALALALLAVVALSVVAATIDSTVVSSGGPVGFGGGETG
FT                   GAVAGDTDETGTQPSGDSSGSLSIPTPCFPWLLSPGVLAVVALVFVLLGAYAYRETGSL
FT                   LPPLAIFAAVGPPVVLLFALLTGCRREFSFSSRAAAAARNVSFLPAGGGGSLGQGGNAA
FT                   QSVSPPTVLFGLLLAVALAVAAFMLVTGTGDSPAADDEVTPADEDEGSNVAAVGRAAGA
FT                   AAQRIEDGDADVENEVFRAWGEMTALLDVPNRRAATPAEFAHSAVDAGMDRDDVDDLTT
FT                   LFEEVRYGGFEATPERERRAVDALRSIERAYADSPEGDR"
FT   gene            572154..572726
FT                   /locus_tag="HVO_0636"
FT   CDS_pept        572154..572726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0636"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02471"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSP1"
FT                   /protein_id="ADE02471.1"
FT                   /translation="MTLTRRLFLLVGVVATTAGLAVVAGVSFGLELTDIFLGLVAALAA
FT                   LQGLRYVQRRRDTPSNTTVTDDPEARISVPVPGADFDDDLVSAMGQGTRWAARERVVDR
FT                   LETRAKEALVASGGHAPEEAAALLKTGGWTDDPVAARFLGASVSIPLRQRVRLFLSGRS
FT                   SLTDRAERAVAAIEQVGTTDGPAGERR"
FT   gene            572723..573991
FT                   /locus_tag="HVO_0637"
FT   CDS_pept        572723..573991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0637"
FT                   /product="DUF11/DUF58 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03028"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSP3"
FT                   /protein_id="ADE03028.1"
FT                   /translation="MSRGFDTERWTGLDGLVLVAAAAGVFTRESSLLLAAGLGVVVLGY
FT                   VRVAAIPEVSLRIERDLSDATPDPDDEVEVTLRVTNEGSSTLFDLRVVDGVPPALGVVD
FT                   GSARLGTALRPGATTTATYTVTAVRGEHSWDETVVVVRDPSGAVESRETVDAETTLRCE
FT                   PELAATADLPLRGLTSKYAGRVETDVPGSGLEFASIREYRHGDPIRRIDWNRRARTGEL
FT                   ATVEFREERAASVVLVVDTRSEAHVAPDDEGETAAERSVDAASVAFSALLDGGDSVGVA
FT                   AFGPDECWLAPSSGVDHRARARRLFATHPAFAPTPPDGAFFTSVAVRRLRRRLASDAQV
FT                   IFCSPLVDDYGVSVARRLEAYGHAVTVVSPDPTTTSTVGARLARIERDLRLRELRRSGL
FT                   RVVDWGDESLGVALARAEAGWSR"
FT   gene            573979..574485
FT                   /locus_tag="HVO_0638"
FT   CDS_pept        573979..574485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0638"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02574"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSP5"
FT                   /protein_id="ADE02574.1"
FT                   /translation="MVAVSEITRQPTRTGTALALSAAGFAILALGFTTSTAAVGGLAAT
FT                   VALAAGLVRGSRRIVDAAGGLFFLSLLFAGASGAGTEALLLAAVGSILAWDLADNARSV
FT                   GAHLGRETDTLRLELVHAAATLVVLAVGAAVVYGADRAAAGGQPITAVVLLLVGVVALV
FT                   AVVAR"
FT   gene            complement(574519..575469)
FT                   /gene="moxR1"
FT                   /locus_tag="HVO_0639"
FT   CDS_pept        complement(574519..575469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moxR1"
FT                   /locus_tag="HVO_0639"
FT                   /product="AAA-type ATPase (MoxR subfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05041"
FT                   /db_xref="GOA:D4GSP6"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSP6"
FT                   /protein_id="ADE05041.1"
FT                   /translation="MDIDTASETCSEVLDAISEAVIADRAFLETVLTGVLARGHVLLED
FT                   VPGTGKTLTARSVATALGLSFSRVQFTPDLLPADVTGTNIYDERERTFEFSPGPIFANV
FT                   VLADEINRAPPKTQAALLEAMEEGQVTVDGETHQLPSPFFVIATQNPVEQEGTFTLPEA
FT                   QVDRFVVKSAIGYPDLDGEVELLHRRAGRSDQSPSVERVLDRDAVAAIRRAPESVRVED
FT                   DLLEYMAKLARETRTDRRVRIGVSPRGTQRLFEATRARAVIEGREFVTPDDVKRVAQSV
FT                   LAHRLVLTPDARVEDVRKSDVVDDVLGRVTVPTLE"
FT   gene            575668..575752
FT                   /locus_tag="HVO_3028"
FT   tRNA            575668..575752
FT                   /locus_tag="HVO_3028"
FT                   /product="tRNA-Ser"
FT   gene            complement(575944..576600)
FT                   /gene="bluB"
FT                   /locus_tag="HVO_0641"
FT   CDS_pept        complement(575944..576600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bluB"
FT                   /locus_tag="HVO_0641"
FT                   /product="5,6-dimethylbenzimidazole synthase BluB"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03882"
FT                   /db_xref="GOA:D4GSP8"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR012825"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSP8"
FT                   /protein_id="ADE03882.1"
FT                   /translation="MVGFTERERSGVYKSIYARRDIRRFSDDPVSEETLARLLDAAHHA
FT                   PSVGFSQPWDFVVVEDDETKAAVASIAERAIAAAREGYREPRKSEFGRLKLEGITDAPV
FT                   NVCVTCDPTRDAPHVLGRNTMQAMDAYSTCLAVQNLWLAARAEGVGVGWVSFLYPHEVR
FT                   EVLGIPHHVEPIAYLCVGYPEDGFPEEPVLQREGWRERIDTSELVHWGEWESTSD"
FT   gene            576706..576855
FT                   /locus_tag="HVO_0642"
FT   CDS_pept        576706..576855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0642"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03462"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSP9"
FT                   /protein_id="ADE03462.1"
FT                   /translation="MDTALKYRLDVIIALLFLVVLIESYRVAGYFGAAFVVVVTIVLVA
FT                   FAPE"
FT   gene            576993..577172
FT                   /locus_tag="HVO_0643"
FT   CDS_pept        576993..577172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0643"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03309"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSQ1"
FT                   /protein_id="ADE03309.1"
FT                   /translation="MSANAASADTSERDGTRRIDVTTVRTGRVADFAETELGDDAIGFE
FT                   RRGGWTYLVAKGTR"
FT   gene            complement(577242..578780)
FT                   /gene="leuA1"
FT                   /gene_synonym="cimA1"
FT                   /locus_tag="HVO_0644"
FT   CDS_pept        complement(577242..578780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA1"
FT                   /gene_synonym="cimA1"
FT                   /locus_tag="HVO_0644"
FT                   /product="2-isopropylmalate synthase / (R)-citramalate
FT                   synthase"
FT                   /EC_number="2.3.3.13"
FT                   /EC_number="2.3.1.182"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04954"
FT                   /db_xref="GOA:D4GSQ2"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSQ2"
FT                   /protein_id="ADE04954.1"
FT                   /translation="MNERFGKTPELRTSDSVQLLDTTLRDGEQAPGVSLTPTQKADIAR
FT                   ALDRAEVDYIEAGSACTGPGERETIKRVTSLGLDATVTSFARGVKNDVDLALDCDVDGV
FT                   TLVVPASDRHVESKVGTTREDVVETTDELVAYAKDHGLWVEVIGEDGSRAAPEFLESLA
FT                   RASHDAGADRFCFADTVGHTSPEHTYEVVSRLSELGPTSTHTHDDLGLAMANVHASLAA
FT                   GADLVHTTVNGIGERAGNVALEEVAIALDHCYDVESVKLDELYALAQKVAQATGVSLPP
FT                   NKAVVGQNAFTHESGIHTDGTLKDDAMYEPYPPETVGRERRLVLGKHAGRAGVKAALDE
FT                   HGVDATDEEVAAVVERVKELGDRGKRVTDADLLAFAEDVQGRERARQVELLDLTAASGG
FT                   GTPTASVRLRVEGEERVASGTGSGPVDAAVKAVREALGPDADAQLDEYHVDAITGGTDA
FT                   VVTVEVTMSLGDRSVSVAASHADITRASVQAMVDALDRLLAPNHTSPTPASADD"
FT   gene            complement(578988..579335)
FT                   /locus_tag="HVO_0645"
FT   CDS_pept        complement(578988..579335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0645"
FT                   /product="DUF192 family protein"
FT                   /note="COG1430"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04205"
FT                   /db_xref="InterPro:IPR003795"
FT                   /db_xref="InterPro:IPR038695"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSQ4"
FT                   /protein_id="ADE04205.1"
FT                   /translation="MRLVHRQNGAQSTLASNVETADSFLSQARGLMFRGSVPDDYALVF
FT                   RFDDADRHSLHMVFVPFDIDALWLVGDEVTKKKRLSAWTGIGFGMADTVVELPAGAADG
FT                   VEPGDLVEIAE"
FT   gene            579438..579980
FT                   /locus_tag="HVO_0646"
FT   CDS_pept        579438..579980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0646"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03694"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSQ6"
FT                   /protein_id="ADE03694.1"
FT                   /translation="MERTPTGTPVGVDDPYDHAGRCDHLTSDAACRLAREYADRDPAFA
FT                   RERARADYDCVAAAEGCDFRDCPHYASTTSGRECVRCGLEEVRMAHDSTARPLLEAHHL
FT                   SYGGRGGDGSGDGDEPSHEITVALCRWCHTKVHKSFARIDDDAAPDVEAIAEREGRRTK
FT                   ELDELGFQTARDRAGDE"
FT   gene            580081..580632
FT                   /gene="guaAa1"
FT                   /locus_tag="HVO_0647"
FT   CDS_pept        580081..580632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaAa1"
FT                   /locus_tag="HVO_0647"
FT                   /product="GMP synthase (glutamine-hydrolyzing) subunit A"
FT                   /EC_number="6.3.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02845"
FT                   /db_xref="GOA:D4GSQ7"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR023686"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSQ7"
FT                   /protein_id="ADE02845.1"
FT                   /translation="MTRIVVIDNHGQFTHLERRALRDLGVDTELVDNDTDPADIDADGI
FT                   VLSGGPDMDRIGRCPDYLDLDVPVLGICLGMQILAEELDGRVGSGDYGGYADVDVEILD
FT                   EDDPLIGSLAPETRVWASHADEVKEVPEGFTHTATSDVCTIEAMSDADRDLYGVQWHPE
FT                   VAHTAEGEEVFENFIDICER"
FT   gene            580809..582722
FT                   /locus_tag="HVO_0648"
FT   CDS_pept        580809..582722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0648"
FT                   /product="DUF2070 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03365"
FT                   /db_xref="InterPro:IPR019204"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSQ8"
FT                   /protein_id="ADE03365.1"
FT                   /translation="MTSTQSDLAGLSRFIFRAPSWYTSLGFALLVAAMAGIGAFDSGDL
FT                   AGSWRGIFFIGRDAWEGIFFIGIPTVVAAFGTTGVDRFVGGKLTHNRSSLLALAGEVII
FT                   VTFLTGAAIVSVFTGLGQTFIFDALVIALASVFAFRLLIVMAVSRSSLLIAAVPASIQT
FT                   LTSAALLFVYSGTLRFFEVGGPILDAYLMPYLARPDRAPPELSAIALSHFQLLAITCVM
FT                   YALGVYVFLRIIDRPWRRGLGVSVLDFIRGFIGHIAEGTRELEDFFEQLGQEAIVPVTV
FT                   LSFERDDGTEKARFVLPMIHPGPMGEIGGGNFPERVARRAEGLVFPPHATAGHDFNLVT
FT                   EREVDVVLDAADDAYERIEYSPDVTESVRVQSGDAKMLGQRFGDDALLVSTYAPQFADD
FT                   VEYAVGLSASAEARTTGLRDVLLVDAHNCNNGLQGPDLGHVTPGSKRSFDMITAAGLAG
FT                   EELSASSRGSLSLGTAFDPTDWTPREGIGPLGIRVAATTVGDQTTAYVLIDGNNMEPGL
FT                   RDRIVEGLTTGPNAKADVAEVMTTDTHIVNTVEAENQVGAAIDHDELRETIDRLVDEAL
FT                   ADTEPVVAGMATERAEVTIFGNDRTETLASHANVVVSMGGALALALILAAMAVSLLVFF
FT                   LA"
FT   gene            complement(582834..583040)
FT                   /locus_tag="HVO_0649"
FT   CDS_pept        complement(582834..583040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0649"
FT                   /product="small CPxCG-related zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02444"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSQ9"
FT                   /protein_id="ADE02444.1"
FT                   /translation="MSIGRTPRGTTALDRLRERYSDADLTCSKCGFTDDGGEWSAKTTG
FT                   SSVFYRRVCPSCGAIETRTLSLK"
FT   gene            complement(583221..583484)
FT                   /locus_tag="HVO_0650"
FT   CDS_pept        complement(583221..583484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0650"
FT                   /product="DUF3194 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04882"
FT                   /db_xref="InterPro:IPR024502"
FT                   /db_xref="InterPro:IPR035954"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSR0"
FT                   /protein_id="ADE04882.1"
FT                   /translation="MSQPTDEEVVETAAEAAEGLIFARFKQSRVKDFDVTVTFEDGVLD
FT                   VDVYVNAPDDADDADDAEAVAEEAALTAQEAVDELFAAADEE"
FT   gene            complement(583485..583868)
FT                   /gene="pfdB"
FT                   /locus_tag="HVO_0651"
FT   CDS_pept        complement(583485..583868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfdB"
FT                   /locus_tag="HVO_0651"
FT                   /product="prefoldin beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04166"
FT                   /db_xref="GOA:D4GSR1"
FT                   /db_xref="InterPro:IPR002777"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="InterPro:IPR012713"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSR1"
FT                   /protein_id="ADE04166.1"
FT                   /translation="MQGSLPPEAQEKLEELQNLQETAQNVSEQKQSSESALNEAQTALT
FT                   TLEEIDGDSQMYREVGELLIETDYESAKDDLEEKVESLEVRVEQLTKQETRVQEKFESL
FT                   QEELQQMLQGGAGGAGPMGPGGA"
FT   gene            complement(583912..584181)
FT                   /gene="pcc1"
FT                   /locus_tag="HVO_0652"
FT   CDS_pept        complement(583912..584181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcc1"
FT                   /locus_tag="HVO_0652"
FT                   /product="KEOPS complex subunit Pcc1"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02840"
FT                   /db_xref="InterPro:IPR015419"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSR2"
FT                   /protein_id="ADE02840.1"
FT                   /translation="MRPAHSASLEFDYPDERRARVVERSVAVEEGEIDDARSGAHVARE
FT                   GRTVVVTVEADDLVALRAGVNSWIRLVETAERVASAGSALSESA"
FT   gene            complement(584183..584317)
FT                   /gene="rpoP"
FT                   /locus_tag="HVO_0653"
FT   CDS_pept        complement(584183..584317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoP"
FT                   /locus_tag="HVO_0653"
FT                   /product="DNA-directed RNA polymerase subunit P"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05173"
FT                   /db_xref="GOA:D4GSR3"
FT                   /db_xref="InterPro:IPR006591"
FT                   /db_xref="InterPro:IPR023464"
FT                   /db_xref="InterPro:IPR029040"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSR3"
FT                   /protein_id="ADE05173.1"
FT                   /translation="MSYKCSRCKRDVELDEFGGVRCPYCGHRVLLKERSPNVKEVAVE"
FT   gene            complement(584352..584621)
FT                   /gene="rpl43e"
FT                   /locus_tag="HVO_0654"
FT   CDS_pept        complement(584352..584621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl43e"
FT                   /locus_tag="HVO_0654"
FT                   /product="50S ribosomal protein L43e"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05137"
FT                   /db_xref="GOA:D4GSR4"
FT                   /db_xref="InterPro:IPR002674"
FT                   /db_xref="InterPro:IPR011331"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSR4"
FT                   /protein_id="ADE05137.1"
FT                   /translation="MADKKARSVGSSGRFGARYGRVARRRVKEIEAEMRNSKVDGDDVT
FT                   RVETGVWKNEETGEIFTGGTYRPQTPAGKQVRRSIRAALTGEDE"
FT   gene            584724..585749
FT                   /locus_tag="HVO_0655"
FT   CDS_pept        584724..585749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0655"
FT                   /product="GalE family epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04337"
FT                   /db_xref="GOA:D4GSR5"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSR5"
FT                   /protein_id="ADE04337.1"
FT                   /translation="MTQHVVVGAGPVGLAVMEQLRERGADVAAVTRHDPDFLPEGVESR
FT                   LADVLYPDRAVAAFADADVVYHCAKPPYDQWPELFPDLTRGIVAGVEAAGARFVVAENL
FT                   YMYGPVQARLSEDLPYAATGPKGQTRAECADIVLDAHEAGRIEATIGRASDFFGPRVRE
FT                   SVVGEQVFGAAVAGKRAKVFGDPRLAHTYTYVPDFARALVLLGERDEALGEVWHVPNPE
FT                   TVSTRRFVNLVYEAADVDPGFPHIIAAPGVALTLGGYLSAPLNYLSAPLKVLTEMRYAF
FT                   EEPYVVRDAKFRETFGDAVEPTPLEDATAETVAWFESQREADETEPIHIETAPEGATES
FT                   A"
FT   gene            complement(585788..586513)
FT                   /locus_tag="HVO_0656"
FT   CDS_pept        complement(585788..586513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0656"
FT                   /product="DUF2103 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02330"
FT                   /db_xref="InterPro:IPR018664"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSR6"
FT                   /protein_id="ADE02330.1"
FT                   /translation="MHCRRCGNPLEKPGDYCLTCNTANCDAVVAVFAADRATLTFLDDE
FT                   DVLGETTVTTIPESDDETKVVQLRNFAGLVADEIRRKRPETVYAAGERAPLRETRAQLH
FT                   HEFYRVSDDDPVQRVLDTRGERTLEVVDIPPAEKLGGSHSTLIGGRRGRRAIGVVAGHP
FT                   HVKKVIPGPIDAGGTGSRAGLRAKVTRADGNGNVRLLLRDGSSVQENRIVTTAMNRETG
FT                   ERVRDDLNEALREDGLQDE"
FT   gene            586618..587451
FT                   /locus_tag="HVO_0657"
FT   CDS_pept        586618..587451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0657"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04793"
FT                   /db_xref="GOA:D4GSR7"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSR7"
FT                   /protein_id="ADE04793.2"
FT                   /translation="MSESPLRMRRRALLASLSPLALAGLAGLVALALDPETTARLATQL
FT                   GQSALDTGRGVASYLGRAAPLSTALFAALAWVAAGGFRAFVAHRDPSDTRTTAEHAFAL
FT                   VASATVPLVAIFARDRLVVVAGVGVALLAGAGAVFAGRSNARGVVTGSLYAVAPVVGGG
FT                   VVASLVAGPAVARTATLALPLAVGYALGVASARGRLRLGAAVSALAFAVPAWTYFPPAA
FT                   EAAGFDPETVGLALGFAVAAALLSLPFAAIGYATTRTADAERQAGASPAASAVEQ"
FT   gene            complement(587495..588886)
FT                   /gene="truD"
FT                   /locus_tag="HVO_0658"
FT   CDS_pept        complement(587495..588886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truD"
FT                   /locus_tag="HVO_0658"
FT                   /product="tRNA pseudouridine(13) synthase TruD"
FT                   /EC_number="5.4.99.27"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03492"
FT                   /db_xref="GOA:D4GSR8"
FT                   /db_xref="InterPro:IPR001656"
FT                   /db_xref="InterPro:IPR011760"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR020119"
FT                   /db_xref="InterPro:IPR042214"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSR8"
FT                   /protein_id="ADE03492.1"
FT                   /translation="MREAHPLERAVGIDSYVSDADGVGGRLRVAPEDFRVRELELDSLN
FT                   VRPPDAPTGDFPNLVLRVTLRGWDTNDFAGRLSDELGASRERVSWAGTKDKHAVTTQLF
FT                   TVNGGDAADVPEVPNADIEVVGRLGRTLDFGDLAGNGFRIRVRDPETPDNAAAVTDALT
FT                   EFGGREGRVGVPNFFGHQRFGSIRPITHTVGLHVVRGEWREAVLAYCGGPTEDEPEETQ
FT                   AGRAVVDEEAASADPDWHRALDRIPGYLGYERGMLHRLAEDGAETDEDWRNALESVPSN
FT                   LQRLFVNAAQSYAFNRMLSERRDRGLPFDEPVEGDVVCFADRDAPGGLELPDVSRLQTA
FT                   TGRRVDVMSRHIERGRAFVTAPLVGTDTELAEGEQGDIERAVLDDLDLEPGDFDLPGNF
FT                   RSTGTRRAILVRTDLDVERESGDDDADTDAAGGADDLVFDFALPHGSYATAVMREYLKA
FT                   GPLDL"
FT   gene            complement(588886..589224)
FT                   /gene="pth"
FT                   /locus_tag="HVO_0659"
FT   CDS_pept        complement(588886..589224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="HVO_0659"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02636"
FT                   /db_xref="GOA:D4GSR9"
FT                   /db_xref="InterPro:IPR002833"
FT                   /db_xref="InterPro:IPR023476"
FT                   /db_xref="InterPro:IPR034759"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSR9"
FT                   /protein_id="ADE02636.1"
FT                   /translation="MKQAIVARADLGMGRGKLAAQVAHASLSAYEDTDSQTRKRWKGGG
FT                   QKKVVLKANGESELFKLADEAERAGIPHAIIRDAGHTQLDPGTVTALAVGPAEDDEIDR
FT                   VTGDLSLY"
FT   gene            589320..590060
FT                   /locus_tag="HVO_0660"
FT   CDS_pept        589320..590060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0660"
FT                   /product="Yip1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05155"
FT                   /db_xref="GOA:D4GSS0"
FT                   /db_xref="InterPro:IPR006977"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSS0"
FT                   /protein_id="ADE05155.1"
FT                   /translation="MAGPRTPLRKPREYFASRPRPLGTKRALAVVALVTLVVAAATGGI
FT                   LVTFTQQLDQRVSVDNPEHAPEFMCENYVEGGPFDDMDAPAGCDPSVPEQLDERLGDLV
FT                   WDEISWVPWAMLLGVPLFWLFEGAMLHLGTSLVGGEGGFAESLTVAAWGMVPSAARALA
FT                   LAGYLAYVLPRIDLPSTPDAAVAAMQSALSGFGLVSGAVVVVTVAWATYVRTYGMARAR
FT                   DLDVESAAVVTVGLSLVGLLFELL"
FT   gene            590190..590777
FT                   /gene="dcd"
FT                   /locus_tag="HVO_0661"
FT   CDS_pept        590190..590777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcd"
FT                   /locus_tag="HVO_0661"
FT                   /product="dCTP deaminase"
FT                   /EC_number="3.5.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04157"
FT                   /db_xref="GOA:D4GSS1"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSS1"
FT                   /protein_id="ADE04157.1"
FT                   /translation="MILSDSDILSRLAEGDLVVDPIDDVDMQVQPASVDLRLGTEFLEF
FT                   QRTNISCIHPNRESEVSEYVRETHVPEGDDFILHPGDFVLGTTKERVEIPTDLLATVEG
FT                   RSSLGRLAVVIHATAGIVDPGYEGQITLELSNLGTAPVALTPGMRISQLVFTEMKSPAD
FT                   RPYGVERGSKYQGQRGPQASRLSSDPEFGGDE"
FT   gene            590774..591673
FT                   /gene="thiN"
FT                   /locus_tag="HVO_0662"
FT   CDS_pept        590774..591673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiN"
FT                   /locus_tag="HVO_0662"
FT                   /product="HTH domain protein / thiamine-phosphate synthase"
FT                   /EC_number="2.5.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03120"
FT                   /db_xref="GOA:D4GSS2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR019293"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSS2"
FT                   /protein_id="ADE03120.1"
FT                   /translation="MKFIEEIVVDAFLPTFRALLAEDLRDRGFTQSEVAEALGISQSAV
FT                   SKYAHGEVATNERVATDPRVVDLVSRVGDGLATGDMTPVQALVEAEVLIRQLEEGDLLS
FT                   DLHEDEMPELASHDGFRSIHDPEGRLRTVEQVRSSVRRGLRMLTNTSGFAGLIPNVGSN
FT                   LVESLPDADSVDDVAAIPGRIFDVKGQATVPGEPEFGVSGHVAGVLLSARAAGADVNAA
FT                   LNIVYDAGVIEDLEAAGYECIEFDPDAPTDPVRELLTARDLPETFVVYQSGGYGIEPIT
FT                   YILGPDAPAVADVVRVLL"
FT   gene            591686..592441
FT                   /locus_tag="HVO_0663"
FT   CDS_pept        591686..592441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0663"
FT                   /product="putative S-adenosylmethionine-dependent
FT                   methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03883"
FT                   /db_xref="GOA:D4GSS3"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSS3"
FT                   /protein_id="ADE03883.1"
FT                   /translation="MTAEQSNSRSRSRSGSRSRGRSRSRSRSPSAVAQSFYTRWATLYD
FT                   ALARRAPGVGSVRTEAADALALDPGETVVEMGCGTGANLPYLAERVGPEGSVVVVDFSP
FT                   GVLDVARERTREFPQVHLVRGDATRPPVARDLDASPAAVLATFVSGMFDDPAAVISSWA
FT                   DLVGPDGRLCLVDLAETTDSRWRPLNPAFRVLVRVTAPPEPRTMRASPTKLLNRRLVAA
FT                   HRALESRCRVTHETTHALGFARVRAGVVE"
FT   gene            592508..592975
FT                   /locus_tag="HVO_0664"
FT   CDS_pept        592508..592975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0664"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02386"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSS4"
FT                   /protein_id="ADE02386.1"
FT                   /translation="MASFLAALLGAPFNAFHLLFLGLVGYWVSLDAAERGSNASLLWAL
FT                   GCVVFQPLVAGYLLYRSRIGGRPDPAGVQERLVGTFVIGHFVAAQLWFAVRLTDVIASV
FT                   TYPPVVELQYYLALLAVGVLPGTLLVWNRGWARIRRTLGWVHEQEREAVQR"
FT   gene            complement(593079..594002)
FT                   /gene="thi4"
FT                   /locus_tag="HVO_0665"
FT   CDS_pept        complement(593079..594002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thi4"
FT                   /locus_tag="HVO_0665"
FT                   /product="thiamine thiazole synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05087"
FT                   /db_xref="GOA:D4GSS5"
FT                   /db_xref="InterPro:IPR002922"
FT                   /db_xref="InterPro:IPR022828"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSS5"
FT                   /protein_id="ADE05087.1"
FT                   /translation="MSFDGFTDATEAQVTRAISDSWMEEFRERTDTEVIVVGGGPSGLV
FT                   AAKELAERGVDVTIVEKNNYLGGGFWLGGFLMNKVTVRDPAQRVLDELGVPYEESDEAE
FT                   GLYVADGPHACSALIKAACDAGAKIQNMTEFTDVVLREDDRVGGIVMNWTPVHALPREL
FT                   TCVDPIAVESDLVLDATGHDAVVLSKLSERGVLDVNGIEHAKEHNTGMDKTADGEYGAP
FT                   GHDSPGHDSMWVSESEDSIVDATGVVHPGVVASGMAVATAHHLPRMGPTFGAMLLSGRQ
FT                   AAQSCLDELGRDAPDVSISGPAPADD"
FT   gene            594094..595581
FT                   /gene="dsa2"
FT                   /locus_tag="HVO_0666"
FT   CDS_pept        594094..595581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsa2"
FT                   /locus_tag="HVO_0666"
FT                   /product="dihydrolipoamide S-acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04485"
FT                   /db_xref="GOA:D4GSS6"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSS6"
FT                   /protein_id="ADE04485.1"
FT                   /translation="MAYVVKMPKLGLEMKSGELSAWLVSEGDEVTEGDPIAEIESEKTT
FT                   AEIDAKEDGVLRRVVLAEGESTAPGGALAIVAGADEDISGLEADAGVGEGGSEPVATDD
FT                   SAGDSSPTEVTETTETAATGGGDASSVAQSRSRGSDGASENGEVRASPRAKRLADDLGV
FT                   DLTTVEGTGPQGAITESDVETAAESATATAAEKRVFAPPSARRLARELGVDIEAVEGTG
FT                   QNGRITESDVRAAGGATAAATDSSAAGAATTAATDATAASEPAETERPLSGMRRTIADR
FT                   LGESYREAVHVTVDRRADAEELLAAANAAADALGVDVSITDVLLLALSASLDEHPEFNA
FT                   TFEDGVHRLHGEHNVCIAVDVDEGLIAPVVRDVASLSLSELAETRAETTQRALSGDFTM
FT                   DDLSGGTFTVSNLGVLGVESFDPIINPPQVAILGVNTIRREAVPTDDGDVAVRRVISFS
FT                   LSFDHRIVDGADAARMLGTLVEHVENPWPLVIAAGGR"
FT   gene            complement(595636..596685)
FT                   /locus_tag="HVO_0667"
FT   CDS_pept        complement(595636..596685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0667"
FT                   /product="homolog to NAD kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03491"
FT                   /db_xref="GOA:D4GSZ7"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="InterPro:IPR039065"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSZ7"
FT                   /protein_id="ADE03491.1"
FT                   /translation="MTTTIGLVVNPAAGRDIRRLTGGASVSNNYAKRRTAGCVLAGLTL
FT                   VDDVEVLVMPDSTGLADRIVDDAPDDLGVEFVDMTVTASGQDSRTAAAHFAEHADAVVV
FT                   LGGDGTTRDVAQTIDDVPVVSISTGTNNVVPTPVDGTVAGAAAALVGSGAIPAAEATTR
FT                   HGTIEVDVVRSEETTVIRGLATVGVLDRPFVGTRAILDPSDIVGGVVSRSSPAEIGLSG
FT                   IAGGLVTHRPDEPGGVGFRLARGGDDGGDGTDAAGAADATTNPATTVRAITVPGRLSTV
FT                   DVAEHRVLDDGEGYAFEVDRGVISVDGEREREVRNGTVRLRPVSDGPRLVDVEAVLERA
FT                   ADDGRFRLG"
FT   gene            complement(596686..597696)
FT                   /gene="oadhB3"
FT                   /locus_tag="HVO_0668"
FT   CDS_pept        complement(596686..597696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oadhB3"
FT                   /locus_tag="HVO_0668"
FT                   /product="2-oxoacid dehydrogenase E1 component beta
FT                   subunit"
FT                   /EC_number="1.2.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04900"
FT                   /db_xref="GOA:D4GSZ8"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSZ8"
FT                   /protein_id="ADE04900.1"
FT                   /translation="MSTETSSGTGPDQTKEMTIREAIRLALREELERDDDVFVMGEDVG
FT                   KFGGVYEVTGDLVEQFGETRVRDTPISEAGFMGAAVGAAATGTRPVVEIMFSDFIGVCS
FT                   EQIINQMAKNRYMFGGKTEMPVTVRTTEGGGSGAASQHSGTIHTWFAHFPGVMAVAPAT
FT                   PASAKGLLKSAIRSDDPVIVFENKQIYEQKGEVPLDEDFTIPIGTASVEREGEDVTVVA
FT                   TQRMVGESLELAEELAGQTSVEVIDLRSLYPMDTDTLVESVGKTGRLVIADESPLSYGT
FT                   HAEVATRVMENAFYSLDAPIQRVGVADVHIPFSPALEEEVLPSGSDVEAAINRIV"
FT   gene            complement(597693..598727)
FT                   /gene="oadhA3"
FT                   /locus_tag="HVO_0669"
FT   CDS_pept        complement(597693..598727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oadhA3"
FT                   /locus_tag="HVO_0669"
FT                   /product="2-oxoacid dehydrogenase E1 component alpha
FT                   subunit"
FT                   /EC_number="1.2.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04257"
FT                   /db_xref="GOA:D4GSZ9"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D4GSZ9"
FT                   /protein_id="ADE04257.1"
FT                   /translation="MVVLDIETEDGQREALRRMLTIRAFDTKAADLFSDGELPGFVHLY
FT                   VGEEAVGVGACSALESDDYITSTHRGHGHCIAKGLDPDLMMAELFGKADGYCNGKGGSM
FT                   HIADVDAGMLGANGIVGAGPPLATGAALTSHLKGEDTVALAFFGDGAVAQGQVHEAVNL
FT                   AATWSLPAVFLVENNQYGEATPVEKQHNVQNLSETAEAYNIPGFTVDGMDITAVYEAVK
FT                   EARKRAADGEGPTFIEAETYRYHGHFEGDQQPYRTEEDVAIWKDRDAIETFKRRLVDAG
FT                   TITEAEFDEMKAEIDQQIEDAVGKAKDAAYPDPSEAYEDMFNAAVPEISDFSSGMRADG
FT                   GENR"
FT   gene            598977..599957
FT                   /locus_tag="HVO_0670"
FT   CDS_pept        598977..599957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0670"
FT                   /product="glutathione S-transferase"
FT                   /EC_number="2.5.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03977"
FT                   /db_xref="GOA:D4GT00"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR016639"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT00"
FT                   /protein_id="ADE03977.1"
FT                   /translation="MNMLYEGEWRTDKFVANNEDGEFERQTTDFRNWVGEDERFPVEAG
FT                   RYHLYICRACPWAHRTAMTRALKGLEDAISLSLVEPVRIDDGWEFSEDLPDPLYGEEFL
FT                   RDIYLRADDEFTGRVTVPVLWDKQRETIVNNESREIMRMLDEAFDPLAERDVDLNPDGY
FT                   EEEVDRLVDEIYEPVNNGVYRAGFATTQEAYEEAVEELFDALDHWDEVLDDQRFLAGDV
FT                   VTEADIAMFATLIRFDHVYHTHFKCNKKAIHEYDNLWNYTKELYQLPGVAKTVNMDHIV
FT                   RHYFVSHGDINPKRIYGVGPDLDFDAEHDRDRLPADLPAALTADD"
FT   gene            600054..601019
FT                   /locus_tag="HVO_0671"
FT   CDS_pept        600054..601019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0671"
FT                   /product="molybdopterin-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02414"
FT                   /db_xref="GOA:D4GT01"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT01"
FT                   /protein_id="ADE02414.1"
FT                   /translation="MASRATRLTRALRRVEPPPRAVDWSIFALVVFETLSGVLSLGAGH
FT                   PANGLLFVVHGVAGLSLVVLVGFKLYRVRRRVLDARLRDRHTALSVLLAVVALASLGTG
FT                   IAWVLGVEVRIGFWTLLNVHIGFGLLVVPVLFFHLWARFRPPRRVDFAERRRALQYGAI
FT                   LVFSAATYRATETVGALRGVGRRFTGSRPLPPGEGNDAFPVTSWVADDPDPVDPDSWSL
FT                   SVTGLVDRSLELDRADLAPGETRSVLLDCTSGWYTEQHWTGVRLGDALDAAGVHSSARW
FT                   VTVRSVTGFRWSFPIAEAREMLLATHVGGDPLSHGHGAPL"
FT   gene            complement(601170..601301)
FT                   /locus_tag="HVO_0672"
FT   CDS_pept        complement(601170..601301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0672"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02306"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT02"
FT                   /protein_id="ADE02306.1"
FT                   /translation="MTTSDSSAPDEGEATNASTDDTTDEAEKTILDRLVDVLWILPW"
FT   gene            complement(601363..601848)
FT                   /locus_tag="HVO_0673"
FT   CDS_pept        complement(601363..601848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0673"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02945"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT03"
FT                   /protein_id="ADE02945.1"
FT                   /translation="MDRQRALAVVMAVVGFGAVVAGIHQELLHVAPGYDGTITTGWGGR
FT                   LNHEEYLLARLGGVGVVGTLAAFRWKYAAVLPVAVGGVEVGYSLVAVSHYVREPGLYTT
FT                   VQTFDGTTRLILGAEPFLLVAGGLLFLGAGVVAWRTRRDCTSVHRRGTKTASRGIPR"
FT   gene            complement(601895..602647)
FT                   /locus_tag="HVO_0674"
FT   CDS_pept        complement(601895..602647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0674"
FT                   /product="4-phosphopantoate--beta-alanine ligase"
FT                   /EC_number="6.3.2.36"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03982"
FT                   /db_xref="GOA:D4GT06"
FT                   /db_xref="InterPro:IPR002855"
FT                   /db_xref="InterPro:IPR038138"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT06"
FT                   /protein_id="ADE03982.1"
FT                   /translation="MSDIEIPESHPRYQSLLTRHRIEEGVEKGITSRQGLIAQGRGEAF
FT                   DYLLGERTLPSSDEATRAAAAHLLLADQPVISVNGNVAALCPGEVVDLAAAVDADIEVN
FT                   LFNRTDERMRAIAAHLRDHGADEVKGLTGDGRIPGIDHERAKVDADGIGSADVVVVPLE
FT                   DGDRAEALGAMDKVEIVVDLNPMSRSAQVATVPIVDNIMRAVPNIAAHARDLRGSGATR
FT                   EELETIVADFDADAALDAAERAIRAGDE"
FT   gene            complement(602703..603536)
FT                   /locus_tag="HVO_0675"
FT   CDS_pept        complement(602703..603536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0675"
FT                   /product="pantoate kinase"
FT                   /EC_number="2.7.1.169"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04606"
FT                   /db_xref="GOA:D4GT07"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR012043"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT07"
FT                   /protein_id="ADE04606.1"
FT                   /translation="MSDDATAFVPGHVTGFFSAHPDDDPAVAGSRGAGLTLSHGVSVTV
FT                   EPAPVTAITLDGEAVEMPPVVGVLRALGVTAAVDAESELPLGAGFGVSGAMALGTALAA
FT                   NAVFACGRSENELITLAHVAEVRAGTGLGDVVAQARGGMPLRIDPGAPRHGYMDGIPAR
FT                   PHIEYVTFGGLSTADIIGGDTSTLTAAGEAALDALAEEPTVERFLAESRQFARDAGLLT
FT                   DRVETAIADVRDAGGDAAMAMLGETVFAVGTGLSDAGYDTERCRIHPAGSTLDSA"
FT   gene            complement(603591..604046)
FT                   /locus_tag="HVO_0676"
FT   CDS_pept        complement(603591..604046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0676"
FT                   /product="DUF2078 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02662"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT08"
FT                   /protein_id="ADE02662.1"
FT                   /translation="MTDAERVVDDAVEDASDDDDDSPLQELVAGVVVALIFLVGFGLLA
FT                   LGEWWFWIVFPVGFAGVLPAALALVRIYESRRGYDASESMTTETEDALETLRRRYATGE
FT                   LSEEEFEAKVERLLETETVADARESAASRRREGKAGETERETAFDRD"
FT   gene            complement(604398..605702)
FT                   /gene="aspS"
FT                   /locus_tag="HVO_0677"
FT   CDS_pept        complement(604398..605702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspS"
FT                   /locus_tag="HVO_0677"
FT                   /product="aspartate--tRNA(Asp/Asn) ligase"
FT                   /EC_number="6.1.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03330"
FT                   /db_xref="GOA:D4GT09"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004523"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT09"
FT                   /protein_id="ADE03330.1"
FT                   /translation="MRNRTYTADAEPGDTVTVAGWVHEVRDLGGIAFLILRDTSGKIQV
FT                   KFEKDEMDDDLVETGLGVHRESVISVTGEVDEEPRAPTGVEVTPESLDVIAEAEAQLPL
FT                   DPSGKVDAELSTRLDNRTLDLRKDEVKAIFEIRAEVQRAVRDKFRDLRATEINTPKIVA
FT                   TGTEGGTELFPITYFGQEAFMNQSPQLFKQLMVGSGLERVFEVGPIFRAEEHNTPRHLN
FT                   EATSIDFESAFIDHTEAMDVCEAVVTAAYEAVEENCQDELEALGLEEEFEAPSGEFPRL
FT                   TYEEAIERINATGELDEQLVWGDDLPTEGEKALGEDVGEHYFITDWPSEIKPFYIKDHD
FT                   DDETLSTGFDMMHPNMELVSGGQREHRFDHLVAGFEQQGLDPDAFEYYTKMFKYGMPPH
FT                   AGFGLGGERLIMTMLGLENIREAVLFPRDRQRLSP"
FT   gene            606297..606410
FT                   /locus_tag="HVO_0678"
FT   CDS_pept        606297..606410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0678"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02784"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT11"
FT                   /protein_id="ADE02784.1"
FT                   /translation="MFCGTPPGGDGDARTLHGYFPRDAAVDYWDGEPTTGE"
FT   gene            606487..607254
FT                   /locus_tag="HVO_0679"
FT   CDS_pept        606487..607254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0679"
FT                   /product="DUF4013 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03644"
FT                   /db_xref="InterPro:IPR025098"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT14"
FT                   /protein_id="ADE03644.2"
FT                   /translation="MDVSDLEAAFALPLAEDTSVDTTLLGVVSTLASLATPLAGILLAG
FT                   YVVRLVRAGDREAAALPSFDDLTGMAVDGARLSAALVALQLPAVGLATVSLPGSRPSIA
FT                   MLSYATNPVMLGSFGVTALDTAGLVAAGLASLLGSYLSLVATVALAREASLAAAIPATR
FT                   DLASDRSFVRVASAVALVVFVARLFVALCAAVPVAGTLLAATASFLLLVVSATLLGRGA
FT                   PDASSPGADATRESHADGVNAESVESAESVPSA"
FT   gene            complement(607278..608000)
FT                   /gene="pcrB1"
FT                   /locus_tag="HVO_0680"
FT   CDS_pept        complement(607278..608000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcrB1"
FT                   /locus_tag="HVO_0680"
FT                   /product="(S)-3-O-geranylgeranylglyceryl phosphate synthase
FT                   1"
FT                   /EC_number="2.5.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04458"
FT                   /db_xref="GOA:D4GT16"
FT                   /db_xref="InterPro:IPR008205"
FT                   /db_xref="InterPro:IPR026417"
FT                   /db_xref="InterPro:IPR038597"
FT                   /db_xref="InterPro:IPR039074"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT16"
FT                   /protein_id="ADE04458.1"
FT                   /translation="MSYPWEDWDHITKIDPDKDLVDGETFEDVCETGTDALEIGGTLDI
FT                   TEEKMERVIEATSKYDVPIYQEPSNPGVVIDDDALDGYLIPTVFNASDSFWITGAHKEW
FT                   VRIEDGLDWDRTHTEAYIVLNPESSVAEYTDADTDQSAEDVASFARVAEKMFGQKIIYV
FT                   EYSGTYGDPEKVGAAHDALDDATLFYGGGIHDYESAYEMGQHADAVVVGNLLHDEGVDA
FT                   VRETVEGAKDATAELVAE"
FT   gene            608106..609110
FT                   /gene="mrr"
FT                   /locus_tag="HVO_0682"
FT   CDS_pept        608106..609110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrr"
FT                   /locus_tag="HVO_0682"
FT                   /product="putative Mrr family endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02322"
FT                   /db_xref="GOA:D4GT18"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT18"
FT                   /protein_id="ADE02322.1"
FT                   /translation="MDAAAATEYVESRAMTLSPEEFELLCESVLSESLPSARFSVTAFR
FT                   QDGGIDIDGRIRNSLLDVSLGVQAKQYGSSNTVGSPEIQRFQGALADTGCDTGTVITAS
FT                   SFTTPAVESAERAGIHLVNGSELFDSMINLRVGVRRQSTRFEPDEEFWSLFGEPGEAGV
FT                   IPSKRVPLANSFETLDAVLSAIGDTRGEKDDIVESAGASPRHADLYAIAGWVLGFVHQE
FT                   WPDEESHRQRRWSLTRSGARYVAYRAAGLDDEAEILLLDGIRNAEIIERLVNSLSESGS
FT                   LGHSDLVDFVASESELSRSSAKRRGSSVGIWLARLPEVSVENGREKRYVWNGS"
FT   gene            complement(609107..611629)
FT                   /gene="topA"
FT                   /locus_tag="HVO_0681"
FT   CDS_pept        complement(609107..611629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topA"
FT                   /locus_tag="HVO_0681"
FT                   /product="DNA topoisomerase 1"
FT                   /EC_number="5.99.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03158"
FT                   /db_xref="GOA:D4GT20"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT20"
FT                   /protein_id="ADE03158.1"
FT                   /translation="MSRGPELIITEKDNAARRIADILSGETASAERMNGVNVYKWGGKR
FT                   CIGLSGHVVGVDFPPEYNDWRDVEPVELIGAPVEKHPTQENIVAALRRLARRAGKVTIA
FT                   TDYDREGELIGKEAYELVRDVNEDVPVDRVRFSSITNREVTEAFENPDDLDFDLAAAGE
FT                   ARQIIDLVWGAALTRFLSLSARQLGNDFISVGRVQGPTLKLIVDREREIDAFDPEDYWE
FT                   LFSKLTKDADGDAESFEAQYFYLDDDGTEAERIWDEDDAEEAYQTLLGVEAAEVSSVNR
FT                   RTRTDTPPAPFNTTQFIRAAGSIGYSAQRAMSIAEDLYTAGYITYPRTDNTVYPDDLDP
FT                   RELLGAFEGDRRFKEDAESLLEQEEIEPTEGDNETTDHPPIHPTGELPSASDLSDDEWD
FT                   VYELVVRRFFATVAEDAVWEHLRVVAEVEGLSLKANGKRLLEAGYHDVYPYFNSSESFV
FT                   PDVEEGESLVLSDTHLDAKQTQPPRRYGQSRLIETMEQMGIGTKATRHDVIQKLYDRGY
FT                   IESDPPRPTRLARAVVEASEDFAKLIVSEEMTSQLESDMLAIARGEATLEDVTEESKEM
FT                   LGEVFEGLMESREELGKQLQDSLKADKTVGTCPDCGGDLVVRKSRRGSYFIGCDSYPDC
FT                   TYTLPLPSTGKPLIMEESCEDHDLHHIKMLAGRKTFVHGCPLCKAEEADEEDDLVIGTC
FT                   PECGEEHDGELAIKRLRSGSRLVGCTRYPDCDYSLPLPRRGDIEVTDESCEEHDLPELR
FT                   ITYEGDREPWELGCPICNYREYQAQQNGEGGSELESINGIGAKTAEKLKDAGIEDVKTL
FT                   KASEPDDIAAKVEGVGADTVRKWQTAAD"
FT   gene            611926..612621
FT                   /locus_tag="HVO_0683"
FT   CDS_pept        611926..612621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0683"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02716"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT21"
FT                   /protein_id="ADE02716.1"
FT                   /translation="MRQPSTEHLRLGLAVLLIFTPLWGPALGLTGPTYTYESAEIGVED
FT                   NRLVVPDRDARSELWHGIDGFACSVGSSVTRYCALEAATLNGTLAVDHPDVQSSSSGHL
FT                   DVEERYLAYYDGRVFERESTWEDGRYVLSTARVPAAAALDEVARPPDRYPTAWTAIENG
FT                   SGTADRELWPTDAGARVFEVDGDYYLVYRTGVDRPLPSSPAAEEALTWFAVVLGSAMLF
FT                   GRDDDDDWS"
FT   gene            complement(612687..614177)
FT                   /gene="gatB"
FT                   /gene_synonym="aatB"
FT                   /locus_tag="HVO_0684"
FT   CDS_pept        complement(612687..614177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /gene_synonym="aatB"
FT                   /locus_tag="HVO_0684"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B"
FT                   /EC_number="6.3.5.6"
FT                   /EC_number="6.3.5.7"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04708"
FT                   /db_xref="GOA:D4GT23"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT23"
FT                   /protein_id="ADE04708.1"
FT                   /translation="MTAQALEQRELAVVIGLEVHVQLETATKIFCSCSTEPAEDEEPNT
FT                   RVCPVCLGLPGALPVLNEAAVESAVKIGKALNADIAEDTRFHRKNYYYPDLPKNFQITQ
FT                   YDAPICADGTLEVSVEGTRRDIGITRAHLEEDPGSLQHKGGSIDTADYTLVNYNRAGTP
FT                   LVEIVTEPDFRSPQETRAFLAKLEEVLEYLGVFDATRDGSLRIDANISLVPADEVDDDG
FT                   AISDDALEAANRTEVKNISSHKGAEKALAYEVTRQKNAIQRGRAVEQETRHWDESRGIT
FT                   VSMRSKEEEKDYRYFREADLPPLQVAHWKEEIPIPELPDARRERFRTEYGIDEESASKL
FT                   TSTKEVADFFEDVAAEFDADLAATWVADNLLGELNYRDMHITDVSDRLDEFTRLVELVA
FT                   ADEVTTKNAEEIVLREMLDEGKDPDTIVNEAGLGKADDDEIGGFVQEAIDENPDAVEDY
FT                   HNGEGGALNFLVGQVMQKSQGSADPGTVNQLLRERLDE"
FT   gene            614347..615231
FT                   /locus_tag="HVO_0685"
FT   CDS_pept        614347..615231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0685"
FT                   /product="DUF3100 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04083"
FT                   /db_xref="InterPro:IPR021450"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT24"
FT                   /protein_id="ADE04083.1"
FT                   /translation="MTNDTTSDRWAPIRTAGRLSAHLRTHLTVLLIVVVAELIGTITFP
FT                   LGPGQVVLLPLLYAVVLGLALSYSVLGSVIEPLRSVVDEDVSRIASPLLVVALMPLGVK
FT                   YGTLVAPSFYDLVAAGPAFVLQEFGNLGTILIALPLALLLGLKRESIGAAVSIAREPTL
FT                   GVITDKYGIESPEGRGVLGTYMTGTVLGTVFFGLLGGFAPATGLHPLALSMACGMGSAS
FT                   MMTACSTSLATAVGGAGVAEDQILSFAATSNLLTGITGLYMVILVGLPVITRLYAVLAP
FT                   VFGRDTAAADGGE"
FT   gene            615233..615697
FT                   /locus_tag="HVO_0686"
FT   CDS_pept        615233..615697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0686"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03710"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT25"
FT                   /protein_id="ADE03710.1"
FT                   /translation="MSMSTPEFSVESLKMLLVVAFLTLTANFIATGTGFVAALPGTALI
FT                   VVLGLVALLMGRLIPLDLPAFAYAMVLAFALALPFSPVQAPFLAAVGEIDFLATTTPIL
FT                   AYAGLSIGLQTGKMKEVSWKLVLVAVFVFFGTFFGSALISQAVLSAQGII"
FT   gene            615744..617078
FT                   /locus_tag="HVO_0687"
FT   CDS_pept        615744..617078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0687"
FT                   /product="M20 family amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02268"
FT                   /db_xref="GOA:D4GT26"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017144"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT26"
FT                   /protein_id="ADE02268.1"
FT                   /translation="MTDDRVAALKARVCDAIDDRADEIIDFAKDVQAEPELGYKEVKTT
FT                   EKVVSLFEDLDLDVETELAITGARARAGSGDFVAAVLGELDALVNPDHPMADPETGAVH
FT                   ACGHNAQLANLVGTAFGLVGSGVVDDLDGAVEFVAVPAEEYLDLDYRRGLLDAGDIEFF
FT                   GGKQELIRRGYVDDWDAAAMMHAGSDTPERTITSDFSTNGFVGKFVTYRGTEAHAGAAP
FT                   EEGVNALNAAMLGMNAVHAQRERFRDEDHVRVHPIITRGGDGVNVVPAEVTMESYVRAA
FT                   SVEAVADANESVNRALASGAMGVGGDVEIEDYPGYMPLRTDETIVAFYDENARDIVGPD
FT                   AVTPGTPHLSGSTDMGDITQLVPGIHPWTGGFEGAVHARDFRVVDEEMAYVIPAKLTAC
FT                   TLVDLLTSPEAMAAVREAKAEKRSREEYLDAVRSLRATTTESYRD"
FT   gene            617184..617507
FT                   /locus_tag="HVO_0688"
FT   CDS_pept        617184..617507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0688"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02698"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT28"
FT                   /protein_id="ADE02698.1"
FT                   /translation="MSNRVEELESKVAELQAAVNGLTEELVETKERLRQLEDANDVQVP
FT                   SRAATRRGDWETEDQADAEAAAAEPADADETSPADADETKPDEADETDEGDGEAPDDDI
FT                   IVA"
FT   gene            617591..621313
FT                   /gene="smc"
FT                   /locus_tag="HVO_0689"
FT   CDS_pept        617591..621313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smc"
FT                   /locus_tag="HVO_0689"
FT                   /product="chromosome segregation protein Smc"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02606"
FT                   /db_xref="GOA:D4GT30"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT30"
FT                   /protein_id="ADE02606.1"
FT                   /translation="MHIKELVLDGFKSFGRPTRIPFYEDFTVVTGPNGSGKSNIIDGVL
FT                   FALGLARTRGIRAEKLTDLIYNPGHADGSDEAPDKPKEASVTVVLDNSEGTLDRSQVVN
FT                   AAGTDKVGGVEEITIKRRVKETPDNYYSYYYLNERSVNLSDIKDLLAQAGITPEGYNVV
FT                   MQGDVTEIINMTPYQRRGIIDEIAGVAEFDEKKDAAFEELEAVEERVDEADLRIEEKEA
FT                   RLDQLADERETALTYKGLREEKEEYEGYLKAAELEDKRDDLSRTESRIESTEADLEDLQ
FT                   AELDERQGKVTRLEADLEDLTREIERKGEDEQLRIKSEMEEIKGDISRLENAIDAAEEK
FT                   RDDAEAERRKAFVDIDRKQEQIDDLEDDIREVKVEKASVKSDIQSKRVELSEVQAEIDS
FT                   VDTEFDELKSELAERKETLDELKDEKNDRQRAKDRLLDDARRRSNQISETRDELERARE
FT                   RIPELKATVSDLHSELDTAEKNEAKIDGVIEDLQAEKADLNDELSEVTDELQTKQSEYA
FT                   RLEARAGKDGDNSWPRAVTTILNAGISGVHGAVGQLGSVDGEYAKACETAAGGRLANVV
FT                   VDDDGVGSSCIGHLKSRKAGRATFLPITKMDNRSLPREPDNPGVVDFARNLVDYDSQYE
FT                   SIFSYVLGSTLVVEDMETARDLMGDYRMVTLDGDLVERSGAMTGGSGGGSRYSFSKSGE
FT                   GKLDRLAKEITKLEDRRRSLNEEIRDIDDDLDDARGRASDAADRVRTIEREIEDAEEDI
FT                   EEAEAEIDRLEDRLDELQSERESVDEQMSDLDDEIADLDDEIETVEAEIEDIEAELADS
FT                   EIPELTARADDIRADIDDLEDRMSTLDGRLNEIQLEKQYAEDAVDDLHDTIEAAQNRKA
FT                   EARESISEAESTIEEREDDLEAKREAVAELEEELVDLKEDRTELQDDLREARSARDEKK
FT                   DRVNAVESKLESMRSAAERLEWEIDELQSQVGDYDPDEIPDHDTVESEIERLTEEMEEL
FT                   EPVNMLAIDEYDDVKADLEALQERRDVLVEERDAIADRIDQYESQKKATFMESFDAIAE
FT                   NFTDIFERLSNGTGHLQLENPDDPFEEGLTMKAQPGDKPIQRLDAMSGGEKSLTALAFI
FT                   FAIQRHNPAPFYALDEVDAFLDAANAERVGQMVDDLAGDAQFVVVSHRSALLERAERAI
FT                   GVTMQGDNVSAVTGIQFGGDGEAGSDGGDGRDADGPGGDDGGSGDGSDDDGDDADGGDG
FT                   GEADADVEAEVPADD"
FT   gene            621306..622433
FT                   /gene="scpA"
FT                   /locus_tag="HVO_0690"
FT   CDS_pept        621306..622433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scpA"
FT                   /locus_tag="HVO_0690"
FT                   /product="chromosome segregation and condensation protein
FT                   ScpA"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04375"
FT                   /db_xref="InterPro:IPR003768"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT32"
FT                   /protein_id="ADE04375.1"
FT                   /translation="MTDDIPELNLSRGRGERDGSDGDDDDDGVFSFAGDDAAPDSEADA
FT                   APAEPDAMDEVLPEDVSESDDDEVEPVELLVQLAKEGTIDPWDIDIVEVTDAFLNRLDA
FT                   MDLRTTGRALFYASVLLRMKSDELLAPDEPDEEELEPWELALESGGDEGHPGDDGEGPP
FT                   GFDPIDALEDEMDRRLERKHARGSPETLDELVRELREVERGSWWKRRREYDTSESPRGF
FT                   SRGTQTLDYHTPGEMRGAGEPTEDDVTGTAHNEDIEAVVEAVGDVLATHYEKGRDEVLF
FT                   AEIRDVADTVMTTYLALLFLSHRSTVYLKQDDLFGDLWIRNPEVFDADPGAGSDADADA
FT                   EVADDADAEVADGGDDADDADSDDPELEAEAIADD"
FT   gene            622466..622942
FT                   /locus_tag="HVO_0691"
FT   CDS_pept        622466..622942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0691"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03576"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT34"
FT                   /protein_id="ADE03576.1"
FT                   /translation="MPHPTLLSSTLRRLTVAVSLVTSTLFAALAAAILFPQSAIWTWAL
FT                   LFFVPIFWLHCYFPGYVSYSPTAFGRVREVVTSPRAVRECVVCGEADDRGVARAFSTQF
FT                   VVAGIPLSTTDRGENEYCTRCHGVEFSPTDEAARGEREAGESEGDSGKSAELND"
FT   gene            complement(622950..623810)
FT                   /locus_tag="HVO_0692"
FT   CDS_pept        complement(622950..623810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0692"
FT                   /product="putative 6-oxopurine phosphorylase"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02291"
FT                   /db_xref="GOA:D4GT36"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010044"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT36"
FT                   /protein_id="ADE02291.1"
FT                   /translation="MKIGFIGGSGIYEALPLENTREEPVETPFGEPSTTPVVGEFGDTG
FT                   REVVFLPRHGPDHQHSPTTLPYRANIFALKQLGVTHVLASNAVGSLKEDLPPQTLVVPD
FT                   QIYDRTKHRPLTFFDEGIVVHQPFAMPYDEELVSILAEAAEEATDAQVQEGGTYVCIEG
FT                   PSYSTKAESEHYRAQGWDVIGMTTIPEAKLAREAEMAYATITGVTDYDVWKDDSEVTLD
FT                   EVLKNAAANEEAIKETVEAAIHKIPDGHETDSHSALEGTINTPDEAIPAETKAKLAPLI
FT                   DEYVD"
FT   gene            complement(623856..624830)
FT                   /locus_tag="HVO_0693"
FT   CDS_pept        complement(623856..624830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0693"
FT                   /product="auxin permease family transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02958"
FT                   /db_xref="GOA:D4GT38"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT38"
FT                   /protein_id="ADE02958.1"
FT                   /translation="MSLFSIFAGALLPILAIGAVGFLLGRVRDVDPEPLNTVTVYVLAP
FT                   VLVFYSLATTELAGETLAALTAGVVAYHVAMLLVAGGVARLAGISDPLLGALVLVAAFP
FT                   NSGNYGIPVSSFAFGDTGRSTAVVYLAVQSVLIYTLGVYIAGRGDDRDDAPPGWRVGLE
FT                   RIVRIPLVYAVVAALAARWLGVVPPTGVPAMETLRLVGDSSIPMMLLILGIQLAGADLG
FT                   STLSEVGVVAALKMVVAPAVAVGVALVAGFGDPTVARTFVLESAMPAAVTPLILVAEFG
FT                   DASGAGSATSLAEFVSAAVFATTLLSVPALSVLIYLLNHGFVV"
FT   gene            complement(624993..625706)
FT                   /gene="gptA2"
FT                   /locus_tag="HVO_0694"
FT   CDS_pept        complement(624993..625706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gptA2"
FT                   /locus_tag="HVO_0694"
FT                   /product="putative phosphoribosyltransferase"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03614"
FT                   /db_xref="GOA:D4GT40"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT40"
FT                   /protein_id="ADE03614.1"
FT                   /translation="MGDLPDEFNCTITNWEYIYGLCRDVSDEVKTSEFEPDVIVALARG
FT                   GWFAGRCICDFLGLDDLTSLKMEHYVGTAQKSNEPEVRYPMPEGSVEGKDVLIIDDIAD
FT                   TGGSIKRAHEYVNERNAGEVRTATLQLLQTSEFEPDYVGERLEEWAWVVYPWNFIEDMI
FT                   DLTSGVMAKADDDTFELEDIRHYLAEFHDVDRIEMEIAQPDRMPEVMSEMERRGYVEST
FT                   GDGAWRLLENDGVGA"
FT   gene            625917..626087
FT                   /locus_tag="HVO_0695"
FT   CDS_pept        625917..626087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0695"
FT                   /product="small CPxCG-related zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04209"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT41"
FT                   /protein_id="ADE04209.1"
FT                   /translation="MHTCGNCGEFVSRDFVRVFGNDMDEVVGCPACMNMREVMQGDGAA
FT                   QTSGRVRWTRA"
FT   gene            626195..627094
FT                   /gene="phzF1"
FT                   /locus_tag="HVO_0696"
FT   CDS_pept        626195..627094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phzF1"
FT                   /locus_tag="HVO_0696"
FT                   /product="PhzF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04803"
FT                   /db_xref="GOA:D4GT42"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT42"
FT                   /protein_id="ADE04803.1"
FT                   /translation="MDSRRALLVDAFTTEPLSGNAAGVVPDADGLDAEQMRALAAELGA
FT                   SETAFVCSSAAADRRIRYFTPQQEVDLCGHATIAAHAHLAAERDLEPGTHTLETNVGTL
FT                   DIELGDLGEVWMTQDAPTVRPLEVDYDRLAAALGVDDAALRDVGADLPVAVASTGLPFL
FT                   VVPVNFLEHLSAADPDDAAIADLAAEHDAAGFYAYTFDAIDGDSTLHARCFAPGIGISE
FT                   DPATGTAAGACGAYLRQVGAFDSMPDELRFEQGHFVDRPGTVRVQVGAEIRVGGRAVQS
FT                   FDGEIVVPEFADDDIIEA"
FT   gene            complement(627140..627907)
FT                   /locus_tag="HVO_0697"
FT   CDS_pept        complement(627140..627907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0697"
FT                   /product="PAC2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02658"
FT                   /db_xref="InterPro:IPR004426"
FT                   /db_xref="InterPro:IPR019151"
FT                   /db_xref="InterPro:IPR038389"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT44"
FT                   /protein_id="ADE02658.1"
FT                   /translation="MDDIEIEAVEEVDLTDPVLIEGLPGVGNVGKLAVEHLLEEFEEAT
FT                   LVRRVYADAFPPQVSIDEGVAELTHVAIHAVETPGEGPDLLLLTGDHQAQSNEGHYHLT
FT                   DTFLDIGEEFGVERLFALGGVPTGELVDEPSVLGAVADESRLDELDEAGIEFREGEPAG
FT                   GVVGVSGLLLGLGGRRGLDATCLMGETSGYLVDPQSAQVVIEVLQDLLQFSVDFESLEE
FT                   RAEEMKEVAAKIQEMQQQQQGSIASDDDLRYIG"
FT   gene            complement(627962..628153)
FT                   /gene="nop10"
FT                   /locus_tag="HVO_0698"
FT   CDS_pept        complement(627962..628153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nop10"
FT                   /locus_tag="HVO_0698"
FT                   /product="tRNA/rRNA pseudouridine synthase complex protein
FT                   Nop10"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03110"
FT                   /db_xref="GOA:D4GT45"
FT                   /db_xref="InterPro:IPR007264"
FT                   /db_xref="InterPro:IPR023532"
FT                   /db_xref="InterPro:IPR036756"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT45"
FT                   /protein_id="ADE03110.1"
FT                   /translation="MKSDIRVCSAWRDRHDRPVYSLSETCPECGAATENSAPAPYNPED
FT                   PHGEYRRARKRRLAEEPE"
FT   gene            complement(628158..628958)
FT                   /gene="tif2a"
FT                   /locus_tag="HVO_0699"
FT   CDS_pept        complement(628158..628958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tif2a"
FT                   /locus_tag="HVO_0699"
FT                   /product="translation initiation factor aIF-2 alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04027"
FT                   /db_xref="GOA:D4GT46"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR011488"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022964"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR024054"
FT                   /db_xref="InterPro:IPR024055"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT46"
FT                   /protein_id="ADE04027.1"
FT                   /translation="MKYSGWPDPGELVVGKVDDIADFGVFVDLEEYEDKRGLCHISEVA
FT                   SGWIKNVRDHVREGQTVVAKVLEVNESSQQIDLSIKDVNEHQRKEKIQEWKNEQKADKW
FT                   MALAFGEDIADDRYQSIANALLAEFESLYDGFEQAAIHGIEALDGVELDDDELETIVET
FT                   ARQNVSVPYVNVTGYVDLRSPAGDGVDDVKEALKAAEGDGEIGDEIELSVTYVGAPEYR
FT                   VKVKAPDYKTAETELESSVARAREAIEAAGGTAEYHRERSGDEE"
FT   gene            complement(628977..629171)
FT                   /gene="rps27e"
FT                   /locus_tag="HVO_0700"
FT   CDS_pept        complement(628977..629171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps27e"
FT                   /locus_tag="HVO_0700"
FT                   /product="30S ribosomal protein S27e"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04475"
FT                   /db_xref="GOA:D4GT48"
FT                   /db_xref="InterPro:IPR000592"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR023407"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT48"
FT                   /protein_id="ADE04475.1"
FT                   /translation="MAGNFYKVACSDCENEQVVFGKASSVVNCAVCGTTLATPTGGNAE
FT                   FHGEVVETVERRDSDELEA"
FT   gene            complement(629175..629456)
FT                   /gene="rpl42e"
FT                   /locus_tag="HVO_0701"
FT   CDS_pept        complement(629175..629456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl42e"
FT                   /locus_tag="HVO_0701"
FT                   /product="50S ribosomal protein L42e"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02337"
FT                   /db_xref="GOA:D4GT50"
FT                   /db_xref="InterPro:IPR000552"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT50"
FT                   /protein_id="ADE02337.1"
FT                   /translation="MQMPRRFNTYCPNCKGHHEHEVEKVRTGRPTGMKWNARQTRRGKA
FT                   TIGNAGKFSKVPGGDKPTKKTHLKYICSDCGKAHMREGWRAGRLEFQE"
FT   gene            629659..629919
FT                   /locus_tag="HVO_0703"
FT   CDS_pept        629659..629919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0703"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02770"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT52"
FT                   /protein_id="ADE02770.1"
FT                   /translation="MKKLIIHGDPGVRRDGVIEYDGEEYVLFSVDRQGDWHGPDRVQLW
FT                   CTAGTEDERETFEKREFVPHWLETEGVDAEAVEVVRERGAA"
FT   gene            complement(629916..632279)
FT                   /locus_tag="HVO_0702"
FT   CDS_pept        complement(629916..632279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0702"
FT                   /product="DUF2298 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03826"
FT                   /db_xref="InterPro:IPR018746"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT53"
FT                   /protein_id="ADE03826.1"
FT                   /translation="MEYALVVRWLLLFAALWAVGLPLSARLFCRLPGRGAGLALPVSLV
FT                   ALTLPAYYVGHLSFGPVALVAGVGTLLVASAVAGLDFGALRRGDRRLAPGLDIDRRAVA
FT                   DAAAVFLVAFLFAVALRALDPAVHAGGGEKFLDFGLLQSLARASVLPPEDMWFAGEPVR
FT                   YYYGGHLASILLARLTATDPSFAYNLALAGFFGVLVTAAFELGRGVATAAGANGRLGGL
FT                   LSAFFVGFASNLVTAGRFLLAALPEGLRRPVARAVAERSQYTVEQVLAGASNFSYWSAS
FT                   RVIPGTINEFPLFAWLNGDLHAHMMGTPFLLLAAGLAFAYFRTPEEAVGERRRLVAATT
FT                   LVGAFQVVVDTWSFPSVFGVLFLGIVFAPARPWTLFSGRERVRSAVGGSAVAGELARLG
FT                   GTVAAVGLAGVAATVLASPFLLGAVAGGGSARTVELLSPDQRSGFGALALVHGAFLAAF
FT                   AGYYVRRLGAQDGLGGREWAVLVGSFAALTVVAAAQSFAALALVAPLVAVGWVLLRFAD
FT                   DPRFETVLVVAGAGLVMLVELVYVNEQAGPGRMNTVFKTYMQVWVLWGSVMGAVLAGFV
FT                   GDAVAASDVSLPRVDLGVRGGAVSAVGVGFVALLVASTSVYGGLAVVEHTGSAREEATL
FT                   DATAFADWRHENESTAIAWLDETVEGNPTMLTAPGTKWSEAVTDKREDVMYDWRGNPES
FT                   SLTGVPTVAGWAHEVGYRGPDAYYDRVRDVDAMYVGNESTRARLVERYDVQYVWVGPGE
FT                   RARYGEIETDVAWLTPVHRSGSVAVYEVEEARLP"
FT   gene            632375..633160
FT                   /locus_tag="HVO_0704"
FT   CDS_pept        632375..633160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0704"
FT                   /product="putative glycosyltransferase, type 2"
FT                   /EC_number="2.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03301"
FT                   /db_xref="GOA:D4GT55"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT55"
FT                   /protein_id="ADE03301.1"
FT                   /translation="MSQSVGVVVPAYRPDPERLVPYVHALVESLDPDAVRVELDAPRPE
FT                   TLDALDALPAVARVNDVDARRGKGAAITAGFESLRTDILAFADADGSTPAASMADVVAA
FT                   VRDGADLAVGSRRHPNATVASHQTVARRYLGDGFAWLARHLTEVPLYDYQCGAKAVTAA
FT                   AWNDVRTHLYEPGFAWDIELIAVSGAFGHRVAEVPVVWEDQPNSTVSPVDTTVKMARGL
FT                   LRSRHRARTIREDRLHELIDARSDERTLVEQFSTEVADD"
FT   gene            633153..633620
FT                   /locus_tag="HVO_0705"
FT   CDS_pept        633153..633620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0705"
FT                   /product="GtrA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02487"
FT                   /db_xref="GOA:D4GT56"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT56"
FT                   /protein_id="ADE02487.1"
FT                   /translation="MTDRLSALVSGTRFGKFASVGAVGAVFDLSLSSLLIVFFGVANEL
FT                   AKLAGAELAIVVMFVINDRWTFAGAGSDLLTAKIRRFVKSNLVRSGGLLVQVLVVRALG
FT                   EVSLSIPVAGIDLWELIPLPLAIGASMLLNYVAESLFTWRIATRSSQRDSR"
FT   gene            633681..633755
FT                   /locus_tag="HVO_3029"
FT   tRNA            633681..633755
FT                   /locus_tag="HVO_3029"
FT                   /product="tRNA-Met"
FT   gene            633967..634392
FT                   /locus_tag="HVO_0707"
FT   CDS_pept        633967..634392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0707"
FT                   /product="homolog to Rieske iron sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0707"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04181"
FT                   /db_xref="GOA:D4GT58"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT58"
FT                   /protein_id="ADE04181.1"
FT                   /translation="MSDLERICAVGDVPDDTTFLFRVRAADDADAEELEAILVRTDDGI
FT                   QGWLNYCMHLTHIKLDKGSGAPMRNDEVICQNHGAYFEADTGYCNYGPCEGAVLDDLDI
FT                   TVDGDHVFLSDDEFDYVGQGEIETDPADRSSSSNVEF"
FT   gene            complement(634430..635422)
FT                   /gene="pabC"
FT                   /locus_tag="HVO_0708"
FT   CDS_pept        complement(634430..635422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabC"
FT                   /locus_tag="HVO_0708"
FT                   /product="aminodeoxychorismate lyase"
FT                   /EC_number="4.1.3.38"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0708"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04873"
FT                   /db_xref="GOA:D4GT60"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT60"
FT                   /protein_id="ADE04873.1"
FT                   /translation="MSDDGVGDGDGDADADTGGRSLRYHVDGDLVPAESASVPVTDRGF
FT                   LYGDAAFETLRAYGGEVFHWDAHADRLAETCDALGMDHGLSDDDLRARIDETLAANDLD
FT                   EAYVRLSVTRGSQGGRLTPAEAVDPRVVVIVEPLSRGGRGSDPVWDGPATVQTVKTRRI
FT                   PDRSLPARAKTHNYLNGILARVELRVTGADEALMLDADGYVTEGATSNLFFVDDNALCT
FT                   PSLDGPVLPGITRRVVLDLARQEGIPIRERRFTPDDVRDANEAFLTNSTWELRPVETVD
FT                   GIEVGDGPVTKLLSRLYDDYVERRHYGGDGGSDDADNGGDADSVGGDEN"
FT   gene            complement(635419..636138)
FT                   /gene="pabA"
FT                   /locus_tag="HVO_0709"
FT   CDS_pept        complement(635419..636138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabA"
FT                   /locus_tag="HVO_0709"
FT                   /product="aminodeoxychorismate synthase component 2"
FT                   /EC_number="2.6.1.85"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0709"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04219"
FT                   /db_xref="GOA:D4GT61"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT61"
FT                   /protein_id="ADE04219.1"
FT                   /translation="MTRILVVDNYDSFAYNLVQYVGEAVSEARGGDESADGSSSDGSDD
FT                   VLVYRNDALSTDDVRDIDPDGIVVSPGPGTPAEAGVSVSVFRDLDYPTLGVCLGHQSLC
FT                   AALGSRVGHAPHVVHGKPSLVEHDGAGVFSGLPDRIEVGRYHSLAVEHEDVPPELAVTA
FT                   YTVAEGSEAENSDGDTGTEGDEPAVVMGVRHREKPHVGVQFHPESILTDSGKDIVRNFV
FT                   ALAVGDGPAAAAWEGER"
FT   gene            complement(636135..637649)
FT                   /gene="pabB"
FT                   /locus_tag="HVO_0710"
FT   CDS_pept        complement(636135..637649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabB"
FT                   /locus_tag="HVO_0710"
FT                   /product="aminodeoxychorismate synthase component 1"
FT                   /EC_number="2.6.1.85"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0710"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04032"
FT                   /db_xref="GOA:D4GT63"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR010118"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT63"
FT                   /protein_id="ADE04032.1"
FT                   /translation="MTAPTVVTDRDDFRATAAVASPGARVPVEVRVAVSDPFDAYRRAR
FT                   RDAGGFFYETTGGQPGWGAFGVDPAERLTADAPTDDDWGDPGVDTAPSLAALESFVDSE
FT                   TLVRGDCDAPYPCGLFGWLSYDAARELESLPEQTTDDRGLPHLQLGLYDLVASWAEPRP
FT                   DDGETTLRVTCCPVVEADEDLDAVYDEARTRATDFATEAVEGEPEPVSAPVESDEATFE
FT                   SACGREAFADRVRAAKRYVRDGDTFQANLSQRLVAPAAVHPVDAYAALREVNPAPYSGL
FT                   LELPGVDLVSASPELLLRVEGDRLVTEPIAGTRPRGATTEEDEALEADLTTDEKERAEH
FT                   AMLVDLERNDLGKVSEYGSVEVTEYRRVDRYSEVMHLVSLVEGTRREGTSLADAVAAVF
FT                   PGGTITGAPKPRTMEIIDELEATRRGPYTGSMFAVGFDDRAVLNIVIRTLVRFGDEYHL
FT                   RVGAGIVHDSDPQREYDETLAKARALITAIDEALGERANMTVGTER"
FT   gene            complement(637764..638414)
FT                   /locus_tag="HVO_0711"
FT   CDS_pept        complement(637764..638414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0711"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03318"
FT                   /db_xref="GOA:D4GT64"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT64"
FT                   /protein_id="ADE03318.1"
FT                   /translation="MGLLDTISSLWKSLVGGDSSSSSKEGRDDTATVTVERDTRTEREE
FT                   ANVETEAAVKEPVEETESADETAGEEADAESHADDEDTRDDAEVAADAIEEAEPEDEAV
FT                   EPEPESESEVEVEVEVDGEPEVEGEPELEDEDEESDGAEVEDEESDDETADNADAPTVD
FT                   RIRGIGPAYAERLSGIGIETIADLAAADADEVGDEIDVSPKRVQRWIDRAGDA"
FT   gene            complement(638458..638931)
FT                   /gene="aroE2"
FT                   /locus_tag="HVO_0712"
FT   CDS_pept        complement(638458..638931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE2"
FT                   /locus_tag="HVO_0712"
FT                   /product="shikimate 5-dehydrogenase C-terminal domain
FT                   protein"
FT                   /EC_number="1.1.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02349"
FT                   /db_xref="GOA:D4GT66"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT66"
FT                   /protein_id="ADE02349.1"
FT                   /translation="MGLAGNSAVVVGAGGAGRAAAFALADAGASVHVANRTAETAVELA
FT                   AAVPGATGGGLDTLDRIREADALVNATSVGMESPDETPVSAEYLHGDLAVLDAVYTPLE
FT                   TRLLREAAAAGAVTIDGAWMLLLQGVEAFERWTGRDAPVDAMNAALRSHLESD"
FT   gene            complement(638904..639269)
FT                   /gene="aroE1"
FT                   /locus_tag="HVO_0713"
FT   CDS_pept        complement(638904..639269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE1"
FT                   /locus_tag="HVO_0713"
FT                   /product="shikimate 5-dehydrogenase N-terminal domain
FT                   protein"
FT                   /EC_number="1.1.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04588"
FT                   /db_xref="GOA:D4GT68"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT68"
FT                   /protein_id="ADE04588.1"
FT                   /translation="MQVYGLVGNPVGHSLSPPMHEAAYEETGLDARYVTFEPARDDIAA
FT                   AVEGADALGVSGLNVTIPFKQDVLELVDPDPLAERIGAVNTGRFRRGDAEGVQHRRGGR
FT                   HAVSSSVTAWASPGTRP"
FT   gene            639441..640412
FT                   /locus_tag="HVO_0714"
FT   CDS_pept        639441..640412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0714"
FT                   /product="homolog to sodium/calcium antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0714"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02807"
FT                   /db_xref="GOA:D4GT70"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT70"
FT                   /protein_id="ADE02807.1"
FT                   /translation="MSALATLISFDTALLVAGIVALYLGAEALVEGASRLAIGLGLRAA
FT                   IVGVTIVAFATTTPELFVAVLSGLGYSSDLGLGAIVGSNIANIGLVLGISALIEPMGVS
FT                   TATLRRHVPFMIAAAVVLVALGMDGNLSAVDGGVLLLILVAFTGYLLYRARSATADAIG
FT                   ADEIDIEDEDEVSAQFKDVVYLALGLLLLFVGSNWLIQGGQGLLESFGFGPRFIGLTVL
FT                   AFGTSLPELAASVISAVRGESELSIGNVVGSNIYNVVAVLGILAIMVPVNVPPSTISLD
FT                   FPALLVFTFGVIALMLRNRDVSRLDGGILVVGYLVFFWLILP"
FT   gene            640510..641862
FT                   /locus_tag="HVO_0715"
FT   CDS_pept        640510..641862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0715"
FT                   /product="sodium/calcium antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0715"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05098"
FT                   /db_xref="GOA:D4GT72"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT72"
FT                   /protein_id="ADE05098.2"
FT                   /translation="MGQRRLSHPLTAVFGAALLTVPWLGLHTVFGVDLATGVTVALSGI
FT                   AVLGASFLLAWGAETAEADVPRAFALAILAVLAVAPEYAVDALYAWEAGINPGTPESAE
FT                   AASLAVANMTGANRILIGIGWSAIALFTVYRARDTGDEAVESRPGFLADVVRLDHGIAT
FT                   EILFLFAATVFAFFVPLGAGIGAVDMFVLVGLYVAYIFVAMNSPHEDEEQIGVPAYLQS
FT                   YRKPKRIATTLSLFVFSGIVILVAVEPFAHGLEALGKSVGIPSFLMIQWVAPLASESPE
FT                   LIVVAYLVNKARSTAGFNALISSKLNQWTLLIGTLVLVYSLSLGYYGPLPLDTHQMGEL
FT                   WLTAAQSYFAIAILITFSISLREAVALLGLFLAQFVYSVTGLALTLPIPGLGAVTFDGA
FT                   TSLIGFSVVYLVVGTTLFVRRREQLAAVAKLSVRRVRGDYGANEIPAAVED"
FT   gene            641920..643239
FT                   /gene="dtdA"
FT                   /locus_tag="HVO_0716"
FT   CDS_pept        641920..643239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dtdA"
FT                   /locus_tag="HVO_0716"
FT                   /product="D-aminoacyl-tRNA deacylase"
FT                   /EC_number="3.1.1.96"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0716"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03449"
FT                   /db_xref="GOA:D4GT74"
FT                   /db_xref="InterPro:IPR007508"
FT                   /db_xref="InterPro:IPR018033"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT74"
FT                   /protein_id="ADE03449.1"
FT                   /translation="MIGIVVSRADSASVHIGEHLLELADWDERTDGDRPDADGGGTVFS
FT                   RDGFELREFDDLHIDLDDPAEAFDADLDLVVVVSRHAGETGALLTAHFTGNFGPADYGG
FT                   EPGRFARACPNAQRAVIEALRERAPDDYEVGIEATHHGPTEPTVPSMFVELGSDEEQWG
FT                   DPEGARAVAAAVLDIEGVAPDADRQLVGFGGGHYAPRFERVLNETDWRVGHIAADWQLK
FT                   AMGAPENNRDVLRRAFEASAADLALVDGDRDDLAAALEAEGFRVVSETWVRETAGVPLD
FT                   RVAALEADVTTVEEGLRFGARVDAGDYEVVSLPDGLLGEAQGIDLDAALSAVRETTVAF
FT                   HTTEGGTRAVGRAAVAGDGYDELASRLCDVLREKHDSVVRDDGAVTATTRAFDPAAARE
FT                   FGVPEGPAFGKLSAGQSVEVDGETVAPEDVSKERLVEFSV"
FT   gene            643397..644536
FT                   /gene="ftsZ1"
FT                   /locus_tag="HVO_0717"
FT   CDS_pept        643397..644536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ1"
FT                   /locus_tag="HVO_0717"
FT                   /product="cell division protein FtsZ, type I"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0717"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02725"
FT                   /db_xref="GOA:Q48327"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q48327"
FT                   /protein_id="ADE02725.1"
FT                   /translation="MDSIVGDAIDEAEAEDMGDESAQVDGAANINRSGTMTDDELKAVL
FT                   KDLQTNITVVGCGGAGGNTVNRMHEEGIKGAKLVAANTDVQHLVEIGADTKILMGEQKT
FT                   QGRGAGSLPQVGEEAALESQEEIYDAIEGSDMVFVTAGLGGGTGTGSAPVVAKAARESG
FT                   ALTIAIVTTPFTAEGEVRRTNAEAGLERLRDVSDTVIVVPNDRLLDAVGKLPVRQAFKV
FT                   SDEVLMRSVKGITELITKPGLVNLDFADVKTVMERGGVAMIGLGESDSESKAQESVKSA
FT                   LRSPLLDVDISGANSALVNVTGGSDMSIEEAEGVVEEIYDRIDPDARIIWGTSVDDELE
FT                   GMMRTMIVVTGVESPQIYGRNGEAQAHAEERLEDIDYVE"
FT   gene            644717..644890
FT                   /gene="secE"
FT                   /locus_tag="HVO_0718"
FT   CDS_pept        644717..644890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="HVO_0718"
FT                   /product="protein translocase subunit SecE"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0718"
FT                   /db_xref="EnsemblGenomes-Tr:ADE05111"
FT                   /db_xref="GOA:D4GT81"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR008158"
FT                   /db_xref="InterPro:IPR023391"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT81"
FT                   /protein_id="ADE05111.1"
FT                   /translation="MDVKYDLNSYVRVLKLASTPSWQEFSQISKIAGAGIFLVGLLGFI
FT                   IFAVMSFLPGGV"
FT   gene            644892..645344
FT                   /gene="spt5"
FT                   /gene_synonym="nusG"
FT                   /locus_tag="HVO_0719"
FT   CDS_pept        644892..645344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spt5"
FT                   /gene_synonym="nusG"
FT                   /locus_tag="HVO_0719"
FT                   /product="transcription elongation factor Spt5"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0719"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03005"
FT                   /db_xref="GOA:D4GT82"
FT                   /db_xref="InterPro:IPR005100"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011590"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT82"
FT                   /protein_id="ADE03005.1"
FT                   /translation="MPIFAVKTTARQEQTVADMIATKEFEQIHAVLAPDSLTSYVMVEA
FT                   DDDGIVTRVLEEIPHARGLVESGGAVGTSSMAEVEHFLSPTPDVEGIAEGDIVELIAGP
FT                   FKGEKARVQRIDETKDQVTVELYEATVPIPVTVRGDQIRVLDSEER"
FT   gene            complement(645525..645827)
FT                   /locus_tag="HVO_0720"
FT   CDS_pept        complement(645525..645827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0720"
FT                   /product="small CPxCG-related zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0720"
FT                   /db_xref="EnsemblGenomes-Tr:ADE03195"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT84"
FT                   /protein_id="ADE03195.1"
FT                   /translation="MSRWKCGIEGCDGRFEDVESAVIHQTVDHERHECKVCGTVVPEGY
FT                   FAIRHAFDEHTRAEFVRAYDADSSAVRIREDVKDAVEADADLNSVVETLRERGAL"
FT   gene            645926..646690
FT                   /locus_tag="HVO_0721"
FT   CDS_pept        645926..646690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0721"
FT                   /product="PHP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0721"
FT                   /db_xref="EnsemblGenomes-Tr:ADE02528"
FT                   /db_xref="GOA:D4GT85"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT85"
FT                   /protein_id="ADE02528.1"
FT                   /translation="MSATTTTRVDMHVKILDERVVSRAKARGIDVLVYAPHFVRLPDAR
FT                   ARAERFSDDDLLVVPAREVFAGSWRDRKHVLAVGLSDPVPDFITLDGAFAEFDRQGAAT
FT                   LVPHPTFLTVSLTAEDVAARRDDIDAVETYNTKALPRDNRRGRDIARETGLPGFASSYA
FT                   HLRGTVGEAWTEFDRDIDSEADLVAALREGAERRVVRRTGVSHGFRGAAEFAHLGYENS
FT                   WGKIDRLLLSGMEPTHPDHIAYDGRFDDVSVY"
FT   gene            complement(646747..647271)
FT                   /locus_tag="HVO_0722"
FT   CDS_pept        complement(646747..647271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HVO_0722"
FT                   /product="DUF457 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0722"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04677"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT87"
FT                   /protein_id="ADE04677.1"
FT                   /translation="MNKKGHVLNAILLALGLGVILTVDPQSFEPTMDSAFLLAQKIGQL
FT                   SLPVVLGALFPDVDTAFGKHRKTLHNLPVLVIFLAFPLVFDNLQFVWIGVATHYVLDMV
FT                   GSKRGIALFYPLSPQEYDLPTGVATSSKHADAVTVVVTVAELGVLAGVHYFLFSLDVSL
FT                   ADAAASFTAVV"
FT   gene            complement(647342..647872)
FT                   /gene="cinA"
FT                   /locus_tag="HVO_0723"
FT   CDS_pept        complement(647342..647872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cinA"
FT                   /locus_tag="HVO_0723"
FT                   /product="CinA C-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HVO_0723"
FT                   /db_xref="EnsemblGenomes-Tr:ADE04046"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:D4GT88"
FT                   /protein_id="ADE04046.1"
FT                   /translation="MREFASDPPEEVRAGDALREAGHTVAVAESCTGGLIGSLLTDVPG
FT                   SSDYFDRSLVTYSYDAKRHELAVSRESLDEHGAVSEAVAREMAAGVRDVADATWGLATT
FT                   GIAGPEGGLPGKPVGTVFVGVAFAAPWGSGDSYARVERFEYDGSRTQVKERIARGALAL
FT                   LREEIESESVTTG"
FT   gene            648022..649251
FT                   /gene="arsA1"
FT