(data stored in ACNUC1104 zone)

EMBL: CP001958

ID   CP001958; SV 1; circular; genomic DNA; STD; PRO; 3157527 BP.
XX
AC   CP001958;
XX
PR   Project:PRJNA37711;
XX
DT   01-JUN-2010 (Rel. 105, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Segniliparus rotundus DSM 44985, complete genome.
XX
KW   .
XX
OS   Segniliparus rotundus DSM 44985
OC   Bacteria; Actinobacteria; Corynebacteriales; Segniliparaceae; Segniliparus.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-3157527
RX   DOI; 10.4056/sigs.791633.
RX   PUBMED; 21304703.
RA   Sikorski J., Lapidus A., Copeland A., Misra M., Glavina Del Rio T.,
RA   Nolan M., Lucas S., Chen F., Tice H., Cheng J.F., Jando M., Schneider S.,
RA   Bruce D., Goodwin L., Pitluck S., Liolios K., Mikhailova N., Pati A.,
RA   Ivanova N., Mavromatis K., Chen A., Palaniappan K., Chertkov O., Land M.,
RA   Hauser L., Chang Y.J., Jeffries C.D., Brettin T., Detter J.C., Han C.,
RA   Rohde M., Goker M., Bristow J., Eisen J.A., Markowitz V., Hugenholtz P.,
RA   Kyrpides N.C., Klenk H.P.;
RT   "Complete genome sequence of Segniliparus rotundus type strain (CDC 1076)";
RL   Stand Genomic Sci 2(2):203-211(2010).
XX
RN   [2]
RP   1-3157527
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Mikhailova N., Misra M., Chertkov O., Brettin T., Detter J.C., Han C.,
RA   Larimer F., Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P.,
RA   Woyke T., Wu D., Jando M., Schneider S., Klenk H.-P., Eisen J.A.;
RT   "The complete genome of Segniliparus rotundus DSM 44985";
RL   Unpublished.
XX
RN   [3]
RP   1-3157527
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Mikhailova N., Misra M., Chertkov O., Brettin T., Detter J.C., Han C.,
RA   Larimer F., Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P.,
RA   Woyke T., Wu D., Jando M., Schneider S., Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (24-FEB-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; e0fc7aebd168e3f741df32c20e74050b.
DR   BioSample; SAMN02598516.
DR   CABRI; DSM 44985.
DR   EnsemblGenomes-Gn; EBG00001108873.
DR   EnsemblGenomes-Gn; EBG00001108874.
DR   EnsemblGenomes-Gn; EBG00001108875.
DR   EnsemblGenomes-Gn; EBG00001108876.
DR   EnsemblGenomes-Gn; EBG00001108877.
DR   EnsemblGenomes-Gn; EBG00001108878.
DR   EnsemblGenomes-Gn; EBG00001108879.
DR   EnsemblGenomes-Gn; EBG00001108880.
DR   EnsemblGenomes-Gn; EBG00001108881.
DR   EnsemblGenomes-Gn; EBG00001108882.
DR   EnsemblGenomes-Gn; EBG00001108883.
DR   EnsemblGenomes-Gn; EBG00001108884.
DR   EnsemblGenomes-Gn; EBG00001108885.
DR   EnsemblGenomes-Gn; EBG00001108886.
DR   EnsemblGenomes-Gn; EBG00001108887.
DR   EnsemblGenomes-Gn; EBG00001108888.
DR   EnsemblGenomes-Gn; EBG00001108889.
DR   EnsemblGenomes-Gn; EBG00001108890.
DR   EnsemblGenomes-Gn; EBG00001108891.
DR   EnsemblGenomes-Gn; EBG00001108892.
DR   EnsemblGenomes-Gn; EBG00001108893.
DR   EnsemblGenomes-Gn; EBG00001108894.
DR   EnsemblGenomes-Gn; EBG00001108895.
DR   EnsemblGenomes-Gn; EBG00001108896.
DR   EnsemblGenomes-Gn; EBG00001108897.
DR   EnsemblGenomes-Gn; EBG00001108898.
DR   EnsemblGenomes-Gn; EBG00001108899.
DR   EnsemblGenomes-Gn; EBG00001108900.
DR   EnsemblGenomes-Gn; EBG00001108901.
DR   EnsemblGenomes-Gn; EBG00001108902.
DR   EnsemblGenomes-Gn; EBG00001108903.
DR   EnsemblGenomes-Gn; EBG00001108904.
DR   EnsemblGenomes-Gn; EBG00001108905.
DR   EnsemblGenomes-Gn; EBG00001108906.
DR   EnsemblGenomes-Gn; EBG00001108907.
DR   EnsemblGenomes-Gn; EBG00001108908.
DR   EnsemblGenomes-Gn; EBG00001108909.
DR   EnsemblGenomes-Gn; EBG00001108910.
DR   EnsemblGenomes-Gn; EBG00001108911.
DR   EnsemblGenomes-Gn; EBG00001108912.
DR   EnsemblGenomes-Gn; EBG00001108913.
DR   EnsemblGenomes-Gn; EBG00001108914.
DR   EnsemblGenomes-Gn; EBG00001108915.
DR   EnsemblGenomes-Gn; EBG00001108916.
DR   EnsemblGenomes-Gn; EBG00001108917.
DR   EnsemblGenomes-Gn; EBG00001108918.
DR   EnsemblGenomes-Gn; EBG00001108919.
DR   EnsemblGenomes-Gn; EBG00001108920.
DR   EnsemblGenomes-Gn; EBG00001108921.
DR   EnsemblGenomes-Gn; EBG00001108922.
DR   EnsemblGenomes-Gn; EBG00001108923.
DR   EnsemblGenomes-Gn; EBG00001108924.
DR   EnsemblGenomes-Gn; EBG00001108925.
DR   EnsemblGenomes-Gn; EBG00001108926.
DR   EnsemblGenomes-Gn; EBG00001108927.
DR   EnsemblGenomes-Gn; EBG00001108928.
DR   EnsemblGenomes-Gn; EBG00001108929.
DR   EnsemblGenomes-Gn; EBG00001108930.
DR   EnsemblGenomes-Gn; EBG00001108931.
DR   EnsemblGenomes-Gn; Srot_R0001.
DR   EnsemblGenomes-Gn; Srot_R0002.
DR   EnsemblGenomes-Gn; Srot_R0003.
DR   EnsemblGenomes-Gn; Srot_R0004.
DR   EnsemblGenomes-Gn; Srot_R0005.
DR   EnsemblGenomes-Gn; Srot_R0006.
DR   EnsemblGenomes-Gn; Srot_R0007.
DR   EnsemblGenomes-Gn; Srot_R0008.
DR   EnsemblGenomes-Gn; Srot_R0009.
DR   EnsemblGenomes-Gn; Srot_R0010.
DR   EnsemblGenomes-Gn; Srot_R0011.
DR   EnsemblGenomes-Gn; Srot_R0012.
DR   EnsemblGenomes-Gn; Srot_R0013.
DR   EnsemblGenomes-Gn; Srot_R0014.
DR   EnsemblGenomes-Gn; Srot_R0015.
DR   EnsemblGenomes-Gn; Srot_R0016.
DR   EnsemblGenomes-Gn; Srot_R0017.
DR   EnsemblGenomes-Gn; Srot_R0018.
DR   EnsemblGenomes-Gn; Srot_R0019.
DR   EnsemblGenomes-Gn; Srot_R0020.
DR   EnsemblGenomes-Gn; Srot_R0021.
DR   EnsemblGenomes-Gn; Srot_R0022.
DR   EnsemblGenomes-Gn; Srot_R0023.
DR   EnsemblGenomes-Gn; Srot_R0024.
DR   EnsemblGenomes-Gn; Srot_R0025.
DR   EnsemblGenomes-Gn; Srot_R0026.
DR   EnsemblGenomes-Gn; Srot_R0027.
DR   EnsemblGenomes-Gn; Srot_R0028.
DR   EnsemblGenomes-Gn; Srot_R0029.
DR   EnsemblGenomes-Gn; Srot_R0030.
DR   EnsemblGenomes-Gn; Srot_R0031.
DR   EnsemblGenomes-Gn; Srot_R0032.
DR   EnsemblGenomes-Gn; Srot_R0033.
DR   EnsemblGenomes-Gn; Srot_R0034.
DR   EnsemblGenomes-Gn; Srot_R0035.
DR   EnsemblGenomes-Gn; Srot_R0036.
DR   EnsemblGenomes-Gn; Srot_R0037.
DR   EnsemblGenomes-Gn; Srot_R0038.
DR   EnsemblGenomes-Gn; Srot_R0039.
DR   EnsemblGenomes-Gn; Srot_R0040.
DR   EnsemblGenomes-Gn; Srot_R0041.
DR   EnsemblGenomes-Gn; Srot_R0042.
DR   EnsemblGenomes-Gn; Srot_R0043.
DR   EnsemblGenomes-Gn; Srot_R0044.
DR   EnsemblGenomes-Gn; Srot_R0045.
DR   EnsemblGenomes-Gn; Srot_R0046.
DR   EnsemblGenomes-Gn; Srot_R0047.
DR   EnsemblGenomes-Gn; Srot_R0048.
DR   EnsemblGenomes-Gn; Srot_R0049.
DR   EnsemblGenomes-Gn; Srot_R0050.
DR   EnsemblGenomes-Gn; Srot_R0051.
DR   EnsemblGenomes-Gn; Srot_R0052.
DR   EnsemblGenomes-Gn; Srot_R0053.
DR   EnsemblGenomes-Tr; EBT00001700109.
DR   EnsemblGenomes-Tr; EBT00001700110.
DR   EnsemblGenomes-Tr; EBT00001700111.
DR   EnsemblGenomes-Tr; EBT00001700112.
DR   EnsemblGenomes-Tr; EBT00001700113.
DR   EnsemblGenomes-Tr; EBT00001700114.
DR   EnsemblGenomes-Tr; EBT00001700115.
DR   EnsemblGenomes-Tr; EBT00001700116.
DR   EnsemblGenomes-Tr; EBT00001700117.
DR   EnsemblGenomes-Tr; EBT00001700118.
DR   EnsemblGenomes-Tr; EBT00001700119.
DR   EnsemblGenomes-Tr; EBT00001700120.
DR   EnsemblGenomes-Tr; EBT00001700121.
DR   EnsemblGenomes-Tr; EBT00001700122.
DR   EnsemblGenomes-Tr; EBT00001700123.
DR   EnsemblGenomes-Tr; EBT00001700124.
DR   EnsemblGenomes-Tr; EBT00001700125.
DR   EnsemblGenomes-Tr; EBT00001700126.
DR   EnsemblGenomes-Tr; EBT00001700127.
DR   EnsemblGenomes-Tr; EBT00001700128.
DR   EnsemblGenomes-Tr; EBT00001700129.
DR   EnsemblGenomes-Tr; EBT00001700130.
DR   EnsemblGenomes-Tr; EBT00001700131.
DR   EnsemblGenomes-Tr; EBT00001700132.
DR   EnsemblGenomes-Tr; EBT00001700133.
DR   EnsemblGenomes-Tr; EBT00001700134.
DR   EnsemblGenomes-Tr; EBT00001700135.
DR   EnsemblGenomes-Tr; EBT00001700136.
DR   EnsemblGenomes-Tr; EBT00001700137.
DR   EnsemblGenomes-Tr; EBT00001700138.
DR   EnsemblGenomes-Tr; EBT00001700139.
DR   EnsemblGenomes-Tr; EBT00001700140.
DR   EnsemblGenomes-Tr; EBT00001700141.
DR   EnsemblGenomes-Tr; EBT00001700142.
DR   EnsemblGenomes-Tr; EBT00001700143.
DR   EnsemblGenomes-Tr; EBT00001700144.
DR   EnsemblGenomes-Tr; EBT00001700145.
DR   EnsemblGenomes-Tr; EBT00001700146.
DR   EnsemblGenomes-Tr; EBT00001700147.
DR   EnsemblGenomes-Tr; EBT00001700148.
DR   EnsemblGenomes-Tr; EBT00001700149.
DR   EnsemblGenomes-Tr; EBT00001700150.
DR   EnsemblGenomes-Tr; EBT00001700151.
DR   EnsemblGenomes-Tr; EBT00001700152.
DR   EnsemblGenomes-Tr; EBT00001700153.
DR   EnsemblGenomes-Tr; EBT00001700154.
DR   EnsemblGenomes-Tr; EBT00001700155.
DR   EnsemblGenomes-Tr; EBT00001700156.
DR   EnsemblGenomes-Tr; EBT00001700157.
DR   EnsemblGenomes-Tr; EBT00001700158.
DR   EnsemblGenomes-Tr; EBT00001700159.
DR   EnsemblGenomes-Tr; EBT00001700160.
DR   EnsemblGenomes-Tr; EBT00001700161.
DR   EnsemblGenomes-Tr; EBT00001700162.
DR   EnsemblGenomes-Tr; EBT00001700163.
DR   EnsemblGenomes-Tr; EBT00001700164.
DR   EnsemblGenomes-Tr; EBT00001700165.
DR   EnsemblGenomes-Tr; EBT00001700166.
DR   EnsemblGenomes-Tr; EBT00001700167.
DR   EnsemblGenomes-Tr; Srot_R0001-1.
DR   EnsemblGenomes-Tr; Srot_R0002-1.
DR   EnsemblGenomes-Tr; Srot_R0003-1.
DR   EnsemblGenomes-Tr; Srot_R0004-1.
DR   EnsemblGenomes-Tr; Srot_R0005-1.
DR   EnsemblGenomes-Tr; Srot_R0006-1.
DR   EnsemblGenomes-Tr; Srot_R0007-1.
DR   EnsemblGenomes-Tr; Srot_R0008-1.
DR   EnsemblGenomes-Tr; Srot_R0009-1.
DR   EnsemblGenomes-Tr; Srot_R0010-1.
DR   EnsemblGenomes-Tr; Srot_R0011-1.
DR   EnsemblGenomes-Tr; Srot_R0012-1.
DR   EnsemblGenomes-Tr; Srot_R0013-1.
DR   EnsemblGenomes-Tr; Srot_R0014-1.
DR   EnsemblGenomes-Tr; Srot_R0015-1.
DR   EnsemblGenomes-Tr; Srot_R0016-1.
DR   EnsemblGenomes-Tr; Srot_R0017-1.
DR   EnsemblGenomes-Tr; Srot_R0018-1.
DR   EnsemblGenomes-Tr; Srot_R0019-1.
DR   EnsemblGenomes-Tr; Srot_R0020-1.
DR   EnsemblGenomes-Tr; Srot_R0021-1.
DR   EnsemblGenomes-Tr; Srot_R0022-1.
DR   EnsemblGenomes-Tr; Srot_R0023-1.
DR   EnsemblGenomes-Tr; Srot_R0024-1.
DR   EnsemblGenomes-Tr; Srot_R0025-1.
DR   EnsemblGenomes-Tr; Srot_R0026-1.
DR   EnsemblGenomes-Tr; Srot_R0027-1.
DR   EnsemblGenomes-Tr; Srot_R0028-1.
DR   EnsemblGenomes-Tr; Srot_R0029-1.
DR   EnsemblGenomes-Tr; Srot_R0030-1.
DR   EnsemblGenomes-Tr; Srot_R0031-1.
DR   EnsemblGenomes-Tr; Srot_R0032-1.
DR   EnsemblGenomes-Tr; Srot_R0033-1.
DR   EnsemblGenomes-Tr; Srot_R0034-1.
DR   EnsemblGenomes-Tr; Srot_R0035-1.
DR   EnsemblGenomes-Tr; Srot_R0036-1.
DR   EnsemblGenomes-Tr; Srot_R0037-1.
DR   EnsemblGenomes-Tr; Srot_R0038-1.
DR   EnsemblGenomes-Tr; Srot_R0039-1.
DR   EnsemblGenomes-Tr; Srot_R0040-1.
DR   EnsemblGenomes-Tr; Srot_R0041-1.
DR   EnsemblGenomes-Tr; Srot_R0042-1.
DR   EnsemblGenomes-Tr; Srot_R0043-1.
DR   EnsemblGenomes-Tr; Srot_R0044-1.
DR   EnsemblGenomes-Tr; Srot_R0045-1.
DR   EnsemblGenomes-Tr; Srot_R0046-1.
DR   EnsemblGenomes-Tr; Srot_R0047-1.
DR   EnsemblGenomes-Tr; Srot_R0048-1.
DR   EnsemblGenomes-Tr; Srot_R0049-1.
DR   EnsemblGenomes-Tr; Srot_R0050-1.
DR   EnsemblGenomes-Tr; Srot_R0051-1.
DR   EnsemblGenomes-Tr; Srot_R0052-1.
DR   EnsemblGenomes-Tr; Srot_R0053-1.
DR   EuropePMC; PMC3165615; 21752969.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01781; ASdes.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001958.
DR   SILVA-SSU; CP001958.
DR   StrainInfo; 677561; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4083320
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Segniliparus rotundus DSM 44985
CC   Culture Collection ID :: DSM 44985, ATCC BAA-972, CDC 1076, CIP
CC                            108378, JCM 13578
CC   GOLD Stamp ID         :: Gi02321
CC   Greengenes ID         :: 105706
CC   Funding Program       :: DOE-GEBA 2007
CC   Gene Calling Method   :: Prodigal, GenePRIMP
CC   Isolation Site        :: Human sputum
CC   Isolation Country     :: USA
CC   Host Name             :: Homo sapiens
CC   Body Sample Site      :: Airways
CC   Cell Shape            :: Rod-shaped
CC   Temperature Range     :: Mesophile
CC   Temperature Optimum   :: 28C
CC   Gram Staining         :: gram+
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3157527
FT                   /organism="Segniliparus rotundus DSM 44985"
FT                   /host="Homo sapiens"
FT                   /strain="DSM 44985"
FT                   /mol_type="genomic DNA"
FT                   /isolation_source="sputum"
FT                   /note="type strain of Segniliparus rotundus"
FT                   /db_xref="taxon:640132"
FT   gene            130..1593
FT                   /locus_tag="Srot_0001"
FT   CDS_pept        130..1593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; KEGG:
FT                   mab:MAB_0001 chromosomal replication initiation protein;
FT                   SMART: Chromosomal replication initiator DnaA domain; AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96494"
FT                   /db_xref="GOA:D6Z9G7"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9G7"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ADG96494.1"
FT                   /translation="MPLPTETSPFDAVWAEVLAQLSDESATEAFGYPPLTKQQRAWLPL
FT                   AKPVSLGEGFALISVPSSFAADAFDRGLRAPIAAALRRILGREIELNLRITSQNQETPE
FT                   PKESAAAAGDGAQAEETGPAEEPPSENSGKTALAPTTDTTTSLNARYTFETFVIGASNR
FT                   FAHAATFAVSEAPARAYNPLFIWGDSGLGKTHLLHAAGHYTQRLFSGFRVKYVSTEEFT
FT                   NDFINSLRDDRRVAFKQRYRDVDLLLVDDIQFIAGKEGIQEEFFHTFNTLHNSNKQIII
FT                   TSDRPPKKLAALEDRLRTRFEWGLITDVQPPELETRIAILRKKANIDGLEVPDDVAELI
FT                   ASRIERNIRELEGALIRVTAFASLNHQKLTSALAEMVLRDLVPDSPTLEISVSVILGAT
FT                   AEYFSTTIEELCGPVKTRPLAQARQIAMYLCRELTDLSLPKIGQAFGRDHTTVMYADKK
FT                   VRKELAERRQVYDQVHELTARVRQRAKTS"
FT   gene            2095..3288
FT                   /locus_tag="Srot_0002"
FT   CDS_pept        2095..3288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: mab:MAB_0002 DNA
FT                   polymerase III subunit beta; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96495"
FT                   /db_xref="GOA:D6Z9G8"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9G8"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADG96495.1"
FT                   /translation="MSEEDFTFEVPRDLFADSVSWVTRRLPARPAMPLLAGLLLSADET
FT                   GELSLGGTDYDLTAQAHLSAQVSGPGKVLVSGRLLADIAKALPSPSVRIATEGTKVHVR
FT                   SGSAKFTLPSMPVDEFPSLAEHPTPIGSAQAKELFAAISQVGVAASRDDTLPALTGLRL
FT                   VFTQEGIELAATDRFRLSVRKLVWDGKGVGEEPLTALVPAAVLSEFARTQLETDDAPVE
FT                   FALDQGAGSPSLLGVQAGPFRITTRLLDAQLPDVSQLIPKRYSSLARVELAPLVEAVRR
FT                   VSLVSARRSQIRLDFQGSGSDALLKLSAGAEEAGFAEEELAVQHWGEPISVVFNPGYLL
FT                   DGLSTFRGECGQFGFTGPNRAVALVTGDGPEPEETAEGYTADAPDQVYVLMPVRLQG"
FT   gene            3292..4497
FT                   /locus_tag="Srot_0003"
FT   CDS_pept        3292..4497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="KEGG: rop:ROP_34860 DNA replication and repair
FT                   protein RecF; TIGRFAM: DNA replication and repair protein
FT                   RecF; PFAM: SMC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96496"
FT                   /db_xref="GOA:D6Z9G9"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9G9"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ADG96496.1"
FT                   /translation="MRVSSFEIRDFRSWEHAAMRLDEGCTLFLGRNGYGKTNLVEALGV
FT                   LSSLSSHRGAQNAAMVRRGAAEAFLSAEVLNEGRKLTVGLRIAPGKATKAQLNGVNRPT
FT                   REVAGILRTVFFSPEDLALVRGEPGERRRFLDETLIVRQPRMAGVKADFERVLRQRATL
FT                   LKSLSGARGAARNDEARATLEAWDEQFASRAAALTVARLDLVRALSPRVGRCYAAIDPL
FT                   SDDAELRYRMSAEDADQEETGGEAPVGETSEPQVANAVMERLSQLREEELRRGQCLVGP
FT                   HRDDLELRLAGGAARAFVSHGEAWSYALALRVAAFELLREEGHDPVLVLDDVFAELDGP
FT                   RREVVAGLAKKAEQTLITAADPATVPDGLVANVVPVSLGESRGTKSSRILVEQTPMGED
FT                   DA"
FT   gene            4490..5002
FT                   /locus_tag="Srot_0004"
FT   CDS_pept        4490..5002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0004"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   rer:RER_00050 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96497"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9H0"
FT                   /inference="protein motif:PFAM:PF05258"
FT                   /protein_id="ADG96497.1"
FT                   /translation="MHEDDPSGSAEELARRLIGEFHGQSALGKRVPRRLKPDQRPDRFR
FT                   WSGPGPDVRDPKPFSELCDQLQKKDTWSAKLAEGKIFSLWPMIVGDQIASHAKPLHLTD
FT                   GLLHVQAESTAWATQLRLMQNQLLEKFSHHMGTRVVRALKITGPKAPSWKKGERHVRGR
FT                   GPRDTYG"
FT   gene            complement(5230..5598)
FT                   /locus_tag="Srot_0005"
FT   CDS_pept        complement(5230..5598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0005"
FT                   /product="glyoxalase family protein"
FT                   /note="KEGG: aha:AHA_2915 glyoxalase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96498"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9H1"
FT                   /inference="similar to AA sequence:KEGG:AHA_2915"
FT                   /protein_id="ADG96498.1"
FT                   /translation="MRPMSTYPPVIPMLRVFPDGGARAFYVDYLGFQTDWEHHFEPELP
FT                   LYQQVSRGPWVLHLSEHIGDATPGSAVRFITDDIAALHSELRAKPRVPAVPKIERCDWG
FT                   DELLVLDPFGNRLIFHQP"
FT   gene            complement(5878..5951)
FT                   /locus_tag="Srot_R0001"
FT                   /note="tRNA-Asp1"
FT   tRNA            complement(5878..5951)
FT                   /locus_tag="Srot_R0001"
FT                   /product="tRNA-Asp"
FT   gene            complement(5990..6065)
FT                   /locus_tag="Srot_R0002"
FT                   /note="tRNA-Glu2"
FT   tRNA            complement(5990..6065)
FT                   /locus_tag="Srot_R0002"
FT                   /product="tRNA-Glu"
FT   gene            complement(6165..6767)
FT                   /locus_tag="Srot_0006"
FT   CDS_pept        complement(6165..6767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0006"
FT                   /product="protein of unknown function DUF179"
FT                   /note="PFAM: protein of unknown function DUF179; KEGG:
FT                   mbt:JTY_0039 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96499"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9H2"
FT                   /inference="protein motif:PFAM:PF02622"
FT                   /protein_id="ADG96499.1"
FT                   /translation="MGLPFSAQIESVRAGSLLLASTDLRGDTFQRTVVYILEHDERGTF
FT                   GLVVNRPTKISVASVAPAWEDFAAEPCVVHNGGPVRKDGLLCLGLPREGVAAAESGSTE
FT                   SLGFSVVAPDIAVVDLEGDAQLIASSLQYVRIFAGYSGWASGQLAAELSRGAWYVVSGL
FT                   PQDVFVGAGVDLWGQVIRRHGARAGVLATHPIDTGVN"
FT   gene            complement(6849..8390)
FT                   /locus_tag="Srot_0007"
FT   CDS_pept        complement(6849..8390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0007"
FT                   /product="polynucleotide adenylyltransferase/metal
FT                   dependent phosphohydrolase"
FT                   /note="TIGRFAM: tRNA adenylyltransferase; metal dependent
FT                   phophohydrolase; PFAM: Polynucleotide adenylyltransferase
FT                   region; metal-dependent phosphohydrolase HD sub domain;
FT                   KEGG: rha:RHA1_ro03641 tRNA nucleotidyltransferase; SMART:
FT                   metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96500"
FT                   /db_xref="GOA:D6Z9H3"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR014065"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9H3"
FT                   /inference="protein motif:TFAM:TIGR02692"
FT                   /protein_id="ADG96500.1"
FT                   /translation="MVAAKATSHSLCARLYAQVVAKPSSTNPESGGQEDRAPGAERRVR
FT                   LLAQAHTALHAHDGLFGSLAERFADQGHQLYLVGGSVRDALLGRLGDDLDFTTDARPEH
FT                   TQKLLRGWAEEMWDTGIAFGTVGALKNGNKLEITTFRKDDYDQSSRNPAVDFGTDLRTD
FT                   LTRRDFRMNAMAVSLTAQGCGEFVDPLGGLEDVLAGRIDTPDTPEISFGDDPLRMLRAA
FT                   RFAAQLGFTWSPRVARATVDMAGEITRITAERVGAELQKLIVGEHAVEGVELLVDSGLA
FT                   EFVLPEVPQLQLATDAAHHHKDVYRHSLAVLGNAMALEPGDPDPVLRWAALLHDIGKPA
FT                   TRRFEAGGAVSFHHHEVVGAKLARKRLRALAFPKHMVEDVGKLVFLHMRFYGYGEQSWT
FT                   DSAVRRYVVDAGELLPKLNLLVRADCTTRNARRSRQLAAAYDRFEERIAKLAEAEDLAK
FT                   VRPDLDGNAIMEILGIGPGRAVGEAWHHLKELRLEHGPLDPQEAKRHLLDWWAKR"
FT   gene            8399..9016
FT                   /locus_tag="Srot_0008"
FT   CDS_pept        8399..9016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0008"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: mjl:Mjls_5774 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96501"
FT                   /db_xref="GOA:D6Z9H4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9H4"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADG96501.1"
FT                   /translation="MTSTDNTGPEESPRGDRPDGRPRRRRKHKPRSQRPRRHDRETSAG
FT                   GLVVAGLDGPPEEFRAALIGRLDKAGRMRWSMPKGHIEPGETAEQAAVREVKEETGIDG
FT                   TVLASLGSIDYWLHGQGKRVLKTVHHYLMRFQSGELSDEDVEVTEVAWVPLTELSTRLS
FT                   YADERKLAAIANNLIEGMRAGGARAPLRGGGSAGSADESAAP"
FT   gene            9013..11331
FT                   /locus_tag="Srot_0009"
FT   CDS_pept        9013..11331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0009"
FT                   /product="glycoprotein"
FT                   /note="KEGG: rha:RHA1_ro03643 glycoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96502"
FT                   /db_xref="GOA:D6Z9H5"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9H5"
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro03643"
FT                   /protein_id="ADG96502.1"
FT                   /translation="MIARGLLRALGAWLGALCLVAALSSASAEPQTRDRAPSFLRISLD
FT                   PASLNMVTTGGEDAVDVDGEIENFSDKPVTDVEARLQRAPAVLDAAGLAASLTDPEETY
FT                   DTLGPFQLIAEHIAAHAKARFHLSLPLRGSADSLQIPNPGVYPMLVNVNGTPDSGVHAR
FT                   LDDLRFLLPVLGLPAAPGLPAQPAKIDRPARLGLVLPFADEPRWAPGSIEGDGLVRLTD
FT                   DELAGELAPDGRLGVLLAGFERLRHAAEPTANALRQGVCVAVDPDLLRTVNAMTGDYLV
FT                   QSPRDGLVAGKGSAAARDWLARLRAATAGQCVVAMPFAHADLAALAQSADPQLQKIALD
FT                   QAGDFVDNFLSVTSVRGLIVSANTRIGKPVADMLSAKGFHTVLTPRATELPDASEALGP
FT                   GLAAVHFDSTTSTLLGSLGSRNSPGLPPQDRTAQRQSAVAALLWPALQSSNPGQLPTTG
FT                   GLELLVPPSVWSPSQADFDALIFAASIALQAGIAKPISWNPVSGPRAFGAGANATAEQE
FT                   VAVAAPKTLLKPLPGSVIDAANQVRGVVDQLAAGIVDQPDDPMTAERYARSWNEQLLRT
FT                   LASGPSADGAPERMDRLGSALDAATASVCPVDPGKPYTLFTEDGSLPVVVRNGLPVSMR
FT                   VQLAVRAPSGVEVSALGPETVPAHGSRVLSLPARVKAPKLSPVEIELRTVSGLNLGNLV
FT                   TVSVQSSQYRGLVAVVTAVVGALLLALMARRLWRRITGKGGPGGRLKPDEHDRKMAGLG
FT                   FRERTLVESRHGALPPDDD"
FT   gene            11303..12988
FT                   /locus_tag="Srot_0010"
FT   CDS_pept        11303..12988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0010"
FT                   /product="integral membrane protein MviN"
FT                   /note="KEGG: rop:ROP_34640 hypothetical membrane protein;
FT                   TIGRFAM: integral membrane protein MviN; PFAM: virulence
FT                   factor MVIN family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96503"
FT                   /db_xref="GOA:D6Z9H6"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9H6"
FT                   /inference="protein motif:TFAM:TIGR01695"
FT                   /protein_id="ADG96503.1"
FT                   /translation="MGRCRRMTTEPRGLKPDSPEPQTVKTGPRLAARRVVATGGLVAFA
FT                   TLLSRITGFAKAVLVVVLLLPEVSSAFTIANQIPNMVEQLVLGAVITQAFVPVLVRASV
FT                   ADEDGGSAFTQRMIGLTLAVLAAATLLGYLLAPWLLPQFLDHGGGKVPARLVAQLLLLL
FT                   LPQIFFYGLFSLGNAVLNQRGRFQPGAWAPVVNNLVVIAALLLFAVLPGSPRPGLLTAP
FT                   QLWTLGCGATAGVLAQALVLWPALRRAGVRLRPRWGIDSRLKRFGGTVAAMVCYVVISQ
FT                   AGFLVAVQIAGRVDGGGPTIYQNVWLLLQLPYGVLGVTIITMMTPQLAKAAADGDDEQV
FT                   VADLARANRFTSAALTPVVALMTAAGPLIGVGLFGHGKFDQAHAQTLGLVLSWSAFTIL
FT                   PYAVVLVQLRVFYARQESWTPTWIVVGVTAVKIAGSYLALVASSDPTRVQELLGVANGL
FT                   GYLFGAVIGFVLLRRSLGPLGLASLGRGFALVAAASAFGAALFALVAASGPVGRCVSDH
FT                   GSAGGLLVLAVLGSVCLVVVYALLWALGAPEIRALASLARRTTG"
FT   gene            13127..14701
FT                   /locus_tag="Srot_0011"
FT   CDS_pept        13127..14701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0011"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_4937 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96504"
FT                   /db_xref="GOA:D6Z9H7"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9H7"
FT                   /inference="similar to AA sequence:KEGG:MAB_4937"
FT                   /protein_id="ADG96504.1"
FT                   /translation="MTQEQALSPEQAPPPRIPGAMVLGGRYRLLVRCGSVGSHTFWQAM
FT                   DAHLNRHVALTFTTNAAPEALRAAMVLAKLSSPGLARIFDVTNDQGDLVVITEWVAGAP
FT                   LREVALSRPSALGSANALTALADAAAAAHENGALLGLDHPIRVRISNDGEAVLAYPSVS
FT                   ATQTRADDVRALGGTLYALLTGQWPEKAGNAEDSGLPLAKEEPDAGLASARERDPSVPR
FT                   LVSDAADSALGATVSAEQFRELLEQALSEEDPEAAGPETQAQASDGGLQLDLGLRSSAP
FT                   AQSAVHRARTGEPGTGDAPSLRERLLGSDSRSRKTLLIGSSLLVVIMLLVGYSVYALVD
FT                   SIGAGGSNGRPLVPGQTGSASSSGPAAPVKATDAQVVDFRGDPSGLDDPREAKNAIDGS
FT                   NASYWQTDLYNEGPKMVFKPGIGLLVTLEKAVKLQQVTVSSPSNGTVVDIYVAKSPSTK
FT                   ASDVKKLDDLVKVASGQINGQTTTLSCNTAQAQPSSLVLVWLTTLSPAGGQYRSRINEL
FT                   AFTGSAS"
FT   gene            14726..15334
FT                   /locus_tag="Srot_0012"
FT   CDS_pept        14726..15334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0012"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: saq:Sare_5095 ECF subfamily RNA polymerase
FT                   sigma-24 factor; TIGRFAM: RNA polymerase sigma factor,
FT                   sigma-70 family; PFAM: sigma-70 region 2 domain protein;
FT                   Sigma-70 region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96505"
FT                   /db_xref="GOA:D6Z9H8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9H8"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADG96505.1"
FT                   /translation="MTSNLFEPQDDEGPGDKELLQAHVAGDKRAFATLFRRHYNRMWAV
FT                   ALRTCFNPEEAAEAIQEAMLSAHQAASSFRGDAAVSTWLHRIVVNACLDRARRQRSRPP
FT                   AVPLPEEEELEKTSLRQRPDNDTALSLAVRDALNALPYEHRVVLVAVDVEGYSVEEAAR
FT                   LLDIPQGTVKSRCARGRAKLAKQLGFLRKEGNQSGSANV"
FT   gene            15537..16361
FT                   /locus_tag="Srot_0013"
FT   CDS_pept        15537..16361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0013"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rop:ROP_34660 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96506"
FT                   /db_xref="GOA:D6Z9H9"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9H9"
FT                   /inference="similar to AA sequence:KEGG:ROP_34660"
FT                   /protein_id="ADG96506.1"
FT                   /translation="MATSDQPGNTPGDDRAGKAGFSEDHGPELSVETLALLHADALEGA
FT                   ERDRAKAQAAADPAAQAVLAGLDMVCAQLRRLDHAAPPAEQMPEFLARRMDRELAKLSE
FT                   TPEARRRRWTAAASVGSVAAAAAVLSLVTYAAWPRQEQDSPQPQAQPEPSAAQETSAEA
FT                   TEPLLASVDNRFTIERKDFSTLLRSGGSFKDLGPLSDEAIRGDCLAANGFPADQQLVAA
FT                   GRIKRGDKEGIFMMIPTPAMRGGAPGMTVLVVGSECRAGIPATLSKQVLSRN"
FT   gene            16558..17529
FT                   /locus_tag="Srot_0014"
FT   CDS_pept        16558..17529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0014"
FT                   /product="thioredoxin reductase"
FT                   /note="KEGG: sen:SACE_7384 thioredoxin reductase; TIGRFAM:
FT                   thioredoxin reductase; PFAM: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96507"
FT                   /db_xref="GOA:D6Z9I0"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9I0"
FT                   /inference="protein motif:TFAM:TIGR01292"
FT                   /protein_id="ADG96507.1"
FT                   /translation="MPETLENLIIIGSGPAGYTAAVYAARAQLNPLVFEGTQFGGSLMT
FT                   TTEVENFPGFQEGVQGPDLMVEMRSQAERFGARLQTKDVEWVELGGDRKLVHVDGEVHA
FT                   ARAVILAMGAAPRYLGVPGEQELLGRGVSSCATCDGFFFKDQDIAVIGGGDSAMEEATF
FT                   LTRFAKSVTLIHRRDEFRASRIMLERAKSNPKIKFVLGASVSRVLGSTSVTGVELSHVA
FT                   TGQTSELPVTGLFVAIGHDPRAELVVGQVDQDEDGYVKVQAPSSATSTPGVFAAGDLVD
FT                   RHYRQAITAAGSGCVAAIDAERWLAAAETAQAAPRHALSAQH"
FT   gene            17584..17913
FT                   /locus_tag="Srot_0015"
FT   CDS_pept        17584..17913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0015"
FT                   /product="thioredoxin"
FT                   /note="KEGG: mjl:Mjls_5779 thioredoxin; TIGRFAM:
FT                   thioredoxin; PFAM: Thioredoxin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96508"
FT                   /db_xref="GOA:D6Z9I1"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9I1"
FT                   /inference="protein motif:TFAM:TIGR01068"
FT                   /protein_id="ADG96508.1"
FT                   /translation="MADSESKTLTVTDNSFAQDVLASEQPVLVDFWAAWCGPCRMVAPV
FT                   LEEIAKEQAGKLVVAKLDVDANPKTSTKYDVNSIPNLILFQNGEPVKQIIGAKPKAAIL
FT                   RELGL"
FT   gene            18132..19340
FT                   /locus_tag="Srot_0016"
FT   CDS_pept        18132..19340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0016"
FT                   /product="cell wall hydrolase/autolysin"
FT                   /note="KEGG: msm:MSMEG_6935 N-acetylmuramoyl-L-alanine
FT                   amidase; PFAM: cell wall hydrolase/autolysin;
FT                   Peptidoglycan- binding domain 1 protein; SMART: cell wall
FT                   hydrolase/autolysin"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96509"
FT                   /db_xref="GOA:D6Z9I2"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9I2"
FT                   /inference="protein motif:PFAM:PF01520"
FT                   /protein_id="ADG96509.1"
FT                   /translation="MVFLRRGDIGPEVVAVRAILEELGFLRSSNGSPDQGAAHDGLTPD
FT                   ASGQEARVEALFDAELDLAVRAFQQHRGMLVDGIIGPATSQCLREASFRLGARVTSYQP
FT                   SAPMVGDDVADLQARLHDLGFYMGLVDGYFGPKTHNGLMSYQREFGLTPDGICGPATLR
FT                   SLNFLGSRVTGGSAHELHERELMRLSGPRLEGKRIVIDPGCGADKPGLVVMGAHGPTSE
FT                   ADVLWDLATRLEGRMVATGMEAGFSRSHAHSPTDEERAQTANSYGADIVLALRCATHES
FT                   PMANGVACFYFGNSLGYDSAVGKQLAELIQRELVARTPLRDCRTHGRTWPILRTTRMPS
FT                   VQINIGYLSNPADRAFLSEPSGRDIIAEGILVAVKRLYLLGRGDSPTGSLTFEDLLLHE
FT                   QRA"
FT   gene            19456..20775
FT                   /locus_tag="Srot_0017"
FT   CDS_pept        19456..20775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0017"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; KEGG: mmi:MMAR_0770
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96510"
FT                   /db_xref="GOA:D6Z9I3"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9I3"
FT                   /inference="protein motif:PFAM:PF01593"
FT                   /protein_id="ADG96510.1"
FT                   /translation="MNVPRVPPRAVAVIGSGVAGLTAAYVLSRSCKVVLYEADNRIGGH
FT                   AHTHLVEQGDGSSVAVDSAFLVHNDRTYPTLCRLFQELGVATQETDMSMSVRAERSGFE
FT                   YAGSRGVRGLFPSLGAVQPRHIMMLAEVAKFHRAAAQLLRSGPDEEEPLGEFLARHSFS
FT                   RRFTDYFMTPLVAAVWSCDPRDALRYPARFLFVFLEHHGMLSVFGSPTWRTVTGGSARY
FT                   VERIAARLSEVRTNAPVRSVRRVAGGVSVQAAAEPPRHFDAAVIAAHSDQALAMLAEPT
FT                   ADERRILGKMAYSTNHAQLHTDASLLPKHRFARASWNYLIPAAAHGSEGVLVTYDISRL
FT                   MRVRGADGRRFLVSLGAERRVAPESVIAEMTYHHPLYTPEFVAAQRSLPTLGDDRVVFA
FT                   GAYHGWGFHEDGAASGLRAAQRLGADWKTAEAGREELAQC"
FT   gene            20769..21470
FT                   /locus_tag="Srot_0018"
FT   CDS_pept        20769..21470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0018"
FT                   /product="protein of unknown function DUF1365"
FT                   /note="PFAM: protein of unknown function DUF1365; KEGG:
FT                   mmi:MMAR_0769 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96511"
FT                   /db_xref="InterPro:IPR010775"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9I4"
FT                   /inference="protein motif:PFAM:PF07103"
FT                   /protein_id="ADG96511.1"
FT                   /translation="MLTPKLYRTEIAHTRLSPIRHEFRYRGYSWHVDVDNLPRLPLWLR
FT                   PFAGFQAKDHFTGQPQASLRERVDACLAANGLEPPGGPVTALVQARVLGYVFNPLSLYW
FT                   CHDTEGRLRHIIAEVHNTYGGRHAYPFQPDDKGGATLAKEFYVSPFNPVDGHYCIRAPE
FT                   PETDLDVSVVLRRAGAAVFVATMRGKALPATAGRLARLQLAAPLAPLVGSLRIRKQGIM
FT                   LWLRGLKVVPR"
FT   gene            21467..22753
FT                   /locus_tag="Srot_0019"
FT   CDS_pept        21467..22753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0019"
FT                   /product="Cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /note="KEGG: mmi:MMAR_0768 cyclopropane-fatty-acyl-
FT                   phospholipid synthase UfaA1; PFAM:
FT                   Cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96512"
FT                   /db_xref="GOA:D6Z9I5"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9I5"
FT                   /inference="protein motif:PRIAM:2.1.1.79"
FT                   /protein_id="ADG96512.1"
FT                   /translation="MSPNPVLTQPPGLLVDAQRWPDVASVPKGPVAAIGSKVALRLLCQ
FT                   AAERFSVRLARPDGTALGTGRVAAGAPVIVVRQPDRLGRRLARHGLIGFGESYMAGEWD
FT                   SPDLVAALTALAAGMAHLVPRRLQRLRPLVLARQPKAQRNSLSQAQRNIAQHYDLSNEL
FT                   FAAFLDETMVYSSALFEQLPATQDELPEAQRRKVDRLLDLAGVRAGSRVLEIGTGWGEL
FT                   CLRAAQRGATVRSVTLSCEQRELALDRVRRAGFADQVAVDLCDYRSVDGQYDCVVSVEM
FT                   VEAVGREYWPTYFRALDRLVVPGGRVAIQAITMPHDRMLASRRTHTWVQKYIFPGGLLP
FT                   STEAISDVTARHTALRTVERTSLRPHYAQTLQLWRERFLASGDRVAALGFDHVFQRMWE
FT                   LYLAYSEAGFRSGYLDVQQWVFIREGARR"
FT   gene            22750..23544
FT                   /locus_tag="Srot_0020"
FT   CDS_pept        22750..23544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0020"
FT                   /product="protein of unknown function DUF1295"
FT                   /note="PFAM: protein of unknown function DUF1295; KEGG:
FT                   rha:RHA1_ro02561 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96513"
FT                   /db_xref="GOA:D6Z9I6"
FT                   /db_xref="InterPro:IPR001104"
FT                   /db_xref="InterPro:IPR010721"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9I6"
FT                   /inference="protein motif:PFAM:PF06966"
FT                   /protein_id="ADG96513.1"
FT                   /translation="MTVLHNFAAVAAATAAVLAAVQAAAFAVGRKIGRYNVVDVAWGLG
FT                   FALAAAVAAAVGQGDLPRRVLFAALIALWGLRLSWHMHRKSAGRGEDPRYEALLERKGG
FT                   ASTWNIIVQVFVIQGLAQWFVSLPVQLSAVLGPTPRAFFPALVAGVGLYTAGVLFEAVG
FT                   DWQLRAFKSNPDNRGRIMDVGLWRWTRHPNYFGDSCVWWGLWLCSLACPASLATVLSPA
FT                   LMTYFLVHATGARLLERHMADRPGYREYQQRTSFFVPWPPRS"
FT   gene            23526..24173
FT                   /locus_tag="Srot_0021"
FT   CDS_pept        23526..24173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0021"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: mva:Mvan_4927 RNA polymerase sigma factor
FT                   SigK; TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: Sigma-70 region 4 type 2; sigma-70 region 2
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96514"
FT                   /db_xref="GOA:D6Z9I7"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9I7"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADG96514.1"
FT                   /translation="MAATILKPTTAAAAGIRLAADDRNVTVSAELDRLLARVADGDADA
FT                   FASFYDQTKARVFGLVLRVLRDQGYSEETVQEVYLQVWRSASAFHPEAGSALSWVLTLA
FT                   HRRAVDRVRAEHSAARRDLQYGSAMSSPAFDEVVDTALRRDEQRQVVRCLSVLSEAQRR
FT                   CLELAYYDGLTYQQVAEGLATSLSTVKSRMRDGLARLRGCLRANADEAGEPA"
FT   gene            24170..24880
FT                   /locus_tag="Srot_0022"
FT   CDS_pept        24170..24880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0022"
FT                   /product="Anti-sigma K factor RskA"
FT                   /note="PFAM: Anti-sigma K factor RskA; KEGG: mva:Mvan_4928
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96515"
FT                   /db_xref="GOA:D6Z9I8"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9I8"
FT                   /inference="protein motif:PFAM:PF10099"
FT                   /protein_id="ADG96515.1"
FT                   /translation="MSRPGEPPAGLLGLAAPYALHAVSDTERAAIERALREADPAEAQA
FT                   FRNEVRRIHETMADVAALTAVEPPERLKARIVAATAQTRPKWFQRTSLRVAAVAATLLV
FT                   GLAAGAGWMLLGRSPAPPSAAARILAAPDVRAVSGAIPGGGTATVVFSPELHKAVLVMN
FT                   DVAPPRPGTVYELWLVGPNGPEPAGTMDAHAISPSTTAVIDNLGDSTVVGLSVEPPGGS
FT                   RKPTGAMFAELRLA"
FT   gene            complement(24905..25657)
FT                   /locus_tag="Srot_0023"
FT   CDS_pept        complement(24905..25657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0023"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rop:ROP_49090 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96516"
FT                   /db_xref="GOA:D6Z9I9"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR018763"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9I9"
FT                   /inference="similar to AA sequence:KEGG:ROP_49090"
FT                   /protein_id="ADG96516.1"
FT                   /translation="MDTEPKDTAAEIVVSLSGIRDTTLGQARAFAELLDARGVPLSLLV
FT                   APKLPGKYKLAKDPGTADWLRERRAHGDAIVLHGYDQAATKRRKAEFAALPEYEARLRL
FT                   TAADRMMDHLGLRTRLFAPPEWAASPGAQAVLPALGFHQLVRADSVLEVRAGAARPARL
FT                   FAPRPKYESWQRRVVSFWAWRSGRRGELAQLAISGKHLETESVRGLFFEALGLALERGV
FT                   RPVRYTDLLGVSTTGGGPRFAALVTDVA"
FT   gene            25842..25911
FT                   /locus_tag="Srot_R0003"
FT                   /note="tRNA-Lys1"
FT   tRNA            25842..25911
FT                   /locus_tag="Srot_R0003"
FT                   /product="tRNA-Lys"
FT   gene            complement(25876..26169)
FT                   /locus_tag="Srot_0024"
FT   CDS_pept        complement(25876..26169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0024"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: nfa:nfa14720 putative DNA-binding protein;
FT                   PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96517"
FT                   /db_xref="GOA:D6Z9J0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9J0"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADG96517.1"
FT                   /translation="MLAIYDSGTSPEISLKYRLLIARMEAGLEQSQLAERTGISVRTIR
FT                   NAERGHTSPKQHVIYQWALATGVPATWLLTGQDPNKNGGPDGPSAGTYGSSD"
FT   gene            26293..26502
FT                   /locus_tag="Srot_0025"
FT   CDS_pept        26293..26502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0025"
FT                   /product="regulatory protein MerR"
FT                   /note="PFAM: regulatory protein MerR; KEGG: nfa:nfa14730
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96518"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9J1"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ADG96518.1"
FT                   /translation="MPHSEDLLSITDVVEQTGISRRTILYHIHKGRLTAEPRPSGGRGA
FT                   WLIAPLELRKYLESQDQCAVKQSA"
FT   gene            complement(26522..26812)
FT                   /locus_tag="Srot_0026"
FT   CDS_pept        complement(26522..26812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0026"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96519"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9J2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96519.1"
FT                   /translation="MSIENFFNGWATITNAEIPADYTISAEIKHLLSNATANIALENVK
FT                   VKTEDPREEAKKLALVGASLSVVLGAVVKLEGRVIDLETRLAALETPQQGT"
FT   gene            26959..27198
FT                   /locus_tag="Srot_0027"
FT   CDS_pept        26959..27198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0027"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GD10068 gene product from transcript GD10068-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96520"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9J3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96520.1"
FT                   /translation="MNYGSTPYGSGQGKSLEEVLDIAGIVHKALRLPFAHHPVVAAHIR
FT                   DVTARLEEWESMFLPDEEIPFVGVDRGEITGASA"
FT   gene            27195..27479
FT                   /locus_tag="Srot_0028"
FT   CDS_pept        27195..27479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0028"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: CBP1; corticosteroid-binding protein; likely
FT                   Flavin containing amine oxidoreductase; one of two genes
FT                   similar to S. cerevisiae spermine oxidase FMS1 (YMR020W)
FT                   involved in beta-alanine/pantothenate biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96521"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9J4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96521.1"
FT                   /translation="MSGGLVLRLPRRDFPKLIEERARVLNEAMRLFLSAYDDECSEAVT
FT                   DEEREWCRNTRRYMDDWFGDVLSEVEQYAFPDAEDIEADRACDLAREVA"
FT   gene            27479..28375
FT                   /locus_tag="Srot_0029"
FT   CDS_pept        27479..28375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0029"
FT                   /product="ParB domain protein nuclease"
FT                   /note="KEGG: mlu:Mlut_00240 ParB-like nuclease; PFAM: ParB
FT                   domain protein nuclease; SMART: ParB domain protein
FT                   nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96522"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9J5"
FT                   /inference="protein motif:PFAM:PF02195"
FT                   /protein_id="ADG96522.1"
FT                   /translation="MTRAVPVADVRVEGRHRRDLGDVSALAASIREVGLIHPVAVTADL
FT                   RLVAGQRRLEAARLLGWQTVPVTVVASLVEAADLLRAEADENTQRKPFTPTEAEAIASA
FT                   IEAALRPVAAARRAAAIKDRDEKGRALSTSAESAEVERQPETRDIAAQAVGYGRDTISK
FT                   VRKVKDLAEDEETPEPVREAARWALGEMDATGSVAGPHHRVMCAVEAEAAPKPHPGVTK
FT                   WLESSQELKDKGYMVAFYKVLKKSGEMFQFDPERVGRLGDERDVEVVEHQLKSTQKFLD
FT                   KMRAARSGLRLIKGDQG"
FT   gene            28372..28920
FT                   /locus_tag="Srot_0030"
FT   CDS_pept        28372..28920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0030"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to U1 small nuclear ribonucleoprotein
FT                   C (U1 snRNP protein C) (U1C protein) (U1-C); K11095 U1
FT                   small nuclear ribonucleoprotein C"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96523"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9J6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96523.1"
FT                   /translation="MSRRRAKKSVWSTAHWSQRDRDEHDALVYEAWESSKRQDERTDFY
FT                   LNGLIDAEQAQRGWAVEVLAHYRRNGCANGLKNHMKRCRVPMSHDGRILSKPAVVGARR
FT                   TDEDGTRYYEQALIYYVTLPELREKQKESIALSKTYDETTAMFGKLIALCEAGGANTPA
FT                   EAAENLGVTVEGWLLGAAA"
FT   gene            28917..29114
FT                   /locus_tag="Srot_0031"
FT   CDS_pept        28917..29114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0031"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96524"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9J7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96524.1"
FT                   /translation="MTGQKKDERCAWCERAFRAHVAAGGSWASAPRVRAAQTRTHPGKG
FT                   GEPVCMEHRAEFTGVFGVLI"
FT   gene            29111..29863
FT                   /locus_tag="Srot_0032"
FT   CDS_pept        29111..29863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0032"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL2785 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96525"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9J8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96525.1"
FT                   /translation="MSGLVRIEKGRNHFYELDGERVDGVTTILSGGIPKAALMPWALKT
FT                   AAQFAVENWDELCGLGQFERVDQIKKAPWRERDEAANRGSEVHRLAERLMRGEEVTVPA
FT                   TLSGHVRSCVDFLDEWQPVPVLLECPVASRAERYAGTLDAVVDIPGEGRCLIDFKTSRS
FT                   GVHPETGLQLAAYRHADFALAGGEEVAMGGLGVERAFGVWLRPDGYSVHELRAGAEEFA
FT                   VFLSAARIARWAKTSKQVVGEALERQKH"
FT   gene            29860..30516
FT                   /locus_tag="Srot_0033"
FT   CDS_pept        29860..30516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0033"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: jde:Jden_2282 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96526"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9J9"
FT                   /inference="similar to AA sequence:KEGG:Jden_2282"
FT                   /protein_id="ADG96526.1"
FT                   /translation="MSELERTETEPEQRALSKVGQWALDAREAHQVAQSLAKTSFVPKC
FT                   YQGKPSEATAAILMGSEIGLSPMTALRSIVVIHGTPAMTAVALRGLVQSQGHRVWIEKA
FT                   SDQSVTAKGVRQGDDIVHESVWDIKRAESLGLMDRDQWRKQPKAMLTARATSEVCRLVS
FT                   ADVLLGLPYSVEELDEPEPTTTVKRKRLEPVESQSSERAEAEPAAAEEPQEEEAV"
FT   gene            30516..30917
FT                   /locus_tag="Srot_0034"
FT   CDS_pept        30516..30917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0034"
FT                   /product="single-strand binding protein"
FT                   /note="KEGG: rha:RHA1_ro03431 single-stranded DNA-binding
FT                   protein; TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96527"
FT                   /db_xref="GOA:D6Z9K0"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9K0"
FT                   /inference="protein motif:TFAM:TIGR00621"
FT                   /protein_id="ADG96527.1"
FT                   /translation="MAGDTVINVVGNLTADPELRFTPTGAAVANFTVASTPRVFDRQTN
FT                   QWQDGEALFLRCNIWREAAENVAESLVRGQRVIVVGRLKQRSFEKDGQKRTVVELEVDE
FT                   IGPSLRYSTAKVSRANRGGVSQSDEPDWR"
FT   gene            30923..31276
FT                   /locus_tag="Srot_0035"
FT   CDS_pept        30923..31276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0035"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aau:AAur_pTC10275 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96528"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9K1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96528.1"
FT                   /translation="MESSPVSLELELRELMKQRRLASLEKRDLRIKADDERREWKRAHA
FT                   VCHAFYRSKGYAVEDAKQAATADKGVMAAQQRAEHAEALAGYAADQLQDLRQEVIAVQS
FT                   LISLWKTLVENGG"
FT   gene            31280..31432
FT                   /locus_tag="Srot_0036"
FT   CDS_pept        31280..31432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0036"
FT                   /product="S-adenosyl-L-homocysteine hydrolase"
FT                   /note="KEGG: aav:Aave_4060 S-adenosyl-L-homocysteine
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96529"
FT                   /db_xref="GOA:D6Z9K2"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9K2"
FT                   /inference="similar to AA sequence:KEGG:Aave_4060"
FT                   /protein_id="ADG96529.1"
FT                   /translation="MSDQIKKADEALRAHEEAWVRRYVQLGHSLEEARAAYRAKFWAGE
FT                   VDLRW"
FT   gene            31483..31845
FT                   /locus_tag="Srot_0037"
FT   CDS_pept        31483..31845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0037"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mrd:Mrad2831_2107 two-component VirA-like
FT                   sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96530"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9K3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96530.1"
FT                   /translation="MCPAHERQLHRRGEGGLTPLGVPLWKGCVVPGCERRRFGKNMCGL
FT                   HLNRSRKGLPLDPWTRHDEKVYQSALRGVAGVFERRVAVEIEAGECRAEAERKFRVEFQ
FT                   LLASFLDDFAGEGALR"
FT   gene            31842..32357
FT                   /locus_tag="Srot_0038"
FT   CDS_pept        31842..32357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0038"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ckp:ckrop_3006 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96531"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9K4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96531.1"
FT                   /translation="MTAEFSKRARALVELRSEGRCEGEFDPRERSKRPRCLRVAEEMHH
FT                   RRTRGSGGTSDPASSQVSNALALCRNCHHWAGQCFRLAEALGICVYQAHRPDARPVLIR
FT                   GEWRLLLDDGGLTPLIRVGEDEWRFDALGGHRYPAWLVDGATPLDERYVDVSGPLDANR
FT                   YATRWAVA"
FT   gene            32357..33292
FT                   /locus_tag="Srot_0039"
FT   CDS_pept        32357..33292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0039"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kra:Krad_1758 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96532"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9K5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96532.1"
FT                   /translation="MSWFKVDDGFYAHPKVMGLSDGALSLWTLAGTWCAHQLTDGVVPH
FT                   AALSMHRGTPERAQELVEAGLWELHPKGHKFHDWEQYQPTKEQVEAEREAAKERMKAAR
FT                   AKRKAAKPVRENTEDGSRDVPENTEDGSEDVRANTDRTSGEVRLTPTRPDPSLSTDVDN
FT                   SSTSPSAQCSPAELRAEFAAFWTVYPRKSGKAKAEKAFERARRKTTVEAMTEAAGRYRD
FT                   DPNREAGFTKEAATWLNQECWNDPPLPPRFERTSAKPPPGPLDGYGAGVKSQIGWEMLS
FT                   PTPDPQAVAMAEAAGYKPPSNGHRLREVGA"
FT   gene            33289..33654
FT                   /locus_tag="Srot_0040"
FT   CDS_pept        33289..33654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0040"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nfa:nfa220 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96533"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9K6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96533.1"
FT                   /translation="MITEQEVVLVLRKISANDKRKPDQFELDEFVSAARRHNWTYREAC
FT                   AQVDAFFDIPRGGERITHGHITAGIKADRRHPKPVADVLQLEGPKPASEDNPDRQRVLA
FT                   MVRELSRKFSMPEETAR"
FT   gene            33651..34037
FT                   /locus_tag="Srot_0041"
FT   CDS_pept        33651..34037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0041"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_3778 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96534"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9K7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96534.1"
FT                   /translation="MNRMKQKGDRAEREAGRIAGASGFPWWERMKAGAERDRGDLTLCP
FT                   YVIAQVKDCKRISIPEWLRQLAQQKRNARADVAVLVVKHSIPGKAPVWSMILPYQEGLR
FT                   LLRQAGWGEPVTDEPRITEERTEL"
FT   gene            34034..34234
FT                   /locus_tag="Srot_0042"
FT   CDS_pept        34034..34234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0042"
FT                   /product="23S rRNA m(2)G2445 methyltransferase"
FT                   /note="KEGG: amc:MADE_02010 23S rRNA m(2)G2445
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96535"
FT                   /db_xref="GOA:D6Z9K8"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9K8"
FT                   /inference="similar to AA sequence:KEGG:MADE_02010"
FT                   /protein_id="ADG96535.1"
FT                   /translation="MSGNPIATTRYTVLSGPGSGPTLGELRELVAKTHDWAADSRVLIA
FT                   RSRIDQDDESWHMALLREAGK"
FT   gene            34231..34542
FT                   /locus_tag="Srot_0043"
FT   CDS_pept        34231..34542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0043"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="KEGG: tmz:Tmz1t_3243 heavy metal translocating P-
FT                   type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96536"
FT                   /db_xref="GOA:D6Z9K9"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9K9"
FT                   /inference="similar to AA sequence:KEGG:Tmz1t_3243"
FT                   /protein_id="ADG96536.1"
FT                   /translation="MSEDMWRDAAQVAARNNAGSGGRVPLLAFVDRSDMAQVGVLIAAL
FT                   VAMAWMSADGLAWDMAGVLSFAGGFLTATLVNALVFTLMVVNGRAVLRRLAVEKGAGE"
FT   gene            34539..34751
FT                   /locus_tag="Srot_0044"
FT   CDS_pept        34539..34751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0044"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bln:Blon_1294 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96537"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9L0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96537.1"
FT                   /translation="MSARKLMAGAVAVVVVIAAAGCGASNEQINPPEPQVWRLPIADGR
FT                   KVVCVSISNSSNTAMSLSCDWGNAK"
FT   gene            34748..34984
FT                   /locus_tag="Srot_0045"
FT   CDS_pept        34748..34984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0045"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: seu:SEQ_0231 Mga-like regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96538"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9L1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96538.1"
FT                   /translation="MSDELPIGVVGRRIVSIAEGARRIVEPSAYDSSPFVHDGLVIGLD
FT                   DGSELFIQDNGEYYPGFFTHWLGQSITEERTQQ"
FT   gene            35011..35331
FT                   /locus_tag="Srot_0046"
FT   CDS_pept        35011..35331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0046"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mjl:Mjls_2273 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96539"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9L2"
FT                   /inference="similar to AA sequence:KEGG:Mjls_2273"
FT                   /protein_id="ADG96539.1"
FT                   /translation="MWSDVAFTALPPGWVNVYRMDDGTYETEPCPGVLLQEATQYKECW
FT                   DEEVGGSNVLRTRRCEMDRETRTVPAEICVGNLSPACDVSNYVTTATAEEWEGQEAGEA
FT                   GE"
FT   gene            35328..35798
FT                   /locus_tag="Srot_0047"
FT   CDS_pept        35328..35798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0047"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_1817 putative phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96540"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9L3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96540.1"
FT                   /translation="MNAQELKEFIDEHMAQDWLILVNEMTGAALVADLAITSAEGFIRL
FT                   SGRITPDFYRFDPETGRLAHERYSLELMRGWRAVKPGSPEYEAAMRLNTARIKARAVFD
FT                   QLGAGDMTMIETRWPVIRAAMSNVSEAAAHIAAADEYGELLRRQETIKEAGA"
FT   gene            35795..36223
FT                   /locus_tag="Srot_0048"
FT   CDS_pept        35795..36223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0048"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mva:Mvan_3957 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96541"
FT                   /db_xref="GOA:D6Z9L4"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9L4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96541.1"
FT                   /translation="MTDGGLDFGDGVTTAPTQRWAEATTNVSELRDVWGELANHNGRVT
FT                   DLEAEVESVKAEVRARMLEAAYPSRKSLLAYMRPARWAQLAALFANLALVLWWAVVSCG
FT                   MGMSPYPGAIVCGIAICAAWIFSVEALFEALDRKGAGE"
FT   gene            36220..36798
FT                   /locus_tag="Srot_0049"
FT   CDS_pept        36220..36798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0049"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ami:Amir_5773 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96542"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9L5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96542.1"
FT                   /translation="MSDETKPFRLQDQILVLMLMHLDRIDEAYCATLDGYKVTEARAED
FT                   VDLLRMSAYLAEHADAFRDDSEAESGEIRVVEVAKGLRMLKAGDMWVTESMVEQLGRVA
FT                   FDDIKPLGKVRIPVAKHFGLANTYAIGLSKSTGCLSLASSAGTEKLSRNLCFFGDEKLD
FT                   ETQSEEAHIYAAQERAIAALPLMVLADQA"
FT   gene            36795..37106
FT                   /locus_tag="Srot_0050"
FT   CDS_pept        36795..37106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0050"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_1911 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96543"
FT                   /db_xref="GOA:D6Z9L6"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9L6"
FT                   /inference="similar to AA sequence:KEGG:Adeh_1911"
FT                   /protein_id="ADG96543.1"
FT                   /translation="MSRDEFWTGPVSFWTMTGAGFVCAALAGFFAAQGKWPLALYFAFA
FT                   AIVYLCWVKYRRVDDSRRAFEDGRRYTVDEVARMRRVLWESRPQVSYTYAPGESEESA"
FT   gene            37103..37882
FT                   /locus_tag="Srot_0051"
FT   CDS_pept        37103..37882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0051"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pst:PSPTO_1714 adenosylcobinamide
FT                   kinase/adenosylcobinamide-phosphate guanylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96544"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9L7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96544.1"
FT                   /translation="MSVTTFCSVPHSREATEDDPADALREHGGRLVVYDLNRPAAFDGA
FT                   YLCAGHLARLADLIAQTPHIVALLLSDREKSCAWGDQEGTRRKTDPPAPLSLAALDEAD
FT                   KEFAVLQSWAENHRDSTGLVPPRIQHLWKRGGAGEVIGAKSGHVRLCHALVGYLLTDPN
FT                   VLASQEWAGEMLQELADMRARRRPRWRLVDEPTPTGYPCLKCGGRTMLFRPPIDQFDPC
FT                   LVQCPGCGFTLEREQFDRITTVIEDGKTPRGRVGSDA"
FT   gene            37879..38100
FT                   /locus_tag="Srot_0052"
FT   CDS_pept        37879..38100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0052"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lsp:Bsph_1148 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96545"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9L8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96545.1"
FT                   /translation="MNALLDVDVPEFVTVERAVRATGRSRRTIYRWKESGAVRWRMFEG
FT                   KLMVEVNDADEAKLRCSDARRANLRRKR"
FT   gene            38249..40009
FT                   /locus_tag="Srot_0053"
FT   CDS_pept        38249..40009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0053"
FT                   /product="protein of unknown function DUF1023"
FT                   /note="PFAM: protein of unknown function DUF1023; KEGG:
FT                   rop:ROP_19500 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96546"
FT                   /db_xref="InterPro:IPR010427"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9L9"
FT                   /inference="protein motif:PFAM:PF06259"
FT                   /protein_id="ADG96546.1"
FT                   /translation="MAALGDLATSLASRASSLEEARAQFAKITQFPGWSGTAKDAAAGS
FT                   FQRADASLLDDVARVSAVHQAVLELSADFAQLQARVRELEREAASIGAVLGDDGKVTFP
FT                   EGAPWPDATQQHRALVIGGEAYELMTDADRLDEKAGEVLRKAVGGEINAAGTGNETQAA
FT                   LAGAAQGTLGMPEPPKAPGGHADPSYNAGWWKDLTPEQRRRVLDLHPEWVGNLDGVPAS
FT                   VHDEANRKMLPGDIARLQAEVDRLQKQLDSEFGHGAFSNTDSDLWYAQRRLEGLQATEK
FT                   ALRDNPGTKLLVLDPDYGTRGRVAIGTGDPDTANHISISTPGVNSSPGQSIGEMTKEAV
FT                   ALKTETENVLKANGHGNETVSTISWIGYEPPQAQLDPQHLDKTGDVGPGGLRDEPGGLS
FT                   DVASDAKAKAGAASLSQFYEGISAAWHPADGDSATSPHITALGHSYGSLTTSLALQQTQ
FT                   TGVVDNAVFYGSPGLELPSLDRLPVATGHAYSMQAPSDPINYVPNLTEHYGPNPVEIPG
FT                   ITRLSTEAGDTTGDAAPGTTVHHDGAHGHSEYPRKGDNGQLRMPGYNMSVIVAGMTGQD
FT                   GRPDLTKRGE"
FT   gene            40017..40673
FT                   /locus_tag="Srot_0054"
FT   CDS_pept        40017..40673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0054"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mul:MUL_2139 lipoprotein LppV"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96547"
FT                   /db_xref="GOA:D6Z9M0"
FT                   /db_xref="InterPro:IPR032018"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9M0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96547.1"
FT                   /translation="MTYPVEKRSWLRRRAAWLWAAGVVVLVGVVLVCGVGVFRFVEVLK
FT                   GMDDAPRHMAQEKVPAFEERYRDKGSVQQAAEDLEAVIARAADKIAALVPGLTWKWQYD
FT                   PGNIGCPADAASDTRVTRFATRLAGFDGAIPEDVWPRAVAIVRSEAEFLGMTAQFKYQD
FT                   AAKQHDLVFSSQDGGEIRIATAVEAFIRGKTPCRLMEDWYTDRNIPIPGTGKEPR"
FT   gene            40670..40990
FT                   /locus_tag="Srot_0055"
FT   CDS_pept        40670..40990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0055"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_6962 methyl-accepting chemotaxis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96548"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9M1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96548.1"
FT                   /translation="MTADGAPAGAGQRIEVALEELHAGASQLHDLAQEATSKLASSDLM
FT                   LETSSRALKGLKSAIEFAAYAEFETARGKSAIETITAAAENVGYAAEHYHGTDESNAAS
FT                   LG"
FT   gene            41205..41459
FT                   /locus_tag="Srot_0056"
FT   CDS_pept        41205..41459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0056"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aau:AAur_0477 putative
FT                   choline/carnitine/betaine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96549"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9M2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96549.1"
FT                   /translation="MPSLDALRDEIDRAVTAYVAQSRAEDGDSPGLPGPWVVAVGSQSI
FT                   DDDGETIHTIEPVGQPGWVTKGLLLSTQELLRAEYQERE"
FT   gene            41512..41895
FT                   /locus_tag="Srot_0057"
FT   CDS_pept        41512..41895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0057"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hoh:Hoch_5303 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96550"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9M3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96550.1"
FT                   /translation="MSDTTALPVKGRTLIVANLQTKKALQIGLGPEVTITSTLRVPDGF
FT                   GPNAPEPRQLHIAVGGDSEAVNSARAALSPEEGDMIAVQDNTDDSVPAWFALSRETITR
FT                   AADGQALWSIEGVSMYDLRRARA"
FT   gene            41892..42371
FT                   /locus_tag="Srot_0058"
FT   CDS_pept        41892..42371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0058"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpc:RPC_2792 silent information regulator
FT                   protein Sir2"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96551"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9M4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96551.1"
FT                   /translation="MSKRIAPSRPGVDFLIDGELHKVPRSAMLEPYGAARLQDGSMVYR
FT                   FMAERLPPGLTEAVKNSAHAVNIREHDAIRGHGTLRYTEPLWVTTVVEERGVTTFKAVF
FT                   TQIERHILGWPTRDLWVSAQAAPVSCRPRGGCSSRRGLWPRSLVGPFRALGTRSC"
FT   gene            complement(42274..42642)
FT                   /locus_tag="Srot_0059"
FT   CDS_pept        complement(42274..42642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0059"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gbr:Gbro_1107 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96552"
FT                   /db_xref="InterPro:IPR025240"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9M5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96552.1"
FT                   /translation="MMRFTAALVALAASFSFASPAFAYHARWGAIAYDRQGNATAATGA
FT                   SSGNYAMLAAKDKCGPRCGTYPFRGCAAIAFTRDSVNGRRGYELAASSSASRAREMARQ
FT                   GCEATSRADCYIRLSVCN"
FT   gene            42807..43085
FT                   /locus_tag="Srot_0060"
FT   CDS_pept        42807..43085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0060"
FT                   /product="HNH endonuclease"
FT                   /note="KEGG: snm:SP70585_0056 HNH endonuclease domain
FT                   protein; PFAM: HNH endonuclease; SMART: HNH nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96553"
FT                   /db_xref="GOA:D6Z9M6"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9M6"
FT                   /inference="protein motif:PFAM:PF01844"
FT                   /protein_id="ADG96553.1"
FT                   /translation="MGVPRSTTKRDADRKTIARGKPPCGICGGEIDYALPHTDPASFVA
FT                   DHIVPLNKGGADVLANKQPAHRDCNRAKSDTAVTDLRRRYVTERAWA"
FT   gene            43082..43267
FT                   /locus_tag="Srot_0061"
FT   CDS_pept        43082..43267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0061"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: acr:Acry_0583 riboflavin biosynthesis protein
FT                   RibF"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96554"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9M7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96554.1"
FT                   /translation="MNETEPRATLTGPPTTSTIFYPANSEHPAFKIVLVEQAGAWEAES
FT                   VEILDRHPVQEPDSGT"
FT   gene            43504..43767
FT                   /locus_tag="Srot_0062"
FT   CDS_pept        43504..43767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0062"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: blj:BLD_1160 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96555"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9M8"
FT                   /inference="similar to AA sequence:KEGG:BLD_1160"
FT                   /protein_id="ADG96555.1"
FT                   /translation="MSRGSSRHQVLGPVARAVETGSEIDRLNALQARLAGAIDDEGTPP
FT                   RDLAALTRRLQDVSERLDSLMSEKAEQVAAIVEDERWDGSAI"
FT   gene            43751..45166
FT                   /locus_tag="Srot_0063"
FT   CDS_pept        43751..45166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0063"
FT                   /product="Terminase"
FT                   /note="PFAM: Terminase; KEGG: bln:Blon_1811 phage
FT                   terminase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96556"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9M9"
FT                   /inference="protein motif:PFAM:PF03354"
FT                   /protein_id="ADG96556.1"
FT                   /translation="MARLSEVARHLVVPEGIVSTEWPRVRAKCSELGLGFDEWQDGLGR
FT                   LMFSKREDGLYACDTVVVSIPRQVGKTHVMMSALFALCLLRAGLTVLWTAHRVKTAKET
FT                   FGSMAALAARDSVRPLVAQVVRGRGDEAVLFVNGSRILFGAREAGFGRGFADVGVLAFD
FT                   EAQILGESALDDMLASQNVAENPLTLFMGTPPRPKDPGEAFTMFRQEALDGESEGTLYV
FT                   ELSADRGCDVEDREQWRKANPSYPHRTSERAMLRLRKNLLEDSFRREALGVWDEVSTHQ
FT                   AVVKDSVWRALRADGPESSVRPHALVVDMSHSREVSVGACWLDGDCAHVEEVWAGVSGS
FT                   ECVEWVAANVGRRVPVGVDSASPASSLVPELRRRGVRVVVTNASDMAKAFGMLMDRVAA
FT                   GSLSHANQESVNQAVAGARRRPIRDAGGYGLDRRDETANIAPLVAVMLSVLVAVTHGRR
FT                   KSVVSSGRGGFVL"
FT   gene            45163..46566
FT                   /locus_tag="Srot_0064"
FT   CDS_pept        45163..46566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0064"
FT                   /product="protein of unknown function DUF1483"
FT                   /note="PFAM: protein of unknown function DUF1483; KEGG:
FT                   rer:RER_22740 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96557"
FT                   /db_xref="InterPro:IPR021145"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9N0"
FT                   /inference="protein motif:PFAM:PF07360"
FT                   /protein_id="ADG96557.1"
FT                   /translation="MTVFAEAPRVRGLTDDEQRLLGRLFDELTRRAGRNQSRSRLYEGK
FT                   YAVKRTSTIPPEYFRMGIVLGWAAKAVDILARRCNLDGFTWADGDLESLGSREVWSENL
FT                   LGTESDSGVVSSLIHGPAFLVNTAGEAWEPKALIHVKDALNAVGDWNPRARRLENLLSI
FT                   TDRDEEDRVTGFALYMDGLTVSAARDSSGWAVERSDHKFGVPAEPLVYKPRAGRPFGSS
FT                   RINRAVIALLEQATRVAIRMEAHADTFSFPEFWMFGATLADLAGGEKNPNPWRVRMGRI
FT                   KGLPDDEETGVRAEVHQFPAASPQPHVDMFEHIAGQFAGETSIPVESLGLVNRANPTSA
FT                   ESYIASREDLIAEAEGATDDWSPAFQRSFTRALAIRNGLDSVPAEWVTIAPKWRSPIHL
FT                   SRAAQADAGSKQLAAAPWLADTEVGLGLLGLDEQQIRLALSQRRRAQGSQALAALTARA
FT                   RGTADAAGE"
FT   gene            46550..47233
FT                   /locus_tag="Srot_0065"
FT   CDS_pept        46550..47233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0065"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: jde:Jden_2308 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96558"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9N1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96558.1"
FT                   /translation="MPLASDAEQMRASLVGLSGMLEDEARSLAADDSGSLAGSAAKAWI
FT                   GSRLAVGIGGLIEEYAGAAQAVAADFYDLARGALALPGRFTAFVPDPGTFGPDALTGWA
FT                   ASEATSFTAFESLVVGGASRRVMNAARDTTMANALADPQCRGWMRIGAGECDFCRMLIA
FT                   RGDVYTSESVRFKSHDHCKCQAAPVWDESNVVELREKYVPSARFKTEAARRRNNEAVRA
FT                   YLSAQ"
FT   gene            47285..47761
FT                   /locus_tag="Srot_0066"
FT   CDS_pept        47285..47761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0066"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lxx:Lxx03900 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96559"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9N2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96559.1"
FT                   /translation="MSEPIVEAAEAPETEADEPKPKQTETVDFWKSKARDWESKAKSNK
FT                   SAADELAALKDSQKTEAERAAEKLANAEAEAATVPVKVAGALKAHLVALHGISDEDAEL
FT                   FLTAQDPELLLKQAARLVGNQSGVKGNKVPHEGANPRPKPNSTSEFLGALTGAG"
FT   gene            47788..48696
FT                   /locus_tag="Srot_0067"
FT   CDS_pept        47788..48696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0067"
FT                   /product="phage structural protein"
FT                   /note="KEGG: bln:Blon_1815 phage structural protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96560"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9N3"
FT                   /inference="similar to AA sequence:KEGG:Blon_1815"
FT                   /protein_id="ADG96560.1"
FT                   /translation="MAALQSTDLFLPTQIADGIVERAKTGSTVAALSAQEPMRFGKVEI
FT                   ITFDDDLTAEFVEESAPKGADSAKPSHVTAVPHKAVVQMRTSDEFKWADEDYQLGVLGK
FT                   YQEKCARALARGLDLGLYYRTNPRTGNALTAWTNYLNATTKRVEITASSQPDIDFETAA
FT                   GLVIGDGHSVNGVAFDPKHAWKLSTARYADGRKKYPELGLGANLSSFEGVTAAVSSTVS
FT                   GKAKDGDATDNKVRAILGNFQSGIRWGVQRNFPFKMLEYGDPDNTGKDLAGNNEILFRT
FT                   EIVYGWYVFTDQFAVIEDAAA"
FT   gene            48841..49308
FT                   /locus_tag="Srot_0068"
FT   CDS_pept        48841..49308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0068"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cur:cur_1418 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96561"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9N4"
FT                   /inference="similar to AA sequence:KEGG:cur_1418"
FT                   /protein_id="ADG96561.1"
FT                   /translation="MPAVTITPADLAPFAVIEEPKALAMIADALAMARLVAPCVDKDDF
FT                   PFADAAKAVIRGAILRWEESGSGAISQQTAGPFGQTLDTRSPRRGMFLPSEIEQLQKMC
FT                   RNASSSGAFSIDTAPNGGGVWHDDACNLAFGASWCSCGANLTGDGPLWGTA"
FT   gene            49305..49646
FT                   /locus_tag="Srot_0069"
FT   CDS_pept        49305..49646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0069"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96562"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9N5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96562.1"
FT                   /translation="MSLPQPHTVQHRRKTKGGYDDQGYQIEPGFSEPVERRVIAVYWER
FT                   PAEAVVGDSPERDRDELVVLTGEPEAYGDGDLIEAAGLQYRVIGPRDWRMGPFGFKPGG
FT                   EVRCVRRDG"
FT   gene            49647..49955
FT                   /locus_tag="Srot_0070"
FT   CDS_pept        49647..49955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0070"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: formin homology 2 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96563"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9N6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96563.1"
FT                   /translation="MGRIDWNREGFRELRKDPALVAHLKTIAEDAKRDLDAELHGAQTN
FT                   RGQREASGYRADVAVGRTRARGYVGTETARAMAHEQAHDSLLKWAFRNGGQSPKRKG"
FT   gene            49959..50357
FT                   /locus_tag="Srot_0071"
FT   CDS_pept        49959..50357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0071"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cur:cur_1063 NADH dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96564"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9N7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96564.1"
FT                   /translation="MAVYRPPVAGEVRAHLARGLSARGASFGWFSSNPNPRPTDGRWGV
FT                   CSQIELRDVQRVESESLLRLVVIDPDERRGERSASLALALIEAAHRTAAFSFHELYSGP
FT                   ARYQDPDDPRVFGHVMRLSVTRAGEPFA"
FT   gene            50395..51042
FT                   /locus_tag="Srot_0072"
FT   CDS_pept        50395..51042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0072"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spm:spyM18_1465 putative structural phage
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96565"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9N8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96565.1"
FT                   /translation="MTNPTTPATGKDYFGYGDVRNIFKPQPDSEKTVGGLFVGPKFIDV
FT                   AEALDLDAPVLESLKQAGYLTVEGIRVKQDRPGKAINAFGGDELDYGQTSFSLTVAFDV
FT                   LEYFNDDAQRLAYGKNNVTVTPATTSHGKRTLTKITAKQLDEVSLFILLVQGDKQARYL
FT                   APFARVTEVGEEKHVHDELVSTPLTARCFPYQGAVLHRNVDDGMKLPAGLAA"
FT   gene            51039..51371
FT                   /locus_tag="Srot_0073"
FT   CDS_pept        51039..51371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0073"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to armadillo repeat containing 9"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96566"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9N9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96566.1"
FT                   /translation="MSAAKGRGAKAEKPAPVPGDLDFDWSKVYPEGELFEYESGGVKVV
FT                   IPVFEKFSADWYRRNRRLSNEERFYLHLERSAKPETFEAADRLSHDGYAAWLTAWGEEM
FT                   MSQLGK"
FT   gene            51380..51763
FT                   /locus_tag="Srot_0074"
FT   CDS_pept        51380..51763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0074"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ckp:ckrop_1599 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96567"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9P0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96567.1"
FT                   /translation="METLHRHPFAARRDLLALGLRWENLWDGTLDVLDVAALAVAAPPH
FT                   SALFHALTEGWDVNAHLTADLVYLSELGLWARTKDAQSDFPRHKPQPVPRPGAAREHGP
FT                   TQADFENFHDAVDRRARGGDQSL"
FT   gene            51744..55466
FT                   /locus_tag="Srot_0075"
FT   CDS_pept        51744..55466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0075"
FT                   /product="Phage-related protein"
FT                   /note="KEGG: ami:Amir_3249 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96568"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9P1"
FT                   /inference="protein motif:COG:COG5412"
FT                   /protein_id="ADG96568.1"
FT                   /translation="MATNLSDVYVTIIPETRRVGEAIRAAFRDAEREAKLSSERMGRDL
FT                   DRELGDVHVTVKVGADTKRARREVDELKTHGQRAGEAMGTATGLAFGKMFSAQLGLVKF
FT                   ASLGAAGGLALSGLGGSLASIVGVASRASGALALVPAAAMGAAASVSALKLGVSGLSDA
FT                   FKAMEDPQKFANALQKLSPAAQESAKAVYALKPAFDSMKNTVQDSLFAGLAPQITQLGR
FT                   TYLPVVQQGFAGVAGAANQAGKSVAAWAQTPEAVGQVNKLLGNTTAGMNILATAARPAV
FT                   QAVLGLGAAGSDSLPRLSQAVADVSNRFAGFVKNASESGRITEWIDAGLTSLTQLGHAI
FT                   GAVGSVFATVFKAGSAVGGGMLGTITQVADKFNDFLKSADGQAALSGFFTGISQAAAAL
FT                   APILGTLAQIVGTTIVPALSNLGTAVAPALNGMLQGLGAGLNAIKPVFEQLSGPLSQIG
FT                   QVIGDVLAKTLPILAPALVPLAQAFADLLSAIAPLIPPIAQLASMFVQAVAPALSVVFQ
FT                   ALAPVIQQLMDALKPVLDQLGPVLAQVAQTLAGLLVQAIQELLPPLMPLVKSFADFLAA
FT                   VLPLLPAVVKVAAVIAGALVKAMAATLPLAVSVVKAMVDFSTKIANFVVPWVSKLADGF
FT                   GWLGDKVKSLIGWFSGVKDAAGEASGSVSSFASATPAPFAFPQTSGGVPGGGEPSALAN
FT                   RLRRSAGTPEGMDRAEAGRLGQSLAASATPDANGSLLADASRLLADYATGKGDQDAVAR
FT                   AAELIDQASKGGAYVPDSDPPPPAVPLPPVPAPLPVPAAPVLPAPSAGKGGKAPALAPI
FT                   TMADLDKYDTPGLETGAPVTVAPGSPARAEQSVPATMGVDVYTGMGQTGGGSGAQQGID
FT                   FAHSMTGTAYSQQVFGRIGIDCSGMVSATVNAAEGKDPFSSRMSTVNEGEWLKAHGAVE
FT                   GMGGPGDLSIGWWNKGSSGGNNGHTALTLPNGENVESGGSHGVVAVGAGAAGAGDKQFD
FT                   HHMHIPKELLGSVPTAAGYAPALSGASGDWRSRTADRAVQNAQDSVKDHQWRVDQAKRR
FT                   MIEAKTQQQRDMAEHALIVAERELAKSHEKLRDAQDKRAETMAKARQKGQRGGSDGAED
FT                   FGHSLVSGALSGLGLDGSLLDNPLEWSGVKWLTSMVNGFTKPAQGQQGRYGSDGAALPG
FT                   FGPPASDPAQLASLGAQGLSQGFGADSGSQPSPAQVDQSINLTGQFGNPNDTARAMRAE
FT                   MDNRNRAFSMNAGRM"
FT   gene            55466..56728
FT                   /locus_tag="Srot_0076"
FT   CDS_pept        55466..56728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0076"
FT                   /product="bacteriophage protein"
FT                   /note="KEGG: mab:MAB_1797 bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96569"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9P2"
FT                   /inference="similar to AA sequence:KEGG:MAB_1797"
FT                   /protein_id="ADG96569.1"
FT                   /translation="MAYQRTDMTQYPSQHPDLRTPQGDYPPFGRPLTEYFQSWENVPPV
FT                   LRSDQLTVIYVGVPDERGVRAMWHLAGPRRGLEGVALATDLSGLVMPEFERAWHESAWM
FT                   TGAVPGHLSWPKRLLNLGVHISAPRLPRTILAADGRLERLVASSSADRYRLTHQLWWNS
FT                   FSMDADGDLLCFTRTTGFRNLKVRLAKAPAGTLETDPAAFGNNRITVDLPLVASDPFFA
FT                   SPASMGTWRNNEDTATPLDALEELVRKVIPDADFTFAKTALALVAEALGNLIPGIDVGQ
FT                   GHIAVRNDGDVPAWPEYVIHSGSGGFCWLPDGDRMVMLPRLLPTDGKVLVSTDPSKKTF
FT                   TAENEPVDIGFLGVVARSQLLDLVLKPFLEATEPLWRRGAEVFFTKPIPPKTTVQLPVR
FT                   HSNENAVITARVPQRHYGPGI"
FT   gene            56728..58500
FT                   /locus_tag="Srot_0077"
FT   CDS_pept        56728..58500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0077"
FT                   /product="bacteriophage protein"
FT                   /note="KEGG: mab:MAB_1798 bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96570"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9P3"
FT                   /inference="similar to AA sequence:KEGG:MAB_1798"
FT                   /protein_id="ADG96570.1"
FT                   /translation="MPSWAVSPESLASTALSVMTTLVVGPEDDGAPRCDYLKLSARRDA
FT                   RLAQLSQAPMVRIWDHQMRLVGQVQVESLSADELLRDTGTCQFRFPLDSHVARWLRNGR
FT                   RPDSDVHVTIDPIPTERTWRDRWGGKASLVSFIRAEDGREWCEVKAAHHFEHLKHIIYR
FT                   NNPITPPEAQGVRFWLLPGPTRSVVYWTTLLALAQQFFPPLTLVDSFADPLRWATINPL
FT                   DLSPLNWPVQPQFVNPLLDQSMFTVLTASFQNAHAATADVLKASGCHIRAYTWLPEDKD
FT                   SPHPELEALIGPLARPSRACVVLACEDLSGVTGPTGTIFDSVLSFGAKLLDDSLTEVLL
FT                   PLDLDGDGRTDPFFRALTLTAPARPKVVFRDGDQTGVIESSYSHAPATAHTVSTGKGSP
FT                   PLLNDGISFGVKYGLSRLQDLLQGGQLGGTWQVPGTPGLDELYQGQLSNRFLTHKAWTD
FT                   ALRALRSGDYAYIAAHEQSAVGYSVAGALAIQSGLHKNRPRTTKHVRVRNGAPHWVGRD
FT                   YTLGTRVLHEHGGVLFADQTGALGIRMDPDGLVTRPVQIGEDDDEENPVASALRAVQGI
FT                   WGAIGAFGGADGGI"
FT   gene            58500..58751
FT                   /locus_tag="Srot_0078"
FT   CDS_pept        58500..58751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0078"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpi:BPLAN_456 DNA-directed RNA polymerase beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96571"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9P4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96571.1"
FT                   /translation="MDDEEEVKALEAACRAVPLASGAVLDLRLFAKEIAEHLFAEGCRK
FT                   RAERVEREFPERFLAVPDKLLGGWSQPCEVVDKRSEER"
FT   gene            58751..59812
FT                   /locus_tag="Srot_0079"
FT   CDS_pept        58751..59812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0079"
FT                   /product="bacteriophage minor tail subunit"
FT                   /note="KEGG: mab:MAB_1800 bacteriophage minor tail subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96572"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9P5"
FT                   /inference="similar to AA sequence:KEGG:MAB_1800"
FT                   /protein_id="ADG96572.1"
FT                   /translation="MADVPQPGDKVYMFSADARMDFQGIVLDPDVPLNMAATMQMVGMN
FT                   GVVTFPVLVGRQGPPGVDRPIIKLIYDPQIDDASKLPQLTNTPEDVQKGYVIGSLCHWW
FT                   DGRQWRGIQLGVPGPSGPVPIISWSVVLLDPDGSEESNVKVTGSDAAPGVQLRLKVPKG
FT                   PKGDSGSIRLASDYDDATPPAVGDLLTWTPEKKWAPRSLGKEDVAYYTVPQSQFKAQSL
FT                   VVGANVPVGSFTIPKQSFDWKPWVSGCVKITGAELDLDPFSSRIEVRKDSMDGPLCAVG
FT                   FGTPTTMTVVSPHFSSPGNKTAAVNANNDAMRCEAGKDAVFHVVIAMDQGIGGVYSYNP
FT                   DWTEFHVECKRVN"
FT   gene            59814..61079
FT                   /locus_tag="Srot_0080"
FT   CDS_pept        59814..61079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0080"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96573"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9P6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96573.1"
FT                   /translation="MPRAHQTAPVEIDKNPEHRLGVNAHKDPVDLQKIAQMQVQGLLNA
FT                   IKLFTGLDLADPGKLLESVVSGAAGFAGAVLNALTSALGFDLSAKLREFEQALEEVPVL
FT                   GDIVKALTGKAGGAGDLEAWAQSLPAQAEQAAHDAIAQVNTLVGELAHGAETVGQTLAD
FT                   TIGSVVDLLAGTHQQTQDNTAAITALSTIAPTNVVTSLASSTDPNDIPAFDRILMVPIA
FT                   ATASAGAHTHTYSSGGTGQGTTSTAGAHTHAIGSDAWGYAPEDKELVLVFIRSDRKQSV
FT                   NAVKVITAVTGWSLGGVSTVQLSLHAYSQPDAALKLLATTSNQKDVITTAAQEYAIGLG
FT                   STFDVLPGHVLAIGVWQQVNLFGATRKLAGIPQVGVKPRTGAPVKTILGKITGQSSIPA
FT                   TIKLSDVAWNYNAAVWGALTLA"
FT   gene            61144..62403
FT                   /locus_tag="Srot_0081"
FT   CDS_pept        61144..62403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0081"
FT                   /product="glycoside hydrolase family 25"
FT                   /note="KEGG: rha:RHA1_ro08409 glycosyl hydrolase; PFAM:
FT                   glycoside hydrolase family 25; SMART: Glycoside hydrolase,
FT                   family 25 subgroup"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96574"
FT                   /db_xref="GOA:D6Z9P7"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018077"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9P7"
FT                   /inference="protein motif:PFAM:PF01183"
FT                   /protein_id="ADG96574.1"
FT                   /translation="MTDPYGLPVGSDVRQGARGFPEWVYALGAAFGLDASTYPGHQERA
FT                   GLNQGIDWWPKGRADMTGASYTPAQRLALGRFALWAGTQPGVEQVIWCDPVSGVKTGFF
FT                   MGERVGPGTAQPGYYRDDWSGHTGHVHTRIVRALAAPDDIGQEGNSMPLWGVDISNNNG
FT                   AVDLAQVKAEGFDFVAAKVTEGTGFKDSYWPRNRDAARANDLILIGYHYVRDGDAEGQA
FT                   ANLAAHIGDTSVPVALDFESGSGGYANFQAVKSAVERRGMRVALSYIPRWYWQRIGSPD
FT                   ISDAPGLWASAYVNGTGYASVLYPGDEWSGWQPYGGGEPKILQFSSSAHVAGKSVDVNA
FT                   FRGAREELLSLLGATAPAQPTASLDQLVLDQLVGPGFHGWPQLDNKSVVDFLASWREEQ
FT                   RTANKAMADALALLLKGTTQ"
FT   gene            62400..62756
FT                   /locus_tag="Srot_0082"
FT   CDS_pept        62400..62756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0082"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: SORBIDRAFT_07g002060; hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96575"
FT                   /db_xref="GOA:D6Z9P8"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9P8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96575.1"
FT                   /translation="MNVISLPYKWRVALYQVLKLASAAVGALFVIAPLFGWELPNTKLD
FT                   ALDQLVFAVVSLLGLGAGSVATEHAKISTDGPLPDPRAQAPQPDPMAVAAQTVAMTIEG
FT                   VLAQLERLAKPQGE"
FT   gene            62756..63031
FT                   /pseudo
FT                   /locus_tag="Srot_0083"
FT   gene            63031..63237
FT                   /locus_tag="Srot_0084"
FT   CDS_pept        63031..63237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0084"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: abn:AB57_1256 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96576"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9P9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96576.1"
FT                   /translation="MRWPWQLRESVEFDGEDLDRRVREAQHAKDRADKLREEAAPLVAL
FT                   ARRQRRENGFGAAVERTMRRRHA"
FT   gene            63230..63589
FT                   /locus_tag="Srot_0085"
FT   CDS_pept        63230..63589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0085"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nfa:nfa15470 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96577"
FT                   /db_xref="GOA:D6Z9Q0"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9Q0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96577.1"
FT                   /translation="MRSRESAVGAASAAAVAAASWRWLGWGRVDDALLTAAALASVLFS
FT                   LMYWRQARGYMNRAGRAVLWVLAALSAVLAQNTLSVWTEQDYPGRDLVRTVLYGALLFT
FT                   LARLTATALAYRKKH"
FT   gene            complement(63716..64015)
FT                   /locus_tag="Srot_0086"
FT   CDS_pept        complement(63716..64015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0086"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_2756 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96578"
FT                   /db_xref="GOA:D6Z9Q1"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9Q1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96578.1"
FT                   /translation="MNDKTKTEKTPPADSPISFFWCLLASGTLILLGFTLESKFGFILL
FT                   VSLGVGVYLFRVDERWRNAGRGVIAASLAGMVFYFGWPVFYISIPAAFLSILHH"
FT   gene            complement(64012..64293)
FT                   /locus_tag="Srot_0087"
FT   CDS_pept        complement(64012..64293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0087"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ami:Amir_2455 protein of unknown function DUF6
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96579"
FT                   /db_xref="GOA:D6Z9Q2"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9Q2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96579.1"
FT                   /translation="MPTIRFPAVSWNAATWSAPILTAVCEILYSLIRYFLPHEAASQRP
FT                   ALIMTCLIMACAGLLLPLIKRTPLWRGAAIGCLIVPVALAVLRENVTF"
FT   gene            complement(64298..64633)
FT                   /locus_tag="Srot_0088"
FT   CDS_pept        complement(64298..64633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0088"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_4137 amino acid/peptide transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96580"
FT                   /db_xref="GOA:D6Z9Q3"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9Q3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96580.1"
FT                   /translation="MNQRDRESDDTAPAQRLHGPESFAALVLTSAALMAVAALHMAWYV
FT                   PTVLILFLSGLAMSLTTGKQRKIGMGMLAATVSALLLRYVFWLFLYTIPGMFLALFSTK
FT                   DATHIQW"
FT   gene            complement(64630..64902)
FT                   /locus_tag="Srot_0089"
FT   CDS_pept        complement(64630..64902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0089"
FT                   /product="protein of unknown function DUF81"
FT                   /note="KEGG: vap:Vapar_3543 protein of unknown function
FT                   DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96581"
FT                   /db_xref="GOA:D6Z9Q4"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9Q4"
FT                   /inference="similar to AA sequence:KEGG:Vapar_3543"
FT                   /protein_id="ADG96581.1"
FT                   /translation="MPSIKLPAVSWAAATWSAPVAVCACLTAITFLVNLQPPGSKSLTF
FT                   PLLCGIVSTLSLLLWVFVRTPTARGVALGIFGVPFVLAWFVWLTQ"
FT   gene            complement(64902..66164)
FT                   /locus_tag="Srot_0090"
FT   CDS_pept        complement(64902..66164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0090"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0088 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96582"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9Q5"
FT                   /inference="similar to AA sequence:KEGG:Mvan_0088"
FT                   /protein_id="ADG96582.1"
FT                   /translation="MGQPLNASQETMLAHAEQTEQMALMLDGTIAFDPSVFQGMMTTAL
FT                   GPIGAPFIAAFMAAITNQHINAQEAAAALHAHAQATRESALQYETTDELNAAELAADKD
FT                   LAEELGDQLDSVKKEADKFEPFKQDPGEIPDRGSHHGVDPDQFQHVYGRLPQSDADWKM
FT                   AAIMDTHSMVGRNHGVPARVDVGRIKAVPGQGIVRVGLYIPATDVFNMPNDLGDARGPK
FT                   EQFDPRQTRVSLYIDYENGVVAARQNPSVDIQGKTEVQDPVIDVQQTTDGRVRIHYDAT
FT                   NPLAPFFSHAAGLSVNGEITLTPTANGVHIDGQVGDYPSMEVYQDRNGTTTTAYAYQAT
FT                   GSEFGPMENLPKSHPVGNGPTGSIQEYQPGLQWDGPGIPSNRPQVPVPDESMTLAPEDG
FT                   DSPPQLNPVAPQQPPAMRGDI"
FT   gene            complement(66247..67296)
FT                   /locus_tag="Srot_0091"
FT   CDS_pept        complement(66247..67296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0091"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: mpa:MAP2752
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96583"
FT                   /db_xref="GOA:D6Z9Q6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9Q6"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ADG96583.1"
FT                   /translation="MAPRQNERRLRAVPHPLQDDKKSAPCPSRIDNQGQQEVNSSLTDA
FT                   NIPAVLSPVNVAGTHHAHNVAMLLVQEWELFMLARRLSQRTITERIRVIKSFASSIGIE
FT                   PSQASALDVARWLAQQSSLGQSSLATYSQYLKAWFKWLQVHEHRTDDPMVKVGTVRYPD
FT                   RAPRPVSDRDLARLLETVNRKRTRLMVLLYCLAGLRAFEIAKLRGEDIVDGVFVRVLGK
FT                   GNKERLVPLHPILQAIAPTMPERGWWFPRDSRWPGMHISGKSVSQTISLTMRRAGVRAT
FT                   PHQLRHWQGTTLLDEGVDIRVVQEIMRHASISTTAQYTQVPTHKTSEAVSRLNPFRGAE
FT                   TKLTVALAG"
FT   gene            67372..67447
FT                   /locus_tag="Srot_R0004"
FT                   /note="tRNA-Lys2"
FT   tRNA            67372..67447
FT                   /locus_tag="Srot_R0004"
FT                   /product="tRNA-Lys"
FT   gene            67557..67631
FT                   /locus_tag="Srot_R0005"
FT                   /note="tRNA-Thr1"
FT   tRNA            67557..67631
FT                   /locus_tag="Srot_R0005"
FT                   /product="tRNA-Thr"
FT   gene            68434..69720
FT                   /locus_tag="Srot_0092"
FT   CDS_pept        68434..69720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0092"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ach:Achl_0532 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96584"
FT                   /db_xref="GOA:D6Z9Q7"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9Q7"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG96584.1"
FT                   /translation="MTSLARSIAPLKGRDYRLLFLSCVISMLGDGVWLVAVPWLAIQNG
FT                   ADSAGVGAVVGAESVGLICFVLIGGVLTDRFSRKLVVGWSHCASFIVLAALGAITVTGS
FT                   MRLWHLALSAFLLGAAAAISGPATDALVPDIVPSDDLHAANALESMARSVALRIAGPTL
FT                   GGLLVALLPSVSVIAVNAASFFAAACCVALLRTARANPAASAETEAGGETKVSGRQFWR
FT                   YLYGERWLWVLILWAGVLLLLQTGPRQVLLPLLVHDRFDKGASSYGILIAASGVTAILA
FT                   SLYIGSRALPPNYPRRMLLAWMAGAVPLAAMVFVPSFWWLLPLMGVYGFFSTIGNVYWF
FT                   TLLQIHVPDEVRGRVISVDWLGSLALVPASAVLAGASQSPTYATSLFVLGGTLPVLFTA
FT                   VLLARVRMPEAKSAETATTKMFEDGVVVS"
FT   gene            69928..71202
FT                   /locus_tag="Srot_0093"
FT   CDS_pept        69928..71202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0093"
FT                   /product="Arsenical pump membrane protein"
FT                   /note="PFAM: Arsenical pump membrane protein; KEGG:
FT                   sma:SAV_7477 membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96585"
FT                   /db_xref="GOA:D6Z9Q8"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9Q8"
FT                   /inference="protein motif:PFAM:PF02040"
FT                   /protein_id="ADG96585.1"
FT                   /translation="MSAFGAEAVAFLLLLAVLVFAVARPKGLPEAAAAVPAAGLAVLAG
FT                   TVSWSEAVAESAGLLPVVGFLAAVLVLAELCDAEGVFRYCGSVMARGVADPVGLFGRVF
FT                   LAACAVTAVLSLDATVVLLTPVVFSTAARLGFRPKPHVYACAHLSNTGSLLLPVSNLTN
FT                   LLAFSACGLSFAGFAGVMAAPQLAAVAAEYAVLRLFFSKDLAGSGLAGAVPRGQEEPQG
FT                   QRAPVFALAVLGCVLAGFVAVQAAGASPAWAALAGAVALGVRSLAAGRTSVAKIAGSAQ
FT                   PLFLVFVLALGVVVRAVADNGLSGLLSRTLPHGEGLAALAGFALVAALVSNVINNLPAA
FT                   LALVPLAAAAGPGAVLAVLLGVNIGPNLTYAGSLATLLWRRVAQRNGHAVRLREFTRLG
FT                   ALSTPAALAAGVLGLWLSLRVGGVR"
FT   gene            71199..72395
FT                   /locus_tag="Srot_0094"
FT   CDS_pept        71199..72395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0094"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   msl:Msil_0516 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96586"
FT                   /db_xref="GOA:D6Z9Q9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9Q9"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG96586.1"
FT                   /translation="MTAVASARTVRGLDGLVFFLADVQSGLGPFLAVYLASRGWDEQRV
FT                   GIALTVGGLAAIVFQAPAGALVDRLRAKRALTAAAVAALACAALAVAFVPRFWPVLGAQ
FT                   AVIGAAGTVFGPMMCALALGVVGPAGFDRRQGRNQSLNSAGNVFAAVSMGLLGYYVSNR
FT                   SVFFFAAACAVPVFLSLRAIRAEEIDHAAARGSAPSASGSGGSRGMFSDWRLGVFLVCA
FT                   VMFHFANAAMLPLLGERLAKGQGASSMMFMSACVITTQLVIACIAAPVGALAGSWGRKP
FT                   LLLVAFAVLPVRGVLYTLTDSTVSLVAIQVLDGIGAGVFGVVSVLVIADLTKGTGRFNL
FT                   VLGLMSTAVAVGASLSQTVAGSIAHHGGFDAAMLSLAGIAAAAFLLLAVRMPETRTSG"
FT   gene            72455..72679
FT                   /pseudo
FT                   /locus_tag="Srot_0095"
FT   gene            73216..74007
FT                   /locus_tag="Srot_0096"
FT   CDS_pept        73216..74007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0096"
FT                   /product="MspA family protein"
FT                   /note="PFAM: MspA family protein; KEGG: rer:RER_02660
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96587"
FT                   /db_xref="InterPro:IPR015286"
FT                   /db_xref="InterPro:IPR036435"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9R0"
FT                   /inference="protein motif:PFAM:PF09203"
FT                   /protein_id="ADG96587.1"
FT                   /translation="MFDAIFRSNEVGAVSKVSGRTKRYRVRKNTTLGALSAALFTAVLG
FT                   ASSSYGQGLPDTVLHDVSEDGWEMVVETLDEEVNPVANLADTAFTREGFVQLTGVGKIL
FT                   GKGKYPVTAAELIIGYQIGCQIDVSQGVTLGGSLGASAGVDAYQGVGVGGIGGAGTLVP
FT                   PIGGAIIGGGGAVGGAILHEGANASIGGSVQFTLRPGGIVAIPMDRIPLKGSEARLRVR
FT                   NVNVKIDACGGPVNVRSFALLSLTTDYSHSTLATYGTEYPI"
FT   gene            74115..74690
FT                   /locus_tag="Srot_0097"
FT   CDS_pept        74115..74690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0097"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aau:AAur_0607 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96588"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9R1"
FT                   /inference="similar to AA sequence:KEGG:AAur_0607"
FT                   /protein_id="ADG96588.1"
FT                   /translation="MRKWALSSIFVGLLFAPSAAADPVLPVPSDPYGGGGIYGETSPYA
FT                   QGPNPGAALPQPGLISGTVPGSNAPLATELSTGTSGVRPGTNALVPGSLSHNPAPDFPD
FT                   NYFQGPAQSLPGQPPPKVTPALTQPAPDHKWGPIAQGGDSNPEDPENTESAPDASMARQ
FT                   LEPEAGEEEDEPTGDQSFASQLNSDDDE"
FT   gene            74687..75313
FT                   /locus_tag="Srot_0098"
FT   CDS_pept        74687..75313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0098"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kse:Ksed_11420 putative enzyme of poly-gamma-
FT                   glutamate biosynthesis (capsule formation)"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96589"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9R2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96589.1"
FT                   /translation="MTGQSLRTAASGALLVGALLVAGWSGNSAADPDFPDIPQANADVS
FT                   QESGAAQQRQGSTEQSTAEEDTAGQATAPEDDNAPADGLASPQDCVVIKHLVAHVDVLL
FT                   QRQVSVTQGFPTGKEGEQAVSLDLDLLNQALPFLVGAETGVQDAVQRAKVTKYKNDLGQ
FT                   LSLVLAERKTQNLSAPAPYAWVDKLSAASNQAGRDYLDIGNSCVV"
FT   gene            complement(75446..77155)
FT                   /locus_tag="Srot_0099"
FT   CDS_pept        complement(75446..77155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0099"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: rop:ROP_48340 two-component histidine kinase
FT                   PhoR; PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96590"
FT                   /db_xref="GOA:D6Z9R3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9R3"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADG96590.1"
FT                   /translation="MSRVDREAALTPQEGESRRRSPQARKLPLWLTLVSLMLVLVGGGV
FT                   LVSDAIVTISFQRSVMDRIDQDITGVAQRISDRPLKPPIPPGMPIPSISYPGVPSESGA
FT                   PSESPPSTTSAQATPPSTTSAQATPPTLRTEQQPSPELSQPADGAPEPSVAPISSEGAS
FT                   SARYYVRVGDRVYGRFRGADGTVIAPKIPADLWELRTPQTVASEGDSQVRWRAVWVPSL
FT                   HGDIVVASELSDVDGNLSSLLTLQLAIGTGVLLVLGLAGYFLVRWSLRPLVEVERTANQ
FT                   IAAGDLERRVPDWGERTEVGRLSKALNSMLAQIQHAFAATLASEEKAKSSERRMRQFVA
FT                   DASHELRTPLTAMRGFAELHRTGAGVSTTIAMSRIESEAIRMGKLVEDLLVLARTDEER
FT                   PLEKEPVDMLQLMTDAVHDAKAIAPSRTIRFEFQPSGGAPVVLGDDASLRQVLSNLVSN
FT                   ALLHTGEDATVTLSLGGDAHDVLVEVCDTGPGLAPEDAERVFERFYRVDPSRTRSSGGS
FT                   GLGLAIVNAIVRAHGGHASVRSELGVGTTLRVTLPRLAAGPEEDDELYVADE"
FT   gene            complement(77142..77864)
FT                   /locus_tag="Srot_0100"
FT   CDS_pept        complement(77142..77864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0100"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: mmi:MMAR_4942 two-component system response
FT                   phosphate regulon transcriptional regulator, PhoP; PFAM:
FT                   response regulator receiver; transcriptional regulator
FT                   domain protein; SMART: response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96591"
FT                   /db_xref="GOA:D6Z9R4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9R4"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADG96591.1"
FT                   /translation="MTATLASNSAAHTSSILIVDDEPNIAYLLRECLLAQGFSVKEAHN
FT                   PTDALAVVTKEPPDAMILDVMLPGMDGYTLLRRVREMGTECPVLFLTARDSLEDKLTGL
FT                   TIGGDDYVTKPFSLEEVVARLRVILRRAGKSDGARESPTLVFEDIELNEETHEVWKAGV
FT                   LVPLSPTEFTLLRYFMVNARIVLSKRQILEHVWHYDFGGDMNVVESYVSYLRRKIDTGE
FT                   KKMLQTLRGVGYVLREPR"
FT   gene            complement(78033..78707)
FT                   /locus_tag="Srot_0101"
FT   CDS_pept        complement(78033..78707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0101"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV_1510 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96592"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9R5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96592.1"
FT                   /translation="MGKATSPRAGGASQRHGRRLTGLGLAAGLIAASVFAISRPAADAT
FT                   PGTAGGPARMNPTSWNPTDDREPFESHGPYVFDSREPYASRTGPAEYRTGVGSFGEACR
FT                   RAINTWGPIEPAYLTWRVKVESTDDYYAAEYEADKLSFYVDTAHTSIQRGLAGVPGYET
FT                   RADPIRKLDNALVLMHEMIGTGGGQAPLFPDVGIPWEHWDSMWDVLDQAHDEVLAACPA
FT                   QS"
FT   gene            complement(78775..79467)
FT                   /locus_tag="Srot_0102"
FT   CDS_pept        complement(78775..79467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0102"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mab:MAB_2802c ABC
FT                   transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96593"
FT                   /db_xref="GOA:D6Z9R6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9R6"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADG96593.1"
FT                   /translation="MIDHLVRWFGADPSWNRLGPQLGEAFGDTLWMVLVTIVFGGVLGL
FT                   ILGVVLYCSRPSGLLENRLAHIVLNVAVNVVRPIPFVLLVAALGPITLGLIHTTIGVQA
FT                   AVFVMVVSAAFAIARIVEQNLVTIDPGVIEAARAVGAGPLRIIVTLLIPEALGPLILGY
FT                   TFVLVGVVDMSAMAGVVGGGGIGDFAITYGYNRFRWDVTLVSVLIIIVFVQLAQFLGNY
FT                   LARKALRR"
FT   gene            complement(79464..80519)
FT                   /locus_tag="Srot_0103"
FT   CDS_pept        complement(79464..80519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0103"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: mab:MAB_2803c methionine import ATP-binding
FT                   protein MetN; PFAM: ABC transporter related; NIL domain;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96594"
FT                   /db_xref="GOA:D6Z9R7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9R7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG96594.1"
FT                   /translation="MTQNTAASGGTSIRFENVSKTFASGKRLVTAVDNVSLDIPSGEIF
FT                   AMIGYSGAGKSTLLRMINGLERPTSGRVLVGGAEVSSLPERQLRAIRADVGMVFQQFNL
FT                   FRSRTVAGNVAYPLKVAGWPAAKRAARVAELLDFVGLADKAKHYPDQLSGGQKQRVGVA
FT                   RALASGPSVLLADEATSALDPETTKDVLGLLRSVNTEFGVTIVAITHSMSVVRALADRV
FT                   AVLANGAVVETGTVFDIFANPRSDISRNFVSTVLRHAPDSQDLARIARRHAGTIVSVEI
FT                   RDDVQIGRLLSEAARGGVGFEVVHGGVSSLQSRVFGNLSLELQGPPEGVARLVGELKAA
FT                   TKTIVAQEALP"
FT   gene            complement(80519..81463)
FT                   /locus_tag="Srot_0104"
FT   CDS_pept        complement(80519..81463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0104"
FT                   /product="NLPA lipoprotein"
FT                   /note="PFAM: NLPA lipoprotein; KEGG: mab:MAB_2804c ABC
FT                   transporter periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96595"
FT                   /db_xref="GOA:D6Z9R8"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9R8"
FT                   /inference="protein motif:PFAM:PF03180"
FT                   /protein_id="ADG96595.1"
FT                   /translation="MSATAPKRSANGLFPRSLAQGLVLLGTAAGSIVVVLAALVALLNF
FT                   SAKTATGGANVVVLGTTDAGKDSWSAFVAEAKQQGVEIATVNFSNYQQPNDALAQGQVG
FT                   ANLFQHLRFLAEYNVAHNTNLTPVAATFIVPLGLYSHKHKTLAEIPKGGQIAIPNDPSN
FT                   QGRALFVLRAAGLVKLVGDRLSPTTNDVDTAASKVVLVPVDPAQTARSLDSADGAVINN
FT                   NYLSDAGVDPATALAKDDPNDPSSAQYINVVVVRPEDKNNPLYSKLADIYHSRPVVDAY
FT                   NTESKGTQVPVQKSGPELQAILADIEAKTRAGQ"
FT   gene            complement(81614..82519)
FT                   /locus_tag="Srot_0105"
FT   CDS_pept        complement(81614..82519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0105"
FT                   /product="NLPA lipoprotein"
FT                   /note="PFAM: NLPA lipoprotein; KEGG: mab:MAB_2804c ABC
FT                   transporter periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96596"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9R9"
FT                   /inference="protein motif:PFAM:PF03180"
FT                   /protein_id="ADG96596.1"
FT                   /translation="MRVRTAARFGIVPAALALLAGALGACGSPEPTATVKIGTTDDKGE
FT                   GWKAFVQEAKRQGINLETTPSWDYLGPNDELENKQVDVNLAQHLRSLARYNVEHGTQLA
FT                   PIASTYIVPLGLYSKKHRTLAEIPQGAKIAIPDYPPDTARALFVLRSAGLVVLKGDPWS
FT                   PTKDDVDPSSKVAVETIKADFLVRGYTEDDGAVVNNTWLASAGIDPSAALAKDDPSAIN
FT                   SPDPQERARMEQYINVIVARSEDKNNPLYKRLGDIYHAKPVQDTYARQSKGSQIDVKKT
FT                   PEELQSALVALESRIRADRK"
FT   gene            82604..83548
FT                   /locus_tag="Srot_0106"
FT   CDS_pept        82604..83548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0106"
FT                   /product="DNA-cytosine methyltransferase"
FT                   /note="KEGG: npu:Npun_R6310 DNA-cytosine methyltransferase;
FT                   TIGRFAM: DNA-cytosine methyltransferase; PFAM: C-5
FT                   cytosine-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96597"
FT                   /db_xref="GOA:D6Z9S0"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031303"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9S0"
FT                   /inference="protein motif:TFAM:TIGR00675"
FT                   /protein_id="ADG96597.1"
FT                   /translation="MAPHDIVGRPRLLDLFAGCGGLSLGFESAGFEVALAVDNWPEALA
FT                   VYRRNFRHRAVELDLGDVDLASSALRECAAEVDGIIGGPPCQDFSSAGRRVEAGRADLT
FT                   EKFAQLVATFLPSFFVMENVERAAKAAAPRRAVALLEAHGYCVARIVLDASRCGVPQRR
FT                   KRLFTIGFLHPGSTRAAMGALTGNLAAAPMTLRDYFGSALDVDHYYRHPRSYARRAVFS
FT                   VDEPSPTVRGVNRPVPRGYPGHPGDTAPLTAGLRALTTAERAMVQTFPPDFWFGATKTA
FT                   AEQMIGNAVPVKLAQYVAEAVRQGLASAQRACA"
FT   gene            83545..84129
FT                   /locus_tag="Srot_0107"
FT   CDS_pept        83545..84129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0107"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cti:RALTA_A0385 putative ABC transporter, ATP-
FT                   binding membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96598"
FT                   /db_xref="GOA:D6Z9S1"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9S1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96598.1"
FT                   /translation="MTIADELRVVRKNGVVNNLGLVGSVVLVVGLCGLSGAWGLKDGGV
FT                   WWAVFGVASWLFGAAALLVIWSQANQLWDAKPVFVFRPDGFAPGSPDPEQDAFVPWEQI
FT                   AALSAVTDVTYRALGSDVSARSSHTLLLARQPDPRAGRGAVERFDYPRWTVPGFDEVAR
FT                   YIAAAAPHVAVRDEREYGMVEQFLRDWGLRT"
FT   gene            84304..86325
FT                   /locus_tag="Srot_0108"
FT   CDS_pept        84304..86325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0108"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA topoisomerase II; ATP-binding region
FT                   ATPase domain protein; TIGRFAM: DNA gyrase, B subunit;
FT                   KEGG: nfa:nfa60 DNA gyrase subunit B; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   ATP-binding region ATPase domain protein; TOPRIM domain
FT                   protein; DNA gyrase subunit B domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96599"
FT                   /db_xref="GOA:D6Z9S2"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9S2"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ADG96599.1"
FT                   /translation="MSEKKNADKSSYGASSITILEGLEAVRKRPGMYIGSTGERGLHHL
FT                   VQEVVDNSVDEAMAGYATRVDVTLLADGGVEVVDDGRGIPVAPHASGPPTVEVVLTVLH
FT                   AGGKFDSDSYAVSGGLHGVGISVVNALSYKLEVEIDVDGFHWSQSYDKAKPGPLTKGDP
FT                   VKRTGTTVRFWADPEIFETTHYDFDTIARRLQEMAFLNKGLIITLTDLREGQIDAAEDG
FT                   EALDTAEVARSEQEAQAQAPAVKRREYHYPGGLHDYVGHINRTKTAVHNSIVSFEGKGE
FT                   GHEVEIAMQWNSGYTESVYTFANTINTHEGGTHEEGFRAALTSTMNKYARDKKILKEKD
FT                   KNLTGDDVREGLAAVISVKLGEPQFEGQTKTKLGNTEIRSFVQKICNEELTHWFEANPS
FT                   EAKLIVTKAQQAYLAREAARSARETVRRKTATDIGGLPGKLADCRSKDPSKSEVYIVEG
FT                   DSAGGSAKSGRNSEFQAILPIRGKIINVEKARIDRVLKNTEVQSIITAFGTGIHDEFDL
FT                   AKLRYHKIVLMADADVDGQHISTLLLTLLFRFMRPLVEHGHVYLAAPPLYKLKWQRAEP
FT                   EYAYSDRERDALIEAGLSAGKRINKDDGVQRYKGLGEMNAKELWETTMDPDTRTLRLVT
FT                   MDDAAAADELFSILMGEDVPARRGFIARNARDVRFLDV"
FT   gene            86402..88882
FT                   /locus_tag="Srot_0109"
FT   CDS_pept        86402..88882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0109"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA gyrase/topoisomerase IV subunit A;
FT                   TIGRFAM: DNA gyrase, A subunit; KEGG: rop:ROP_34970 DNA
FT                   gyrase subunit A; PFAM: DNA gyrase/topoisomerase IV subunit
FT                   A; DNA gyrase repeat beta-propeller"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96600"
FT                   /db_xref="GOA:D6Z9S3"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9S3"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ADG96600.1"
FT                   /translation="MTDPTDPTPSRDRIEPVDLGQEMQRSFIDYAMSVIVSRALPDVRD
FT                   GLKPVHRRILHAMQDQGFRPDRGYVKSARPVAEAMGNYHPHGDTAIYDALVRMAQPWSL
FT                   RYPLVDGQGNFGSRGNDGAAAMRYTEARLAPLAMEMVRDIDEETVDFVPNYDGKTEEPS
FT                   VLPARIPNLLVNGSGGIAVGMATNIPPHNLREVADAIFWALEHHDADEASTLEAVKEIV
FT                   KGPDFPTAGLIVGTDGVHDAYTTGRGSIRMRGVVEVEEDSQGRAILVITELPYQVNPDN
FT                   MITSIAEQVRDGKIAGISAIDDETSDRIGMRIVVTLKRDAVARVVLNNLYKHSQLQTNF
FT                   GANMLAIVDGVPRTLRLDQILRLYIAHQIEVIVRRTQYRLRKAEERAHILRGLVKALDA
FT                   LDEVIALIRASQTVDIARAGLMELLDVDEIQADAILAMQLRRLAALERQKIIDELAEIE
FT                   EAIADYQDILARPERQRAIVRDELKEIVDRHGDERRTRIIAAEGEVRDEDLIAREDVVV
FT                   TITETGYAKRTKTDLYRSQKRGGKGVQGATLKQDDIVAHFFVCSTHDWILFFTTRGRVY
FT                   RIKAYELPETSRAARGQHVANLLALQTDEKIAQVIHLQTYEDSPYLVLATKRGLTKKSK
FT                   LTEFDSNRSGGLIAVNLRDEDELVGAALCSSDDDLLLVSEHGQSIRFHANDEQLRPMGR
FT                   ATSGVLGMRFNEDDQLLAMNVVRDGAYLLVATSGGYAKRTALGEYPVQGRGGKGVLTVQ
FT                   YDRRRGGLVGAVIVDDDTELYAITQGGGVIRTDARQVRRAGRQTKGVRLMNLGEGDRLI
FT                   AVARNDEDSAEVAE"
FT   gene            88922..89521
FT                   /locus_tag="Srot_0110"
FT   CDS_pept        88922..89521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0110"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0008 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96601"
FT                   /db_xref="GOA:D6Z9S4"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9S4"
FT                   /inference="similar to AA sequence:KEGG:Mvan_0008"
FT                   /protein_id="ADG96601.1"
FT                   /translation="MSNPPEQEPPTTALPKVAAPARRPAERISPASDSVSAVTARLADA
FT                   RRSGADRSGSSRPAPDPAPSSAPKAAAVPSQQPSGPLRAQVQVRWIDPWTVLKVTAAVM
FT                   VVLFVAWMIGVAVLYALLEAIGVMGKINSGLGDFSTAAADQGGDIVTPGMVFGFSALVG
FT                   IVNIVLVTALATVGAFIFNLCVDLVGGVEITLADPE"
FT   gene            89593..89669
FT                   /locus_tag="Srot_R0006"
FT                   /note="tRNA-Ile1"
FT   tRNA            89593..89669
FT                   /locus_tag="Srot_R0006"
FT                   /product="tRNA-Ile"
FT   gene            89730..89802
FT                   /locus_tag="Srot_R0007"
FT                   /note="tRNA-Ala1"
FT   tRNA            89730..89802
FT                   /locus_tag="Srot_R0007"
FT                   /product="tRNA-Ala"
FT   gene            89950..91038
FT                   /locus_tag="Srot_0111"
FT   CDS_pept        89950..91038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0111"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rop:ROP_56140 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96602"
FT                   /db_xref="GOA:D6Z9S5"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9S5"
FT                   /inference="similar to AA sequence:KEGG:ROP_56140"
FT                   /protein_id="ADG96602.1"
FT                   /translation="MARKHFFAGVERLKLTALPIVQCSVGAGLAWFVAKNIVGHASPFF
FT                   APVAAVISLGVSLGSRWRRAVELVCGVMLGIVIGDLLVRVTGHGWWQISFFVAAAMVLA
FT                   TFIDKGLIFPMQAASSALLVVLFPPTVGGASIAGPGRLVDAFVGGVIGILISALLPAHP
FT                   FLRAHQAAAAVLATGESVLRGVAEGLAARDADRIEEVLSLARSSQPQIDTLQNYLRAGD
FT                   EIVRISPLFWAYRDRVHEVSASADHIDRIIRDLRVLARRAWILVNSGGKTGAGLTRAIE
FT                   STADAVAQVRLLWLAKKPDQAQREEVLAALQECAARLDPTMLSGVALSAEVVFAQLEST
FT                   IFDLFQAAGFDSATALRALREA"
FT   gene            91254..92210
FT                   /locus_tag="Srot_0112"
FT   CDS_pept        91254..92210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0112"
FT                   /product="fatty acid desaturase type 2"
FT                   /note="PFAM: fatty acid desaturase type 2; KEGG:
FT                   rha:RHA1_ro02258 acyl-[acyl-carrier- protein]desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96603"
FT                   /db_xref="GOA:D6Z9S6"
FT                   /db_xref="InterPro:IPR005067"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:D6Z9S6"
FT                   /inference="protein motif:PFAM:PF03405"
FT                   /protein_id="ADG96603.1"
FT                   /translation="MVQRELSDKELLHELYGVAEDNVNRHLKMAKDWNPHDYIPWSEGK
FT                   NFKMLGGEDWELGQSQLDEPARIAMLTNLVTEDNLPAYHRDIADAFSRDSAWGTWVGRW
FT                   TAEENRHSIAIRDYLLTTRAVDPVELERARVASTVSGFNPPMAAQDMLHTVCYVTFQEL
FT                   ATRVSHRNTGKACKEPIADKLLQRISADENLHMIFYRNLVEQALNVSPNQTMKAIADIL
FT                   TMFQMPGAGMKNFRRNAVIISKSGIYDLKQHMEDVVMPVLRHWKIFERDDFSGYGEWER
FT                   DRLAEFLRMLNGKVQQIEESQARRAERLAARDAARAS"
FT   gene            92288..93448
FT                   /locus_tag="Srot_0113"
FT   CDS_pept        92288..93448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0113"
FT                   /product="TIM-barrel protein, nifR3 family"
FT                   /note="KEGG: rha:RHA1_ro04868 tRNA-dihydrouridine synthase;
FT                   TIGRFAM: TIM-barrel protein, nifR3 family; PFAM:
FT                   dihydrouridine synthase DuS"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96604"
FT                   /db_xref="GOA:D6ZA62"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA62"
FT                   /inference="protein motif:TFAM:TIGR00737"
FT                   /protein_id="ADG96604.1"
FT                   /translation="MTTTFAAPALRIGPFELASPVVLAPMAGVTNLAFRTVCRELETRL
FT                   TGQARGLYVNEMVMARSLVNRNPKAMRMIEFGPEERPRSMQLYTVDPEAVGEAVRMIVA
FT                   EDLADHVDLNFGCPVPKVTRNGGGAALPYKRRLFARIIEAAVNGAQGAVPITVKFRVGI
FT                   DDEHHTYLDAGRIAQDSGAASVALHARTAAQLYSGTADWSAIARLKEHVTEIPVLGNGD
FT                   IFAAADAKRMMDQTGCDGVVVGRGCLGRPWLFAELAAALSGGAIPAPPPPNLGEVARIV
FT                   LRHAQLLVLHAGSHGVAEMRKHFAWYLRGFSVGSELRGKFSTVGSLAEIEDLLGQLPQE
FT                   EPFPEEAEGPRGRKGSPQKKVALPQGWLDDPQDWAVRLDDVEHSGG"
FT   gene            93613..95367
FT                   /locus_tag="Srot_0114"
FT   CDS_pept        93613..95367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0114"
FT                   /product="cell envelope-related transcriptional attenuator"
FT                   /note="KEGG: gbr:Gbro_3920 cell envelope-related function
FT                   transcriptional attenuator, LytR/CpsA family; TIGRFAM: cell
FT                   envelope-related function transcriptional attenuator,
FT                   LytR/CpsA family; PFAM: cell envelope-related
FT                   transcriptional attenuator"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96605"
FT                   /db_xref="GOA:D6ZA63"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA63"
FT                   /inference="protein motif:TFAM:TIGR00350"
FT                   /protein_id="ADG96605.1"
FT                   /translation="MRIPDLSDETTRRRLAAKAARANRIRIPERAAAAERSSSSILRPL
FT                   SGKAELPPVPSKPARARWEAASRLVARAAVVLLAVSSLAATGAFWGVSRGALEGKGVLA
FT                   LLLNDPNIKDPGQQQGDENFLLIGADTREGDNGKLGAGDVNDVEGSRSDTIILVNIPAS
FT                   RARVVAVSFPRDLQVDRPACAKWNSTTKQYSKEIQPAETHSKINSAYMYGGPRCLVQVV
FT                   QKLSGLKVNHFIGEDFEGFSKMVDAVGGVQVCSTKPLYDDELGTVLAKSGSQTLDGAQA
FT                   LQYVRARQIEAEGTGDYGRIKRQQRFISSLLRSMLSQKILANPTKLNGLLEAFTDRAVM
FT                   DGVKVDDLLKLAQSMQSIQTNKVTFITIPTTGTSEDGMNNEVPNDDGVRAIFDAIIYDK
FT                   PLPGEGGSNTSSASVVTPWTVETTGKPATKTTTSSTPQPGPPPETQPAEGVKAVSVKGF
FT                   TVQVVAPTSTILYKVAMALSKQGFKVDMTSSGVAHSDTVATIARFSPESRDAAATVASA
FT                   IPGAIIELGSTPDADVELVVGSGGDVPTVVEPAAPGAGIVANEVKAVDGVVRLPENLTV
FT                   TNGADTTC"
FT   gene            95474..96124
FT                   /locus_tag="Srot_0115"
FT   CDS_pept        95474..96124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0115"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /note="KEGG: mgi:Mflv_1665 phosphate uptake regulator,
FT                   PhoU; TIGRFAM: phosphate transport system regulatory
FT                   protein PhoU; PFAM: PhoU family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96606"
FT                   /db_xref="GOA:D6ZA64"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA64"
FT                   /inference="protein motif:TFAM:TIGR02135"
FT                   /protein_id="ADG96606.1"
FT                   /translation="MRAVFHEQLSDLTGQLGLTCALTGEAMRQATLALLSADLVLAETA
FT                   ISKDDEISALSKDSEERAFALIAAGPTEEDLRAAVGQMQVVVDLRRMGALARHVGNVAR
FT                   RRHPLHAVPVDVHRQFEQMGEIAVALSAAARQALLTQNPVAAAKLQAEDDAMDALHQQL
FT                   FSLLLGSQWQHGVGPAVDVALLGRYYERFADHAVQIGRRVRFVATGATLSQTG"
FT   gene            96192..98378
FT                   /locus_tag="Srot_0116"
FT   CDS_pept        96192..98378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0116"
FT                   /product="Oligopeptidase B"
FT                   /EC_number="3.4.21.83"
FT                   /note="KEGG: rha:RHA1_ro04818 oligopeptidase B; PFAM:
FT                   peptidase S9A prolyl oligopeptidase domain protein
FT                   beta-propeller; peptidase S9 prolyl oligopeptidase active
FT                   site domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96607"
FT                   /db_xref="GOA:D6ZA65"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA65"
FT                   /inference="protein motif:PRIAM:3.4.21.83"
FT                   /protein_id="ADG96607.1"
FT                   /translation="MMVAMSSPVPPPVPKTVPTTRAHHGEVVTDDLAWLGDEEDPDTIA
FT                   YLEAQNAHTEALTEHLGPLREAIFDEIKSRTLETDMSVATRIGDWWYFTRTQAGEQYGA
FT                   HCRAPVASPEDWTPPQVSPDAALPGEMVLLDGNERAQGHEFYSLGAYEVSHDGRLLAFS
FT                   EDVKGDERYDLRVKDLATGELLADELTGVAPGAVWSLDGHYLFYQRVDEAWRPDSVWRH
FT                   RLGDDSANDVRVYHEPDERYWVGVGSSRSERWLFIASSSKATSEMWALDSSDPTGAFQV
FT                   VAERREGVEYEVEHAVVDGTDVFLILHNDEAENFALAQVPASDPARWGREHWTSVLEHD
FT                   PALRLEGVDAFDGYLALSYRREGLPKFAVCAYGDSVRPADQAAPAEAFSFGEFHGGQFQ
FT                   ELAFSEQLVAAGLGANPEWASPRLRFGRSSFTTPAQVYDLDVPTGERILLKTQPVLGDF
FT                   DPSQYEAYRLWAVADDGAQVPISVVRKRSVAKPAPTLLYGYGAYESSIDPGFSVARLSL
FT                   LDRGVVFALAHVRGGGELGRHWYEQGRFTAKPNTFTDFIACAKALVDQGETAPGRLVAE
FT                   GGSAGGWLVGAAANLAPELFAGVLAVVPFVDPLTTILDPSLPLTVTEWEEWGNPLEDKA
FT                   VYDYMKAYSPYENVTAKAYPKILAICSLNDTRVRFAEPAKWVARLQQATTSGEPVLLKT
FT                   EMNAGHGGRSGRYERWKEAAFEQAWILDVLGARV"
FT   gene            98410..99123
FT                   /locus_tag="Srot_0117"
FT   CDS_pept        98410..99123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0117"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   gbr:Gbro_0602 glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96608"
FT                   /db_xref="GOA:D6ZA66"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA66"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADG96608.1"
FT                   /translation="MTTQDDVWLVIPVYNEGSVITRVVGQALAVFPNIVCVDDGSRDDT
FT                   AAQIGQTGAHLVRHPVNLGQGAAIQTGVEYARAQPGATYFVTFDADGQHRTEDAARMVA
FT                   RLRAADRGEGEPVDLVLGSRFLAEEARKGVPVVKRVLLRVVAAISPEGRRLKLTDAHNG
FT                   LRAFNRVVAERLDILQNGMGHASEFVKLALHHHWRVVEEPVVILYTDYSKAKGQSLLNG
FT                   VNILVDNALRPARGR"
FT   gene            99123..99611
FT                   /locus_tag="Srot_0118"
FT   CDS_pept        99123..99611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0118"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gbr:Gbro_0601 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96609"
FT                   /db_xref="GOA:D6ZA67"
FT                   /db_xref="InterPro:IPR019277"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA67"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96609.1"
FT                   /translation="MSPLLTQLPIKLVLLAAGATLAFYLARARGTARASAAVKLLFLGF
FT                   LAFGALAVLRPDDVSAFARLLGVGAGMNLLLYALVIAFAFTTVSTYLRFKELEGRYVSL
FT                   ARVIALSTASPPSTRGPAADPSAGAGTISRLADGPSGQNEEQENAAPDARGSWEVPPA"
FT   gene            99608..100825
FT                   /locus_tag="Srot_0119"
FT   CDS_pept        99608..100825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0119"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro05190 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96610"
FT                   /db_xref="GOA:D6ZA68"
FT                   /db_xref="InterPro:IPR021424"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA68"
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro05190"
FT                   /protein_id="ADG96610.1"
FT                   /translation="MTQPQPGKAQNLLPLALIAFGAALLAIAVLVPLYSEDELVKASLS
FT                   DRITLVSPAQSTGEDGPGLSQEFPAQVIDRCSVSSDAAKAAVLQAKATIRTYVTVEEPS
FT                   TDSTVTYQAGTSVLVSEVKSQGDGQPKTLVPTALQRSASGAPAPKTPWSDGQCDNGLLL
FT                   ATVDRVTVGRHNGLPTAKGLSEVQVEPEQQAHLLPNRSGQQYRFPFDTSSKGKYQYFDV
FT                   TTGTSFPVTYVENTEISDIKTLHFHVDVPETDLALVNMPVGYDEKEWTAPPGTTLTKPL
FT                   NWWNIPNSPGGQDQTMHRFYRNGIDLYVDPESGVIVRERQDLRQYFAEPFSAREAASPD
FT                   LRNFTLTILSGVFDYNQQTIEATVKQAKSYQDDIALYGRTIPIGSAVLGLVLLAGGGVI
FT                   YYRLTR"
FT   gene            100829..102562
FT                   /locus_tag="Srot_0120"
FT   CDS_pept        100829..102562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0120"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rop:ROP_52380 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96611"
FT                   /db_xref="GOA:D6ZA69"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA69"
FT                   /inference="similar to AA sequence:KEGG:ROP_52380"
FT                   /protein_id="ADG96611.1"
FT                   /translation="MPLVWLWSLTLSLVALGPLLGGGHWLWADAVSVPRSFLVDQAFGL
FT                   ADAAPRATPQDAALAAVSNILDGGLVVKAITVLALFAAGTGAARLVREFLPESSWAVHI
FT                   VAATFAIDNLWVVERLLQGQWSLLVGYGALGHVAVVAARLRNTPSASGWAELGFWLAAG
FT                   GLVPTGALLVAVLAGLVLAAPGGARWWRRTAAFTGLAIVAASPWAAAGLFGLCGPELAD
FT                   GGAAGAHAFATRPDRAGWLALGGIWNAGSTPDSQRGAWGLAADLALVALVAAGAFLLRR
FT                   RLRQDRAFALLFALGLAAVALVGLSATGFAQSSLAEAMATTPALGVLRDGQKWAALAWP
FT                   AYALALSWIAMRAKQWACALVPVVLLLVPDALWGAGGRLAPVRYPNDWFEVRSLVAADP
FT                   SHGALLTVPVGITRQYDWAGRRTSIDPAPRLLPVPVAQSGDLVVAGAVVPGEGALARRA
FT                   AAHVRAGAGPERFAEDSIGWVLVERDQLSALPPAALAALARFELVRSDQHFDLYRNPLT
FT                   PWPVPAVPDAARRVVVAAHLAWAALLACGAAGALWRRRAPGARLGRIGGTCPDGFREKA
FT                   L"
FT   gene            102630..103058
FT                   /locus_tag="Srot_0121"
FT   CDS_pept        102630..103058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0121"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to potassium transporter Trk1p"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96612"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA70"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96612.1"
FT                   /translation="MMRHTALALPAALAGMFGFAAHAQAQPAIWSASSAHLNVSSAQYD
FT                   DPDEDDTADDADDEDEAAPDRPGGNTHFPRNGITHDDDTVAPDDDDAAPDRPGAKTHFP
FT                   RNATKLDNSGHPVTGQGPNKGTKPLNDTLDAAGGKHHC"
FT   gene            103161..105296
FT                   /locus_tag="Srot_0122"
FT   CDS_pept        103161..105296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0122"
FT                   /product="ATP-dependent DNA helicase, RecQ family"
FT                   /note="TIGRFAM: ATP-dependent DNA helicase, RecQ family;
FT                   PFAM: helicase domain protein; DEAD/DEAH box helicase
FT                   domain protein; phosphoribosyltransferase; KEGG:
FT                   kra:Krad_4305 ATP-dependent DNA helicase, RecQ family;
FT                   SMART: helicase domain protein; DEAD-like helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96613"
FT                   /db_xref="GOA:D6ZA71"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA71"
FT                   /inference="protein motif:TFAM:TIGR00614"
FT                   /protein_id="ADG96613.1"
FT                   /translation="MTTALRETAQHALRALVGRDDAVLREDQWAAIQALVEGKRRALVV
FT                   QRTGWGKSAVYFVATALLRARGAGPTVIVSPLLALMRNQIDAAARAGISALTVNSTNVD
FT                   EWGLVHAQVRAGEADVLLVSPERLNNPGFRDEVLPALAAGAGLVVVDEAHCISDWGHDF
FT                   RPDYRRIRTLLADLPDGVPVLATTATANARVTADVAEQLSGSDQAPLVLRGALDRESLH
FT                   LGVLKLPDHAARLAWLAARLGAFPGSGIVYCLTVAATEQVAEHLRQAGHTVAAYSGQTD
FT                   PGEREAVERDLLANRVKAVVATSALGMGFDKPDLGFVVHFGAPQSPVAYYQQVGRAGRG
FT                   VDQASVVLLPGAEDKDVWRYFGSLGFPPENDVRAVLDALAQAEQPLSIGQLETVVGLRR
FT                   SRLETMLKVLDVDGAARRVQGGWTGTGSPWRYDHERYARVAQTRLAEQRLMLDYQDTEQ
FT                   CRMRFLREALDDEVSEDCGRCDNCGGLEVAPAPSAQEVEAAREHLRRPGVAVEPRKMWA
FT                   PGAPGLNPARAGGSAKRIPPDEQASPGRAVARLDAVGWGPQLRAVFASGSPDGELPVPL
FT                   RYPVAEVLKSWFAPVSSDAGPFAAGAPDSVVFVDSSARPKLLAHLAAGAAKVLGVPVAG
FT                   RFVPNSPAAPHDVNSSFRLRSVAQRFALEPSAPLGRRVLLVDDWSDSGWTLTVAARLLR
FT                   KAGADEVAPFVLAVGSV"
FT   gene            complement(105369..107976)
FT                   /pseudo
FT                   /locus_tag="Srot_0123"
FT   gene            108076..108924
FT                   /locus_tag="Srot_0124"
FT   CDS_pept        108076..108924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0124"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="KEGG: hch:HCH_04117 carbonic anhydrase; PFAM:
FT                   carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96614"
FT                   /db_xref="GOA:D6ZA72"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA72"
FT                   /inference="protein motif:PRIAM:4.2.1.1"
FT                   /protein_id="ADG96614.1"
FT                   /translation="MREIIEGFLTFQQEIYPKRLELFKKLAAAQSPKALFISCSDSRVV
FT                   LELLTQQEPGDLFVIRNAGNIVPPYGPEPGGVTATVEYAVAVLQVTDIVVMGHSNCGAM
FT                   KAIAAGQPLDSLPAVSHWLRYSDAAKAVNQAREYGSDDEKLTALVHDNVVAQISNLKTH
FT                   PTVALALAEQPLSIGQLETVVGLDSPDGELPVPLRYPVAEVLKGWFAPVSSDAGAPDSV
FT                   VFVDSSARPKLLAHLAAGGRLVGFGLDLDGGRAAAAQGRRGRSRAVRPGGGFGLMLAPP
FT                   K"
FT   gene            complement(108977..111112)
FT                   /locus_tag="Srot_0125"
FT   CDS_pept        complement(108977..111112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0125"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mab:MAB_2960 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96615"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA73"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96615.1"
FT                   /translation="MAGTSSKALAFLLAKPKLAASVAVAATAVAGTGVATYNSGPGDAL
FT                   WGLQKTVFSSHAQQVAVNDVASDLKNAQALLSKNPIGADDLGQARNYLNQAKQLIDDAS
FT                   NVPDANQRAGLQQLYLQLTQNLADSVPPPADLPAAPDASLDANAQGSVATQASAQLPTW
FT                   GYSTQAAASASAPQPPAQVAGADISNPPGEADPDWSDPTPAAATLNQQELGYYDPTWDT
FT                   FYGYNRDDWHRWGLDGYNPYGYDYTGYDRYGYDRAGYDRWGYDRRGYDRYGYNYAGWRY
FT                   DPISRMGWHRDGYNEWGQRQGHPDDPRNAGWRDKWYNRYQGYYENRWYYNDPVYQRHQW
FT                   DRDRWLRQNPSGADAQFNVYVETARLRPFLPVVNLNVSLGQFVDIQVPRQTRDFVRNGV
FT                   IATLAAADIVAHIAQEAVPIVRVRQQQEQFFDRRAAEANAKVALDIPVAGSLNAQFNAQ
FT                   ASGGLATRPDPGQPNPRPGQNGQASLSSSVEAAAAITTPPIFGAGANVQQLLQVQQSQQ
FT                   QQRQQRVSAEAKAQIQAEIAQEQKSRPTTPPKQPVAPAQGGQVGGQVNGQVGGQAGAGG
FT                   VNGQIGGQADGKAGGAGGVNGQIGGQAGGQVGPGGAGANGQADGRAGASPAPEPRQERP
FT                   QPQQGGQVGGQAGGQAGGQVGPGGAGANGQIGGQAGGKAGGPGGPAGGAGASGQAGGQA
FT                   GPGGPGGATIPAGPGGR"
FT   gene            111311..111961
FT                   /locus_tag="Srot_0126"
FT   CDS_pept        111311..111961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0126"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="KEGG: pfo:Pfl01_2731 carbonate dehydratase; PFAM:
FT                   carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96616"
FT                   /db_xref="GOA:D6ZA74"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA74"
FT                   /inference="protein motif:PRIAM:4.2.1.1"
FT                   /protein_id="ADG96616.1"
FT                   /translation="MREIIEGFLTFQQEIYPKRLELFKKLAAAQSPKALFISCSDSRVV
FT                   LELLTQQEPGDLFVIRNAGNIVPPYGPEPGGVTATVEYAVAVLQVTDIVVMGHSNCGAM
FT                   KAIAAGQPLDSLPAVSHWLRYSDAAKAVNQAREYGSDDEKLTALVHDNVVAQISNLKTH
FT                   PTVALALEQGRLDLHGWVYDIEPGVIDAYDGTSRTFVPLSDNTKVSALATKQG"
FT   gene            complement(111975..113081)
FT                   /locus_tag="Srot_0127"
FT   CDS_pept        complement(111975..113081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0127"
FT                   /product="mycothiol-dependent formaldehyde dehydrogenase"
FT                   /note="KEGG: nfa:nfa12230 putative dehydrogenase; TIGRFAM:
FT                   mycothiol-dependent formaldehyde dehydrogenase; PFAM:
FT                   Alcohol dehydrogenase zinc-binding domain protein; Alcohol
FT                   dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96617"
FT                   /db_xref="GOA:D6ZA75"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR017816"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA75"
FT                   /inference="protein motif:TFAM:TIGR03451"
FT                   /protein_id="ADG96617.1"
FT                   /translation="MPQTVKGVVSRAKGAPVELVDVVVPDPGPAEVVVQIQACGVCHTD
FT                   LAYRDGNITDQWPFLLGHEAAGTVEAVGSAVTHVEPGDFVVLNWRAVCGECRACRKGKQ
FT                   QYCCNTFNAEQPMTLTDGTALTPALGIGAFIEKTLVHQGQCTKVNPAADPAVAGLLGCG
FT                   VMAGIGAAVHTGAVARGDAVAVIGCGGVGSAAVAGARLAGASVVIGVDVDQRKLDWAKD
FT                   LGATHTILSGEGVHVPEAVKALTGGFGADVVIDAVGRPETWEQAFYARDLAGVVVLVGV
FT                   PSPTMRLEMPLLDFFSHGGSLKSAWYGDCLPERDFPALVDLSLQGRLPLEKFVTERIGV
FT                   GDVEEAFHAIHEGRVLRSVVVFGANNPG"
FT   gene            complement(113161..113715)
FT                   /pseudo
FT                   /locus_tag="Srot_0128"
FT   gene            complement(113747..114280)
FT                   /locus_tag="Srot_0129"
FT   CDS_pept        complement(113747..114280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0129"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ABR092Cp"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96618"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA76"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96618.1"
FT                   /translation="MALAALPLVLPLCGSPAHASPDNPCPTERIGDQGDEPWDSMRDDT
FT                   REGERVSLLKLFQAAYPQATLMREKLLLTAYGPFYAKSNQPTVGGWSRIQRRFHEKLPG
FT                   IGFSPSGARRAGSGDAEGWVELANPPKNIPPDAQACESRPIVLAMLDGKSFRKAHQYGD
FT                   DFDGDMYGYFEIKP"
FT   gene            complement(114306..115622)
FT                   /locus_tag="Srot_0130"
FT   CDS_pept        complement(114306..115622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0130"
FT                   /product="putative integral membrane protein"
FT                   /note="KEGG: mkm:Mkms_4874 putative integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96619"
FT                   /db_xref="GOA:D6ZA77"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA77"
FT                   /inference="similar to AA sequence:KEGG:Mkms_4874"
FT                   /protein_id="ADG96619.1"
FT                   /translation="MCDMFLPGGRRARCDIMLVMSTPRPAVLSVGVATALSAASGYFVL
FT                   LLAARSLTESQYAGWFVFWSAFGLATGALGGLLQETARGVRAAPAEARGARPLLAGFGS
FT                   GVVLGGLALATAPLWAGLLFLEAGGAQPGSARPAENGVLPLAGLFAVGVCGVAAQAAVG
FT                   GLLSAAYAWTPFAVLTVLDAAFRLAAAISCVAFGAGPGWFCVAAVAGAGSWLVLLTASP
FT                   RARALAAARADVPMREFLRRCAAAVAAASASAVLVMGFPVLLKITTPGRLPEGAGALLL
FT                   AVTLTRAPLLVPLNVFQGALVAWCTDRRSRPWRALGIATGAVLLAGAASALAAALLGPW
FT                   LLAAVFHVAWPFGRATLAALTLGAAMIALLTCTGVSCLTTGRGRINAVGWWAATLASLA
FT                   LLLVPALPQDQIGLRVCLALLIGPLVGMAVHLSALRGRL"
FT   gene            115729..117567
FT                   /locus_tag="Srot_0131"
FT   CDS_pept        115729..117567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0131"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; KEGG: rha:RHA1_ro05228 flavin
FT                   binding monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96620"
FT                   /db_xref="InterPro:IPR032371"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA78"
FT                   /inference="protein motif:PFAM:PF00890"
FT                   /protein_id="ADG96620.1"
FT                   /translation="MTVSAQTGETQEQASGTAALLDVLVVGAGFSGICAGVKLQEAGVY
FT                   DFLIVEKAEDFGGTWWHNTYPGCAVDVTSPMYSFSFAQKSDWSNLFAPQPELLAYARQV
FT                   AKDFNLRPRTRFGVAVEQLVFDESADRWDVSLSDGSVYRARVVIGGFGGLHVPKIPEFA
FT                   GLSTFQGPVFHSAQWRHDVDLQGKKVVVIGTGASAVQFVPEVAKEAERLTVFMRSPHWV
FT                   LPRLDYSIKPWQHAVLKHVPGARRLLRAIAYFLYEGFVFNLFFPKVFARFFEAASKAHM
FT                   RRQIADPALRQLLTPDWRFGCKRVVMSSTYYPALQRPNVTLEHSGVAEFTEHGVRSADG
FT                   VLHEADVVILGTGFETTEGVLHLPIIGRGGTSLADAWHTDGPEQFLGLSTHGFPNLFTL
FT                   VGLNTTGGNQSVIFAIEAQMHYINQAIRWIFGSRSGVTRVELRESVQRRYNRDVQKKLK
FT                   KSVWLTGGCKSWYLDSEGRNAIAWPGFSFGLWCKTRFAKASDWELSGVQSRQIAEGYTG
FT                   PAEIVLVGESIPVEAEVRGHIDPLDGARPWYGRVVGGPSLGVLAASGDTTATLQIPGRE
FT                   AASVRLAGQDARGGFRVVGVGAPPFALGPAALERSG"
FT   gene            117610..118617
FT                   /locus_tag="Srot_0132"
FT   CDS_pept        117610..118617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0132"
FT                   /product="F420-dependent oxidoreductase, G6PDH family"
FT                   /note="KEGG: gbr:Gbro_4404 glucose-6-phosphate
FT                   dehydrogenase, F420-dependent; TIGRFAM: F420-dependent
FT                   oxidoreductase, G6PDH family; PFAM: Luciferase-like,
FT                   subgroup"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96621"
FT                   /db_xref="GOA:D6ZA79"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019944"
FT                   /db_xref="InterPro:IPR019945"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/Swiss-Prot:D6ZA79"
FT                   /inference="protein motif:TFAM:TIGR03557"
FT                   /protein_id="ADG96621.1"
FT                   /translation="MSLPIKLGYKASAEQFNPRELVEYTVAAERHGFDSVVVSDHFQPW
FT                   RYTGGHAPWALAWLGAVGERTSRVQIGTSVLTPTFRYNPAIIAQAFATFGMLYPGRVFL
FT                   GVGTGEALNEQAVGLKEWPEFKERFARLRESVELMRKLWTEERVNYEGEYYRTVDATVY
FT                   DKPSEPIPVYVSAGGAVVARYAGRAGDGFICTSGKGAELYTETLLPAVQEGADKVGRDA
FT                   GGIDKLIEIKLSYDPDPWLALNNTRFWSPLSLSAEQKHSLSDPKQMEEAADALPMEQIA
FT                   KRWIVASDPDEVVEKIKFYTDLGLNHLVFHAPGHDQLRFLEVFERDLAPRLRSL"
FT   gene            complement(118796..120970)
FT                   /locus_tag="Srot_0133"
FT   CDS_pept        complement(118796..120970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0133"
FT                   /product="serine/threonine protein kinase"
FT                   /note="KEGG: mab:MAB_4224 serine/threonine-protein kinase;
FT                   PFAM: Serine/threonine-protein kinase-like domain; SMART:
FT                   serine/threonine protein kinase; Tyrosine- protein kinase,
FT                   subgroup, catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96622"
FT                   /db_xref="GOA:D6ZA80"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR031634"
FT                   /db_xref="InterPro:IPR031636"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA80"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADG96622.1"
FT                   /translation="MTEAFSPADTTQPAPTAPVESSGPAKRAERTVTVPLSERLIGGGL
FT                   VRIQPAPALDPSLALMPDPQVPENKRFCWKCHAPVGRKGPDDPGLPEGVCGNCGTPFSF
FT                   LPQLKAGEVVAGQYVVRGPIAHGGLGWIYLAEDRNVDNRPVVLKGLLSRGDASAQAIAR
FT                   AERQFLSEVSHPAIVEILNFVEHPDLDGVPVGYIVMQYIGGVSLRDLLYGRKPGSPPLG
FT                   GALRRTSLPVEQALAYLMEIMPALGYLHSIGLAYNDLKPENIMLTEGQLTLIDLGAVTS
FT                   MHDTNRLYGTVGYQAPELTLTGPTVQTDVFTVGRTLAVLTVDLPLDKGRYAEGLPSPQE
FT                   EPVFAKYPSYYQLLLRATHPNSRARFQSASEMSVQMSGVLREVLAERRGRPYPSSSTLF
FT                   TASRGEFGTDVLSRRLDVYADGRDRRGELRRDEVVQALPLPLVDPAHPSAALLATLLHT
FT                   KPEHALESVTGALESDPDDTETVLAAVRVHMGLGQLDEAARLLDNLYAPRNWRPSWYQG
FT                   NLALLQGDLEEAKKSFEEVWGMLPGEPAPKLALAVVLELLDDPAAKTLYRLCSTTDDGL
FT                   ISATFGLARRLSAEGDPMGAVAALDKVPSSSRHAATATVSAIVILLKDEVDEDLLRAAA
FT                   ERQQRLPKEEPRTLAARALLLGKAVDWMQGRPAHSPPLSGSFLGKPFTLHSLRRQSEFV
FT                   LRALAKRAAHRSQRYALVDLANIVRPRTVF"
FT   gene            complement(121086..122093)
FT                   /locus_tag="Srot_0134"
FT   CDS_pept        complement(121086..122093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0134"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="KEGG: rha:RHA1_ro02194 amino acid ABC transporter
FT                   ATP-binding protein; PFAM: extracellular solute-binding
FT                   protein family 3; SMART: extracellular solute-binding
FT                   protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96623"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA81"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ADG96623.1"
FT                   /translation="MSAAALLRALAASLVSAVLAGCSAQGAAVIAQPSVSLPPLLPAGA
FT                   ALLDSAALSESEEGQCAPPLPLRPYSGNHDPIHGGRLDRILQRGKLVVGLDQGTYPFSY
FT                   RDSATGQMKGFDVAMAREIAQGMLGDPNRVDYRIISSAGRTTALENDSVDIVIKTMSIN
FT                   CKRMKEITFSEPYFETDQRVMAATNANATTLADRKILGESTVCAARGSTAVGHFHHLFP
FT                   TAKILGTTTWADCLVAIQQGSVDAISSDESILYGFYDQDPNLYFLSALQLGREVYGVGM
FT                   HKGEAELERVVNKIIEEIKADGTWTNLCRDNLKFSPCNRPPATPEYAPEEPSTP"
FT   gene            complement(122090..123427)
FT                   /locus_tag="Srot_0135"
FT   CDS_pept        complement(122090..123427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0135"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro02193 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96624"
FT                   /db_xref="GOA:D6ZA82"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA82"
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro02193"
FT                   /protein_id="ADG96624.1"
FT                   /translation="MRTISPLSVLKTDAASLRRGRRTTADEDTDFLELLWERAQTSPGK
FT                   LAATALGLILLIIIAGATVAQAVAERTQGLDTTLRRAEPLTNVTLTLYTELSIADAITG
FT                   AVFLSPGLESQEMRDRYDKAIAAASAATVQVAANTQSQQLETIAEELPVYTKLVESAKV
FT                   YNRAGKPVGAAYLSQASHLMQTVILPAAEHMHRDQIDALEAAQQQQTQLPWAPALLLTL
FT                   ALGSLVLAQLHLSKRSRRRFNPGLILASGCFALLLLWFLVASAFLVTLSGEGQRKGTDP
FT                   LRTLTAARIDVQQARTQETLQLLRRGDEDQLEQSYRSSMAAAHNQLDELDRAQGEPGAR
FT                   QTAASAAQAWEKTHEQLRKDLVAGMYGESVELAIGPSPDACAAQYRSLDKALTSDIEHS
FT                   RRTLRDSVASAREALTALAPATAVLSFLAAAFVVAGYWPRLNEYRA"
FT   gene            123455..124921
FT                   /locus_tag="Srot_0136"
FT   CDS_pept        123455..124921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0136"
FT                   /product="Propeptide PepSY amd peptidase M4"
FT                   /note="PFAM: Propeptide PepSY amd peptidase M4; PepSY-
FT                   associated TM helix domain protein; KEGG: msm:MSMEG_6570
FT                   integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96625"
FT                   /db_xref="GOA:D6ZA83"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA83"
FT                   /inference="protein motif:PFAM:PF03413"
FT                   /protein_id="ADG96625.1"
FT                   /translation="MGLLSRSSEILRSSFPQSSVTKPDAGNFPGLISDLCNMMETVLPE
FT                   PPEVCPPPPARDRRTAVLAFFRRLHFYVGVFVGPFLLVSALTGVLYTVAPSMTQALHRH
FT                   ELSVEAAAAGTLPLSQQVRSAQQTYPGRVVLSVATGADARATTRVVMSGSGCPCTVFVD
FT                   PHTARVRGEAPGDGGQVFEAKWSDDLHRTLFLGEFGRNYAELSASWLWVLVVSGPVLWF
FT                   FGRRTRGGGPKAPRLSLRGSHATLGLALSLGLLFLSASGLSWSLHAGENIDALRTAVSG
FT                   ANPPLAKKLDPPVAPAAQGQPEWLARVDRVHAGARSAGLVDPIVITATDKPDSAWTASD
FT                   RERHYPMRNDRASVNPQTGAVVAVSRFQDWPMLAKITQWAIALHMGLLFGWANQLVLAV
FT                   LGIGLAVMIVLGYRMWWARRPRHDGGAWPAPAPQRGALGELPPSAAAALTGALLFAGWF
FT                   LPLFGASLAGFVLIDALLGWRARRRAREAQ"
FT   gene            124918..125598
FT                   /locus_tag="Srot_0137"
FT   CDS_pept        124918..125598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0137"
FT                   /product="tetratricopeptide TPR_2 repeat protein"
FT                   /note="KEGG: ami:Amir_2588 tetratricopeptide TPR_2 repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96626"
FT                   /db_xref="GOA:D6ZA84"
FT                   /db_xref="InterPro:IPR033458"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA84"
FT                   /inference="similar to AA sequence:KEGG:Amir_2588"
FT                   /protein_id="ADG96626.1"
FT                   /translation="MIADPWLRLALAALFGFSAGYCAWRLLRAGAFRPRLWRGCVGHVF
FT                   HLLMCLSMLAMIWPTTPAVPYSAQTAVFAVATLWFAALALGRSSQRAGRTGFACASGRG
FT                   AAWYHTTMMAAMLWMAAVMSGQLLGGAPPASAAPRPGGMAGMDMPGMSMQAEADGGARH
FT                   TAPMWMSAVDVLLGFMFLAAALWWVRGYFELRRSRGRSVPAEAEMLCEVAMALGMGAML
FT                   FAMV"
FT   gene            125699..127585
FT                   /locus_tag="Srot_0138"
FT   CDS_pept        125699..127585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0138"
FT                   /product="Cytochrome c oxidase caa3-type, assembly factor
FT                   CtaG-related protein"
FT                   /note="PFAM: Cytochrome c oxidase caa3-type, assembly
FT                   factor CtaG-related; KEGG: mul:MUL_4847 integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96627"
FT                   /db_xref="GOA:D6ZA85"
FT                   /db_xref="InterPro:IPR019108"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA85"
FT                   /inference="protein motif:PFAM:PF09678"
FT                   /protein_id="ADG96627.1"
FT                   /translation="MSFLFLIGLVAAVAFAARVGPGPYLAVQVPYPGTEVLLVQVATQF
FT                   VASFAGAVCLGGLVFALCCTRPNAKMRLGPRGYAGLRTAERASPLWAVSALFAMVTSAT
FT                   VQAGRAPWDLLHVEDPVGRLVSLVSVSERSGAWLVVAVLATAVAALSRCCLGWASCAGL
FT                   AWLSVFAVVAPWMTQNAGDGPNHDWASGAAVWTSVGLAVLVGVGAQMRGDWTQDRAAAQ
FT                   RRARRTSAVALGMVAAGSAVLGALLIPLSAMPSTWYGQLGLAAAVLFALAAAAVFFGKL
FT                   TVAAGAGVVLLAVAEAMSVQPAPAFAGQRFSVPELLLGFDFPGAPTLWRLLSAWRFDVV
FT                   FGTLAVLLAAAYVLGAARLRGRGDAWSPWRTLSFLFGCALLLLVTSSGIGRYASGQFSY
FT                   HMISHMGLNMFAPVFLVLGAPVTLLLRAAPTAGQHMAGPREWALALVHARLVQILAHPL
FT                   VAVGLFVVSLYGLYFTPVFGLLVRYHWGHLLMTLHFLAIGYTYYWAIIGVDPGARRLPH
FT                   LARLGMLFAVMPFHAFFGVAVLSDNEIIGGDFYRWLALPWVSDLASDQRVAGAVAWTSG
FT                   EIPIVFVVGALLYQWAGADRRAASRADRHAADYEDAELDAYNHMLQKLVERG"
FT   gene            complement(127637..128215)
FT                   /locus_tag="Srot_0139"
FT   CDS_pept        complement(127637..128215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0139"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_1066 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96628"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA86"
FT                   /inference="similar to AA sequence:KEGG:MAB_1066"
FT                   /protein_id="ADG96628.1"
FT                   /translation="MRVVRSFLLWAVPFVVVFGAAAGFAVWHEQQQGQQARAVAEHKLD
FT                   RFRPGECLTASPGRSGAETFGQDDEDLRLTDCASAGVTLTVGLKVRGEDECPSQYYFTY
FT                   RVNLDGRQVGALCLVENLREGHCYTMSATPPLHEETACSTTAEEAASVRDDRVVKAVEG
FT                   SNDPSVCVDSSPVTYPEPKRVYCMGSPVS"
FT   gene            complement(128222..129313)
FT                   /locus_tag="Srot_0140"
FT   CDS_pept        complement(128222..129313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0140"
FT                   /product="2-nitropropane dioxygenase NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase NPD; KEGG:
FT                   rha:RHA1_ro00808 2-nitropropane dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96629"
FT                   /db_xref="GOA:D6ZA87"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA87"
FT                   /inference="protein motif:PFAM:PF03060"
FT                   /protein_id="ADG96629.1"
FT                   /translation="MPLELEQSRSILPGLAIPIICAPMAGGPSTPQLAAAASNAGGLGF
FT                   LGAGYLDPAATAALLDATRELTVHPFGVNIFVPSSDPVDHAAVAAYRERLLPAAEAAGV
FT                   ALPEAGSADPAHPDDDFYDEKIDLAIDREVPLVSFTFGLPSAQVVAKLHDAGIAVVASV
FT                   ASVSAVSSADALGVDAIVVQGPEAGGHRATLSNHEKPEHVPLADLLLWAAEATTAPLIA
FT                   AGGVSRGSHIAELLASGASAVQLGTAFLRAEEAGTRPAHRAALTDPRFVETSVTNAFSG
FT                   RPARGLRNAFMDAHSSHAPGEYPQVHWLTSPLRAAAAKRGDAESISLWAGVGYPETKSG
FT                   PAAAILSALWEDALAARAEHGGS"
FT   gene            129440..130861
FT                   /locus_tag="Srot_0141"
FT   CDS_pept        129440..130861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0141"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; KEGG: mab:MAB_3032
FT                   soluble pyridine nucleotide transhydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96630"
FT                   /db_xref="GOA:D6ZA88"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA88"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADG96630.1"
FT                   /translation="MSSSASPRYDLVVIGSGPGGQKAAIAAAKLGKSVAIVERKHMLGG
FT                   VCLNTGTIPSKTLREAVLYLTGMNQRELYGASYRVKSNITPEDLFARTAQVIGKETEVV
FT                   RSQLQRNRVEIFPGVASFVDEHTVEVVDDDRGESTRLHGEFFVIATGTRPARLPGVNYD
FT                   EERILDSDEILQLKAIPATMVVVGAGVIGIEYASMFAALGTRVTVVERRPSMLEFCDPE
FT                   VIEALRFHLRDLAVTFRFGEEVTDIEVGPNGAVTKLASGKRIPAETVMYSAGRQGQTEA
FT                   LALENAGLSADDRGRIQVDKHFQTAVDHIYAVGDVIGFPALAATSMDQGRLAAYHAFGE
FT                   SAEGMTELQPIGIYSIPEVSYVGATETELTKAAVPYEVGVSRYRELARGQIAGDSYGML
FT                   KLLVNTDDRKLLGVHIFGSQATELVHIGQAVMGCGGTVDYLIEAVFNYPTLSEAYKVAA
FT                   LDVANKIRALAQYCD"
FT   gene            complement(130858..131616)
FT                   /locus_tag="Srot_0142"
FT   CDS_pept        complement(130858..131616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0142"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rer:RER_59100 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96631"
FT                   /db_xref="GOA:D6ZA89"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR022480"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA89"
FT                   /inference="similar to AA sequence:KEGG:RER_59100"
FT                   /protein_id="ADG96631.1"
FT                   /translation="MRVGLLVSQQRAPSYSSLRDVAARAEELGADALFNTDHFFPWSGD
FT                   GNGAHFECWSMLAAWAEQTSRVQLGALVTGVGYRNPDLLADMARTVDHISGGRLILGLG
FT                   AGWLERDYAEYGYEFPSAGARIGLLAQSLPRIKARLGKLNPPPVGEIPILIGGGGERKT
FT                   LRVVAEHADIWHSFSAVGELTRKSAALAEHCASLGRDPAEIARAASWSGPELTEQLVAA
FT                   GASVIVADTSAPDYDLSALRDALAWKNSRG"
FT   gene            complement(131658..132494)
FT                   /locus_tag="Srot_0143"
FT   CDS_pept        complement(131658..132494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0143"
FT                   /product="cutinase"
FT                   /note="PFAM: cutinase; KEGG: mva:Mvan_1441 cutinase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96632"
FT                   /db_xref="GOA:D6ZA90"
FT                   /db_xref="InterPro:IPR000675"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA90"
FT                   /inference="protein motif:PFAM:PF01083"
FT                   /protein_id="ADG96632.1"
FT                   /translation="MEHSRIPRKSTALAAALFCGAGLAVLAPHAAQAHADACPDVEVAF
FT                   ARGTNEPPGLGYMGEYFVDGLRERLPGKAIDAYAVDYPAVLSPESLGDGGNDLSQHVQN
FT                   VARSCPSTKIVLGGFSQGAGVVDLVTVSPLPTQSINLPILGEVSLADTGFDQPLPTNVF
FT                   PHIAAVAVFGNPVKHVYDGVLPMPDGLRSRTDDECADGDPVCHLPGPDDLSNFHNHDSY
FT                   IDRGLTDKAADFVVQHLGLRPNPPKTPTTSSSPDDDAFRPIQTPPPSDDDEEDGDN"
FT   gene            complement(132593..133435)
FT                   /locus_tag="Srot_0144"
FT   CDS_pept        complement(132593..133435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0144"
FT                   /product="cutinase"
FT                   /note="PFAM: cutinase; KEGG: mab:MAB_3766 cutinase cut3
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96633"
FT                   /db_xref="GOA:D6ZA91"
FT                   /db_xref="InterPro:IPR000675"
FT                   /db_xref="InterPro:IPR011150"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA91"
FT                   /inference="protein motif:PFAM:PF01083"
FT                   /protein_id="ADG96633.1"
FT                   /translation="MMISSRVRGVLSGLLPLLSLSAASLPAVATMAPNAAAAPAGCADY
FT                   DISFARGTGEPAGVGVVGNAFANALKAKEPGKTFNVHGVDYAADYDFVALDLHSLAAGA
FT                   DNLSAHLQDVASRCPDTQFVLGGYSQGAALVDAVISFGVPLLGFSNPLPGDVANRIVGV
FT                   ALFGDATHRVFNGLQPVFITPDLAAKTTNICADGDPICENVEGGLDTQSADFNANHTSY
FT                   VSRGLTAQGAAFVADQINGQPAQAAPAPQPPAENDAQTAPDEDTTAAPEEEGSDADGE"
FT   gene            complement(133559..134989)
FT                   /locus_tag="Srot_0145"
FT   CDS_pept        complement(133559..134989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0145"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /note="TIGRFAM: adenylosuccinate lyase; KEGG: rop:ROP_48780
FT                   adenylosuccinate lyase; PFAM: Adenylosuccinate lyase-like;
FT                   fumarate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96634"
FT                   /db_xref="GOA:D6ZA92"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA92"
FT                   /inference="protein motif:TFAM:TIGR00928"
FT                   /protein_id="ADG96634.1"
FT                   /translation="MSTPQTPDVLAARYATKELVALWSPRARVVLERDLWIAVLKAQIE
FT                   LGVPGGDAASVADYERVKEQVDLDSIAARERVTRHDVKARIDEFNALAGHELVHRGMTS
FT                   RDATENVEQSVIRASLAHVRDHAVAALARLAERAAQYAPTMLVARSHNVPAQATTLGKR
FT                   FATCAQELLIAVRRVDELIERYPLRGIQGPVGTAQDMLDLLGGDRDKFARLQRSVAEHV
FT                   GFTQALVSVGQIYPRSLDHDVVSALVQLAAAPSSFAHTLRLMAGQELATEGFQPGQVGS
FT                   SAMPHKTNPRTSERINGLAVVLRGYASMTAELAGAQWNEGDVFCSVVRRVALPDAFYAI
FT                   DGLFEGFLTVLGEFHAFEPVIEREVARYLPFLGTTRILMAAVRAGVGREAAHEAIKEHA
FT                   VALANDIRERGAEPDLLSRLAQDQRLGLTRAQLDEALADRDLFLGAADDQVRRVIDEVE
FT                   ALVAKHPEAAAYRPGSIL"
FT   gene            complement(135010..136218)
FT                   /locus_tag="Srot_0146"
FT   CDS_pept        complement(135010..136218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0146"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mjl:Mjls_5119 glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96635"
FT                   /db_xref="GOA:D6ZA93"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA93"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96635.1"
FT                   /translation="MGILKRAARGRPAGRAVVAVAVATLLASGCGSNTPVAPTTTSATK
FT                   IPVHWSPDLPAVIAYQGGVGYGLAQSEPTVRNSIQNVGVSVVHVPVVLDNNGTAIAWSS
FT                   TKISDAKCSIAPESADPNGPKPAPDGTIGSNVYALSDETVLQGIVCDKTDPAYPNQSES
FT                   EASGSKLRKLVDLLKVGTSYNNAVERLWFDVELITDPVQKANTATPEQYVAAVVKAMNE
FT                   ARFDNVIISSYDWRTLPLVHSGFKVGTEQIPGLSTVPTVALVRADTFYPGSPWIGGLNL
FT                   SEVHADLIEAAVKLGVDGIAPDFLASQPLPQPEDQTPPGQQKPLLVSKQFLDRAHKAGL
FT                   KVFPQVINNLNDMDHQLKICQGTDSQLHLDQCVDGIITAYPDVLDTELGTLGANRPAKL
FT                   SPR"
FT   gene            complement(136229..136780)
FT                   /locus_tag="Srot_0147"
FT   CDS_pept        complement(136229..136780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0147"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro06131 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96636"
FT                   /db_xref="InterPro:IPR027961"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA94"
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro06131"
FT                   /protein_id="ADG96636.1"
FT                   /translation="MAVFKSKPVTSRTELALRGSALGRAWLKLGKSVPGRVAFSAGYAL
FT                   KAPYFATVTPYVRTIEPGRAEVSAPSWFLTHNHIGSLHAIACCNTAEAAMGLVMEASTP
FT                   STHRWLPKGMTVNYLKIIKGGVRTIAHLPEGFDFSTITEGSEVPVHFQVIDSAGIEVAN
FT                   GTITTWVSPKPLGAAPNQLR"
FT   gene            137246..137551
FT                   /locus_tag="Srot_0148"
FT   CDS_pept        137246..137551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0148"
FT                   /product="ribosomal protein S10"
FT                   /note="KEGG: svi:Svir_03970 SSU ribosomal protein S10P;
FT                   TIGRFAM: ribosomal protein S10; PFAM: ribosomal protein
FT                   S10"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96637"
FT                   /db_xref="GOA:D6ZA95"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA95"
FT                   /inference="protein motif:TFAM:TIGR01049"
FT                   /protein_id="ADG96637.1"
FT                   /translation="MAGQKIRIRLKAYDHEAIDASARKIVETVTRTGASVVGPVPLPTE
FT                   KNVYCVIRSPHKYKDSREHFEMRTHKRMIDILDPTPKTVDALMRINLPASVDVNIQ"
FT   gene            137562..138227
FT                   /locus_tag="Srot_0149"
FT   CDS_pept        137562..138227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0149"
FT                   /product="50S ribosomal protein L3"
FT                   /note="KEGG: nfa:nfa7330 50S ribosomal protein L3; TIGRFAM:
FT                   50S ribosomal protein L3; PFAM: ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96638"
FT                   /db_xref="GOA:D6ZA96"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA96"
FT                   /inference="protein motif:TFAM:TIGR03625"
FT                   /protein_id="ADG96638.1"
FT                   /translation="MTSSTSKNRVGLLGAKLGMTQVFDERNRVVPVTVIRTGVNVVTQV
FT                   RTPERDKYSAIQLAFGHIDPRKVNKPLAGQFEKAGVTPRRHLAEFRLDDVSGYEVGQQI
FT                   DATVFSAGDLVDVTGTSKGKGFAGTMKRHGFKGQGASHGAHKVHRRPGSIGACAFPGRV
FT                   FKGTRMAGRMGNAKTTTQNLTVFRVDPEAGVLLIKGAVPGRDGGLVFIRSAVKKGVAK"
FT   gene            138224..138880
FT                   /locus_tag="Srot_0150"
FT   CDS_pept        138224..138880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0150"
FT                   /product="ribosomal protein L4/L1e"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: mmi:MMAR_1032
FT                   50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96639"
FT                   /db_xref="GOA:D6ZA97"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA97"
FT                   /inference="protein motif:PFAM:PF00573"
FT                   /protein_id="ADG96639.1"
FT                   /translation="MSLTVTIHAADGKSAGTFDLPAEIFDAPANISLLHQVVTAQLAAA
FT                   RQGTHKVKTRGEVSGGGRKPYKQKGTGRARQGSTRAPHFTGGGTVHGPVPRDYSQRTPK
FT                   KMKAAALRGALSDRARGGRVHIVDELVAGQSPSTKKASAFLDSIASRPRLLVVLGRADE
FT                   TGLKSVRNLPHAHILTPDQLNTYDVLKSDDIVFSLEALTTFIEHHKVNKKEEVQA"
FT   gene            138877..139191
FT                   /locus_tag="Srot_0151"
FT   CDS_pept        138877..139191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0151"
FT                   /product="Ribosomal protein L25/L23"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: rer:RER_18540
FT                   50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96640"
FT                   /db_xref="GOA:D6ZA98"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA98"
FT                   /inference="protein motif:PFAM:PF00276"
FT                   /protein_id="ADG96640.1"
FT                   /translation="MTIASIPADPHDVLIRPVVSEKSFALAEQKTYSFVVHPEANKTQV
FT                   KLAVEKVFGVKVARVNIMNRNGKRKRTRFGVGKRADTKRALVSLTESSKTIDIFTTAGA
FT                   "
FT   gene            139209..140045
FT                   /locus_tag="Srot_0152"
FT   CDS_pept        139209..140045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0152"
FT                   /product="ribosomal protein L2"
FT                   /note="KEGG: kse:Ksed_20840 LSU ribosomal protein L2P;
FT                   TIGRFAM: ribosomal protein L2; PFAM: ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96641"
FT                   /db_xref="GOA:D6ZA99"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZA99"
FT                   /inference="protein motif:TFAM:TIGR01171"
FT                   /protein_id="ADG96641.1"
FT                   /translation="MAIRKHKPTSPGRRGSSSSDFAEVTRSTPEKSLLRPLHNKGGRNA
FT                   HGRVTVRHQGGGHKRSYRLIDFRRADKDGVPAKVAHIEYDPNRTSRIALLHYADGEKRY
FT                   IIAPAKLKQGDVVETGPQADIKPGNNLPLKNIPTGTVVHAIELRPGGGAKIARSAGSAV
FT                   QLVAKDGPYAQLRMPSGEIRNVDARCRASVGEVGNAEQSNINWGKAGRNRWKGIRPTVR
FT                   GVVMNPVDHPHGGGEGKTSGGRHPVSPWGKPEGRTRRANKESDKLIVRRRRTGKKR"
FT   gene            140060..140341
FT                   /locus_tag="Srot_0153"
FT   CDS_pept        140060..140341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0153"
FT                   /product="ribosomal protein S19"
FT                   /note="KEGG: mjl:Mjls_1044 30S ribosomal protein S19;
FT                   TIGRFAM: ribosomal protein S19; PFAM: ribosomal protein
FT                   S19/S15"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96642"
FT                   /db_xref="GOA:D6ZAA0"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAA0"
FT                   /inference="protein motif:TFAM:TIGR01050"
FT                   /protein_id="ADG96642.1"
FT                   /translation="MPRSLKKGPFVDDHLLRKVDAQNDKNTHQVIKTWSRRSTILPDFV
FT                   GHTFAVHDGRKHVPVFVSESMVGHKLGEFAPTRTFRSHVKEDRKAKRR"
FT   gene            140338..140823
FT                   /locus_tag="Srot_0154"
FT   CDS_pept        140338..140823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0154"
FT                   /product="ribosomal protein L22"
FT                   /note="KEGG: gbr:Gbro_3753 ribosomal protein L22; TIGRFAM:
FT                   ribosomal protein L22; PFAM: ribosomal protein L22/L17"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96643"
FT                   /db_xref="GOA:D6ZAA1"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAA1"
FT                   /inference="protein motif:TFAM:TIGR01044"
FT                   /protein_id="ADG96643.1"
FT                   /translation="MSTVQDNPTAHASLKGARFSATKARRVIDLIRGKRVDEALAILRF
FT                   APQSASEEVSKVLASAVANAEHNLNLHRSTLVVSKAFADEGPTLKRYQPRAQGRSFRIR
FT                   KRTAHITIEVAAALANERPSRAKRVAGSKQGASKKTESKKTESKKTAATATEKGGEE"
FT   gene            140824..141672
FT                   /locus_tag="Srot_0155"
FT   CDS_pept        140824..141672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0155"
FT                   /product="ribosomal protein S3"
FT                   /note="TIGRFAM: ribosomal protein S3; PFAM: ribosomal
FT                   protein S3- domain protein; Ribosomal protein S3 domain; KH
FT                   type 2 domain protein; KEGG: gbr:Gbro_3752 ribosomal
FT                   protein S3; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96644"
FT                   /db_xref="GOA:D6ZAA2"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAA2"
FT                   /inference="protein motif:TFAM:TIGR01009"
FT                   /protein_id="ADG96644.1"
FT                   /translation="MGQKIHPHGFRLGITTDWRSRWFADKQYKDYIKEDIQIRKLLVSG
FT                   MERAGIAKVEIERTRDRVRVDIHTARPGIVIGRRGAEADRIRGQLEKLTGKQVQLNILE
FT                   VKNSETIAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRHQQVKGIKVMCGGRLGGAEMS
FT                   RSEYYREGRVPLHTLRADIDYGFHEAKTTFGRIGVKVWIYKGDIVGGRVEHAAQLAAAE
FT                   EAGARRDRAARPRRSGASGTTATSTEAGRAGQGPSDPSAAEPVAAAPAAESVANESGQE
FT                   A"
FT   gene            141676..142092
FT                   /locus_tag="Srot_0156"
FT   CDS_pept        141676..142092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0156"
FT                   /product="ribosomal protein L16"
FT                   /note="KEGG: nfa:nfa7400 50S ribosomal protein L16;
FT                   TIGRFAM: ribosomal protein L16; PFAM: Ribosomal protein
FT                   L10e/L16"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96645"
FT                   /db_xref="GOA:D6ZAA3"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAA3"
FT                   /inference="protein motif:TFAM:TIGR01164"
FT                   /protein_id="ADG96645.1"
FT                   /translation="MLIPRKVKHRKQHHPSRSGAAKGGTKVTFGEFGIQALEPAYVTNR
FT                   QIESARIAINRHIRRGGKVWINIYPDRPLTKKPAETRMGSGKGSPEWWIANVKPGRVLF
FT                   EMSFPNEETAREALRRAQHKLPLKTRIVTREEQF"
FT   gene            142092..142442
FT                   /locus_tag="Srot_0157"
FT   CDS_pept        142092..142442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0157"
FT                   /product="ribosomal protein L29"
FT                   /note="KEGG: ach:Achl_2679 ribosomal protein L29; TIGRFAM:
FT                   ribosomal protein L29; PFAM: ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96646"
FT                   /db_xref="GOA:D6ZAA4"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAA4"
FT                   /inference="protein motif:TFAM:TIGR00012"
FT                   /protein_id="ADG96646.1"
FT                   /translation="MAHRTKAADLRERGRDDLVEQLGKLKEEALHLRFQLATGQLAKNS
FT                   RVSEVKREIAQVYTVIRERELGLSAEPTAEQAKAKKAEKKTDKAEKTDKAEKAEKKESK
FT                   AKKSEKTEGEDA"
FT   gene            142439..142729
FT                   /locus_tag="Srot_0158"
FT   CDS_pept        142439..142729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0158"
FT                   /product="30S ribosomal protein S17"
FT                   /note="KEGG: gbr:Gbro_3749 30S ribosomal protein S17;
FT                   TIGRFAM: 30S ribosomal protein S17; PFAM: ribosomal protein
FT                   S17"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96647"
FT                   /db_xref="GOA:D6ZAA5"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAA5"
FT                   /inference="protein motif:TFAM:TIGR03635"
FT                   /protein_id="ADG96647.1"
FT                   /translation="MSATKTEPTPQAARTSRRKVRSGVVVSDKMDKTIVVELVDRHRHP
FT                   LYGKIIRTTKKVKAHDEQQDAHIGDTVRIMETRPLSATKHWRLVEVLERAK"
FT   gene            142851..144602
FT                   /locus_tag="Srot_0159"
FT   CDS_pept        142851..144602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0159"
FT                   /product="protein of unknown function DUF1023"
FT                   /note="PFAM: protein of unknown function DUF1023; KEGG:
FT                   rop:ROP_19500 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96648"
FT                   /db_xref="InterPro:IPR010427"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAA6"
FT                   /inference="protein motif:PFAM:PF06259"
FT                   /protein_id="ADG96648.1"
FT                   /translation="MNLGDIRRVDTGAFGDLATSLSSRVASIQDAQGSFAKITQFPGWS
FT                   GAAKDAATQNFQNIDTSLLDDIARLSAVREAVSELHDDFTQLQTELRALEQEADALGAT
FT                   IDDNGFVHDKPDAHISDAQRARIANLSAEVAEVIRAANRLDEKAADVLKRATDGTITAG
FT                   GAADDAQAAHAGEQQGELGVADPPPGKGSPDANTGWWNSLPPKQRQWVIDNHPDWIGGR
FT                   DGVSASARDAANRTLIPAERARLTAERDRLQRELDSNPFGGAFSDKDAQLWYVKKKLDD
FT                   LDAIDRSLNQYGKDAKLLVLDMRSGERGKAAIALGDPDTADHISVTTPGLDSSVGGSLN
FT                   GMVGEASDLKSETERILRAQGKPGETVSTIAWIGYQCPHVDGPGWGDWARGGADVSQDT
FT                   LAKAGAQDLSRFYQGLNAAWHPSDGRADTGPQITALGHSYGSLTTSLALQQTPPGVVQN
FT                   AVLYGSPGIEADSAQQLHMQAGHIFAMQGDGDTIKLAAGTGNFGADPSVQSWVTRLSTH
FT                   EGITLGDSLDGIGVRHEGIQQNGHEHSQYPQNGSNGELRMPGYNMAAVVAGMTGDDGRK
FT                   DVTQHGE"
FT   gene            144592..145263
FT                   /locus_tag="Srot_0160"
FT   CDS_pept        144592..145263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0160"
FT                   /product="lipoprotein LppV"
FT                   /note="KEGG: mul:MUL_2139 lipoprotein LppV"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96649"
FT                   /db_xref="GOA:D6ZAA7"
FT                   /db_xref="InterPro:IPR032018"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAA7"
FT                   /inference="similar to AA sequence:KEGG:MUL_2139"
FT                   /protein_id="ADG96649.1"
FT                   /translation="MGSEMSTDEAVRGDGGGVPRRSWWGRVWKRVLIVLLVLAVCCGGG
FT                   CLALRKAVDSLDPNPKHMTKEQAEAFEERYWNKSTLEQEGQKLEALLARTGDEIAALVP
FT                   GLTWSWKDDMSRTGCPGDPAADTWVGRFWARKVVFDGPIPPGVWPQAVEVVRRAAASYG
FT                   ATEYQNFIDKPDNHDSNFYSPEGARIGLTSAVAAVLVGVTPCRLPERYFTERHLPVPGA
FT                   K"
FT   gene            145273..145596
FT                   /locus_tag="Srot_0161"
FT   CDS_pept        145273..145596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0161"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro02236 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96650"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAA8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96650.1"
FT                   /translation="MPANTPTGAGPHVRAELDELRSGVDQLRNLAEETKDKLASSDSAL
FT                   AGAKSAWPGMRAAGVFAAYADAETARGAAMAESFTTAGDNVAHAAEQYEHVDGVNADAL
FT                   RLR"
FT   gene            145593..146252
FT                   /locus_tag="Srot_0162"
FT   CDS_pept        145593..146252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0162"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro02234 lipoprotein LppV"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96651"
FT                   /db_xref="InterPro:IPR032018"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAA9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96651.1"
FT                   /translation="MSTDDTMRAGGSSAPRRSWWRRVWKRVLVVLLVLAVCCGGGCVAL
FT                   RKLVDSLDPNPKHMTKEQVAAFEARYLDKGTAEQEARNLEDLLARTGDEIVALVPGLKW
FT                   SWNRDWGRLSCPGDAASDTQVVQIWVRQLVFDGPIPPGVWPQAVAVVRRAAASYGATKY
FT                   QNFIDKPDNRDVNFYSPEGARIGLTSAVLAVLIGVTPCRLPEWYFTERHLPVPAGK"
FT   gene            146375..147058
FT                   /locus_tag="Srot_0163"
FT   CDS_pept        146375..147058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0163"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rop:ROP_19490 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96652"
FT                   /db_xref="GOA:D6ZAB0"
FT                   /db_xref="InterPro:IPR032018"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAB0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96652.1"
FT                   /translation="MPNTEAAMRKRKFWIVSLVIATAVLGSVVFCVGGFFLLGSWGSQL
FT                   DPDHTSPHEVAQTEAALRRGGPAEADAQRVEAALIRAADAVAAQHPGVAWHWGEQTPEP
FT                   LDCNPYHMFPATPPEQIVVRRVLFEGDLAAPARDAALAVFEEQAKAVGASLKDSFTTSD
FT                   GRSGVTFSRSPGDIAFVVTWGRVDPRVVGNPTQEQQAAAVVEGRSACLFPQRYFTDRHL
FT                   ATPNR"
FT   gene            complement(147122..149386)
FT                   /locus_tag="Srot_0164"
FT   CDS_pept        complement(147122..149386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0164"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="KEGG: sen:SACE_6624 cation-transporting ATPase;
FT                   TIGRFAM: heavy metal translocating P-type ATPase;
FT                   copper-translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase-associated domain protein; Heavy metal
FT                   transport/detoxification protein; Haloacid dehalogenase
FT                   domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96653"
FT                   /db_xref="GOA:D6ZAB1"
FT                   /db_xref="InterPro:IPR000579"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAB1"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ADG96653.1"
FT                   /translation="MTAVFEPGSLRRTRYAVSGMTCGACSARVGRALGKLDGVRAEVNL
FT                   ATGVAVVDAPESVAPDEIVAVVGKAGYAAALIEANARAAALAEEADQAEEREVQDLFRR
FT                   LAVALLLFFPLANLSVLFAMEPGFRIPGWQWLLTALALPVVLWCAAPMRRRALAALRSG
FT                   GATMDTLVTLGVWAAFGWSLWSMFATTGQPRPAPAGVLATILASDGVYLEVAAGITVFV
FT                   LAGRYFEAKAKQRAGAGTRALAALAAREVTLLIDDREVRASVEDLVEGSRFSVRPGETI
FT                   ATDGLVLSGAADVDMSAMTGEPNPVPVEPGSAVVGGTICLTGRLVVEAAAVGEDTRLAG
FT                   MLRLVEEAQIGKGKATELADRVSAFFVPSVLLIAAATFVGWLLAGAETARAVGVAISVL
FT                   VIACPCALGLAVPTALMVAAGRGALLGVFLKGPRALEATRDVDAVVFDKTGVITTAKMR
FT                   VASVALADGAAEAEAARLAGAVEAASEHPVGAAIASWARGVVPALPEVHGFLALPGSGV
FT                   RGTVDGCDVEVTRPDTRRDAPRPDLPPELARAVREQQRNGATAVVLRKDGAAIAVLGLS
FT                   DTVQDSAAAAVARLRARGLRLLLLTGDNASAAQLVADQVGIPEVIAEVAPEGKADVLRQ
FT                   LQEGGLRVAFVGDGINDGPALAVADLGMAVFTGTDVALSAADVIVVREDLGAVPDAIAL
FT                   ARATLRTLRGNLLWAFGYNVAAIPVAVLGFANPLLASAAMAFSSFFVVANSLRLRRTDI
FT                   R"
FT   gene            complement(149383..149760)
FT                   /locus_tag="Srot_0165"
FT   CDS_pept        complement(149383..149760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0165"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ami:Amir_2774 putative integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96654"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAB2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96654.1"
FT                   /translation="MRSAPEPSSREGSRIPCGTAQESLSARLDGEREPVPAHRVDAHVA
FT                   ACDDCAQWWRQAQTQAAALRLAAVPAAPVFEVALPKPKRSWRSRLSVWSPKPEEVEVRV
FT                   PQGARPGRRTGHLRPAPERPE"
FT   gene            149799..150419
FT                   /locus_tag="Srot_0166"
FT   CDS_pept        149799..150419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0166"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: mmi:MMAR_0265 ECF subfamily RNA polymerase
FT                   sigma factor; TIGRFAM: RNA polymerase sigma factor,
FT                   sigma-70 family; PFAM: Sigma-70 region 4 type 2; sigma-70
FT                   region 2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96655"
FT                   /db_xref="GOA:D6ZAB3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAB3"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADG96655.1"
FT                   /translation="MRAAAAPHDILGSMLQSDGEDRATAFALAAARGDRKALAAFVAET
FT                   QRDVWRFLAHLTDPTQADDLTQETFLRAMTSIARFEGRSNGRVWLLSIARRVVVDQIRS
FT                   AVARPRSAPGADPGLAPVVRRREVAEHGAQVELSLVKMLLEDLAPERREALVLTQMLGL
FT                   SYAEAAAVCDCPVGTVRSRVARAREDLVEASREQSGDAVRGAG"
FT   gene            150406..151941
FT                   /locus_tag="Srot_0167"
FT   CDS_pept        150406..151941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0167"
FT                   /product="protein of unknown function DUF43"
FT                   /note="PFAM: protein of unknown function DUF43; KEGG:
FT                   sen:SACE_6413 methyltransferases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96656"
FT                   /db_xref="InterPro:IPR002723"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAB4"
FT                   /inference="protein motif:PFAM:PF01861"
FT                   /protein_id="ADG96656.1"
FT                   /translation="MALADIALLLARQTACNRQHLAVLARLLAGGASLQELIDAAALSR
FT                   RGVEAFLRVAGEDVVADADGRQGLRPQAREGYEALLASASRPELRPELLEELRAARARA
FT                   PKPNRNLDHVAATAETVLRRASWIARRFETNGLRVLFVGDHDLTSLAVAKLCPSADIAV
FT                   VDIDEALVEFLAAELSSSGAKFRVRHADLRQRFPADLEAWADLFVADPPYTPDGVALFC
FT                   ARGAQGLRCLAQGRGLVAYGYGEAQPALGLAVQKAIVGLDCLVEELIPDFNRYQGAQAI
FT                   GSASDLHLLRFAPSAAKKVDRIASGGAPAAIYTHGRQSVESSAAAGALDLRKHEPSALF
FT                   RALLWEQGDQLALLVDNNHPDVRSADAQARLREDFAEKWNLRLRKSAPDSVSAIIEADA
FT                   VGGAGPRGLVLARPHGKVKNVLREALVRSAGGRTKNQARELVGSILASLGPWGEGVGEC
FT                   VVGDAPRAMLRTVLHAMENAVSHAMENAVLHAMGDAVSHAMEDAARGARQEGT"
FT   gene            151941..152477
FT                   /locus_tag="Srot_0168"
FT   CDS_pept        151941..152477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0168"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   nfa:nfa45760 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96657"
FT                   /db_xref="GOA:D6ZAB5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAB5"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADG96657.1"
FT                   /translation="MATNTAAPGPRAGIVRRARPEDVPAMRAMVYDLAVYEKAPEQCHL
FT                   TEEQLHASLFGERPAVFAHVAVSPEEESRHDTPGEVVGMAVWFLNYSTWDGVHGIYLED
FT                   LYVRPQSRGSGLGKQLLAALAGECVRNGWSRLSWSVLDWNAPAIGFYQSIGAKAQDEWT
FT                   TYRLCGPELRALAEG"
FT   gene            complement(152485..153042)
FT                   /locus_tag="Srot_0169"
FT   CDS_pept        complement(152485..153042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0169"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   acp:A2cp1_1876 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96658"
FT                   /db_xref="GOA:D6ZAB6"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAB6"
FT                   /inference="protein motif:PFAM:PF03641"
FT                   /protein_id="ADG96658.1"
FT                   /translation="MKVAVYCGASTGTDPAHAAAAADFASALARAGVHIVYGGGHKGLM
FT                   GVVADAALAEGGQVHGVIPASLVEKELAHQHLTTQRVVETMHQRKELMLALADAAVALP
FT                   GGLGTLDELFDVWGSAQLALHPKPVGVLNANGFWTDLLAAVRGVREAGFIADSSYDLLI
FT                   VAQDAQDYLKQVESFAHPGGRF"
FT   gene            153214..154587
FT                   /locus_tag="Srot_0170"
FT   CDS_pept        153214..154587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0170"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_0256c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96659"
FT                   /db_xref="GOA:D6ZAB7"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAB7"
FT                   /inference="similar to AA sequence:KEGG:MAB_0256c"
FT                   /protein_id="ADG96659.1"
FT                   /translation="MTSRAVLQHQWERLRHALLKERPEPLEGVDPYPDEDVLTMLRQLG
FT                   IAMIETGQPTNLVESQLRAIGLAYTGHEVRVLVFPTYLIVQLDSPLQTKTQVDEPSWAV
FT                   ARLDQAGEVDTLVKLAKARAATPAEVTARTKAARGWAPRFGAFTTVLGHTLLTIGFGLA
FT                   LQPTWASLPAYALLGLVVGMLLLLGRWLPSVAIMLPPIAATLVTVLTTWYLAEAAGDGL
FT                   LRVLAPALVSVLPGVTLTIGAVELTSTQVISGSTRLMYGAAQLLLLALGVAVGVRIAGP
FT                   LSQHRGPLGALPAHGGLGAWAPCLGAVVAAVGFYLYKSAPKGSLPAIAATMLVALVGQQ
FT                   LGGTYVDPLLAGFLGALVTVPFAQLIGRFRGAPPPMVLLIAAFWFLVPGALSFVNVGEV
FT                   VTTGGVAALSQPGVGGARALLSAVVAIFSIALGMLHGWGVDYAGVSLARLWRARFRST"
FT   gene            154686..157136
FT                   /locus_tag="Srot_0171"
FT   CDS_pept        154686..157136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0171"
FT                   /product="hydrolase CocE/NonD family protein"
FT                   /note="KEGG: nfa:nfa51880 putative peptidase; TIGRFAM:
FT                   hydrolase CocE/NonD family protein; PFAM: peptidase S15;
FT                   X-Pro dipeptidyl-peptidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96660"
FT                   /db_xref="GOA:D6ZAB8"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR005674"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013736"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAB8"
FT                   /inference="protein motif:TFAM:TIGR00976"
FT                   /protein_id="ADG96660.1"
FT                   /translation="MDNGFARCFARWLGTGFASAGLTAAAWLTASAAASADETAASSEG
FT                   AGAFAPIAPLRDSGLIASNARVAAEADDEANLAAEAPDDADDEASAQDVDVDEREAADA
FT                   NDPKYPDQFTLGDLENQWSDTWENDLQYTNIGIDWDVPITMSDGTVLKANVYRPLNDDG
FT                   TPVDEQLPVIVNITPYTKLASMAIDSIMIPHYGENWVNFFGDMYMPPGLKGLEQLLQGF
FT                   NSGFFQELGVDRRLLQSGYAQVVVDQRGTGFSQGTWQVLGKREQLDDKEVVEWASEQPW
FT                   SNGKVGMTGVSYSAINQLQAAQQHPKGLKALFPVVPSADLVADVVAPGGGVGVGFLPYW
FT                   LSLINFMKVLPDLSASAGGTYDWQWADDRRKEVFVKLDLLAQALNTPDIDKVAEYYLDS
FT                   LDEDSPILQEVQRRQAQGQSMGQILVAIARTGSPWRDKALSEGDPHRIPLDVANFADET
FT                   SPWRKDLITDVSKVDVPTFVVGGWHDLFVNSEVRLLNELPLPPSEKKVLIGDWYHFTTG
FT                   SGLGKYPNPPRMDVLARAWFDHWLKGIDNGIDTFAPATFFSQSGGSGVWTNADEWPRKG
FT                   MEYQKLYLSGQQAMSTAFSMLDGSLAEQPDEDENGHWISFGLTNMCSRDMNQPFLGFMA
FT                   WIDACHIDSRIAELNGLTFTSAPVEEQTVISGPIAVHLNTVQQNKDGYWDVTVNDVDEF
FT                   GQSTVLSTGQLVVSLRGLNESKTTRLPDGTVVDPYPVLDFANWRPVEPGDPTPIDVGVV
FT                   PTDATLEPGHRLRVDVFASNFPKSIPIWPLMDDMRLAPQLLELDPDSPSWVVLPVNRNI
FT                   PGVS"
FT   gene            157136..157678
FT                   /locus_tag="Srot_0172"
FT   CDS_pept        157136..157678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0172"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aac:Aaci_1308 carbamoyl-phosphate synthase,
FT                   large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96661"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAB9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96661.1"
FT                   /translation="MQHVRSRPFLLVSVALLVGVPAAHAAPPDGDVACRGLIALDRRLA
FT                   TLDRQFGELNPADPPEILAPKQKDLLKLMRADAVSLRKVLTQTGKPLGNEDADKGLPEF
FT                   LAKAAAFVSWFDKPDAELTDDQRQQVTDAVGEYRFGVGQSCDYYAPHDPETDPEGKNGD
FT                   PYPPGHNGFGDYSPEHQ"
FT   gene            157694..158605
FT                   /locus_tag="Srot_0173"
FT   CDS_pept        157694..158605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0173"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nml:Namu_0091 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96662"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAC0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96662.1"
FT                   /translation="MRGGVRLGRSRFLSARSRTVGGMREDSKQLARLRDGPPGSRALWV
FT                   YDEQDWAVMRAQPSGSLVCPVPGCGAPFTVVRQNERGTRWLVDLPSLAGQTGRTAGCSH
FT                   TLTRPGAGGGPMSAQHRWMQERLRRICAALGHESIPEHHETNADLYVPGARLVIEVQRW
FT                   ATDFAGRTKARERAGARVLWLITEDAAGRSVERALRRQPCVRVRVHERGDRRARLEPWL
FT                   RPQEASRAVLSVGARVAVSGPADGRSRLAWRDGCGFLAEVIDGRRVWTPGGAWASAQSQ
FT                   RPAAAAPAPRRLRLVFWRGDQG"
FT   gene            complement(158570..159208)
FT                   /locus_tag="Srot_0174"
FT   CDS_pept        complement(158570..159208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0174"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: cai:Caci_7871
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96663"
FT                   /db_xref="GOA:D6ZAC1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAC1"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG96663.1"
FT                   /translation="MSNTVSRRPYAPRMPAEQRREQILDAALALICSGGIEAVTVDAVA
FT                   KSIGVTRPVVYSQFTDSNNILRESLKREGNLAIAQLAAIVPKNLNDAEPTTVLTDMTRS
FT                   FLETVLSSPNRWRSILLPAYGGSPPAWQKFKKRAEATAFEVLTGFLKTLAGARQKDMDL
FT                   ELAAHALLRAWEEAGRLVLADPEVYTVERLTTFYSALFSSLVTTPKHKP"
FT   gene            159292..159972
FT                   /locus_tag="Srot_0175"
FT   CDS_pept        159292..159972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0175"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: dze:Dd1591_3141
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96664"
FT                   /db_xref="GOA:D6ZAC2"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAC2"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ADG96664.1"
FT                   /translation="MAEILDFSELVRARHSVRAFLPEPLSKEELDGVLGDAQRSPSNSN
FT                   TQPWRVHIVSGAKRDELRAALLDAAARGETSLDFSFDPKYGQNEVLLEHMRQFGQVYYE
FT                   TMGVSRDDAEGRSKLMLRNLGFFNAPHVAFLFLPVVGDSVRVAADIGMYAQTFLLSLVA
FT                   RGFGGIPQTMLGHFANTVREVLGISEEHKLLFGISFGRPDESALENSFRVDRTPVEHSV
FT                   VLHS"
FT   gene            160145..160960
FT                   /locus_tag="Srot_0176"
FT   CDS_pept        160145..160960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0176"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mjl:Mjls_2657 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96665"
FT                   /db_xref="GOA:D6ZAC3"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR022480"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAC3"
FT                   /inference="similar to AA sequence:KEGG:Mjls_2657"
FT                   /protein_id="ADG96665.1"
FT                   /translation="MPRPIRVSLFIPPTRLASYSAVRDQVTAAEETGADILFGYDHFFP
FT                   PEVTGFKDGVPELADPQPDLPNFEPLTALAAWAEQTSRPELGLLVTGVGYRNPDLLADI
FT                   ARTIDHISGGRHILGLGAGWYKPDYDEYGYEFGTFTTRFKLFEESLERITARFAKLNPA
FT                   PTRHIPVLIGGGGEKKTLPLVAKHADIWHSFSDLESLHRKKDILTGLLEQNGRAADAVE
FT                   ISQNWPGAEQADAYVAAGVTLFNVDYRLDDPEKVAAVREIIAWRDKANG"
FT   gene            160976..161209
FT                   /locus_tag="Srot_0177"
FT   CDS_pept        160976..161209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0177"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Gm7921, EG666080; predicted gene 7921"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96666"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAC4"
FT                   /inference="similar to AA sequence:KEGG:666080"
FT                   /protein_id="ADG96666.1"
FT                   /translation="MRGGWAAPAAMRPASFWLLRAGSSASWMKAPRRAFASAWGEGGLD
FT                   GFGRVEPFGPDRDGGLLCREFFGRKRAHATYA"
FT   gene            161413..162831
FT                   /locus_tag="Srot_0178"
FT   CDS_pept        161413..162831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0178"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   svi:Svir_32050 nitrate/nitrite transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96667"
FT                   /db_xref="GOA:D6ZAC5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAC5"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG96667.1"
FT                   /translation="MPSPTAEKVQTIEKAQTPSAGGTPFGFGEDEALGARTKMGIAAAR
FT                   ASSKAGIPPTLALGFLGLLFFMIGDGVESGFITPFIASHGGGAKAVAAYLITGYGVAVA
FT                   AASWLAGALSQVFGPKKVMWAGFGIWLVFDVVFLLAAMDHNFPLMALGYCVRGFGYPLF
FT                   AYGFLVWITAVTPKRRLGTAVGWFYFAFTGGFPTLGSLVASFAIPGFGQGDQERGEFGT
FT                   LWLAVGILAAGAFLALFGVRDKRGAEPTAGAGGRPFKSLLSSFTVAYHHPKVALGVLVR
FT                   MINTTPQYALLVLFPSVYTNLLGKGDPIAGSQKWLLLVAVIFGTNVGFNLVFGALSDRI
FT                   GWRPTIAWFGAVGSAATFSLFYFLTPLVGPDRFWLILVLGGAYGATLGGFVPISALVPQ
FT                   LAPENRGGAIAMLNLGAGASYFVGPGIVSLFLTLLGSGKFATTVIVLTLSATYCVAAPL
FT                   AFLLRAPDEEEAGA"
FT   gene            163032..163526
FT                   /locus_tag="Srot_0179"
FT   CDS_pept        163032..163526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0179"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: mjl:Mjls_2702 NLP/P60
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96668"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAC6"
FT                   /inference="protein motif:PFAM:PF00877"
FT                   /protein_id="ADG96668.1"
FT                   /translation="MRRVPAAMIAGLVFLGTAKSFALAEPVNHPVNDEQQSVSTAIARA
FT                   LAQRGMPYVYGGGNAQGPTGNPNGTGVVGFDASGLMVYAFAGAGVKLPRTSTDQYNKAG
FT                   RSVWPQQAQPGDLIFYGPNGTESVAMYLGNGQMLEATNPVVTISPVRSEGMAPYMIRVI
FT                   G"
FT   gene            complement(163587..164705)
FT                   /locus_tag="Srot_0180"
FT   CDS_pept        complement(163587..164705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0180"
FT                   /product="phosphoserine aminotransferase"
FT                   /note="KEGG: mlb:MLBr_02136 putative phosphoserine
FT                   aminotransferase; TIGRFAM: phosphoserine aminotransferase;
FT                   PFAM: aminotransferase class V"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96669"
FT                   /db_xref="GOA:D6ZAC7"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR006272"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAC7"
FT                   /inference="protein motif:TFAM:TIGR01366"
FT                   /protein_id="ADG96669.1"
FT                   /translation="MTALEIPSGLKPKDGRFGSGPSKVRPEQIQAIAASAATVLGTSHR
FT                   QAPVKNVVKRVRAGLKELYSLPDGYEVLLGNGGATFFWDAAAFGLIRERSLHLSFGEFS
FT                   AKFASVVAKHPDRKEPVVVQSDPGSAPAVPDSAPAEPVDVLAWAHNETSTGVTVPVARP
FT                   SWAKDELVVIDGTSAAAGVPLDVTQTDVYYFSPQKGFASDGGLWLALLSPAAIERVNEL
FT                   SGRWAPESISLPTALENSTKDQTYNTPAVATLVLLAEQIEWINGQGGLAWSTARTKDSS
FT                   SRLYDWAEQSEFATPFVTDPALRSPVVATIDFHEEVDAAKVAKTLRENGIVDTEPYRKL
FT                   GRNQLRLGVFPAVDPEDVTALTKAIDWVVERL"
FT   gene            164771..165409
FT                   /locus_tag="Srot_0181"
FT   CDS_pept        164771..165409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0181"
FT                   /product="pyridoxamine 5'-phosphate oxidase"
FT                   /EC_number="1.4.3.5"
FT                   /note="TIGRFAM: pyridoxamine 5'-phosphate oxidase; KEGG:
FT                   msm:MSMEG_5675 pyridoxamine 5'-phosphate oxidase; PFAM:
FT                   Pyridoxine 5'-phosphate oxidase, dimerisation- like;
FT                   pyridoxamine 5'-phosphate oxidase-related FMN- binding"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96670"
FT                   /db_xref="GOA:D6ZAC8"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAC8"
FT                   /inference="protein motif:TFAM:TIGR00558"
FT                   /protein_id="ADG96670.1"
FT                   /translation="MPDLREEYTDVSPDLDVADVQAGWPELLQNWLAQAWESGLPDANA
FT                   LVLATVDDAGRPHSRSVLCKGISADGIDFYTHYASAKGRQLAACPHASATFPWYGLSRQ
FT                   VHLRGEVRKLDHDCSIGYWSNRPRGSQLGAWASEQSRPIASREALVAQLRAAAERFPEG
FT                   EPVPLPPGWGGYRLVPFEVEFWQGRANRLHNRVLLALADGQWRATRLQP"
FT   gene            complement(165421..166146)
FT                   /locus_tag="Srot_0182"
FT   CDS_pept        complement(165421..166146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0182"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cai:Caci_2339 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96671"
FT                   /db_xref="InterPro:IPR026954"
FT                   /db_xref="InterPro:IPR038232"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAC9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96671.1"
FT                   /translation="MVQVTKIAGARVCFCCVWDYTGGPMRIPLFASFFTAAAMLCSATP
FT                   AAAAPESPLLSSDELSDIVGADLSADLWELTSPNGPSQTTPVECRTMSNATTTLVYGAS
FT                   WSRYAGAGYADGEGSAYRTVAGQIVGVFPTAKAASDVFAALVKGLRSCGSKTSVEHRSS
FT                   GDLTWRNAVDQITAAGASWHSLLDNKPRWRCSLNARLDETAVVEASVCAFIDPNSAEQA
FT                   AALANKVAAIANELVARAD"
FT   gene            complement(166212..167075)
FT                   /locus_tag="Srot_0183"
FT   CDS_pept        complement(166212..167075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0183"
FT                   /product="Allophanate hydrolase subunit 2"
FT                   /note="KEGG: nfa:nfa56520 hypothetical protein; PFAM:
FT                   Allophanate hydrolase subunit 2; SMART: Allophanate
FT                   hydrolase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96672"
FT                   /db_xref="GOA:D6ZAD0"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAD0"
FT                   /inference="protein motif:PFAM:PF02626"
FT                   /protein_id="ADG96672.1"
FT                   /translation="MTTERSALVLATGPLALFQDLGRPGLAHLGVPRSGAADRGALATV
FT                   NQLLGNDPAAAAIECLFGGFSLRAEATLELLLAGAPAPGTVDGAPVERLARFELRTGET
FT                   LELGMAPVGARVYIGARGGFEAPRSLGSRSTCTLTGLGPAPIRPGGRIAVAEPAPQAPP
FT                   WDFLSLGPRPGGGPAVLRGRLGPRADRVAGLDLAAQTWVAQEQSDRVGVRLRSSGAGPR
FT                   WRFEPQRSEPVAHGSVQATPSGELICFLADHPTTGGYPVVGVLDEPAVGLVAQLRPGEH
FT                   ARFALS"
FT   gene            complement(167072..167674)
FT                   /locus_tag="Srot_0184"
FT   CDS_pept        complement(167072..167674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0184"
FT                   /product="Allophanate hydrolase subunit 1"
FT                   /note="KEGG: rer:RER_06990 hypothetical protein; PFAM:
FT                   Allophanate hydrolase subunit 1; SMART: Allophanate
FT                   hydrolase subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96673"
FT                   /db_xref="GOA:D6ZAD1"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAD1"
FT                   /inference="protein motif:PFAM:PF02682"
FT                   /protein_id="ADG96673.1"
FT                   /translation="MRVMQAGTNALLIECEGQEQVFALYKRLRADRRFVEAVPGDRTLL
FT                   VVADSDIRDTGLVEEVHATEIHVTAEPPGPVVVVKVRYDGPDLAEVAELTGMSVREVVD
FT                   AHTGSAWTTQFLGFSPGFAYLANPEAGLAVPRRESPRARVPAGAVALGAAYCAVYPMAT
FT                   PGGWRLIGATDAPMWDPRRDPPALLAPGSTVVFEAVT"
FT   gene            167809..169137
FT                   /locus_tag="Srot_0185"
FT   CDS_pept        167809..169137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0185"
FT                   /product="citrate synthase I"
FT                   /EC_number="2.3.3.1"
FT                   /note="TIGRFAM: citrate synthase I; KEGG: rha:RHA1_ro04998
FT                   type II citrate synthase; PFAM: Citrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96674"
FT                   /db_xref="GOA:D6ZAD2"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR010953"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAD2"
FT                   /inference="protein motif:TFAM:TIGR01798"
FT                   /protein_id="ADG96674.1"
FT                   /translation="MSVAQPAERTDQNAVGAATLRYPGGEKELTVTPAVEGNAGVQLGD
FT                   LLASTGYVTYDEGFMNTASTKSAITYIDGEHGILRYRGYPIDQLAQKSTFLEVSYLLIY
FT                   GELPTAAQLEEFAHKISRHTMLHEDLKRFFDGFPRDAHPMPVLSSAVNALSAYYPDSVD
FT                   PSDPAQVEQSTLRLLAKLPTIAAYAYKKSVGQPFLYPDNSLNLVENFLRMTFGFPAEPY
FT                   DIDPNVVKALDMLFILHADHEQNCSTSTVRLVGSSNANLFTSVSGGINALWGPLHGGAN
FT                   QAVLEMLDQIKASGESASDFLAKVKDKKTRIKLMGFGHRVYRNYDPRAAIVKQTADQIL
FT                   NQLKVTDELLDIAKELEQAALTDEYFVSRKLYPNVDFYTGLIYRAMGFPDRMFTVLFAL
FT                   GRLPGWIAHWREMHDSGPLKIGRPRQIYTGQPERPYVSLTDRV"
FT   gene            169134..170051
FT                   /locus_tag="Srot_0186"
FT   CDS_pept        169134..170051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0186"
FT                   /product="cell envelope-related transcriptional attenuator"
FT                   /note="KEGG: mgi:Mflv_1142 cell envelope-related
FT                   transcriptional attenuator; TIGRFAM: cell envelope-related
FT                   function transcriptional attenuator, LytR/CpsA family;
FT                   PFAM: cell envelope-related transcriptional attenuator"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96675"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAD3"
FT                   /inference="protein motif:TFAM:TIGR00350"
FT                   /protein_id="ADG96675.1"
FT                   /translation="MTRWLGRFVRRLAAAVLVLTAGLAVAAFALDTQLRRSDVLDDYPG
FT                   RPETASGTNWLLVGSDSRIALSERQQEQLATGGDVGPAHSDTVLLIHVPDSGPATVVSL
FT                   PRDSSVQIPGESGRNKLNTAYARGGGRLLAQTVELATGVRLDHYAEIGFGGLADLVQAV
FT                   GGVDVCLDEPINDPLAGIDLPQGCQRLDGAQALGVSRSRATPRADLDRMLHQRALIGSL
FT                   MAKLGSPWTLADPSRISALWHAATEDVVFDDSVHVWQLGELAKALNGPVDATAVPISGF
FT                   ANTDVGNVVLWDKDQAKALFQSLR"
FT   gene            complement(170043..171212)
FT                   /locus_tag="Srot_0187"
FT   CDS_pept        complement(170043..171212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0187"
FT                   /product="monooxygenase FAD-binding protein"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG: gbr:Gbro_3294
FT                   monooxygenase FAD-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96676"
FT                   /db_xref="GOA:D6ZAD4"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAD4"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ADG96676.1"
FT                   /translation="MVKAVIIGAGMGGTSAALALRHIGFDVEIYEQVRENKPVGAAISV
FT                   WSNGVKCLNHLGLEAQTAKLGGTMNSMSYINGLSGEVMCRFSMLPLIEAVGQRPYPIAR
FT                   AELQLMLMEKFGVDEIQFGKKMTAVADGADAASVRFADGSSASGDIVICADGAKSVGRD
FT                   YVLGRSTQRRYAGYVNFNGLVAVDEAVGPATEWTTYVGEGKRVSVMPVAGNRFYFFFDT
FT                   PEPEGLVFEPGTAKEILAAKFAHWTGGVRALIEAIDPAAVNRVEIFDVDPFDTWVRGRV
FT                   ALLGDAAHNTTPDIGQGGCSAMEDAVALQFAFQDHPNDPHAALLAYQAARTERAGELVL
FT                   RARKRSDVTHAMDPAVTQAWYDKLREEDGSSILRGIADNIMGGPLTPSP"
FT   gene            171233..171583
FT                   /locus_tag="Srot_0188"
FT   CDS_pept        171233..171583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0188"
FT                   /product="protein of unknown function DUF1025"
FT                   /note="PFAM: protein of unknown function DUF1025; KEGG:
FT                   msm:MSMEG_6415 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96677"
FT                   /db_xref="InterPro:IPR010428"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAD5"
FT                   /inference="protein motif:PFAM:PF06262"
FT                   /protein_id="ADG96677.1"
FT                   /translation="MPVQISAESFERLVGEALDLIPPKLARAVDNVVVLIADRNPEEPD
FT                   LLGLYEGVPLGERGSDYGGSLPDVIHIYRDAILEICDSEDDVVDEVAITVVHEVAHYFG
FT                   VDDEKLHELGWG"
FT   gene            171809..172054
FT                   /locus_tag="Srot_0189"
FT   CDS_pept        171809..172054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0189"
FT                   /product="PEBP family protein"
FT                   /note="KEGG: bgl:bglu_1g02270 PEBP family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96678"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAD6"
FT                   /inference="similar to AA sequence:KEGG:bglu_1g02270"
FT                   /protein_id="ADG96678.1"
FT                   /translation="MSLVAVCAAAFGSAAGAAASNAPTPPKPKASDTLDRPGAGTHFPR
FT                   GGFRFDNSGHPVTGQGPNKGTKSLEDTLEAAGAPRR"
FT   gene            complement(172103..172543)
FT                   /locus_tag="Srot_0190"
FT   CDS_pept        complement(172103..172543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0190"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   mab:MAB_1888 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96679"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAD7"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ADG96679.1"
FT                   /translation="MTASPASHPQQAACVQIQLRFGDMDALGHVNNVAVLRVFEEARVR
FT                   LISGQLRLEGVSALVARQEVEYRAVLEYTGADVRVHVWTSRIGGSSFDLSYALEDHNGQ
FT                   VTAVGTTTIVVIGEGGRPVPLPAEARSRFGEVSGPPVEFRGR"
FT   gene            complement(172576..173118)
FT                   /locus_tag="Srot_0191"
FT   CDS_pept        complement(172576..173118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0191"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   rer:RER_15470 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96680"
FT                   /db_xref="GOA:D6ZAD8"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAD8"
FT                   /inference="protein motif:PFAM:PF02627"
FT                   /protein_id="ADG96680.1"
FT                   /translation="MAAQTRVALGGFRQIGPLAWAIDKAGARRLGVRHLRIMQALGRNK
FT                   RLFPFFVGYTGYFQGLSKIKLRNVELVILRVAHLRGSAYEWNHHVRLSARAKITAAEHE
FT                   RVAEGPGAAGWSPKEKALLTAVDGFVRQKSLGDEDFAELARHFDEAEIIEILLLTGAYD
FT                   SLATTIDIIGLQSEYED"
FT   gene            complement(173121..173621)
FT                   /locus_tag="Srot_0192"
FT   CDS_pept        complement(173121..173621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0192"
FT                   /product="Peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /note="KEGG: mjl:Mjls_4940 glutathione peroxidase; PFAM:
FT                   glutathione peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96681"
FT                   /db_xref="GOA:D6ZAD9"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAD9"
FT                   /inference="protein motif:PRIAM:1.11.1.15"
FT                   /protein_id="ADG96681.1"
FT                   /translation="MSTLLDTPVTTLHGQSTTLRELAQPSGPVLVVNVASKCGLTPQYK
FT                   ALEELAENYGPKGLTVVGVPCNQFGGQEPGSAEEIQTFCSTTYGVTFPLLEKAEVNGEG
FT                   QHPLYRELVQKADAEGHAGAVQWNFEKFLIAPDGSVSARFRPTTAPQAPELTAAIEALL
FT                   PGA"
FT   gene            173743..174237
FT                   /locus_tag="Srot_0193"
FT   CDS_pept        173743..174237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0193"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sps:SPs0828 GRAB precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96682"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAE0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96682.1"
FT                   /translation="MNIARRRPVARAWSAGVLPGVVLALTGACGAAAAVADVRDVCDEG
FT                   QRGVVDVKNSMQSFVEALGEYANATDEGKAERAAVGKFAWLAENSLRVAASRLDSVSSF
FT                   SQPGPITEKSEELVHQMRLLFDALGTNDYAFVDPVIDGYNDAAVGFMAACTGDPVGGDE
FT                   A"
FT   gene            complement(174242..175309)
FT                   /locus_tag="Srot_0194"
FT   CDS_pept        complement(174242..175309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0194"
FT                   /product="2OG-Fe(II) oxygenase"
FT                   /note="PFAM: 2OG-Fe(II) oxygenase; KEGG: gbr:Gbro_4579
FT                   2OG-Fe(II) oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96683"
FT                   /db_xref="GOA:D6ZAE1"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR026992"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAE1"
FT                   /inference="protein motif:PFAM:PF03171"
FT                   /protein_id="ADG96683.1"
FT                   /translation="MANLPVVDLSRFGSEPRAFAAQLREVMREVGFCYLAGHGASDGLT
FT                   ELFALATRFFALPEQDKAAIGMAQSPHFRGYTRLGGELTGGRVDWREQIDIGPDLSPIP
FT                   GAQGPWNLQGPNQWPPQLPELRPAVERHCARLERISRQLLAALALSFEAADSHFDTAFH
FT                   PEPDPADPAGYRPQPATLLKIIRYPGAKTGPNEEPGQGVGAHKDSGVLTLLAGAPGSTG
FT                   LQVDVPGQGWTDAPTVHDALIVNIGELLEVATCGYLRATRHRVRTPPEGEERLSIPFFY
FT                   NPALGSSLPTLDLPPELARRVRPVEPEPDNPIFLTYGHNAWKSRVRAHPDVAARWHSAP
FT                   ASASADERTRGDAGG"
FT   gene            175422..177257
FT                   /locus_tag="Srot_0195"
FT   CDS_pept        175422..177257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0195"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   mav:MAV_4914 putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96684"
FT                   /db_xref="GOA:D6ZAE2"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAE2"
FT                   /inference="protein motif:PFAM:PF02770"
FT                   /protein_id="ADG96684.1"
FT                   /translation="MGHYKANLRDIEFNLFELFGLEETLASGDYGDLDVDAVKDILRET
FT                   RKLAEGPLADAWVGPDRNPPVYDPEKFEADLPEELQRAIKLINESGALQLCMDPELGGI
FT                   PAPRALGWASAEMLWGANAAAMFYTWGVPFAQILYDIATDEQKQWCKVIAEQNWDATMV
FT                   LTEADAGSDVGAGRTKAVEQPDGTWHIEGVKRFISGATSGDLFDNIFHLVLARPEGARA
FT                   GTKGLSLFFVPKWHYDFEKRERGERNGVFVTNLEHKMGIKASTTCELAFGQHGIPAVGW
FT                   LVGGVHDGIAQMFDVIENARMTVGIKSTATLSTGYLNALEFAKERVQGSDFTQMLNKDA
FT                   PRVTIMRHPEVRRSLLEQKAYAEGLRALYLLAAAYQDPAVAQRLFGADEDLAYRVNDFL
FT                   LPIVKGFGSEQGYAHLADSLQIFGGSGFLQDYPIEQYIRDAKIDTLYEGTTAIQSLDFF
FT                   FRKIVRDQAGALNHITGQIQEFVDSSAGNGRLKEARELLRAALGDFQATFNALAGIGFA
FT                   AMEQPTEGYKIAQSSVRFLMAAGDLLIGWLLQRQAQIAIEALDGGATGADRDFYEGKIA
FT                   SAVFFAKNILPKLASTRAIVESVDNDIMDLSDSAF"
FT   gene            177327..179162
FT                   /locus_tag="Srot_0196"
FT   CDS_pept        177327..179162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0196"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   msm:MSMEG_0406 acyl-CoA-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96685"
FT                   /db_xref="GOA:D6ZAE3"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAE3"
FT                   /inference="protein motif:PFAM:PF02770"
FT                   /protein_id="ADG96685.1"
FT                   /translation="MGHYKANLRDIEFNLFELFGLEETLASGDYGDLDVDAVKDILRET
FT                   RKLAEGPLADTWVGPDRNPPVFDSEKHEIELPKEIAKALDLLYDSGALQVALPEEIGGI
FT                   PAPRALTWALTELLVGSHAAVYFYAIGPAFTAILYALGTDEQKQWSKVIAEQKWGATMV
FT                   LTEPDAGSDVGAGTTKAVEQPDGTWHIEGVKRFITSATSGDYFDNIFHLVLARPEGARA
FT                   GTKGLSLFFVPKWHYDFEKRERGERNGVFVTGVEHKMGIKASATCELTFGQHGKPAVGW
FT                   LVGGVHDGIAQMFDVIENARMLIGIKSIATLSTAYLNALEFAKERVQGSDFTQMLNKDA
FT                   PRVTIMRHPEVRRSLLEQKAYAEGLRALYLLAAAYQDPAVAQRLFGADEDLAYRVNDFL
FT                   LPIVKGFGSEQGYAHLADSLQIFGGSGFLQDYPIEQYIRDAKIDTLYEGTTAIQSLDFF
FT                   FRKIVRDQTAALNHITGQIQEFVDSSAGNGRLKEARELLRAALGDFQATFNALAGIGFA
FT                   AMENPTEGYKIAQSTVRFLMAAGDLLIGWLLQRQAQIAAQALDGGATGADRDFYEGKIA
FT                   SAVFFAKNILPRLASLKSIVENLDNDIMELPEAAF"
FT   gene            179271..180233
FT                   /locus_tag="Srot_0197"
FT   CDS_pept        179271..180233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0197"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   mav:MAV_0583 periplasmic solute binding protein family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96686"
FT                   /db_xref="GOA:D6ZAE4"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAE4"
FT                   /inference="protein motif:PFAM:PF01297"
FT                   /protein_id="ADG96686.1"
FT                   /translation="MMSASPLRRTRYGALALAALALAGCDKSAGGATARTPNIVASTQA
FT                   WALVAKAVAGEQVPVAVIVGAGKDPHEYQFSSRDAAAVESASVAVMGGKGYDSFMDKAL
FT                   PAGGGPKAIKGESATIVSPELRPKGNAALDNPHVFFDFAVVDAVAHELADELSREDSAH
FT                   GDLYRHNLRTLRAQLQGFAEQLEELGRSHPGLRAVQTESVGQYLLDYLGASDVTPAGYR
FT                   AAVANESDPALADQAAAVGLISSRGADLVVDNPQEENKSVNELLAAATSAGVPVVGVGE
FT                   TPPPQVASYSDWLRSILGGFTTALGSPAQPNGEHAGPAR"
FT   gene            180214..181008
FT                   /locus_tag="Srot_0198"
FT   CDS_pept        180214..181008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0198"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: rha:RHA1_ro04478 ABC transporter, ATP-binding
FT                   component; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96687"
FT                   /db_xref="GOA:D6ZAE5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAE5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG96687.1"
FT                   /translation="MPDRPAEPALRFSAAALRVGERVLVENLDLALAPGEFLAVLGPNG
FT                   AGKSTLVQAALGLRALDAGSVEIFGQPPARARDHIGYLAQRVELDRATALRGRDFVGFG
FT                   YDGFRLGPGFLRAGRRKTAVARTLARLGAEDFADRPVSGLSGGEFARLRLAQALIGDPK
FT                   LLICDEPLVSLDLASQTLVVEQIVRQQQERGAAVVFITHELNPVLAHVDRVLYVARGGH
FT                   RHGPVDEVMTAASLSALYASPIDVLNVRGKLVVVGAGEEGHG"
FT   gene            181005..181859
FT                   /locus_tag="Srot_0199"
FT   CDS_pept        181005..181859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0199"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein; KEGG: nfa:nfa4430 putative ABC
FT                   transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96688"
FT                   /db_xref="GOA:D6ZAE6"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAE6"
FT                   /inference="protein motif:PFAM:PF00950"
FT                   /protein_id="ADG96688.1"
FT                   /translation="MSSASFFDWGLTWHLLGYAPTRRAVLAAAILGLLSAALGPFIVQR
FT                   RMSFAVHATSELAVTGAALALFLGGSLRLGSMFGALAAGLVFGLLGLRAADRDIASGVV
FT                   LSFGLGLSVLLLNLREGAATNLSSLLTGGLASVSNDDLRLMAATAVVACLVVMCCGRPL
FT                   WFASLDPFGAAAKGVPTRSLAVGFTVLVAAAAAIGMQVVGALLVLALMVAPAAAAARLT
FT                   ASPRLGAVLAFVFAQLAAVGGVLLSLAPSWPPSALITTICFLLYMGARAVGFFRRRRFR
FT                   AAG"
FT   gene            181873..182574
FT                   /locus_tag="Srot_0200"
FT   CDS_pept        181873..182574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0200"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pzu:PHZ_c2416 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96689"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAE7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96689.1"
FT                   /translation="MKNGRTFARAGWAALGAVSLPLGLASCSVLGESERFASLPEACFA
FT                   GISSAVDAAVGPLAPQGRKDDVLPEDTAISRPSGSTKFCARSFTDAVNRRDWKQGEPNF
FT                   RKVFLEYALYRSGFLSEGVDDAKRELKPPLVDPKRLVPEPNIGDEAVGWWDYSQSQGAS
FT                   WQVSLRVSNMRVLVRVSGADYLSDYTVDRQFSARLDYDSQRLKDELRREAQSIAKAVVD
FT                   QLAHPSSPGSP"
FT   gene            182673..182879
FT                   /locus_tag="Srot_0201"
FT   CDS_pept        182673..182879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0201"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96690"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAE8"
FT                   /inference="similar to AA sequence:KEGG:CHLREDRAFT_144956"
FT                   /protein_id="ADG96690.1"
FT                   /translation="MSFGRAFAALVLLTAAAVVSVRGAHASSPQAKETGPRPAAMTEPH
FT                   IAAMTEPGGSGDGSKAGGALVPR"
FT   gene            182886..183611
FT                   /locus_tag="Srot_0202"
FT   CDS_pept        182886..183611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0202"
FT                   /product="LamB/YcsF family protein"
FT                   /note="PFAM: LamB/YcsF family protein; KEGG: mab:MAB_0574c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96691"
FT                   /db_xref="GOA:D6ZAE9"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAE9"
FT                   /inference="protein motif:PFAM:PF03746"
FT                   /protein_id="ADG96691.1"
FT                   /translation="MVAAVVDLNADLGESLGVWRIGDDGAMLEMVSSANIACGFHGGDP
FT                   ATLWETCQAAARADVVIGAQVSYPDLLGFGRRFLDIAPKDLTAAVVYQVGALDAIARCM
FT                   GSRVRYVKAHGALYHALAEHDRQADSFAQAVADFDPRLPVVHYGGAITAKAETHGLRLV
FT                   AEAYADRAYTSQGTLVPRSEPGAVLTDPRAIAEQATRFAQEGKAESICLHGDTPGAVAS
FT                   ARAVRAALAASGVAIRPFL"
FT   gene            complement(183632..184606)
FT                   /locus_tag="Srot_0203"
FT   CDS_pept        complement(183632..184606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0203"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rop:ROP_39180 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96692"
FT                   /db_xref="InterPro:IPR026004"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAF0"
FT                   /inference="similar to AA sequence:KEGG:ROP_39180"
FT                   /protein_id="ADG96692.1"
FT                   /translation="MALRAVFAGVGLGALGVAAAAFAPAGSTARQIIPDVVQDAQAQAR
FT                   RAEEPGACLALGPGGQPGGAVDCAAEHVFEVAASVDLNDYPGTVFSSTAYPDQKQIAAW
FT                   DQQLCSGVVNNYLRGRFDTHGRFKIGALLSSESAWAHGGHTLRCGLEVPGGNGALLSFT
FT                   NRVADQDQSLTYDTGVCVGAEHNMPTEPVDCSQPHAFEVIGQTDLAKLFPGRSDTDPPT
FT                   EDEQNDKLKVLCEQAAEAYLGNAERLRASTLDVNWTIVKTQSWLVGSRKTVCFVARHND
FT                   QGFAVVTGSAKGDVLIDGAKPVAPPKPTRSTFGPIQPPSRPPE"
FT   gene            184656..185444
FT                   /locus_tag="Srot_0204"
FT   CDS_pept        184656..185444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0204"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="KEGG: mmi:MMAR_5379 acyltransferase; PFAM:
FT                   phospholipid/glycerol acyltransferase; SMART:
FT                   phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96693"
FT                   /db_xref="GOA:D6ZAF1"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAF1"
FT                   /inference="protein motif:PFAM:PF01553"
FT                   /protein_id="ADG96693.1"
FT                   /translation="MEILYGTVNTAARLMWLYQGLRLKIVGVGNMPARGGAVVALNHTG
FT                   YLDIPFGGLTSFLHKRNMRFMYKTEMRENPFVRWLFDRLRHIPVDRDYGKASYDHAVRL
FT                   LKEGELVAVYPETTISRSFELREFKSGAARMAIDAKVPIVPVIVWGSQRIMTKGHPKAM
FT                   GRTKTPIWIEVGEPIAPDLPPEQLIVKLKESMQAKLYEVQDKYAQTFGPYPPGAWWVPK
FT                   RLGGGAPSLEEADALDAAEAEEKRAKRAAARAAGADEKKH"
FT   gene            185452..186324
FT                   /locus_tag="Srot_0205"
FT   CDS_pept        185452..186324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0205"
FT                   /product="Cof-like hydrolase"
FT                   /note="KEGG: mjl:Mjls_5404 Cof-like hydrolase; TIGRFAM:
FT                   Cof-like hydrolase; HAD-superfamily hydrolase, subfamily
FT                   IIB; PFAM: Haloacid dehalogenase domain protein hydrolase
FT                   type 3"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96694"
FT                   /db_xref="GOA:D6ZAF2"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAF2"
FT                   /inference="protein motif:TFAM:TIGR00099"
FT                   /protein_id="ADG96694.1"
FT                   /translation="MPARHSHEHAHHQSRESAAAPHGRPPKLIVSDVDGTLLDENEHVT
FT                   PRTRKAISTAVASGAHFVLASGRGVRSLLRIVRQLDAPPMTICANGSITYDSAKDVVLR
FT                   ASEFEIAALRRLAEAVKQALPGAEFAVERVDHGTDPLAYVSTPGYVHAWATSDYTPASE
FT                   TELLSRPAVKFLVRAVEESSDAMARVLGPLVRDFAEVSFSTSAGLLEIGPPGVSKGSAI
FT                   AQLAAMFGVEAQDVIAFGDMPNDIAMLRWAGRSVAMANAHPLVLETASEVTASCVEEGV
FT                   AQVLERWWP"
FT   gene            complement(186562..186816)
FT                   /locus_tag="Srot_0206"
FT   CDS_pept        complement(186562..186816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0206"
FT                   /product="transcription factor WhiB"
FT                   /note="PFAM: transcription factor WhiB; KEGG: rop:ROP_64060
FT                   WhiB family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96695"
FT                   /db_xref="GOA:D6ZAF3"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAF3"
FT                   /inference="protein motif:PFAM:PF02467"
FT                   /protein_id="ADG96695.1"
FT                   /translation="MDWRHQAVCRDEDPELFFPVGNSGPALEQIKRAKVVCHRCPVSPE
FT                   CLSWALASGQDSGIWGGLSEDERRALKRRNARARARTVV"
FT   gene            complement(187157..188137)
FT                   /locus_tag="Srot_0207"
FT   CDS_pept        complement(187157..188137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0207"
FT                   /product="diacylglycerol kinase catalytic region"
FT                   /note="KEGG: rop:ROP_64070 hypothetical protein; PFAM:
FT                   diacylglycerol kinase catalytic region; SMART:
FT                   diacylglycerol kinase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96696"
FT                   /db_xref="GOA:D6ZAF4"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAF4"
FT                   /inference="protein motif:PFAM:PF00781"
FT                   /protein_id="ADG96696.1"
FT                   /translation="MRVRAVLVVNPRATTTTAQSRGLLVSLLQNDLDLTVQETSHRGHA
FT                   AELAAECVANGTDLVIAHGGDGTVNELASGLLGPPEQSSRPEPGAAPAVAVIPGGSANV
FT                   FARSLGISPDPRRAVDQLLRALRGNERRRVSAGLCDMSLADGRRESRWFLCNAGLGIDA
FT                   DVVAMMEAGRWSGRPVTPARYFLAAVSAYFRWAFRPGPLTLELPGTAPTRGVGLAFVSN
FT                   CSPWTYFGNRPITTNPGVRHDKGLGVFAATKLDPWHSIPLAVQLLSPRTAPDTPGSVRV
FT                   DNLIELTLSSADALRCQIDGEYVGKRVRAEFRSIPAALDVVAPCS"
FT   gene            188163..188591
FT                   /locus_tag="Srot_0208"
FT   CDS_pept        188163..188591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0208"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mul:MUL_2539 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96697"
FT                   /db_xref="GOA:D6ZAF5"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAF5"
FT                   /inference="similar to AA sequence:KEGG:MUL_2539"
FT                   /protein_id="ADG96697.1"
FT                   /translation="MHPDPRPDSSPAPPPAPPKPILAAGVVSAVLGLIAAGFGAAVAVA
FT                   ALMGRSFPGLSSPATAVAFLAFGGALAAAGGALVKGKAWGRGLIVLFCLLLLPIAYGTV
FT                   RDSQQPLIGYPLGLAALANLVCLFTPTALRWASENRTL"
FT   gene            complement(188616..189251)
FT                   /locus_tag="Srot_0209"
FT   CDS_pept        complement(188616..189251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0209"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: mab:MAB_3534
FT                   acid phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96698"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAF6"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ADG96698.1"
FT                   /translation="MTAKNRLVLIRHGETEWSRIGRHTSVTDLPLLPLGQTQAQGLKGP
FT                   LEQLQLRDPLVYSSPRKRALHTAELAGLTVNETWNDLAEWNYGEYEGLTTHQIRMMEPD
FT                   WSVWTHPSPDGESEEDVLHRADQVIREAVSRLAYHDVVLVGHGHFSRALLVRWLEQPLM
FT                   LGRRFAFPAASITVLGHEHDLRVVECLGVRSAQTGYMDGVSLPVAPMA"
FT   gene            complement(189282..190601)
FT                   /locus_tag="Srot_0210"
FT   CDS_pept        complement(189282..190601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0210"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro06355 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96699"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAF7"
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro06355"
FT                   /protein_id="ADG96699.1"
FT                   /translation="MRRPVFWRDCLIAFSIALTVLAAGAVLWLRAPTRQVVAQTAARAA
FT                   PSPQNAAVVPESFELAWSKSDSAASSPMVFGGTLVVADAHALTGWEIATGRQAWRFAEP
FT                   MPLCAATSAWGKVFAVYRGPDGCSLVVALEAATGKRPTGLHEDTRTGNGALFRHIRLAP
FT                   TVLSQGSEGGGPGSGTGAWAPHMILALGPRHLELWHENLLRSVEYGHVTTPFEPNKQPH
FT                   PGCALRSAVVGEDSFAVLERCRRDSALLLSFLKNSPKKDTEPEKACPKEQTCSAVLDTL
FT                   QPGDDAELLGVVDERAALYVPATQDHPAQIAEVGMHGEVVRSTDLNTPVTEHQTPPWRT
FT                   SPALITWWTGAAVVGLSAESLAVVFQTPGLVGPATEMGGQLIAPTADGLAVLDPATGAR
FT                   LRDIPMQGANAGGKGGVSLAVSGSSVIRQQGGKVLVYSGR"
FT   gene            complement(190608..192095)
FT                   /locus_tag="Srot_0211"
FT   CDS_pept        complement(190608..192095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0211"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="KEGG: rop:ROP_64170 putative ATP-dependent RNA
FT                   helicase; PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; SMART: DEAD-like helicase;
FT                   helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96700"
FT                   /db_xref="GOA:D6ZAF8"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAF8"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ADG96700.1"
FT                   /translation="MITTDIGPSFAELGVHPEIVASLAAAGKHNAFAIQEQALPLALGG
FT                   HDLIGQARTGMGKTLAFGIPLLQRVAEAAAEDIPRALVVVPTRELCLQVTNDLVDACKQ
FT                   LKLSDGRPTRIVSLYGGRPYEGQIATLEKGVDVVVGTPGRLLDLWGRGNLKLNAIRMLV
FT                   LDEADEMLDLGFLPDVEKIMAKLPTGKQTMLFSATIPGPVLTLARTFMTQPTHIRAESH
FT                   DTAAVHERTTQHVYRAHALNKDELVSRFLQAEGRGTTMIFTRTKRSAGKLADELVERGF
FT                   SAGSLHGDMSQGAREEALSGFRKGKIEILVCTDVAARGIDIDGITHVINYTCPEDEKVY
FT                   VHRIGRTGRAGRTGIAITLVDWEDLPRWEHINTALGLNHAEPPETYSNSPHIYTDLGIP
FT                   EGSTGRLTPAQPAPPRAERRERGERPGRRGDSPKPVRDRQRVRRNSATGAAPASGAPAT
FT                   AAAEVGAAPSGAGDADGGAKRPRRRRRRGGAAQPAAE"
FT   gene            192190..192873
FT                   /locus_tag="Srot_0212"
FT   CDS_pept        192190..192873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0212"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rop:ROP_64180 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96701"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAF9"
FT                   /inference="similar to AA sequence:KEGG:ROP_64180"
FT                   /protein_id="ADG96701.1"
FT                   /translation="MAVGTLSPVDQTPPAQWHGVPEFLALLAYGELAAYYRLAEDAALA
FT                   PTLAGKAAIARMGAAQFQHFETLREALAARGADVFQEMTSFQPVLDMFHIRTTPSTWLE
FT                   ALVKFYVGEGLAADFYLEIADGLPPEVAAVVKDVLTDRAHAQFVVEPVRQSVLASPKER
FT                   SRLALWARRLLGEAIAQAQTVLASREELADLLLRSSGNLNRIAQLFDEVTERHQERIRL
FT                   LGLED"
FT   gene            complement(192896..193801)
FT                   /locus_tag="Srot_0213"
FT   CDS_pept        complement(192896..193801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0213"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mab:MAB_3947 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96702"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAG0"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADG96702.1"
FT                   /translation="MSNIAVRNHPSRVLAKVDDAANRFVLRAAPDWKLSRARRDPSYGT
FT                   AIRGKRVLITGASSGIGEAAAHRFAELGATVLLVARRHDELAAVAAKIHAAGGHAAVFA
FT                   CDLRDLDAVDALAEKVNAEHGGVDVLVNNAGHSIRRDTAESLERWHDIERTMQINYFSA
FT                   MRLVRDFLPGMLERRDGHIINISSWVVPIEAGTRFVGYGAAKAAASIAARSIQLEYGHR
FT                   GVCGSSVHFPLVRTPMIAPTEEYDNLAALSAQEAAEWLVLAARTRVSRVLPRVSYFLQA
FT                   VEVLAPRLARQMIVAGGRGR"
FT   gene            complement(193828..194730)
FT                   /locus_tag="Srot_0214"
FT   CDS_pept        complement(193828..194730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0214"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mab:MAB_3947 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96703"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAG1"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADG96703.1"
FT                   /translation="MSNNVVTGRRAAKFLSLARDGFTHWGNQHATTARIRKAAKDPSYG
FT                   TAVRNKRVLVTGSSSGIGEQAARQLGSLGAEVILVARRAEELESVAKQIRTAGGRAEAI
FT                   PCDLRELDAVDALCAEVVSKYGGVDVLVNNAGHSIRRSLPEQLARWHDIERVMQINYFS
FT                   AMRLVRGFLPGMLERRDGHIINVASGGVLSEGVPKFAGYIAAKSALSTMSRNINMELRP
FT                   NGVSATTLYYPLVRTPMIAPTEEYAEVPGLSAAQAAEWVVLAARVRPSRIAPRMFRLSP
FT                   VFTAVLPELSEKVIGTQAR"
FT   gene            194854..195075
FT                   /locus_tag="Srot_0215"
FT   CDS_pept        194854..195075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0215"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rer:RER_21990 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96704"
FT                   /db_xref="InterPro:IPR021456"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAG2"
FT                   /inference="similar to AA sequence:KEGG:RER_21990"
FT                   /protein_id="ADG96704.1"
FT                   /translation="MDVKIGIVHSPREVTIDSAQTSEEVAQLVEAALAGESVLSLVDSK
FT                   GRKYLVPASRIAYVEIGSTDVRRVGFSG"
FT   gene            complement(195090..195731)
FT                   /locus_tag="Srot_0216"
FT   CDS_pept        complement(195090..195731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0216"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mab:MAB_3527
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96705"
FT                   /db_xref="GOA:D6ZAG3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAG3"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG96705.1"
FT                   /translation="MSPQPAAPRRTPGSRPASRGRLAKTDRRKLLLSAANDVFADSGFH
FT                   KSSMEDIADRAGVSKPVLYQHFPSKLELYLTVLDGHVEELVLRVRQALRSTTDNNGRLI
FT                   AAVRAFFDVIDNDTQGYKLIFNTDVMLPEVQSRISRATDACVDAVFDLVRQDSGLGLHQ
FT                   ARMIAVGLVGLIQVSARHWQDTGQPIAKEEAVFAAVSLAWGGLSRVPKLD"
FT   gene            complement(195788..197275)
FT                   /locus_tag="Srot_0217"
FT   CDS_pept        complement(195788..197275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0217"
FT                   /product="permease for cytosine/purines uracil thiamine
FT                   allantoin"
FT                   /note="PFAM: permease for cytosine/purines uracil thiamine
FT                   allantoin; KEGG: mva:Mvan_0932 permease for
FT                   cytosine/purines, uracil, thiamine, allantoin"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96706"
FT                   /db_xref="GOA:D6ZAG4"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAG4"
FT                   /inference="protein motif:PFAM:PF02133"
FT                   /protein_id="ADG96706.1"
FT                   /translation="MSVRYFLRMPAALDEDVVAGHDPRLTNADLAPTRRQNWGVYNFVA
FT                   FWMTDVHSVAGYTAAGSLFALGLAGWQVFVAIMVAVVALYGLSNLVAEPSQRTGAPYPV
FT                   VCRLSFGVLGAKIPAVLRALNAVAWYGMQTYLAANAVTLALVKLFPSARAYADAGEHGF
FT                   LGLSAVGWATFLMVWGAQTLIFWHGMDFIRRFIDWAGPAVYAVMIALCGWLIQQTGWGA
FT                   IRFDLSGGEGQQSWAASLCAMVGAVGLVVSYFGAPVLNFGDFAKYGKSMRVVRTSGFFG
FT                   LPVNFLFFSLLVVVTASLTVPVFGEMVADPNGVVTRIPNSTAVVIGVLTILIATVGINI
FT                   VANFVSAAFDLSNVKPQRISWLGGGMAAAAASVFIAPWKLIENPAAFHVTAETLGAFLG
FT                   ALYAVLVVDYYLVRRRRIVADDLYSMSETGSYWYTRGFHLPAIAATAVGAASAAACVVA
FT                   DDPGASLAVRTLAQCSWFVGASIGGLAYWLLARKHRK"
FT   gene            197333..197770
FT                   /locus_tag="Srot_0218"
FT   CDS_pept        197333..197770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0218"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rop:ROP_36780 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96707"
FT                   /db_xref="GOA:D6ZAG5"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAG5"
FT                   /inference="similar to AA sequence:KEGG:ROP_36780"
FT                   /protein_id="ADG96707.1"
FT                   /translation="MTTEHSDPVNPGFPHSGDPLSGTPAAAESSPPETAEQRAAPGAVG
FT                   SASGNDAKGKGVEHLDAVKHTRTGATWTAIIFGTLLLIVLLIFIVQNGEPTKVVFLSWD
FT                   VSLPLGVLMLAAAIIGVLGTALVGAARMFQVWRAARKSHKA"
FT   gene            197853..198797
FT                   /locus_tag="Srot_0219"
FT   CDS_pept        197853..198797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0219"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mmi:MMAR_0983
FT                   lipase/esterase LipG2"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96708"
FT                   /db_xref="GOA:D6ZAG6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAG6"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADG96708.1"
FT                   /translation="MNEAQQAIPRRTGFAHNERPGHAPVQLFYEEFGAATDPTVLLVMG
FT                   LGAQMLLWPTDLCEELARLGFHVVRFDNRDIGLSSRLDGLQSKATLPFRLVRLFLGLPS
FT                   AMPYSLHDMASDAIAVLDHVGAPRAHVVGASMGGMISQLLAADHPDRVLSLGLFFTCAI
FT                   ERFAIAPRAKILAFFAETAPKNPTREQEIDAFVRSYEHLAGRHYPLETELLRRECEAMW
FT                   DRNPDAEGPMRQLDAIIGTGSIAASAARIDRPTVIIHGSDDPVIRVSCGESLARLIPGA
FT                   KLNVVDGMGHTLPLVLLDFFVEELTANFARAQA"
FT   gene            198806..199753
FT                   /locus_tag="Srot_0220"
FT   CDS_pept        198806..199753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0220"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mab:MAB_3880
FT                   lipase/esterase LipG"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96709"
FT                   /db_xref="GOA:D6ZAG7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAG7"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADG96709.1"
FT                   /translation="MTSDASQAVPRRSGFAANPQARPGPVTLCYEEFGSDADPAVLLIM
FT                   GWSAQMLYWPTAFCEQLAAKGFRVIRFDNRDIGESTKFRGKKPRPIVPSIVRFFFGKPS
FT                   AGATYALPDLAQDAIALLDALGVAQAHIVGASMGGMIGQIVAADYPDRVLSFGAVFTAP
FT                   LRPFVFFTTLKALPLFLKKPPANETKEQTVDRLSREIQWLSGDAKRHESALRAELARAY
FT                   DRGRGDLAGSVRQMDGLLATASLVGHAERINCPTVVIHGAKDPLVRTACGKDLASIVPG
FT                   ATLRVIPGMGHSIAEPVWPILVDELTANFAKATT"
FT   gene            complement(199773..200063)
FT                   /pseudo
FT                   /locus_tag="Srot_0221"
FT   gene            200137..200271
FT                   /pseudo
FT                   /locus_tag="Srot_0222"
FT   gene            complement(200458..202269)
FT                   /locus_tag="Srot_0223"
FT   CDS_pept        complement(200458..202269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0223"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GK23886 gene product from transcript GK23886-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96710"
FT                   /db_xref="GOA:D6ZAG8"
FT                   /db_xref="InterPro:IPR017975"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAG8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96710.1"
FT                   /translation="MTSPGWIDKGEEILTGVRDDQWGCDAFDLLDKYIASRTNHMSGIN
FT                   ALGVTWDHGKYDLPAGEYKKQYELEKDIDLGMIRADANRILQAGKDQEALEELRTKAME
FT                   NLKEHWNDSVTEAAHADFDANKKVVITNTDAAKENAKGILQVADSIQQLLKDKHDKTNQ
FT                   ALQSLADSLKQNDADFEKKCESAAKNTQGGYDAESAEWMVTDQSNDKKSKVLTDLLNNR
FT                   SEVRESVYTKIKGSDDAEKDHTRKIYWDGGPPTTYRFDVEWNPDRYLTGEELVRLKQVA
FT                   TRKLNEAGNSRKYYVEAGGVSEYQIWERKDVVTDMNNVMGQINDTCQQLLQLNYNTKNH
FT                   ISEQYHTMAGYLDNINTAPPQTPSTGNTGGGGTGGGGAGGGGSAASGSGSDSGMPPDGS
FT                   PIGSELSSVGGGTGSGGGSALGSAGQALGSAGQALGQAVSGLGSALGGALSGLMGSLGQ
FT                   IIQTAAQAAQQAQQQQAEQEKDRHEKDKGRDDEDEDKNAEKNTDDNKGDNDGKDKQDEA
FT                   KPDQPGASLSQAPNTPHHPAAPAAHTTTDPGPATATAPAGMGHAPATAHNDSGVHKQGD
FT                   NNHGDFEVQATVHQVGAGNQGHITGFE"
FT   gene            complement(202324..202620)
FT                   /locus_tag="Srot_0224"
FT   CDS_pept        complement(202324..202620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0224"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lxx:Lxx05400 preprotein translocase subunit
FT                   SecA"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96711"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAG9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96711.1"
FT                   /translation="MADMANPDGVRSSGQDFHGFAEKAKTIAEQLKGLQMAKGMGAAFS
FT                   AEAEAMQRGLDKVPVPFQHHGEYNNVFGTVLAEAAASYQGTDESNERDLKIDL"
FT   gene            202783..203211
FT                   /locus_tag="Srot_0225"
FT   CDS_pept        202783..203211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0225"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96712"
FT                   /db_xref="InterPro:IPR009550"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAH0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96712.1"
FT                   /translation="MQPADVLYNMAQSALKRNEQTFQAFQKSMAQRKAQQEALYAQVKE
FT                   KNTAEPTAEELKAEKGERKAASIWNDTGKFGNLESEESVSEEPVKRDVRADADTRSFRP
FT                   VDEDEEAEDAPVGRHSRPDDGIWGASTRKIGSYQDEEE"
FT   gene            complement(203460..203687)
FT                   /locus_tag="Srot_0226"
FT   CDS_pept        complement(203460..203687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0226"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   eba:ebA2762 anaerobic benzoate catabolism transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96713"
FT                   /db_xref="GOA:D6ZAH1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAH1"
FT                   /inference="protein motif:SMART:SM00530"
FT                   /protein_id="ADG96713.1"
FT                   /translation="MGELNETVSRTVQGHLDRLGLSRSDAAQALGVSQQTLADLLGNHR
FT                   VWRLDEVDSIAEWLEVSPKDLFFPGRGDSV"
FT   gene            complement(203757..204818)
FT                   /locus_tag="Srot_0227"
FT   CDS_pept        complement(203757..204818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0227"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_0658 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96714"
FT                   /db_xref="GOA:D6ZAH2"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAH2"
FT                   /inference="similar to AA sequence:KEGG:MAB_0658"
FT                   /protein_id="ADG96714.1"
FT                   /translation="MRNWAQQAAVGVRRYFTRAPRRALLRRRLCALCAPFVALALLSAG
FT                   YLFWVCATGKDAVGLFDRQDVPHLHEKARSLLDWDILEPWKAHFAEGDADILEGRLTAA
FT                   EQHFSEAVALADNPDSCPARINLVVVLESLADEHTNAGGLAHARADLAKAHDAMRDAPA
FT                   GCFTPKPAAAGDQDARLFAETTARLRVKADQLAHGDLRYDPHDSTYHYTPGDSTAKLET
FT                   PPGPGPCPQTNDPEQTACIRDKDQPPPPSDSSEQQDPSDDGAEQHPRGDGAPPEASPPQ
FT                   GSASPPGRSGPQGGPSDPNTAGGSINDIGPDRLPAPGLGPLQHKLNPQSGGDPADKIKQ
FT                   AQADANGSGEDHE"
FT   gene            complement(204815..205846)
FT                   /locus_tag="Srot_0228"
FT   CDS_pept        complement(204815..205846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0228"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_0657 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96715"
FT                   /db_xref="GOA:D6ZAH3"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAH3"
FT                   /inference="similar to AA sequence:KEGG:MAB_0657"
FT                   /protein_id="ADG96715.1"
FT                   /translation="MSAALVAAAAAIVLALRVYTLYCLLVRKSGGRLTAVLLRWGALTL
FT                   AILCVFVAALRPSTSQRRQEPLTSPPVAAPSDNPERNIFLLVDRSPNSWADDFGPKHDY
FT                   RMAGVRADLKAIVRQFPHANFSVIAFSATARVDWPLSADTWGLEAFLENYSAYPVTAGA
FT                   LDRADPTAASPLLNQGLDTARQQHPRSQNLVFYLGEGRRGHNAPRGAFTPGPGLVSGGA
FT                   VLGYGSAAGGRVPERWGDDGAVVYAQGADGPLIVAPDEAALREIAGQLSLPYSHRGPGD
FT                   PIAAVVPVLPGASPAGSGQTSSDWTDRTEYYWVFAMIAALILSVEAFLLIREVRQDQHG
FT                   GLV"
FT   gene            complement(205843..206943)
FT                   /locus_tag="Srot_0229"
FT   CDS_pept        complement(205843..206943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0229"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_0656 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96716"
FT                   /db_xref="GOA:D6ZAH4"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAH4"
FT                   /inference="similar to AA sequence:KEGG:MAB_0656"
FT                   /protein_id="ADG96716.1"
FT                   /translation="MALNLAMELRWAPVFDIGKFLLMGGVLGAALLPVRARTGTALRPL
FT                   ARVERLTALPEYVRAVRIQRALLIVTTMSVLAVLVCVLYASARPVQAERAGGSGHRHPD
FT                   DVMLCVASPVTSPMASALLSYYQREAAALAEQPGSGQRIGLTSPTLRALPLTADHAFAA
FT                   RQLRRFAGLANLAAAAAAGQQLTEQQAKDLADGQDAFSRTVRYVDYQPNFIDTLASCVI
FT                   GFPDHASPSGRRRSVVYLGPTDERPASGSRTVYSPGSLAQLTAEAKAQINIIQIAPGGG
FT                   PGAQPQGVSKTETDVSGGKFFAFSDTADPAALTGALDQIRANRPALAAGAEAVPPEVEA
FT                   DNPSRVLGFAVGFATLLALCLAVIRR"
FT   gene            complement(206934..207416)
FT                   /locus_tag="Srot_0230"
FT   CDS_pept        complement(206934..207416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0230"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_0655 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96717"
FT                   /db_xref="GOA:D6ZAH5"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAH5"
FT                   /inference="similar to AA sequence:KEGG:MAB_0655"
FT                   /protein_id="ADG96717.1"
FT                   /translation="MGADDVEKLRLVLAPVPYDTVWLVLAALLVAAAAGCLVGIFVWTL
FT                   PVERLRRVPVLREITLRRLKRAFSRSIDATAARHRRGEISSRAAHGSISRGMRVFLQLW
FT                   TGEPAGKMVLAEFAESPLAGASGALETLYPGQFAPQEQPDVERAAAAAKEVIAGWR"
FT   gene            complement(207406..208323)
FT                   /locus_tag="Srot_0231"
FT   CDS_pept        complement(207406..208323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0231"
FT                   /product="protein of unknown function DUF58"
FT                   /note="PFAM: protein of unknown function DUF58; KEGG:
FT                   mab:MAB_0654 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96718"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAH6"
FT                   /inference="protein motif:PFAM:PF01882"
FT                   /protein_id="ADG96718.1"
FT                   /translation="MGALLQRVRAQVLAGQKLVGPAGKARGLLEGGHLSLFHGRSQEFD
FT                   DLRPYVPGDDVRDIDWKATARSDSLLVKRFVSLRQHNILLVVDVSRSMAAVAPSGEVKR
FT                   DVAVNAMGLVGLICIAKGDEVGLVYGDARGSARMPPGRGETHVEHILAKVSGHDLDHAA
FT                   RESLCAQLAYVERNFRKRYVVFLVSGEPHLDDDGSAPGALAGQLRRVAARHDLYWIIVR
FT                   DAPILEPESGSGGGYDVETGRALLREEALGRKVLAAYRHAEERRESAFADFLAASGVRA
FT                   ARVEGTAALRREVTALLSRSGRGS"
FT   gene            complement(208343..209353)
FT                   /locus_tag="Srot_0232"
FT   CDS_pept        complement(208343..209353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0232"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_3; KEGG: mab:MAB_0653 MoxR-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96719"
FT                   /db_xref="GOA:D6ZAH7"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAH7"
FT                   /inference="protein motif:PFAM:PF07726"
FT                   /protein_id="ADG96719.1"
FT                   /translation="MSAPPHSSARPSPGEVENGAQVATALAASFAAKVVGQKALRETLL
FT                   IGLLTGGHVLLESVPGLAKTTAAKTLAQSVRAHFQRIQCTPDLLPSDIIGTQLYDGSKG
FT                   EFHTVLGPVHANIVLLDEVNRASAKTQSAMLEAMEERQSTIAGQLYKLPEPFLVLATQN
FT                   PVDQEGTYPLPEAQMDRFMLKEVLEYPTPQEEAEVIFRIEAGVYEDDAAVRPVASLDDI
FT                   LRVQAVVKKIHIDPMVVHYVTHIVAATRNPHAFIPAQLARLIEVGASPRATIALCRAAR
FT                   ALALLNRRDHVLPDDIKALAHRVLRHRLTLGFEAAADQVTPELVIDAILGAVRTP"
FT   gene            complement(209350..210402)
FT                   /locus_tag="Srot_0233"
FT   CDS_pept        complement(209350..210402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0233"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_0652 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96720"
FT                   /db_xref="GOA:D6ZAH8"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAH8"
FT                   /inference="similar to AA sequence:KEGG:MAB_0652"
FT                   /protein_id="ADG96720.1"
FT                   /translation="MFDSSFGQFSEPMPEPAPRRNRRALMVALASAGAIVLIVAIVWAV
FT                   SVFVVGPDAEKVAQTGGKTPEEAVRMYFDALAQDNPQKALALGVEQPSGAEFLTADVLK
FT                   RQQDLARISNTQILGSAAGSQPDTANVSVSVLFGDVKSEDVLTVRKTRAGWKLPHATIA
FT                   LRPSAPTGGGRALDFLTLFGKPAGNTKTIAVFPGALEVGSLNKNITLTAERDKELLGQL
FT                   YQGADPNWLVNGQLSQNGHDAVIQALDDKLQACEQSAELAPAGCPNKLNNDQAAPDTVH
FT                   WTETENYDDQDPAVTVDFATMTAKVTVTLHWNFTVELVGGGKGNGQFPAEPRDFTGSAD
FT                   LTRNQLEVVF"
FT   gene            210517..211674
FT                   /locus_tag="Srot_0234"
FT   CDS_pept        210517..211674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0234"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: nfa:nfa3680 DNA polymerase
FT                   III subunit delta'"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96721"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAH9"
FT                   /inference="protein motif:SMART:SM00382"
FT                   /protein_id="ADG96721.1"
FT                   /translation="MGVYDYVLAADRVVAELRAAALAGRAEGKGFAQSWLFVGPPGSGR
FT                   SVAALSFAAALQCQAPEPGCGECRTCRSVFAGSHPDVRRLNPQGLSISVAEIREATGWT
FT                   ARLPASPWRILLVEDADRLTESATNALLKAVEEPSSRAVFLLCAPSVDPHDIAVTLRSR
FT                   CRLVSLGAPSREQVAKVLVERDGVDASTAQWAASVSAGHVGRARRLARDEAARDRRAAT
FT                   LALPLAMLDVRQRYDAAVRIASQASEEAAARCAALDAQELADLKEQLGVDGPGKAARAA
FT                   QGAVKELERKQKLRATRVERDALDGVLVDLLAYYRDALAWRWGAPTPALCPDVAEQVRE
FT                   LAERRDERRLLAAMEAILGAREAIAANVKPKVALTAMVSSLAMTS"
FT   gene            211909..211984
FT                   /locus_tag="Srot_R0008"
FT                   /note="tRNA-Thr2"
FT   tRNA            211909..211984
FT                   /locus_tag="Srot_R0008"
FT                   /product="tRNA-Thr"
FT   gene            complement(212177..212527)
FT                   /locus_tag="Srot_0235"
FT   CDS_pept        complement(212177..212527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0235"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: fal:FRAAL1243 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96722"
FT                   /db_xref="GOA:D6ZAI0"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAI0"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADG96722.1"
FT                   /translation="MKVNRVVPNLECASLQQAKDFYTRVLGLRVVMDHGWIVTLADPQR
FT                   PETQVSLTTHDETAPLVPAVSIHVDDVDAAYREAVATGAEIVHDLVDEPWGVRRFFVRD
FT                   PEGHVINILAHG"
FT   gene            complement(212599..213102)
FT                   /locus_tag="Srot_0236"
FT   CDS_pept        complement(212599..213102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0236"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="KEGG: ami:Amir_0411 transcriptional regulator, MarR
FT                   family; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96723"
FT                   /db_xref="GOA:D6ZAI1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAI1"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADG96723.1"
FT                   /translation="MGTGQPSGLAPEAKAPFHVGCYGDAADVFYLLLRILRGMRRAGDM
FT                   SSLTVSGISALFVIAQHGPLRLGDLANRERVTAPTMSRVVTLLEQAELVQREPDPADGR
FT                   ATLLSLTPQGSEYVAGDASEKIKTVESALATLSDEEQKQVVRWLQTLEAAVAKSSPEVD
FT                   DDLC"
FT   gene            213235..214026
FT                   /locus_tag="Srot_0237"
FT   CDS_pept        213235..214026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0237"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein LOC100021664"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96724"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAI2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96724.1"
FT                   /translation="MGPVRARRFFSTLAIAPDAVRVVNAVAYGAALGFRLAYVKSMVAN
FT                   PSKARTAAMRRAGAVTAAVEGGLYDAAHARLGDSFLAAQETYRRKRSILGDLLASEPAP
FT                   KRTALLSRALSGSRAVPGLRRLLPKPQPAQERRNRAKLVTPRCARALRSSVLGPSPTML
FT                   SADGEPHDYRTLWTPKDRRVEHQLLIALEEFSGLALPGLTKGNLLPFTDPETGLLVPWD
FT                   EAVASSGAIVVDRAVLEYLLDSRYGDGILRGAEAFNSARAL"
FT   gene            complement(214004..214216)
FT                   /locus_tag="Srot_0238"
FT   CDS_pept        complement(214004..214216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0238"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: SORBIDRAFT_07g019490; hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96725"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAI3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96725.1"
FT                   /translation="MKRGRHKPEPAPPAGLGRPAVIALIAVHYGADESAASRRGDLGET
FT                   SGGEKLGDCGAWAAPSSDVTERARC"
FT   gene            complement(214213..215100)
FT                   /locus_tag="Srot_0239"
FT   CDS_pept        complement(214213..215100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0239"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="TIGRFAM: phosphoribosylaminoimidazole-
FT                   succinocarboxamide synthase; KEGG: rha:RHA1_ro04817
FT                   phosphoribosylaminoimidazole- succinocarboxamide synthase;
FT                   PFAM: SAICAR synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96726"
FT                   /db_xref="GOA:D6ZAI4"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAI4"
FT                   /inference="protein motif:TFAM:TIGR00081"
FT                   /protein_id="ADG96726.1"
FT                   /translation="MRPTLAEYPHVHSGKVRDLYAVDDEHLLFVASDRVSAYDHVLSTP
FT                   IPDKGRVLTALSVYFFDTLSAANHLAGPPDDERIPHEVLGRALVVRRLRMVPVECVVRG
FT                   FLTGSGWAEYQQEGSVSGVALPPGLRENARLEPPIFTPTTKAELGEHDESISLEKVAEQ
FT                   VGTDLAHRLRDAALGIFRSAARHVADRGLTLVDTKFEFGLDPQGQLVLADEALTPDSSR
FT                   YWPAESPGTSLDKQFVRNWLTSPESGWSKSGGTAPPALPDDVVAATRARYVQLYEQVTG
FT                   LSFAAWLSLGPASP"
FT   gene            215206..216189
FT                   /locus_tag="Srot_0240"
FT   CDS_pept        215206..216189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0240"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="KEGG: nfa:pnf1570 putative cation transporter;
FT                   TIGRFAM: cation diffusion facilitator family transporter;
FT                   PFAM: cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96727"
FT                   /db_xref="GOA:D6ZAI5"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAI5"
FT                   /inference="protein motif:TFAM:TIGR01297"
FT                   /protein_id="ADG96727.1"
FT                   /translation="MAHDHDHAHGVGESSDRTWLFAALCLLLLLMAAEAAAGLLSGSLA
FT                   LLSDAAHMLTDVASLGLAIMAVKLAARPARGAMTYGLRRVEILSAQINGATLLILGGWF
FT                   AYEGVQRLLRPHQVEGKLVLVTALVGVVVNLAATMCVNKANRASLNIEGAFQHILADLY
FT                   AFIATVVAGLVIWLTGFSRADALAALVVAGLMLTSGWTLVRAASRVLLEAAPNGFSPDA
FT                   IGAELAALPGVVEAHDLHIWEISSGHPALSVHVLVDEDADCHERRVAIKQLLWEEHGVE
FT                   HTTIQVDHFAAGEEHCHEPHGLVHRSGRDEIRVIEHTGTHGHHCRG"
FT   gene            216167..217330
FT                   /locus_tag="Srot_0241"
FT   CDS_pept        216167..217330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0241"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   rme:Rmet_5086 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96728"
FT                   /db_xref="GOA:D6ZAI6"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAI6"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ADG96728.1"
FT                   /translation="MGITVEADFLVVGAGIAGASTGYFLAQHGKVVVLEREAAPGQHAT
FT                   GRSAAMYEPAYGNAQVRALTAASRSFFDSPPEGFAEHPLLSPRGVVIAQLAGEEFGPGA
FT                   DPAGPALTDEALIADLLEVPGATLLSKHDVLSLIPVLREEMVLGGVHDAQAEDVDVGEL
FT                   HLGFLKGIRARGGEVRCGRGVAAVSRVGAAWQVQAGDESYRAPVLVNAAGAWADVVARL
FT                   AGVREIGLVPKRRSAFVFHPPHGLDVRALPMFKDLRIGFYVKPDAGMLLGSPANADPTH
FT                   PQDVRPPDLDVALAIHRIEEATTLTVGRPLRAWAGLRSFVRDGGLVGGYAPDAAGFFWV
FT                   AAQGGYGIQTSPAMGEATAALALGEQIPEHIAAHSLTAEALAPDRLR"
FT   gene            217327..217797
FT                   /locus_tag="Srot_0242"
FT   CDS_pept        217327..217797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0242"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: rop:ROP_60780 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96729"
FT                   /db_xref="GOA:D6ZAI7"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAI7"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADG96729.1"
FT                   /translation="MNAPGREAAAPWPTLVYEDAKAAVVFFARSFGFTPATLVGSGERV
FT                   LRAELVWKGGGVAVVFSASETDQEGARSLSLVAESAQEVQELYARAVAAGARSVAAPHD
FT                   DEDGSRCFRVADPAGVLWCFRSEGTAAAQEPQIFDDGSEEVPQPPPAHACAE"
FT   gene            complement(217722..218174)
FT                   /locus_tag="Srot_0243"
FT   CDS_pept        complement(217722..218174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0243"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sen:SACE_7375 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96730"
FT                   /db_xref="GOA:D6ZAI8"
FT                   /db_xref="InterPro:IPR025962"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAI8"
FT                   /inference="similar to AA sequence:KEGG:SACE_7375"
FT                   /protein_id="ADG96730.1"
FT                   /translation="MPSTWVVVLATVFVLSGAALLAIAWASWAQKLPRNRFAGVRTSAT
FT                   MRSDQAFKLGNKIAAPGMAASGAVMILAAVGAAALHSPWGLGAAVVTGAAVSIIPAGYG
FT                   AYVGSKAADRVPAAPESVPTCPYSAQACAGGGCGTSSEPSSKICGS"
FT   gene            218317..221145
FT                   /locus_tag="Srot_0244"
FT   CDS_pept        218317..221145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0244"
FT                   /product="leucyl-tRNA synthetase"
FT                   /note="KEGG: nfa:nfa55240 leucyl-tRNA synthetase; TIGRFAM:
FT                   leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96731"
FT                   /db_xref="GOA:D6ZAI9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAI9"
FT                   /inference="protein motif:TFAM:TIGR00396"
FT                   /protein_id="ADG96731.1"
FT                   /translation="MTEPAAHRYDNATVRRIEEFWQAEWQRSGALHADNPTGELAGDGA
FT                   AREPFFIMDMFPYPSGDGLHVGHPLGFIATDVFARFQRMAGKNVLHTMGFDSFGLPTEI
FT                   YAVQTGTHPAAVTDRNVERFLRQIRRIGLGHDERRRFKTSDPDYYRWTQWIFLKIYNAW
FT                   YDREAGRARPVGELEAAFASGARATPDGRAWSALTKAEQRAVVDSHRLVGRHESVVNWC
FT                   PGLGTVLSNEEVTDEGRSERGNFPVFRKSLRQWTMRITEYADRLIDDLDRLDWPEKVKS
FT                   MQRNWIGRSTGAVVSFPCGEQVLEVFTTRPDTLYGVTFLVAAPESELVASLVPQAWPVG
FT                   TDPRWTGSAATPAEAVATYRAKVANRAERERQEDKAKTGVFTGAFAVNPLTQERIPVFV
FT                   ADYVLAGYGTGVVMAVPGHDQRDWDFAKTFGLPVAEVVSGGDVEIGAHTGEGQLVNSGS
FT                   WDGLSASEAKAVAADDLERLGVGRKQLQYKLRDWLFARQRYWGEPFPLVADESGQVFPL
FT                   DDTALPVLLPQIEDFRPIVFDADDQDSRPSAPLKKAGDWLTVECDFGDGAQPYTRETDV
FT                   MPNWAGSCWYYLRYLDPKNEEAFCDPENERYWIGPRPDARGGADPGGVDLYVGGTEHAV
FT                   LHLLYARFWHKVLHDLGYVSSAEPFRRLFNQGYIQAPSYTDSRGAYVPAAEVEERDGEF
FT                   FWQGQPVKREFGKMGKSLKNSITPDEICDEYGADTLRVYEMSMGPLDQSKDWSTKDIVG
FT                   AQRFLARVWRVVVDEQSGQACVVDAEPDAETVRALHRAIDQVGQEYAALKFNLAVAKLI
FT                   EYTNYLTKRYLSGQQGAEGAPRAAVEPLVVMLAPLAPHLAEELWRRLGHDELLVRHPFP
FT                   TADPAFLVDDEVKLPVQVAGKVRATIVVPAGVSEDVVRAAALADPKVVEHLAGKEPKRV
FT                   IVVPKKMVSIVL"
FT   gene            221191..221634
FT                   /locus_tag="Srot_0245"
FT   CDS_pept        221191..221634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0245"
FT                   /product="putative F420-dependent enzyme"
FT                   /note="KEGG: gbr:Gbro_3771 PPOX class putative F420-
FT                   dependent enzyme; TIGRFAM: putative F420-dependent enzyme;
FT                   PFAM: pyridoxamine 5'-phosphate oxidase-related FMN-
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96732"
FT                   /db_xref="GOA:D6ZAJ0"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019920"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAJ0"
FT                   /inference="protein motif:TFAM:TIGR03618"
FT                   /protein_id="ADG96732.1"
FT                   /translation="MAEAHPEVTFAPEVRAFLEEGTRTGVVAWAGATGQPYAAPVWFVV
FT                   EQDVLLFTTMADSAKAKAMRRDPRIALTAQLSEPPYAYVQVRGIAELIEDLAEVRRVAT
FT                   LAGGRYMGQDRAEEFGERNGQPGEVVVRLRPTTVTAMLDVTAT"
FT   gene            complement(221686..223458)
FT                   /locus_tag="Srot_0246"
FT   CDS_pept        complement(221686..223458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0246"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: gbr:Gbro_1521 ABC transporter related protein;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96733"
FT                   /db_xref="GOA:D6ZAJ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAJ1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG96733.1"
FT                   /translation="MAHLLGAESIRREFPTKVVLDSVTVGVAEGDRIGLVGRNGDGKST
FT                   LMRLLAGLDKPDAGRVTARSGLRVGVLGQSDNLDPEASVRQAVVGDAPEHEWASDPKIR
FT                   DVFAGLLPDKELWEQPVRALSGGQRRRVGLAALLAGDWDVLMLDEPTNHLDLEGVLWLA
FT                   EHMKSRWPRGAGGLLVVTHDRWFLDEVCTTTWEVHDRVVEPFDGGYAAYVLAKVERDRM
FT                   AAAHESKRQNLMRKELAWLRRGAPARTSKPKFRIEAANQLIANEPPPRNTVELRSTAVT
FT                   RLGKTVLDLVGAGVSFDGREVLREVEWRIAPGERTGILGVNGAGKSTLLGLVTGEVEPT
FT                   AGKVARGKTVKIATLSQNLAELAEHESQRVREVLADKRSSYTVGGKEHTPAQLLERLGF
FT                   SSAQLSTPIRDLSGGQKRRLQLLLILLDEPNVLILDEPTNDLDTDMLVALEDLLDGWPG
FT                   TLLVVSHDRYLLERVTDQQYAILGGTLRHLPGGVEEYLALRRAADARSSSPAGAKAKSS
FT                   GSADLRAAQKEIASVERRVEKLGAQIEAARHKLAAHDPDDFPGLAAGADALRALEREQA
FT                   ELEDRWLELLEQAQ"
FT   gene            223573..224223
FT                   /locus_tag="Srot_0247"
FT   CDS_pept        223573..224223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0247"
FT                   /product="DNA repair protein RadC"
FT                   /note="KEGG: nfa:nfa9430 putative DNA repair protein;
FT                   TIGRFAM: DNA repair protein RadC; PFAM: DNA repair protein
FT                   RadC; helix-hairpin-helix motif"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96734"
FT                   /db_xref="GOA:D6ZAJ2"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAJ2"
FT                   /inference="protein motif:TFAM:TIGR00608"
FT                   /protein_id="ADG96734.1"
FT                   /translation="MRDIPQHDRPRERLLRQGAAALSEAELVAIHLGSGHARASALDVA
FT                   HVLLTSWGGVHGLARARPEELARTPGVGPAKAARLAAAFAIAGRVDAPDEPVQLVQSSD
FT                   IARVASRVLGASRTEQVAVLVADARLRLRRTEIVAMGSATACPVPVREILATVLRHDGV
FT                   AFALAHNHPSGDPTPSAADRALTDMLHNAAWATGLRFLDHIVVAGERWRSAAF"
FT   gene            complement(224227..224871)
FT                   /locus_tag="Srot_0248"
FT   CDS_pept        complement(224227..224871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0248"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_4399c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96735"
FT                   /db_xref="GOA:D6ZAJ3"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAJ3"
FT                   /inference="similar to AA sequence:KEGG:MAB_4399c"
FT                   /protein_id="ADG96735.1"
FT                   /translation="MPGIPQESARSSAIVRKTLLAALTPLIVYYLARACGAPPWLALTA
FT                   SVVAAAAQTAVNALRERKLDLVSGYMLLLFGMNLAVVLLTENPRLAMAINSVPAFVLAL
FT                   FLLVSGIIRKPVTQDLVEKLRPSLRESELPGRGWSAQDIRDYRAAHARLSVLSGAACLA
FT                   LSLIGLAFIISLPVDMSQLLNSIVSNAGAVLVVILIVSKVRSFVKSHDRPA"
FT   gene            complement(224985..225371)
FT                   /locus_tag="Srot_0249"
FT   CDS_pept        complement(224985..225371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0249"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mgi:Mflv_3614 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96736"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAJ4"
FT                   /inference="similar to AA sequence:KEGG:Mflv_3614"
FT                   /protein_id="ADG96736.1"
FT                   /translation="MAEGAYIFPKWFDRLQVTFMNPLVVKAAPYLPGFAQVVHKGRTSG
FT                   KTFRTPVNPVQTKGRFVATLGHGTYTDWVRNLIAAGEGEVRFLGRSHRISNFRIVPPGD
FT                   PGAGLPYIARKALKRIAVFTADID"
FT   gene            225570..226556
FT                   /locus_tag="Srot_0250"
FT   CDS_pept        225570..226556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0250"
FT                   /product="fatty acid desaturase type 2"
FT                   /note="PFAM: fatty acid desaturase type 2; KEGG:
FT                   nfa:nfa6080 putative fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96737"
FT                   /db_xref="GOA:D6ZAJ5"
FT                   /db_xref="InterPro:IPR005067"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAJ5"
FT                   /inference="protein motif:PFAM:PF03405"
FT                   /protein_id="ADG96737.1"
FT                   /translation="MGADLDQSALLFELEEVAEREVNRHLAMAKDWHPHDYVPWSDGKN
FT                   FAALGGVDWDPEQSKLSDVAKAALVTNLLTEDNLPSYHNRIAGDLSPDGAWGTWVGRWT
FT                   AEEARHSTVMRDYLVVTRGVDPVALECDRMTHMTHGFQPLARFPHGTGAAFLHTVAYVS
FT                   FQELATRISHRNTGAICGDPIAEAIMQRLALDENLHMVFYRNICGAALDADPDQAMEAI
FT                   ANVVTNFQMPGSNMPNFRRHGVLMAKHGVYDLRQHLEEVLLPVIRTWRVFERADFTARG
FT                   EAARDRLAAYLEDLRTVQVPRFEEHRDRALARDKARGIDRALAPQAV"
FT   gene            complement(226587..228251)
FT                   /locus_tag="Srot_0251"
FT   CDS_pept        complement(226587..228251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0251"
FT                   /product="Pyruvate decarboxylase"
FT                   /EC_number="4.1.1.1"
FT                   /note="KEGG: mbt:JTY_0875 putative pyruvate or indole-3-
FT                   pyruvate decarboxylase; PFAM: thiamine pyrophosphate
FT                   protein TPP binding domain protein; thiamine pyrophosphate
FT                   protein central region; thiamine pyrophosphate protein
FT                   domain protein TPP- binding"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96738"
FT                   /db_xref="GOA:D6ZAX9"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012110"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAX9"
FT                   /inference="protein motif:PRIAM:4.1.1.1"
FT                   /protein_id="ADG96738.1"
FT                   /translation="MPQPYTIGHYLADRLAELGVRHVFGVPGDFNLMFLDRIVEHPGLA
FT                   WVGNVNELNAGYAADGYARMNGIAALVTTFGVGELSAVNATAGSYAEHVPVVHICGGPT
FT                   VDAQRARRSLHHSLGDGDFEHFLRIQREITCAQASLTPANATREIDRVLREVREQRRPG
FT                   YLLLPSDVAQVPSYPPAAPIPGPQDASSPGALAAFQEAAAKLLADKRPAVLADLLVHRF
FT                   GAVGELARLLDAGALPHATLLWGKSIVDELDPNFLGIYIGANSEPHVRAGVEEAEALIL
FT                   AGVQFTDFISGFFTQHLDVAKTVDIGPHESTVAGELFAPLEMRDALGALTELLSGRPRP
FT                   PEPAAPAPPAASAASPGEALTQASMWDLLAGAVTPGNIVIAEAGTSFFGLATHPLPAGV
FT                   TFIGQPLWASIGYTLPAALGAGLACPDRRVVLLIGDGSAQLTAQELSVIARYGLNAVIV
FT                   VVDNDGYTVERAIHGAQQPYNDIDHWDYAKLLSAFEPETEPLCLRVGTVGGLRAAIEET
FT                   EAAKDRLVLIEAVVAKMDMPPLLQKLGETMSEANTRA"
FT   gene            228388..229284
FT                   /locus_tag="Srot_0252"
FT   CDS_pept        228388..229284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0252"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96739"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAY0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96739.1"
FT                   /translation="MTQPHEKLPPARNPKPLEERIRILDEELPQLRVSGESACRRVFAT
FT                   VGHERALLELRLAWEALADEFELARGSRNEPLGHVALARIIETAVHAALAGYSQAVVDA
FT                   MHEPKPAGASLENQFYDEYWDLPEDERPDSVDDYIRQRKAELGGPVQPEDQYQADEAAA
FT                   QERIRAEVGSLADLDPDKLRVTESWMTDEAAELRERYAETVRKLQAFDPAGVRGVGKDN
FT                   PHNPIVKVTVSMASAFELELGERVWSDPGSRLGQAVVKAHAAARADFAAKMHDGGITLW
FT                   GDGRPDEEQPGGAPSRA"
FT   gene            229395..229871
FT                   /locus_tag="Srot_0253"
FT   CDS_pept        229395..229871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0253"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rso:RS05355 putative methyl-accepting
FT                   chemotaxis transducer transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96740"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAY1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96740.1"
FT                   /translation="MNAVNPGNPGLKLTDIGGGASGRTNIDLDALGRVTLKMEPLRAEL
FT                   DGLIKQWDESTERYHAAAGSDDMNGNLKQQSTQAKQDADQHSKATSERAQKAADTSKEA
FT                   HAQYSGVEDDNHTELKKPGDHLSGGGGANFNAPAATQAGADSNASAATGGPVAR"
FT   gene            231468..232169
FT                   /locus_tag="Srot_0254"
FT   CDS_pept        231468..232169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0254"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rop:ROP_09190 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96741"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAY2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96741.1"
FT                   /translation="MFFKSAGGISAGEVLGRSRRVLTWGVYWRGSLWRMQFWLVGMQSS
FT                   PQKVRDEELGMKVVSRAAVLGLAGLVAFGAAGCNRGGSGGGTTTIIQQAPPINGGSAQS
FT                   NSLTPSVTQTPISDSKKLCSLAQGRGLEIVHAIDKFWGLVMKDGWSWGDEKVASAADNA
FT                   GQVVSKVAPVLEAAIGSGAPKDIADAIQKFVKSSRSFADAITNRADGDTMNPLNKDFGA
FT                   AVDNLKAVCSI"
FT   gene            233614..234447
FT                   /locus_tag="Srot_0255"
FT   CDS_pept        233614..234447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0255"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_4046 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96742"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAY3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96742.1"
FT                   /translation="MAGSFSGLRDRIAAAHPAAGAGELADLITGGGVVVGAGRAGFLAD
FT                   GFTWGRVEQPPFEHVGSGGLVFLFEDMRVAPNPQAGVWRPVVARVTTTGWLGQVDPAMR
FT                   LPEGTRVLDRSKAPAGTDHLTNPGLLAVGLAKWLLEDGLGGDSSWRLAAVCFLEEPDSR
FT                   YVQALLALPRPVEAYWPDRPGYEADVPQAAVQDARALSSEELAVKQSDPLRHAADMARL
FT                   APDGLYDPAGLPPKEAGWYRKSVQRANSERITNARWKQELDQYRREERGAGALNW"
FT   gene            234483..234953
FT                   /locus_tag="Srot_0256"
FT   CDS_pept        234483..234953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0256"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein LOC100030523"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96743"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAY4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96743.1"
FT                   /translation="MAHPLEMVSPVLAGAVKAVPKEKAPAVAAGMARAGVSGASAYTQG
FT                   QVWGPLYGALANNGEGSGTGEFAAAREAAKGELRSHELDGMELLARLEGRVPAPVGDAP
FT                   PTRGEYENHRNLTWRLRAMLTALEDPYPEQLLDIAHCLHNGGMNDTDITQAL"
FT   gene            235137..235616
FT                   /locus_tag="Srot_0257"
FT   CDS_pept        235137..235616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0257"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nfa:nfa27930 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96744"
FT                   /db_xref="GOA:D6ZAY5"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAY5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96744.1"
FT                   /translation="MADTPYEGMTSAEVNAKFNRDIERRLAELDEAERALTAIRGVGEA
FT                   EHGSVRVEVDSNGMIVDIKLADRAMHLGSPKLERAVLLALTKAKNAAIAAGEAPFSTVV
FT                   GDEEARDYTEKRLEPEPEEEPKGGALWGENGNQRRWAPDPDEEEEEYDWRRDLRR"
FT   gene            235643..235957
FT                   /locus_tag="Srot_0258"
FT   CDS_pept        235643..235957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0258"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cur:cur_0530 putative secreted
FT                   metallopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96745"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAY6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96745.1"
FT                   /translation="MRVNIDGMKTDANRVEDVGRQIVATGNKMKNENADSSAYGWIGDI
FT                   FEAGLRILEVAAGEGLAGLGNTVVTTGGHLREAAKIFEEQEHHNTQSLANVGDQVKYNF
FT                   "
FT   gene            235973..236845
FT                   /locus_tag="Srot_0259"
FT   CDS_pept        235973..236845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0259"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: drt:Dret_0495 translation initiation factor
FT                   IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96746"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAY7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96746.1"
FT                   /translation="MPGTLLSDAVQCKKDVQDFVTKLKALNLAQHSDKTREIDAFDGAV
FT                   SDGDFFMSISKDVIDWLMKNVEQFKHVVDIITMDEKKADSIVHDWSDAFPKELAHHADD
FT                   LKSLGKQIAADWGSSTIPGLNFDSTGLDTMASTFGQLQDGVSGPPGSADHPTWFVVRQT
FT                   ALAEILIVSGDACLAVGELINKVNDLIKKMIKKIKDGLAKLLLAVVNKILTAIAEKIPG
FT                   VGWLMEGIDVIANHSDALTRLIRDITDVIKELMKYKDAVWEALKEADAIVRAGEKVFKD
FT                   VGNLQSHFK"
FT   gene            236915..237331
FT                   /locus_tag="Srot_0260"
FT   CDS_pept        236915..237331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0260"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ami:Amir_2153 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96747"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAY8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96747.1"
FT                   /translation="MIPMPEFKDFDDWEREIKRIQDQTIQTLKAVSAAAQKSRGSGAAE
FT                   RGMIMVEMNAKGDYETLVIDNAAFRFGPTRLAAGILQAMRAAHNARLRTIREDAVEQVG
FT                   EDAVGGAFTPKLYPDPDDETPPDDEDEDQPQRRW"
FT   gene            237428..238051
FT                   /locus_tag="Srot_0261"
FT   CDS_pept        237428..238051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0261"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ami:Amir_2870 YD repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96748"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAY9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96748.1"
FT                   /translation="MLLMLALMPAACSRDVPHAASGGPSSPGSQHSVSPTPVTAATLLP
FT                   NGDSSTQRGSLGQKFTVQAEGAVFEVAVHELVSLGKPSPDWSTPEDGVIPGAAWHGVAW
FT                   RASFTVKWVSGAVSPTKLISLLGWEAGFKKGEEPGADNTYQSKLTGVDALDDQEIGFLL
FT                   GSVHVGQEVDGYTYFDVDKEPITTVDLVHVDSPPRPPLAVWAAS"
FT   gene            238138..239139
FT                   /locus_tag="Srot_0262"
FT   CDS_pept        238138..239139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0262"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cdi:DIP1084 iron ABC transporter membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96749"
FT                   /db_xref="GOA:D6ZAZ0"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAZ0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96749.1"
FT                   /translation="MDELLWFGLSEQAWLSVVVAASLAISLVVTLVSRAVVDPEVVAQG
FT                   TGFFGGDSLELRSVWGRGALLCMGLVLCGAVVVVSDGGLDTLVLFSLFATLVVLAVELL
FT                   FPGALTPGAVGDVDRFSTRRDGTLVRGVALRAKFSHRIAEGIAFLFFSGALLGFAAKAW
FT                   GDPWAFLEGKSSFERWLVIALPGVLGALGFTAALFALFDGEYEQNLLVMTPDWFSFPAD
FT                   SKKSVKTIMWRDVCEMRRCEDEDIVAYSVEDEAGNDRTVHVSRAGDYLAAFDVNGAVLG
FT                   RMLLTGLPRKDQFEKVLTSLWNEPQRRARLAGQDAVAWVRQLAEREAGRTSE"
FT   gene            239260..239535
FT                   /locus_tag="Srot_0263"
FT   CDS_pept        239260..239535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0263"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aau:AAur_1588 putative FtsK/SpoIIIE family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96750"
FT                   /db_xref="GOA:D6ZAZ1"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAZ1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96750.1"
FT                   /translation="MDLLEFILDFLGCPRLRYARVLKFGAALIVVVVVVAQRTWWGALE
FT                   AVFAVAAFVFGMVATRLNGWPGWLALFAGMILLVCAFVLAKEVGHV"
FT   gene            239532..240380
FT                   /locus_tag="Srot_0264"
FT   CDS_pept        239532..240380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0264"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="KEGG: mva:Mvan_2538 molybdenum ABC transporter,
FT                   periplasmic molybdate-binding protein; TIGRFAM: molybdenum
FT                   ABC transporter, periplasmic molybdate-binding protein;
FT                   PFAM: extracellular solute-binding protein family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96751"
FT                   /db_xref="GOA:D6ZAZ2"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAZ2"
FT                   /inference="protein motif:TFAM:TIGR01256"
FT                   /protein_id="ADG96751.1"
FT                   /translation="MSARSARAAHGRAALGSSRRAAPSRLDLMSSVMRTFTATAIAATG
FT                   IASCAHSETEQARGITVFAAASLQKVFTELGKQFEAQHPGTSVRFTFAGSPTLVAQLDQ
FT                   GARGDVLASADEANMDRARESQLVGEARVFATNRLVIVTARGNPKRIAKLADLANPDLA
FT                   VVVCAAQVPCGALAGKVEAKAGVVVRARSQEPSVADVLAKVASGEADAGLVYSTDASAA
FT                   GGTVSSVPVPEGDALATRYPIAVLDQAKGGPRGATAEAFVALVLSPQGQEVFGNAGFGK
FT                   P"
FT   gene            240424..241206
FT                   /locus_tag="Srot_0265"
FT   CDS_pept        240424..241206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0265"
FT                   /product="NifC-like ABC-type porter"
FT                   /note="KEGG: mab:MAB_2434 molybdenum ABC transporter
FT                   permease; TIGRFAM: NifC-like ABC-type porter; molybdate ABC
FT                   transporter, inner membrane subunit; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96752"
FT                   /db_xref="GOA:D6ZAZ3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR006469"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAZ3"
FT                   /inference="protein motif:TFAM:TIGR01581"
FT                   /protein_id="ADG96752.1"
FT                   /translation="MPAALGLVLVTLPVLCLPRGVAFGQLPALARSVAARDALRLSLVT
FT                   TTSATALVLLCGVPLALVLARSGARGSVLLRGALLVPLALPPVVGGMALLSAFGRRGLL
FT                   GHWLDEAGVRIAFSTTAVVLAQAFVALPFFALAFSGALIAAGSAPERAAAGLGARPWQV
FT                   LWRVTLPRLRPALVSAAALAFARALGEFGATLTFAGSFQGVTRTLPLEVYLQREVDPAA
FT                   AQALSLAFLAVAAGLVLLTLWADRRRAAQERRRLEAAR"
FT   gene            241203..242144
FT                   /locus_tag="Srot_0266"
FT   CDS_pept        241203..242144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0266"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: rop:ROP_34560 putative molybdate ABC
FT                   transporter ATP-binding protein; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96753"
FT                   /db_xref="GOA:D6ZAZ4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAZ4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG96753.1"
FT                   /translation="MSGAALRVDVAAAARGVEAAFEVPGGQCAALIGPNGAGKSSLLAM
FT                   VSGGLRPDRGQVLVGGRDVAPTPVWRRKVALLAQRAVLFEHLDVLDNVAFAPRVAGLSV
FT                   ARSRALAREWLEQLGALRWAARRPHELSGGQAQRVALAQALAADPQVLLLDEPFAAMDV
FT                   QAAAELRAVLRRLLDGRTCVLATHDFADVATLADVVVVLDAGRVAQTTSPEGLVADPAT
FT                   EFAARLVGLNRVGSALFPPTAARVVLGAEAPPRHGGACIEGAFIGIVSHGEGLRALCRV
FT                   GDCVVEAQVGHDLAQRLEPGTAVGIAVEDTAR"
FT   gene            complement(242206..242946)
FT                   /locus_tag="Srot_0267"
FT   CDS_pept        complement(242206..242946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0267"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mav:MAV_0109 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96754"
FT                   /db_xref="InterPro:IPR037126"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAZ5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96754.1"
FT                   /translation="MRRLLTALIATGLLAGPAAAPALADQASVCAQAGGAWREHGEYPR
FT                   HTDEARCEFQESLSDDRTVSYSSPVPGDMLGDEWVESQLAAFIKSRFAQLRSSIPSAPQ
FT                   TSVSGDIDEHHDYRHSASVQSLVFHETVSVSAAAHPNDECLTLTFDLAEHRQLRISDLF
FT                   KAGTNIPATITPLVLRDAKQGTLGQLSIGTYNDGSYSAFALTPTDLVVYLPAERVGAVN
FT                   AGAFSATIPLSAFGDTLRPEYRSS"
FT   gene            complement(242952..243626)
FT                   /locus_tag="Srot_0268"
FT   CDS_pept        complement(242952..243626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0268"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96755"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAZ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96755.1"
FT                   /translation="MRKKLLAAMAAVAGAAALAAAPARADRQSVCETVDGLWSERSEFV
FT                   QITGRAACELTPETPGSTFLQLQYEYPSDVADDAAGSKQLAAWLKSRIAVYQGQLAGAR
FT                   DGDERQIAVGATYEEQSAGAARTVVFTETAFTKGNRQPVTQKLTQTFTLSAPPPVAGAP
FT                   DGAAPDSAAPAPGAPVPGAPAPAVPPIAAPASPATTAPAAPAPATPAASAKPPKTSVKP
FT                   LR"
FT   gene            complement(243694..244401)
FT                   /locus_tag="Srot_0269"
FT   CDS_pept        complement(243694..244401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0269"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sen:SACE_1497 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96756"
FT                   /db_xref="GOA:D6ZAZ7"
FT                   /db_xref="InterPro:IPR015402"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAZ7"
FT                   /inference="similar to AA sequence:KEGG:SACE_1497"
FT                   /protein_id="ADG96756.1"
FT                   /translation="MRRETQHLILLLLGGAVLKISLNGNYARYVKPALGPWLTATGAAA
FT                   VLLAVALIAASFRSKPTEHEHEHEHHHSSRMAWLLMVPALVLLFAPPPVLTVDQPPAQA
FT                   QAAPADPAPYPPLPPGQPSMKLIDFVGRALGAPATLDGREVSLVGFVRKLPDGLYLARV
FT                   FIWCCAADARSVVLKLDVDPARAPAQDLADKQWVRLIGTYVPGSIDNDPEDIPTVRVIH
FT                   VAPIPPPENPYET"
FT   gene            complement(244404..245390)
FT                   /locus_tag="Srot_0270"
FT   CDS_pept        complement(244404..245390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0270"
FT                   /product="permease"
FT                   /note="PFAM: permease; KEGG: nfa:nfa40600 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96757"
FT                   /db_xref="GOA:D6ZAZ8"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAZ8"
FT                   /inference="protein motif:PFAM:PF03773"
FT                   /protein_id="ADG96757.1"
FT                   /translation="MRPQAGSVRVSSVWVFTLALLLFILFADQLSGAFAAHPALAEAAT
FT                   VFSGIFVQAIPFVALGVLVSALIAAFLPGDDLRKLLPAGRRARVLAAGLAGVGLPACEC
FT                   ASAPIASRMLDSGVGRGAAIAFLLSAPAINPVVIAATFVAFPDRPQMALCRFAASLLVA
FT                   WLVGLVFAKSSAEREPPPNAAHPHEVAGSWSDRFLAAAQADLLSSGSFLVAGAAFAAIA
FT                   HVALPPSWLAALGASLVPAIAAMAVFAVVLSVCSEADAFVAASFTTMPSTAQLVFLVVS
FT                   PMVDLKLVAMHVGMFGTKFTARLDAVVLAIAVLMAAAAGLLVFGGGR"
FT   gene            245481..246686
FT                   /locus_tag="Srot_0271"
FT   CDS_pept        245481..246686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0271"
FT                   /product="secretory lipase"
FT                   /note="PFAM: secretory lipase; KEGG: rop:ROP_51020
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96758"
FT                   /db_xref="GOA:D6ZAZ9"
FT                   /db_xref="InterPro:IPR005152"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZAZ9"
FT                   /inference="protein motif:PFAM:PF03583"
FT                   /protein_id="ADG96758.1"
FT                   /translation="MASSVPFVLAVCGLGACGQDKAAPPPPPPPAPPSAPPNTTTTPTS
FT                   VPPGTKLSSQEAPADWKRLLPPGADATLIRYRSVSGLDGSATEVGGVVLTPAGPAPKEG
FT                   WPIITVGHGLTGVRGDCGAAEHPLLASVTKRLAPLVKAGYLVVMSDYQGLSSAGTHPFL
FT                   DPKTAAYNLIDAVAAARQLVPQHSNKWAAMGHSQGGQAAWAALEHAKEYGKSFQFVGAV
FT                   ALAPAVNGAAAFDAALHGKLTKLQESLFPALIAGYLARHPDGKWEDFLSGALLENHDVL
FT                   LSCAPEDMQKRAAVLSRITPGDVVPDTEQAQAKLRAWLEEVSLPKTAGDGPLLVVQGAK
FT                   DELIEPEWTREAVRQGCALGLRVQEIVRPGQGHADVEDDKDVLDWLGARFAGDQPAPTS
FT                   CE"
FT   gene            246714..247355
FT                   /locus_tag="Srot_0272"
FT   CDS_pept        246714..247355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0272"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro04825 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96759"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB00"
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro04825"
FT                   /protein_id="ADG96759.1"
FT                   /translation="MRLAHFGQSCVLVEHAGTKVLIDPGSFSHGFEGVSGLDAILITHQ
FT                   HADHVDQSRLGPLIELNPQAALVTDAQTQEILGEGWQKVVPGDSFAAGALNVRVVGGKH
FT                   AVIVPDVPVVDNLGFIFGDESEPDLFYHPGDALHVPERSPQVLAVPTGGPWMRVSDGVE
FT                   FLRAVKARLSVPVHGETERFPQSYTDRYAEYGPAGAELRILPREEAVEVA"
FT   gene            247386..248735
FT                   /locus_tag="Srot_0273"
FT   CDS_pept        247386..248735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0273"
FT                   /product="glutamate decarboxylase"
FT                   /EC_number="4.1.1.15"
FT                   /note="TIGRFAM: glutamate decarboxylase; KEGG:
FT                   rha:RHA1_ro06016 glutamate decarboxylase; PFAM:
FT                   Pyridoxal-dependent decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96760"
FT                   /db_xref="GOA:D6ZB01"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR010107"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB01"
FT                   /inference="protein motif:TFAM:TIGR01788"
FT                   /protein_id="ADG96760.1"
FT                   /translation="MSTDPAYTSWLDLQFQPPARLGDTSLDADGVARHIHDELMLDGSS
FT                   RLNLATFVSTWMEPQAQKLMVEAFDKNMIDKDEYPATAAIETRCVSIVADLFHAPGLDP
FT                   GDPGTATGVSTIGSSEAVMLGGLALKWRWRLARERAGASTARPNLVLGSNVQVVWEKFC
FT                   RYFEVEPRYLPMAPGRYTITAEQVREAVDENTIGVVAILGTTFTGEFEPVEQIAQVLDE
FT                   LAASGGPDVKIHVDAASGGFVAPFLHPELRWDFRVPRVASINVSGHKYGLTYPGVGFVV
FT                   WRDREQLPEELIFRVSYLGGDMPTFTLNFSRPGNQVIGQYYNFLRFGREGYTRIMGALQ
FT                   HIARWIADELAALPGVRMIADGSAIPVVAFALDEELGYDVYALSHALRAGGWQVPAYPM
FT                   PEGAQGLSVLRIVVREGFSGELARALVQAVGTAMQELSQGGLKPRKQFMH"
FT   gene            248810..249484
FT                   /locus_tag="Srot_0274"
FT   CDS_pept        248810..249484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0274"
FT                   /product="putative DNA repair protein"
FT                   /note="KEGG: sgr:SGR_2911 putative DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96761"
FT                   /db_xref="GOA:D6ZB02"
FT                   /db_xref="InterPro:IPR004574"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB02"
FT                   /inference="similar to AA sequence:KEGG:SGR_2911"
FT                   /protein_id="ADG96761.1"
FT                   /translation="MTLFGPEDVLGPPRERQALPAGAVHLPGWLSLPEQARLSAEFQMW
FT                   ARGPVPLRAAALPNGGRMSVRTVCLGWHWQPYRYTRTADDVNGQQVLPFPDWLGDLAKA
FT                   VVREACGATAARTYRPDAALVNHYDAHARMGMHQDKDERTDAPVVSLSVGDSCVFRFGN
FT                   AQGRGKPHTDVRLESGDAFVFGGPSRLAYHGVPKIFPGTAPEGCGLARGRLNITVRATG
FT                   MP"
FT   gene            complement(249488..250582)
FT                   /locus_tag="Srot_0275"
FT   CDS_pept        complement(249488..250582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0275"
FT                   /product="inositol 1-phosphate synthase"
FT                   /note="KEGG: mab:MAB_4907 myo-inositol-1-phosphate
FT                   synthase; TIGRFAM: inositol 1-phosphate synthase; PFAM:
FT                   Myo-inositol-1-phosphate synthase; Myo-
FT                   inositol-1-phosphate synthase GAPDH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96762"
FT                   /db_xref="GOA:D6ZB03"
FT                   /db_xref="InterPro:IPR002587"
FT                   /db_xref="InterPro:IPR013021"
FT                   /db_xref="InterPro:IPR017815"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB03"
FT                   /inference="protein motif:TFAM:TIGR03450"
FT                   /protein_id="ADG96762.1"
FT                   /translation="MSENANEVRVAIVGVGNCAASLVQGVQYYQDADEDATVPGLMHVR
FT                   FGPYHVRDVKFVAAFDVDAKKVGFDLSEAIFASQNNTIKISDVPPQDVTVLRGPTLDGL
FT                   GKYYMQTIEEAPGEAADVVAALKAAKADVLVSYLPVGSEEADRFYAQCAIDAGVAFVNA
FT                   LPVFIASDPVWAKKFEDAGVPIVGDDIKSQVGATITHRVMAKLFEDRGVVLDRTYQLNV
FT                   GGNMDFKNMLERDRLESKKVSKTQAVTSNLQGSLAGKVYDRNVHIGPSDYVEWLDDRKW
FT                   AYVRLEGRAFGDVPLSLEYKLEVWDSPNSAGIIIDAVRAAKIALDRGIGGPVYPASAYL
FT                   MKSPPRQLADDVARAQLETFISGE"
FT   gene            complement(250579..251151)
FT                   /locus_tag="Srot_0276"
FT   CDS_pept        complement(250579..251151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0276"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: rha:RHA1_ro03446 PadR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96763"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR018309"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB04"
FT                   /inference="protein motif:PFAM:PF03551"
FT                   /protein_id="ADG96763.1"
FT                   /translation="MLEMAILGLLHDSSIHGYDLRKNLRELLGPFRAFSYGSLYPALKR
FT                   MEAEGLIGSEDAAPPPSARSALAGSTSVGSKRAKRVYEITPEGRERFIELVSDTGPRNY
FT                   TDDGFGLRLAFFRFTTPEVRMRILEGRRRQVEQRRDTLRETLAKASAGLRRYTAQLQQL
FT                   ALESTEREVGWLNELIAAEIRGESHQA"
FT   gene            251518..252114
FT                   /locus_tag="Srot_0277"
FT   CDS_pept        251518..252114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0277"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mab:MAB_4531 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96764"
FT                   /db_xref="GOA:D6ZB05"
FT                   /db_xref="InterPro:IPR007593"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB05"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96764.1"
FT                   /translation="MSQPSASPETTEPPSKPAPGTVTHVTTNLPQSNIGWAVASAIFFW
FT                   PLSFSAFTNAWKVYPLWSAGDGEGAEQAAAKAKLLGKISLLVGLVLIFLFVGLRIVLPF
FT                   WFWRHHGGGWGLGDWGPGGHEPGGWGPGGHEPGGWGPGGHEPGGWGPGDMDHDGPEGQP
FT                   SPPAPPQQPVPPQQPVPPQLPVPPQQPVPPTAPRS"
FT   gene            252216..252587
FT                   /locus_tag="Srot_0278"
FT   CDS_pept        252216..252587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0278"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gbr:Gbro_4746 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96765"
FT                   /db_xref="InterPro:IPR035169"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB06"
FT                   /inference="similar to AA sequence:KEGG:Gbro_4746"
FT                   /protein_id="ADG96765.1"
FT                   /translation="MEYGLQRRSRLADYQAGLVARGEICDADRFLLLAAKFHGQASTTL
FT                   CPVCGKERLTLVSWVFGDSLGPASGSARGEAELAQLSLARGEFTVHVVEVCRGCSWNFL
FT                   IRSYVTGTAKTRAKRGASR"
FT   gene            252685..253014
FT                   /locus_tag="Srot_0279"
FT   CDS_pept        252685..253014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0279"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbt:JTY_3378 secreted protein antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96766"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB07"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96766.1"
FT                   /translation="MKTMTAALFATAVCGAAFLAPSPALAAPAPGHHDKQWCPGQPWDE
FT                   EWGVNDNPISCHAVDTDEDDEGLDDDAPDPDLGVGVPKAHPDGEYPPDYDWSDRYEDNH
FT                   GGRHG"
FT   gene            253039..254499
FT                   /locus_tag="Srot_0280"
FT   CDS_pept        253039..254499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0280"
FT                   /product="integral membrane protein"
FT                   /note="KEGG: svi:Svir_39350 predicted integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96767"
FT                   /db_xref="GOA:D6ZB08"
FT                   /db_xref="InterPro:IPR016570"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB08"
FT                   /inference="similar to AA sequence:KEGG:Svir_39350"
FT                   /protein_id="ADG96767.1"
FT                   /translation="MARVPDTSPSREVDQASLGGRVLPTWESAAAVQLSRWVGGAFGEH
FT                   GTIGRQPFFTPVRILLLFAVLGLVLGFGSKAPCLEQRETKHGHFEVLWTNHNEYARACY
FT                   TDILPLYGSEGFDKGSVPYRDHRPDGRWMEYPVLLGSFQYAAAAAAHAWTAGARHGVLP
FT                   PMAPGLVFFAVCALVIAAAWLVVVWASARLAGNRVWDVWLVALSPVVFVQAFTNFDAIG
FT                   VALLMAALLAWRRNMPFLVGLLAGLGAAVKLFPVLLFFPLLLVAWRDKRVADWAKALAA
FT                   AAAALLVVNLPVAWAYQEGWSEFFTFNRDRLSQEGSLLYLVFDYLRVQAQHGSVGLLPA
FT                   EKANAISLVAFVLCCAAIAAVSRTARAKPTLEQLVFLTVTAFLLTSKVWSSQYSLWLVP
FT                   LAVLAFPRLWALAGWMFLELLNWLTRQWWFYESFSGGGDPTVERVYFLLLVLRDGALVA
FT                   ICAALVRSLYRGERAPAPCASPTAEPAR"
FT   gene            254627..254914
FT                   /locus_tag="Srot_0281"
FT   CDS_pept        254627..254914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0281"
FT                   /product="ribosomal protein S6"
FT                   /note="KEGG: mav:MAV_0074 30S ribosomal protein S6;
FT                   TIGRFAM: ribosomal protein S6; PFAM: Ribosomal protein S6,
FT                   bacterial-like"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96768"
FT                   /db_xref="GOA:D6ZB09"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB09"
FT                   /inference="protein motif:TFAM:TIGR00166"
FT                   /protein_id="ADG96768.1"
FT                   /translation="MRQYELMLILDPNIDERTVAPAVDKLLGVVREEGGSVEKVDVWGR
FT                   RRLAYEIAKRGEGIYAVVDLKAQSSTVSELDRQLRINETVLRAKVLRKDK"
FT   gene            254932..255432
FT                   /locus_tag="Srot_0282"
FT   CDS_pept        254932..255432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0282"
FT                   /product="single-strand binding protein"
FT                   /note="KEGG: rha:RHA1_ro03431 single-stranded DNA-binding
FT                   protein; TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96769"
FT                   /db_xref="GOA:D6ZB10"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB10"
FT                   /inference="protein motif:TFAM:TIGR00621"
FT                   /protein_id="ADG96769.1"
FT                   /translation="MAGDTVITVVGNLTADPELRFTPTGAAVANFTVASTPRMFDRQTN
FT                   EWKDGEALFLRCNIWREAAENVAESLTRGSRVIVTGRLKQRSYETREGEKRTVVELEVD
FT                   EIGPSLRYSTAKVNRAARGGSSGGGGGRSGGYGDDPWASAPAGDDFPSSSSRSGSGDDE
FT                   PPF"
FT   gene            255454..255909
FT                   /locus_tag="Srot_0283"
FT   CDS_pept        255454..255909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0283"
FT                   /product="ribosomal protein L9"
FT                   /note="KEGG: nca:Noca_4661 50S ribosomal protein L9P;
FT                   TIGRFAM: ribosomal protein L9; PFAM: Ribosomal protein
FT                   L9-like"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96770"
FT                   /db_xref="GOA:D6ZB11"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB11"
FT                   /inference="protein motif:TFAM:TIGR00158"
FT                   /protein_id="ADG96770.1"
FT                   /translation="MQLILTKKVAGLGGAGDLVEVKEGYARNFLLPRKLAITGTASAQK
FT                   QAENIRTAAAQREARAHDRAEELKAKLAEVGKVAVPARAGNTGKLFGSVTPAQVAAAIS
FT                   NAAGSQVDAGDVRLAAHQIRSLGQYEIEVDLGAGLTSKVKLDIVAAQ"
FT   gene            complement(256028..257035)
FT                   /locus_tag="Srot_0284"
FT   CDS_pept        complement(256028..257035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0284"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   mab:MAB_2396 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96771"
FT                   /db_xref="GOA:D6ZB12"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB12"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADG96771.1"
FT                   /translation="MRPSACCDLEYSVWPSRWKTKGAGSFRARRTHGKNLCATAEIDAA
FT                   ERRGHDPGVVVRAHGRVADFWELTRELYEKDAVRNTFTLSALSAYLSQGGAPYLLLTAW
FT                   PHGTLAGAMLQISRDDPLRLSALPRSCVDAVVAAYAEADPALVAVDGPEQVADAFADAW
FT                   CATVGAVALPPRHNVLHELGEHTPPAVPGAARLATAADLDLLVGWTLDYEAEDYGRHGS
FT                   PETMRRVLGSNLRGSDCVFVIWEDKGRPVAFAGVRRPVAGVSRVGPVFAPEDVRGNGYG
FT                   IAVAGAATAWALETGRAARVVLFTDETSPRPNSIYRKLGYRPVLRFSERRFQAP"
FT   gene            257377..258834
FT                   /locus_tag="Srot_0285"
FT   CDS_pept        257377..258834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0285"
FT                   /product="replicative DNA helicase"
FT                   /note="TIGRFAM: replicative DNA helicase; PFAM: DnaB domain
FT                   protein helicase domain protein; KEGG: rha:RHA1_ro03428
FT                   replicative DNA helicase; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96772"
FT                   /db_xref="GOA:D6ZB13"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB13"
FT                   /inference="protein motif:TFAM:TIGR00665"
FT                   /protein_id="ADG96772.1"
FT                   /translation="MPMPVGESRERVGLVRAEDAPREDHGLGSAVASRDRGPSSDGPYD
FT                   AGRQPPQDAVAEQSVLGGMLLSKDAIADVLEHVQGKDFYRPAHQLVFDAILELFGRGEP
FT                   ADAVLVAAELERKGHLGRIGGAPYLHTLISSVPTAANASYYAEIVAEKAIMRRLVEAGT
FT                   RIVQYGYGGADGQDAAEVVDRAQAEIFDVTQRKRADEVVALEDLLQPTMDEIDSIASRG
FT                   GISLGVPTGFADLDKVTNGFHPGQMIIVAARPGVGKSTLALDFLRSCSVQNGLASALFS
FT                   LEMSKMEIVMKLLSAEARIRLADMRSGRMSDDDWSRLARRMSQISEAPLFIDDSPNLTI
FT                   MEIRAKARRLKQRHDLKLVVVDYLQLMTSGKKVESRQQEVSEFSRQLKLLAKELEVPVV
FT                   ALSQLNRGPEQRTDKRPMVSDLRESGSLEQDADMVILVHRPDAIEPDDPRGGEADLILG
FT                   KHRNGPTCTITVAHQLHVSRFVDMARG"
FT   gene            258963..259205
FT                   /locus_tag="Srot_0286"
FT   CDS_pept        258963..259205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0286"
FT                   /product="TolA protein, putative"
FT                   /note="KEGG: mca:MCA1228 TolA protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96773"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB14"
FT                   /inference="similar to AA sequence:KEGG:MCA1228"
FT                   /protein_id="ADG96773.1"
FT                   /translation="MAKADDLYLMQLELQKRTKASMQAVDQGFQAIRDEERRQADQREK
FT                   RAEQEAAATPEGRARAAWDAASDPRRWGSYEDEEG"
FT   gene            259208..259507
FT                   /locus_tag="Srot_0287"
FT   CDS_pept        259208..259507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0287"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: SORBIDRAFT_02g038860; hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96774"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB15"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96774.1"
FT                   /translation="MADMSSPDGVRQLGDAWLQASGGLHDQATAIQSSPLFPASFGSRY
FT                   AEQAAGVREGFEKIADTWRGWGGHCEGYGGNLHGAVNTYTGADEGNASELDMHF"
FT   gene            259507..260196
FT                   /locus_tag="Srot_0288"
FT   CDS_pept        259507..260196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0288"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lcb:LCABL_21960 peptidoglycan lytic protein
FT                   P45"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96775"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB16"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96775.1"
FT                   /translation="MADTGKEILDSGHVPVNGQQTEALAALRQYFDILLLHWVRLAACG
FT                   VSFAGLDPNRGGGYYTQAYHAEDDIDLKAFRDTSQTLRTAGAGTQTQLDLIAQTENLHH
FT                   HWNDPASDAALHNYLTNKDRMEQDQSDLVAHQQNIAQVAENLQKALEAKRDMAVNAVDK
FT                   LVNQALRNSPGISRTGCAPPASRWSPTTRAAASAASASTSTSTSTTGPPARTGTPTTCG
FT                   ATSRTAW"
FT   gene            260166..260999
FT                   /locus_tag="Srot_0289"
FT   CDS_pept        260166..260999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0289"
FT                   /product="chitinase-like protein"
FT                   /note="KEGG: mxa:MXAN_7387 chitinase, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96776"
FT                   /db_xref="GOA:D6ZB17"
FT                   /db_xref="InterPro:IPR000726"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB17"
FT                   /inference="protein motif:COG:COG3179"
FT                   /protein_id="ADG96776.1"
FT                   /translation="MRGDIQNSVVNAFALVCQALDKADNEVKTHIEENYDVLLKALDAQ
FT                   GGPPPPLSEEALGRVMPKLAKDPQKLHEYYEMLLQTMRENGIDDPKAQITFLATLAEES
FT                   DQFTAPGLEELWDEKYGDNPPYDARAHYYQVVDGLEGDDWVYHGRGYIQLTNRANYQAA
FT                   QDYLRQHGYPNIDLMGHPEQASDPKTAAATAGWFWKNHGADLSRVAAAGDPSTAFTNVT
FT                   MGVNGAVNGEVAPAAQYPTRAEYYNALVTEYREMLAARGVPESSLPTTIDTAPRY"
FT   gene            260999..262201
FT                   /locus_tag="Srot_0290"
FT   CDS_pept        260999..262201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0290"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mva:Mvan_5771 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96777"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB18"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96777.1"
FT                   /translation="MRLTHTWFSALAAAFALASCHAPDDGQGSSSSAQHHAVGASTAAT
FT                   APLPTDFPGIPAGAVVAYHDGDGVKVITAIPAATQASFGAKDTGAPSFTADGKHVFASV
FT                   GKANRQDADQILDFDVATRTVRSIACPCAKAVAASGSMLVWWEDPDRLMSLDLREPDPK
FT                   PKILRTVQLPTPAPDKIQGELSWQPSGTAVIGASRDIVLIGRLPTKPLPTGGPTYLFTV
FT                   QDDGTARSLGAANSDGPVTRALFSPGGKQFAYIGRYRASSNSRSASVSIVDTSTWQTQT
FT                   PSIADSSSPGVVPGVTSLWWDSDGALDTVYYSDKEGSPSPMTTVTPPNIWTLTDQTWKQ
FT                   IGFDGERWLYHLAPGAILTLGRSNPRDEHSVSTTLSMEVQGRRAQIAEGVTAVAAMSAR
FT                   Q"
FT   gene            complement(262274..265087)
FT                   /locus_tag="Srot_0291"
FT   CDS_pept        complement(262274..265087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0291"
FT                   /product="Transport protein"
FT                   /note="KEGG: mmi:MMAR_3048 transmembrane transport protein,
FT                   MmpL5_5; TIGRFAM: Transport protein; PFAM: MMPL domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96778"
FT                   /db_xref="GOA:D6ZB19"
FT                   /db_xref="InterPro:IPR004707"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB19"
FT                   /inference="protein motif:TFAM:TIGR00833"
FT                   /protein_id="ADG96778.1"
FT                   /translation="MNGNPQPRPLLARAMRALAAPVILGWLLLTIALNLLVPQIEAVGR
FT                   ANSLPSAPQDAPSVMAAKKMGAAFGEFRSDSAVMVLIEGRDTLGEAARRYDEDLVARLR
FT                   QDTKHVEHVQDFWGDRITAAGAQSSDGKAAYTQVNLAGDQGTPLGNESVRAVRRIAAET
FT                   PPPDGVSVYVTGQAALSADMSDAGDKSMILMMAVTIAVIAIMLLVVYRSISTVLLILFM
FT                   VFVEMGAARGVVAVVGDQRLIGFSTFAVSLLTALAIAAGTDYAIFLVGRYHESRNRGES
FT                   PEDAYDATLRGVPHVILGSGLTVAGATFCLYFTRLTYFKALAIPSSAGLLVVLAAALTL
FT                   GPAVLWLCARFGLLEPKRPANTRRWRKIGAVVARWPGPVLAGTAAAAIIGMLGLAGYET
FT                   TYNDRFYIPADEPANTGYEAAEHHFSAARMNPDILMVQADHDMRNPSDMILLDRIAKNV
FT                   FRAPGVAMVQSITRPLGSPIEHSSIPFQVSMQTVPITENLQFMHDRMADMLTMADQIGD
FT                   MTAVMGRMQQLVQRMAATTDSMAGGMAAMNTTVEEMRDRIADFEEILTPVRDDTSWEQH
FT                   CDGIPVCWSVRSAFEALDGVDRFTEPLAGLLHDIGDMNTTIRQLAAQLPTMIEVAQSMR
FT                   STILVMHSSFAGLLDQMGRMTDTATAMGRAFDSSKSDDYFYLPPEAFQNPDFQRGLTLF
FT                   LSPDGAAARFIITHDNDPATPEGVSHVDAERQAARDAVRGTPLAGAQLFLSGTAATFKD
FT                   IQKGSFYDLLIAGVAAITLILIVMLVVTRALIASLVIVGTVLLSLGASFGLSVLLWQHI
FT                   LGIKLHWIVLAFSVIILLAVGSDYNLLVVSRFKEELGAGMRTGLVRAMGATGGVVTAAG
FT                   LVFAVTMGSMATSSLRMIGQGGATIGLGLLFDTLVVRSFMTPAIASLLGRWFWWPLNIP
FT                   ARPRRGS"
FT   gene            complement(265084..265476)
FT                   /locus_tag="Srot_0292"
FT   CDS_pept        complement(265084..265476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0292"
FT                   /product="membrane family protein"
FT                   /note="PFAM: membrane family protein; KEGG: mmi:MMAR_3049
FT                   membrane transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96779"
FT                   /db_xref="InterPro:IPR008693"
FT                   /db_xref="InterPro:IPR038468"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB20"
FT                   /inference="protein motif:PFAM:PF05423"
FT                   /protein_id="ADG96779.1"
FT                   /translation="MVIAAAASTVAVLRLRAEFGADETRLSQPGNLESIVPITPKTVVY
FT                   EVFGATQARGKVSYVDEHAQPKNASFTALPWSRTITTMAPVVFANLVAQGESGSIGCRI
FT                   RVNGEIQDERTASGQGAQVSCLVKAG"
FT   gene            complement(265562..266722)
FT                   /locus_tag="Srot_0293"
FT   CDS_pept        complement(265562..266722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0293"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: mab:MAB_4743c putative
FT                   dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96780"
FT                   /db_xref="GOA:D6ZB21"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB21"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADG96780.1"
FT                   /translation="MDRKRIVVLGAGIGGLSVVKELRESRAPLDDVDVVLVDQNFEHYL
FT                   GFTLPWVMRGWRDEQSVPIRPTQNALDGLTTVQGKVVGVDPAHKTVALDDGAQLGFDAL
FT                   VLALGAQNTPGEVPGLHEALDAGSAVHYYSAAEAGRAHRALQHFDGGKLVFLVASQPYR
FT                   CPVAPYEGALLAADLLHERGVRETTEISVHTPEPQPMPSAGPHAGPKLVELLHEQGIAF
FT                   HPGHAVQRVDHHTKTVRFADGETAPFDLLVFVPPHKPALSLRADDWISVDRQNMRTEHE
FT                   GVWAVGDIASVTSPSGKTLPKAAIFAKNGGKAVARDLLRHFGKTNEPGSLSGLGYCFID
FT                   TGGHEAARGAGDFFALPHPDVVLEPPSEELHHDKAEEERAWRAFWE"
FT   gene            complement(266730..266894)
FT                   /locus_tag="Srot_0294"
FT   CDS_pept        complement(266730..266894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0294"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:pnf2683 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96781"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB22"
FT                   /inference="similar to AA sequence:KEGG:pnf2683"
FT                   /protein_id="ADG96781.1"
FT                   /translation="MCHAAQCRTCGKTTWSGCGSHIESVKRRTPPEQWCDGHPGQQPRF
FT                   PFGGFFRRK"
FT   gene            complement(266917..267222)
FT                   /locus_tag="Srot_0295"
FT   CDS_pept        complement(266917..267222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0295"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   mav:MAV_5178 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96782"
FT                   /db_xref="GOA:D6ZB23"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB23"
FT                   /inference="protein motif:PFAM:PF02583"
FT                   /protein_id="ADG96782.1"
FT                   /translation="MWVMEETTPPPAPRRAPEDMAAVLGRLRRAHGQLGGVIAMIEQER
FT                   SCRDVVTQLAAVSRALDRAGFKIIATGLRDCVAEPDGTPGHGLTVDELEKLFLSLA"
FT   gene            267453..268523
FT                   /locus_tag="Srot_0296"
FT   CDS_pept        267453..268523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0296"
FT                   /product="phospholipase/Carboxylesterase"
FT                   /note="PFAM: phospholipase/Carboxylesterase; KEGG:
FT                   fre:Franean1_4201 alpha/beta hydrolase domain- containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96783"
FT                   /db_xref="GOA:D6ZB24"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB24"
FT                   /inference="protein motif:PFAM:PF02230"
FT                   /protein_id="ADG96783.1"
FT                   /translation="MRHVRFFHRFRPGAVRRGAGALCVGAVVLAAGCDHGSARSATSTP
FT                   PPAMRVVKDVQYAGGAADADRSGHMLDLYLPQGAAKAVPLVIWTNGSAFLFPAGRDRGD
FT                   LFANRLVPRGYAVAAVAVRGSGQATFPAQRDDTLAAVAFLRRNAAQYGLDPARFAYMGH
FT                   SSGGWSSAVAGVEGSGESAVQAAVALSPVTDVAATAKEALPDDMWRIAEEQRRSNVPGV
FT                   PGFRGDHEAADSPEGKFLGGRVSDNMDKAAAASPALHVAPAGPPFLIVHGTEDEYVPFA
FT                   QGTTLYFALKQAGRDVTFVMLPGASHRATLPPWSAESVKNATSAHSTGGRTPDVSAVSG
FT                   DGWDVILGFLDAHLKP"
FT   gene            268647..269345
FT                   /locus_tag="Srot_0297"
FT   CDS_pept        268647..269345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0297"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ami:Amir_3117
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96784"
FT                   /db_xref="GOA:D6ZB25"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB25"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG96784.1"
FT                   /translation="MGFAMTRKVPSVPVTPAKKPTARARQAAQTRDRILEAAVQCFSEA
FT                   AYEEVAVSDIAKAAGVAHGLLFHYFGSKRGMYLEAMRVAAQQLEASFVFEPDLEPLEQA
FT                   RRAVASHLRFLAAHRGMALRLILGGRGADPAAWEVFEAARWRAVEATAALFGVDSQRPA
FT                   TRMACRAAVGAMDEAAVFWLHNDQLFAVDDMAEWMVAMVASVVRAAIRLDPGMGVEDAL
FT                   SVIDGQLPPG"
FT   gene            complement(269462..269902)
FT                   /locus_tag="Srot_0298"
FT   CDS_pept        complement(269462..269902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0298"
FT                   /product="Polyketide cyclase/dehydrase"
FT                   /note="PFAM: Polyketide cyclase/dehydrase; KEGG:
FT                   rha:RHA1_ro05063 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96785"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB26"
FT                   /inference="protein motif:PFAM:PF10604"
FT                   /protein_id="ADG96785.1"
FT                   /translation="MPEVTTSREIDAPQALVWSAVSNPQRFADWNTLHAKWAEEPPAAL
FT                   EKGARFVEVVKIKGVTDAIEFHADDIRGPEFVSLSGSGSTGSSVVLEFSVADRPAERSR
FT                   ATLHIVFTSPVLVGPLGKVLERAFRKELDASLEKLATLVAAG"
FT   gene            complement(269946..271133)
FT                   /locus_tag="Srot_0299"
FT   CDS_pept        complement(269946..271133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0299"
FT                   /product="Acyl-CoA dehydrogenase type 2 domain protein"
FT                   /note="PFAM: Acyl-CoA dehydrogenase type 2 domain; KEGG:
FT                   rop:ROP_53450 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96786"
FT                   /db_xref="GOA:D6ZB27"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB27"
FT                   /inference="protein motif:PFAM:PF08028"
FT                   /protein_id="ADG96786.1"
FT                   /translation="MTTFDTITAADVLDRVRDLLPLIREHAAQNERDRKIADEVIAALR
FT                   DAGAFRLAAPRRFGGLEAGLRAMLDLSALIAEADGGTSWVTTLSNINAWSTCLYDAATV
FT                   DEIYADGPDAILSGVVSPGGTARATPGGYLIRGEWPYCSASLHADWVSGGVWEVDENGD
FT                   EIDQSMVVMRASDVQIKDTWHVAGMRSSGSNTIVADDVFVPSHRVSSMLPVVSGDSVEQ
FT                   YPDNPFYRSAFAPMLVLVLIGPQLGLGRAALDIAVKKASTKALAYTNIEQQADSVAFQL
FT                   LVADAATKIDTAHLHAYRAADDVERYAEQGVYPDVAARARMRADAAVALTSVNDAINTL
FT                   LNACGAGSFADVNPLQRIWRDANVGQRHAVILPQVSMETYGKALLGRTDHITAIL"
FT   gene            complement(271482..272741)
FT                   /locus_tag="Srot_0300"
FT   CDS_pept        complement(271482..272741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0300"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: Beta-ketoacyl synthase; KEGG: mab:MAB_4608
FT                   3-oxoacyl-(acyl carrier protein) synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96787"
FT                   /db_xref="GOA:D6ZB28"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB28"
FT                   /inference="protein motif:PFAM:PF00109"
FT                   /protein_id="ADG96787.1"
FT                   /translation="MARPSTANGGFPSIVVTGMAMMSAIAPDVEGTWQGLLDGESGIRA
FT                   LEDDFAAGLDLPVRIGGRLKVRDFDKDLTKVEHRRMSYVQRMATVLGRQAWADAGSPDG
FT                   VDEARLAVAIGAGMGSVRGMAEAYDEMREKGARAISPFTVQMFMANGPAAVVGLERKAR
FT                   GGIITPVSACASGNEAIAHAWRQIAYGDADIAICGGVEAAIDAFAVAAFANMRIVLSTA
FT                   NDEPEKASRPFDKNRTGFVFGESGALLVIETEEHAKARGARSYARLLGAGITSDGHHLV
FT                   APHPDGVGAARAMTRALENAGLQPGDVGHVNAHATATSVGDLAEAKAIRLAGLQHAEVY
FT                   APKGAIGHSVGAVGAVEAVITVKTLQEGIIPPTLNLETPDPEIDLDVVSGEPRKSDHAY
FT                   AINNSFGFGGHNTATVFGKY"
FT   gene            complement(273050..273634)
FT                   /locus_tag="Srot_0301"
FT   CDS_pept        complement(273050..273634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0301"
FT                   /product="serine O-acetyltransferase"
FT                   /note="TIGRFAM: serine O-acetyltransferase; KEGG:
FT                   rer:RER_10920 serine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96788"
FT                   /db_xref="GOA:D6ZB29"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB29"
FT                   /inference="protein motif:TFAM:TIGR01172"
FT                   /protein_id="ADG96788.1"
FT                   /translation="MSVLSALREDLQNARSHDPAARSDLENALLYSGLHAIWAYRVAHR
FT                   MWATPALRGPARALSQLARFFTGVEIHPGATIGRRFFIDHGMGVVIGETAEIGDDVMVY
FT                   HGVTLGGRSLRAGKRHPTIGNRVTVGAGAKVLGPLRIGDDSAVGANAVVTRDVPAESIA
FT                   TGIPAVVRSRTEKQREPGVDPTCYIDPALYI"
FT   gene            complement(273642..274577)
FT                   /locus_tag="Srot_0302"
FT   CDS_pept        complement(273642..274577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0302"
FT                   /product="cysteine synthase A"
FT                   /note="KEGG: rer:RER_10910 cysteine synthase; TIGRFAM:
FT                   cysteine synthase A; cysteine synthase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96789"
FT                   /db_xref="GOA:D6ZB30"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB30"
FT                   /inference="protein motif:TFAM:TIGR01139"
FT                   /protein_id="ADG96789.1"
FT                   /translation="MSKIYENVSDLVGHTPLVQLNRLTAGLPGRVVAKLEYYNPANSVK
FT                   DRVGVAIIDAAERSGELRPGGTIVEATSGNTGIALAMVGAARGYKVILTMPDTMSVERR
FT                   AMLRAFGAEIVLTPGSEGMAGAVERAKQIIAGTHNAVAANQFSNPANPAMHEQTTGEEI
FT                   WADTDGAVDVFVAGIGTGGTISGVGRALKARKPGVRIVGVEPKDSPILNGGAAGAHKIQ
FT                   GIGANFIPEVLDRDIYDEILDVEFADAIKVARALGVEEGILGGISAGANVWAALELAKR
FT                   PENAGKLIVTVVCDFGERYISTALFDHIRD"
FT   gene            274825..275502
FT                   /locus_tag="Srot_0303"
FT   CDS_pept        274825..275502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0303"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mav:MAV_1612 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96790"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB31"
FT                   /inference="similar to AA sequence:KEGG:MAV_1612"
FT                   /protein_id="ADG96790.1"
FT                   /translation="MDLQDERARAAPVIIADGLGVDGEHGPFFSDIRLALAPGLHAVRT
FT                   SGPPAQSVLLLTLAGRFKPSRGELSVRGDVEPGKIRRHCAIAAFADIDELEEAVTVRTV
FT                   LAEQRRWLAPWCSRAKAEPAAAVLGEVFAEIPPPPLAKYVADLSDLEVFLLRIALALVT
FT                   DRPILVVGDLEQVRDSAHRALAARRLGALAARRTVVVGVANPLGDDAPDHTLHDCRILL
FT                   RKD"
FT   gene            275505..277337
FT                   /locus_tag="Srot_0304"
FT   CDS_pept        275505..277337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0304"
FT                   /product="YhgE/Pip C-terminal domain protein"
FT                   /note="KEGG: mab:MAB_4762 hypothetical protein; TIGRFAM:
FT                   YhgE/Pip C-terminal domain protein; YhgE/Pip N-terminal
FT                   domain protein; PFAM: ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96791"
FT                   /db_xref="GOA:D6ZB32"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="InterPro:IPR022703"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB32"
FT                   /inference="protein motif:TFAM:TIGR03062"
FT                   /protein_id="ADG96791.1"
FT                   /translation="MLAGLAFGSEIKRFGRSRLTRAAIVVLALLPLVYGALYLWAYWDP
FT                   FGHVNKMPVALVNADRGAVVSGQRINVGDEIAKSLTQDGGLEWHVMSHEQARGGVDHGK
FT                   YYFMLELPPDFSEAVASPVTGQSKKAELIAVYNDANNYISSNIGRTAVDQVLTAVSTRI
FT                   SGQAVNQVLSVVLSSGSGIKQAADGARLLADGAAQVDDGAAQLSAAIDKATDPILAVGK
FT                   AASAVGGDTEQLQQAAVALRQANAQIGGIAKAQDGAAASLAGVIDQLSASDDPAARSSA
FT                   ETLRGVQNQLHEHQFTPQIRQQLTDGENAAISLTETLRSPGSPLRSALDQLGGKGRDLT
FT                   DKLAQLRAGAERLKSGTAQVRGGSSELAAKLADGAGQVPNWTPQQKDAIADTIGGPVHL
FT                   RASHLNAAPNFGTGMAPFFLTLALFFGAIVLWMVFRPLQNRAIAAQAPAFRVALASYLP
FT                   AALIGISQAVVLYCVVRFGLGMRAAHPVAMLAFMALVSFAFVALTQSVNALLGPAVGRV
FT                   LVMALLMVQLVSAGGMYPVETTSKPFQALHRYDPMTYGVNGLRQLVLGGVDSRLWQAVL
FT                   TLAAIMAGALAVSSVCARRNRLWNASRLIPAIKM"
FT   gene            complement(277356..278540)
FT                   /locus_tag="Srot_0305"
FT   CDS_pept        complement(277356..278540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0305"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   nfa:nfa54750 putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96792"
FT                   /db_xref="GOA:D6ZB33"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB33"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADG96792.1"
FT                   /translation="MAQLTQVLLLSWRDTTHPQGGGSEQYLERVGERLASEGVEVVVRT
FT                   ARHRGSARSETRDGMRFSRGGGRLTVYPRALAALALARIGIGPLAGFRPDVIVDTHNGM
FT                   GFFARLATRAPVVVLVHHCHKEQWPVAGRLLGALGWWLESVVSPWVHRRAQYLTVSLPS
FT                   LEGLVRLGVDRERAAVVRAGVDRVPAGAPVGGPATRSAQPTLCVLTRLVPHKRVEDVLD
FT                   ALAALRADGLAQLRLEIVGDGWWADNLRRRADELAVADAVVFHGRVDEARKHEVLARAW
FT                   LHVMPSLAEGWGLAVIEAAQHGVPTVGYTGSGGLTDSILDGVTGVLVDGPEDLARVVRD
FT                   LIGDHRQREALGEKARRRAREFSWAQTAAGVRQVLEAAARGELVSGLVGPANGR"
FT   gene            278542..279342
FT                   /locus_tag="Srot_0306"
FT   CDS_pept        278542..279342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0306"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: rop:ROP_52360
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96793"
FT                   /db_xref="GOA:D6ZB34"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB34"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADG96793.1"
FT                   /translation="MVTEPNAKICQDAVRSALAEGATLRRSFGLLRAFRFESSDPDQFY
FT                   DPLAQDWLRILLAAWRAWRPEAELSALRALDVGGAEGRSAVLLADIVERSVLVDADPDG
FT                   CREALASGVPVVRGDGQRLPFADATFDLVASSNVGEHVPQPWRLADELLRVTRPGGMAV
FT                   FSYTVWLGPFGGHETGRWHWLGGRYAARRYARAHGRPPKNLFGVSLFAVSAADGLRWAR
FT                   RLPPGAVLLAALPRYHPRWAWWLVRLPWLRELLTSNLLLVVGKR"
FT   gene            279441..281270
FT                   /locus_tag="Srot_0307"
FT   CDS_pept        279441..281270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0307"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="KEGG: nfa:nfa8260 hypothetical protein; PFAM: AAA
FT                   ATPase central domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96794"
FT                   /db_xref="GOA:D6ZB35"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR023835"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041627"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB35"
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /protein_id="ADG96794.1"
FT                   /translation="MYDTRAARRSFDIGILSLGIPIDGQEAPKDLAHARKAFDLASRQD
FT                   PTMSDAWLGLATTLAQAQEELPGEIVLRLYENGERNLFAEHRRLGLPPRTLGGRFSTGL
FT                   YIDYPLTDWNEIQVAKASLLIRERSHDEAEQLLKDLRERTGGKLAIVDYVTGFLYYGAQ
FT                   LWPDVLVALRESDGWSDRYLASGADLMVGSSCAQLGLFSQAVQRLERAESGVIPAAQIA
FT                   AKYSRGLVLREQGEAEKARAIFEEIYAREPGFEANKRAMQEPTFRIVTTTPERIALRAN
FT                   RWDPSSAPSEDEIKKKEAAAAEEKRSAENEILLAEAQQELDLQIGMSGVKQQVARLQAT
FT                   VQMARLRAEKGLGGGQAKSQHLAFTGPPGTGKTTIARVVAKIYCGLGLLKTANVLETSR
FT                   KDFVGEHLGSTAIKTTALIDRAMDGVLFIDEAYTLLQSGLSGGDAFGKEAIDTLLARME
FT                   NDRDRLVVIIAGYDNEIDRFLAGNEGLASRFAKRIRFDSYTPDELGRIAEFQAKRRDAV
FT                   ITPDAMREFITQTQRLYDQTKISSSGQEMRLVDLAGNGRFVRNVIEAAEEEREFRLTQS
FT                   GVDPADLTEEDLMSITAEDLRTAMSSVIAANRL"
FT   gene            281608..281922
FT                   /locus_tag="Srot_0308"
FT   CDS_pept        281608..281922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0308"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: msm:MSMEG_1872 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96795"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB36"
FT                   /inference="similar to AA sequence:KEGG:MSMEG_1872"
FT                   /protein_id="ADG96795.1"
FT                   /translation="MGGSLRSDSAELRAVQQLVSGIVDEMRVGFDGLAQHGDQLLEGWI
FT                   GVAASKFRAPWDEWKQGCKTVVDALEAESGLLGESADEYDQQEGVNSDSLANVDVRYNW
FT                   "
FT   gene            281919..282218
FT                   /locus_tag="Srot_0309"
FT   CDS_pept        281919..282218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0309"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa42700 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96796"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB37"
FT                   /inference="similar to AA sequence:KEGG:nfa42700"
FT                   /protein_id="ADG96796.1"
FT                   /translation="MSGMGEEYRVELDQLLAHVERCEEFDKKVEDWLDQIDAAIARLHT
FT                   SWSGEAAAAQREQHDRWVAGAREMRDALARLKDQAAADHGRYAGLIGHQRGMWP"
FT   gene            282215..283735
FT                   /locus_tag="Srot_0310"
FT   CDS_pept        282215..283735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0310"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nfa:nfa42710 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96797"
FT                   /db_xref="InterPro:IPR026835"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB38"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96797.1"
FT                   /translation="MSPDPVLSVSPPDFSRAGQIVRSALGGGSSGSGGEIAPAFFDLVM
FT                   DLKTTKGLAGTDAYAHEWNNQFYRPALIGDTGGAGKGGGLMDAATVALNAMGMLSDLLV
FT                   YSGINHALGDDPDAPAFPPGTHEVIPVPFVPDAQGRTMQAAPGWWPIIAGMLTGQEYPD
FT                   GDVSALRNLRDRYKSTATAFRSGTAALDQASALVQQQQAPEVAGVVNWLGIVKTQLLDV
FT                   ADGFDVLGDGCAQFAQHVQSARDEVNKKAQEELGNIAETEIISAGLAGATLGVSEVLGN
FT                   YRLYKRAKELAEFVKTRLSAERIAQELRDAFSPMAAIAGGPAAQGVGKLLPLLNAMPAI
FT                   YMPEGAAEAAAIGSALGLDRLVTHMTRRMRPNAATERQVYENAVSESMNGKEYWQSGAN
FT                   KNILIPKDGKYPPEITNLPKTDNGKYYQGADGTLYPVNTQIHIGHIKYSEWARLRNDAI
FT                   AKGWTERQLQEYIQNHKLYQIEDAYGNLSHQYEAPIPSVAEILRENPQ"
FT   gene            283732..284289
FT                   /locus_tag="Srot_0311"
FT   CDS_pept        283732..284289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0311"
FT                   /product="Ankyrin"
FT                   /note="PFAM: Ankyrin; KEGG: sin:YN1551_2013 ankyrin"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96798"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB39"
FT                   /inference="protein motif:PFAM:PF00023"
FT                   /protein_id="ADG96798.1"
FT                   /translation="MTNNIDVHSRDSLQQTPLHISVGDMWEPGDRTPSVDQLIAAGADV
FT                   NARDQWGRTPLHYASHSDRADAVAALIAAGADVNARDNGNWTPLHAAAARGCTAVVKLL
FT                   LDAGAEVEPIDSQGETPLSRAITAKSGVPEEVIKLLRERGANPWRKSGRHSPLSAARAH
FT                   TSGYHFQEIKEAFADLPDEEPK"
FT   gene            284286..284726
FT                   /locus_tag="Srot_0312"
FT   CDS_pept        284286..284726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0312"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ZNF692; zinc finger protein 692"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96799"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB40"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96799.1"
FT                   /translation="MSVLDTDGRLADMRVRAERFAARVEGIRGKGTRLNGRLVFEVDAR
FT                   KNPVNVAVDASIGQYNADSIAELFHGAARDACQDVDRQMREALVEFGEDQKTRELVREL
FT                   MGPLSPRLPPAPGAQQRQAEPQGPDPDDEEAWNDARSWLEKA"
FT   gene            complement(285023..285952)
FT                   /locus_tag="Srot_0313"
FT   CDS_pept        complement(285023..285952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0313"
FT                   /product="Prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="KEGG: msm:MSMEG_6418 prephenate dehydratase; PFAM:
FT                   prephenate dehydratase; amino acid-binding ACT domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96800"
FT                   /db_xref="GOA:D6ZB41"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB41"
FT                   /inference="protein motif:PRIAM:4.2.1.51"
FT                   /protein_id="ADG96800.1"
FT                   /translation="MIAYFGPSGTFTEAAMLDFVRRGLAPDTGALALNSPQDVIAAVRD
FT                   GTARYGCVPVESTADGSVAPTLDGLVAGEPVQIVAETQLEVSFSVLLAPEADPDEVATV
FT                   AAYPVAAAQVRSWLAQRWPRAAVVPASSNAAAALDAAEGRADAAVTTPIMAERLSLREA
FT                   ARSVADITGSRTRFALISAPCAPPPRTGSDRTAVALRLAHAPGSLANAMNQLALRDLDL
FT                   IRIESRPTRNQPEPYWFFLDFVGHVDDPVVAEALKSLWQHSIEVFYLGSWSCESFGGAA
FT                   NRPIGVPPPSDEAARRWVAGLRSPSSRP"
FT   gene            complement(285949..286998)
FT                   /locus_tag="Srot_0314"
FT   CDS_pept        complement(285949..286998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0314"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   nfa:nfa32360 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96801"
FT                   /db_xref="GOA:D6ZB42"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB42"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ADG96801.1"
FT                   /translation="MPDESHSGQRPAAWREGLREGPHAPFADRPEPDNAGARYKTLTYE
FT                   TTGRVARIVFNRPERGNAITPDTPLDLAAAVERADLDPRVHVILVSGRGKGFCGGYDLD
FT                   MFAENGGTSDAGAHETAPGAADNRAARAGTVLDPVAQAVNHNPWGVWDPMLDYAMMSRF
FT                   NRGFASLLHANKPTVAKLHGFCVAGGTDIALYADQIICASDTKIGYPPTRVWGVPAAGM
FT                   WAHRLGDQRAKRLLLTGDCISGKQAEEWGLAVEAPEPDELDECAENLVERIAMMPINQL
FT                   MMVKLALNSALINQGVANSTMVSTVFDGISRHTREGYAFQLRSMTAGFREAVRERDEPF
FT                   GDHKRAQFE"
FT   gene            complement(287080..289980)
FT                   /locus_tag="Srot_0315"
FT   CDS_pept        complement(287080..289980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0315"
FT                   /product="MMPL domain protein"
FT                   /note="PFAM: MMPL domain protein; KEGG: mab:MAB_2210c MmpL
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96802"
FT                   /db_xref="GOA:D6ZB43"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB43"
FT                   /inference="protein motif:PFAM:PF03176"
FT                   /protein_id="ADG96802.1"
FT                   /translation="MNRADSRSGARAFAARVRGEFSVSSLREGCARKEGRPLVARLLYG
FT                   FSVPIVAVWLLLAAGLNLAVPQLEKVVELHALSFLPDEASSVQAIANMGKYFGQGGTNN
FT                   FVAVLLEGEEPLGADAHRYQAELMGKLNADKKHVITAIDLWSNPTFAPAFESSDKKASF
FT                   AYLNLTGNMGTALAMESTQAVRDIIAKTPPPKGVKAYVTGPAAVVNDELLSINRSIIPV
FT                   VAACTLLITLTMLLVYRSLLTAGMPLLVVGVALLTARPLVALLGAHEIIGVSIFASSLL
FT                   AGIILGAGTDYGIFLLGRYQEARQAGEDPATAYYTALSGVQHVVFASGLTVAGATACMS
FT                   FTRLSIFSTSGLPCTIGILTALAAALTLGPALLAVGSRLGFYEPRGQRAARRWRRVATR
FT                   VVRWPGPVLVGSAAVLAAAILVLPTYVTSYNERAAQPDTTEANVGLAAADRHLPPNLLN
FT                   PNLLFVESDHDMRNPADLIALAKLTNAVYAVNGVRAVQGITRPLIAPLPQGTLTYQAGY
FT                   VGERMSQMTAMLTAQLGGIASLSDRIGSLSFAVKGLQAELGAARQGLGQSIHSGQGLQA
FT                   EFLDVLEKARSVRDDVRPLSDAGEQLANSIPNCENIPYCHAALTGLSLLDNLDQFDERG
FT                   VQDLLNGARTASQSLPRLDAQIRVLGDFLNEMQQTLAPVRHMLDSLTPQISEITEFTRQ
FT                   VAESFGGADPSGFFFLPSQAFQSPLFQSALSVFFSPDGKVTRMLVMGDVNSFSKASMDY
FT                   SARIVPAATAALKGTSLGGSKVSLGGAGGTLLNIAAFAKEDFITSAVAAFAFVFCVVLV
FT                   LLRSFVAAVAVVGTVAISYLSAWGLSVAIWQHLAGLPLHWAVAPCSFVFLVAVGADYNL
FT                   LLVTRFQEELRAGIKTGIVRSMAGTGSVVTTAGLVFGFTMLAMLAGYSTILAQIGTMVG
FT                   GGLLLDTLVVRSLVIPAIATLLGRWFWWPIPVRNRP"
FT   gene            complement(289977..290390)
FT                   /locus_tag="Srot_0316"
FT   CDS_pept        complement(289977..290390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0316"
FT                   /product="membrane family protein"
FT                   /note="PFAM: membrane family protein; KEGG: mab:MAB_2211c
FT                   putative membrane protein, MmpS"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96803"
FT                   /db_xref="InterPro:IPR008693"
FT                   /db_xref="InterPro:IPR038468"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB44"
FT                   /inference="protein motif:PFAM:PF05423"
FT                   /protein_id="ADG96803.1"
FT                   /translation="MKSAWPYLVSLLILVAAGGFIAHLRSSSIPDEAVGFASALPKLGQ
FT                   SPQRTIDYEASGPAGTPVRVSYLDEHAQAHDADAVLPWQESLRTASPTVMTGLIVQSKA
FT                   GGVGCRIIIDGTVRDEQPPSASANVANCKVQVA"
FT   gene            complement(290425..291270)
FT                   /locus_tag="Srot_0317"
FT   CDS_pept        complement(290425..291270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0317"
FT                   /product="O-methyltransferase domain protein"
FT                   /note="PFAM: O-methyltransferase domain protein; KEGG:
FT                   rop:ROP_33270 putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96804"
FT                   /db_xref="GOA:D6ZB45"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR016874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB45"
FT                   /inference="protein motif:PFAM:PF02409"
FT                   /protein_id="ADG96804.1"
FT                   /translation="MQRSDGTELTDVSETALWTLWCRGSEAARPNPIIHDELAVRLLEH
FT                   IDYPYEQRFGAPTQTFALRASAFDAAVRDFLGEHPNGTVVSLAEGFQTSYWRLGRPRTR
FT                   WVSVDLPPVVRLREQLLPQEEHIVPVATSALDFAWADHVEPGSPVLITAEGLLCYLEKP
FT                   LALGLIRGCAQRFPAGRFLFDALPSWWTKKKYKTFGTKDQLIGGSLAKTKYVVPPMPFP
FT                   ASPIEISKYPETIPGVAAVRPVPIGAGRGLAGRQIQAFYQSKLVPSRFRGTIAELRFAQ
FT                   "
FT   gene            291905..298282
FT                   /locus_tag="Srot_0318"
FT   CDS_pept        291905..298282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0318"
FT                   /product="Mycocerosate synthase"
FT                   /EC_number="2.3.1.111"
FT                   /note="KEGG: mab:MAB_2212 polyketide synthase; PFAM:
FT                   Beta-ketoacyl synthase; Acyl transferase; Alcohol
FT                   dehydrogenase GroES domain protein; Alcohol dehydrogenase
FT                   zinc-binding domain protein; KR domain protein;
FT                   phosphopantetheine-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96805"
FT                   /db_xref="GOA:D6ZB46"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042104"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB46"
FT                   /inference="protein motif:PRIAM:2.3.1.111"
FT                   /protein_id="ADG96805.1"
FT                   /translation="MVAVAIVGIGCKFPGGIADADSFWDFILNKGDAVTDIPGDRWDVD
FT                   KYYDPDPDAPGRMYVRRGGFLTHQFQQFDADFFGISRREAAILDPQQRLLLETVWEALD
FT                   DAGLAGKVSGEEVGTFIGGFTNDNAVGRTSAHQLERINNFAATSSSQTLLANRLAYALD
FT                   LRGPSMTVDTACSSSLVATHLAVRAIESGECDVAIAGGSNVMFQPETFITMCKGRFLAA
FT                   DGRCKSFDAAADGYGRGEGVGAVVLKGLEQALRDGDRVYAVIRASGVNQDGRTPSLPVP
FT                   NPVSQQRLAERVLKEAGIDPALVGYVEAHGTGTNVGDPLELTALGNAYGRVPGRDDPLL
FT                   IGSVKNNFGHTEAAAGVAGLIKAALTVQRRIVAPQVWLEKLNPQIPFEELRLRVPMAAE
FT                   KYPDLRAPAFVAVNSFGYGGTNAHVLVEEPPAPRATGAVDGVRVFPLSARSEASLRGIA
FT                   RSYAQLLESDRSDEKAQRLKTAATGRRAHHFLRKGIVYRDADHLFEQLNAYADNDNVAP
FT                   GRVLVEGISEPVFVFSGMGPQWWAMGRGLLERPGVFRDTAEEVDAAFRAVSGWSVLEEL
FT                   LRPEGDSTISRTDVAQPANFLVQAALAKHVEQFGAKPVCVVGHSVGEVASAYVSGALSL
FT                   HDAATVAFHRSRLQAKTAGTGGMLAVGLGSDDARRRAERFADKVCVAAINSSAATTLAG
FT                   DFDALREIHAELVEEGIFARTLRVEVPYHSHLMEPILDELATALRGLVPRPAAIPVYST
FT                   VTGAQIDGEAFADPAYWQKNVREPVLFAQAIDTLIEERHRAFLEIGPHPVLAGNIRESF
FT                   VRHSVSGAAIPTLDRNVEAEQAVLQAVADLYAAGSIDVPGDAGLYSSSAVDHVDLPTYP
FT                   WAREQLWEEEPVTLRARYGDPDSFPLLGDRTGDTVSQWGLTLAPANLPWLPDHVVAGSV
FT                   VLPGTAYLDAALSAARQRTGRAHAGLDSVAFVAPLVIAEHDVPITRLSVEDATKRFVFK
FT                   GRSAHTQQWTTHAYGRLVEADPGSLTIDIPAPTQSDVAFAREAVYEGLSSVGLSYGPAF
FT                   QRIRSARIASDTCVAQLESPSLSGSGPARQHTVHPTLSDAALQCVAVLLAARPELVAVP
FT                   SAYVPASVDRVRFYHEVPENPLAVVEITSSQPLRANAYLASEDGDVALAMFGVTLRPVG
FT                   AAPSPLEELDRYFFEPRWEPADEEEHAPAAAPRAANAVVLIGNVAQSVEGGCRRAAGAG
FT                   ARVVRLASAAAERSAELAETLAAAMRDDAFVRVLVAVGDDGAPEENVHHIVAVARALTE
FT                   VLASDDTDQTVKADAQAVVVSRGAFFAPGDHDLNLAHAGLAGARRTIANEQLAVRWSLL
FT                   DTAVSATEDEVAEALGAAGATAALDEVAVRAGRRWVQRMRRSLPELTEAWETPFQAADP
FT                   EVAYEVQLPKSRLLKDIALRECDRVEPGPRQVEIRVETIGLNYKDPLKVIGILADRELE
FT                   GTYFGLEPGMEGFGVVTRVGSDVREVRVGDGLIVSERGLLRRYLTFDLDGGAAWAPLRH
FT                   EDFSDSEFDPLAIGSGLPFLTAAYAFRSLVGLQPGERVLVHGAAGGMGMGAVQLAVSMG
FT                   AVVYATAGTEERRRAALELGAAEVFDSRSVGFVDDVLRATQGRGVDVVYNSLPGEVIAQ
FT                   NFAVAGEFCRIVEIGKADIYFGGSMELKPFNRNLTFHSLDMDRLMRQRPDLFRQLLQEG
FT                   VGLLTDTRLRLLPYTRFSISDVAEAFEAVFRARHVGRIVVDLRDEAPMLLPRKAAPVAV
FT                   RPDGSYLITGGFGAFGLATARSLAREGATRLILVGRSGAVTSEVQAQVESLRASGVEVL
FT                   EKRIDIADYDQVAALVSDVESSGSPLRGVFHTAGVIFDEPIGKLTLDAARKVFAPKVVG
FT                   ALNLDRALREHGARIDSFVLYSSISALVGAAPQTSYAAANSALDAFAQWRRAQGLPALS
FT                   VNWGALSGGMAVTSDAVQSYLDFIGFRMVNMETAAALLHECSRFDLPHVAVMGIDWGRW
FT                   RNAMPAAAQSTRFSHLAAEAETVTNEQAAFRAAVLAAPEEERGPIVTKALAEQLAEVLG
FT                   VKAENLDPRGPLVDLGIDSLMAVEFGARAGKHLNIQVAAFQFTPDLTLEAVGARIAALI
FT                   VQEAAAESDQTSEKR"
FT   gene            298279..299055
FT                   /locus_tag="Srot_0319"
FT   CDS_pept        298279..299055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0319"
FT                   /product="Thioesterase"
FT                   /note="PFAM: Thioesterase; KEGG: mab:MAB_2213 putative
FT                   thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96806"
FT                   /db_xref="GOA:D6ZB47"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR012223"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB47"
FT                   /inference="protein motif:PFAM:PF00975"
FT                   /protein_id="ADG96806.1"
FT                   /translation="MSAKIRSPQEFWWWPRPYNPALPTVLHFACSGSDHTGEIRLAPHM
FT                   EGVNFGVWRMPGRGARADEPPSTSLQRLVDEITTAALGLDCRSPVLSGHSFGGLLGYLV
FT                   CQELESQGRAVGRFVPVASADPSVWRRDAALAKLFGGPKKHAQRRVVMFEERGVWPPEG
FT                   AESATVLQAARSRLEGDIALGLQSFRHDRINASITEVSAKDDEILKERAAQRRWAQHTS
FT                   GEFESIAVTGGHFFYWRRPQVLATILKSEVELAQHN"
FT   gene            complement(299193..300743)
FT                   /locus_tag="Srot_0320"
FT   CDS_pept        complement(299193..300743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0320"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: rha:RHA1_ro03944
FT                   succinic semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96807"
FT                   /db_xref="GOA:D6ZB48"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB48"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ADG96807.1"
FT                   /translation="MPVPSPSTFARLGKLVAIDEPAERSSRAITEAFTGKELAQMPIGN
FT                   ETDVERAFARARAAQKEWAKTSLRSRAAILRRFQTLVFQKLDELADIVQAETGKARASA
FT                   VEEVLFVATAAGWYAANGPKILKEKRVKPAVPILMDARVRHLPKGVVGVISPWNYPMAL
FT                   SVQDANPAWLAGNAVIMKPDSQTPFSTLALSELLYEAGLPRDVLQTLPGPGQVVGNALA
FT                   EQADYLMFTGSTATGKSLAEQCGRRLIGFSGELGGKNPMIVTATANIRRAALGATRACF
FT                   SNSGQLCISIERIYVQEQVYEQFINEFVAQTKAMRLGAGYSSDIDMGSLISEAQLKTVD
FT                   DHVNDAVSKGAKVLIGGKARPDLGPYFYEPTVLGGVREGMTLYKEETFGPVVSVYPVKT
FT                   VAEAIAAANDTRYGLNCSVWAGTWREGQEIAGQIYSGSANVNEGFAAWASHEAPCGGTR
FT                   ESGAGRRNGAEGLLKYTETQGLVTQRFLSLSGERWFPGWLLQRILPTVMRLVRLLPGR"
FT   gene            300836..302308
FT                   /locus_tag="Srot_0321"
FT   CDS_pept        300836..302308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0321"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   mbt:JTY_2335 putative cationic amino acid transport
FT                   integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96808"
FT                   /db_xref="GOA:D6ZB49"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB49"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /protein_id="ADG96808.1"
FT                   /translation="MAYTGRFRNLSDTMFRLKPPVDIMVPQGEGVNLKRSLSIWQLAAI
FT                   GIACTVGTGIFVTFSQVVPAAGPGVLVSFVLAGVTAGLTALCYAEVSSKIPLAGSSYSY
FT                   TYASLGEIAAYLVGWCLLLEYSVSTAAVASGWSGYLNQLLSDLRLVNLPGWMSHAPTPG
FT                   QGFGVNAPAVLLVVLCALLLIKGTSESARTNAVMTAIKLAVLLFFAAVAFCGFHASNMH
FT                   PFAPHGIGGIGTAAGMVFFSYIGMDAVSTAAEEVENPRKALPKALILALVVVTGIYLLV
FT                   ALAAIGARRASQFDPNENAPLAVILQEVTGWTWTSVLLSAAAVISIFSVTLVTLYGQTR
FT                   VLHSMSGDGLVPKIFSNLNEKTRTPVGGTIIVAVFVSVLTGLVPLDILADFVSLGTLVA
FT                   FSVVSATVIILRRRRQGDARSFQVPFYPVLPILSILACLYLMYTLADSEHGWLTYSMFG
FT                   LWMAIAIVVYFAYARHHAVLAERESAAPTSIP"
FT   gene            302330..303520
FT                   /locus_tag="Srot_0322"
FT   CDS_pept        302330..303520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0322"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96809"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB50"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96809.1"
FT                   /translation="MLPCEDVDALLKDVGEFIAYFSMVARGPGGPAVDWTGKVGFTSGD
FT                   VRIDLVADDAVHEVWTEDGKEEKARSFSAFPLAGKCVWFDLLCGLLDEEDGYETYQQWI
FT                   HRPPSADVGICNNKKGPDNKRVQQLYVKSSPYITYPIDPDDQDTNAEIAHTMAASYKEI
FT                   WETVARKFSQEQLQAFGPLPKVVEHRHLGDGKAKQGKEDSEKLRHPDTAALLRDLGEFL
FT                   GSMGAVLVAAQQRGGGSGFVRAGVGPVGAVVFNSPNIPELLRVHEKSLLLLRKVQGELL
FT                   PGPAFSGFDVAGKYCLLHYGDRLRASLSAPSVLEDWYAKGQHAQVVVEEAGAHAVRVSD
FT                   MNDPERHAVVHPLETTLMSQLLHTDYKELLTSLLDGLPAPQDAKRAAPISTPWGDF"
FT   gene            complement(303644..304156)
FT                   /locus_tag="Srot_0323"
FT   CDS_pept        complement(303644..304156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0323"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; KEGG: mav:MAV_3729 15
FT                   kDa antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96810"
FT                   /db_xref="GOA:D6ZB51"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB51"
FT                   /inference="protein motif:PFAM:PF08534"
FT                   /protein_id="ADG96810.1"
FT                   /translation="MRLIRHIRAFAFSRALVAVVAMAAGLAVAVAPARADTPDQLQFTA
FT                   TSLDGKEISGATYAGKPAVFWFWTPWCPYCNQEGSFVQKVASEHPNVPFVGVASRSDQG
FT                   AMRDFVNKYGLNFPQIEDSSGEIWGKFGVTWQPAFAFVSSNGDVDMVKFGDLLTEDQLS
FT                   DRVGALR"
FT   gene            304305..304380
FT                   /locus_tag="Srot_R0009"
FT                   /note="tRNA-His1"
FT   tRNA            304305..304380
FT                   /locus_tag="Srot_R0009"
FT                   /product="tRNA-His"
FT   gene            304473..305393
FT                   /locus_tag="Srot_0324"
FT   CDS_pept        304473..305393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0324"
FT                   /product="ABC-type molybdate transport system periplasmic
FT                   component-like protein"
FT                   /note="KEGG: mno:Mnod_2760 extracellular solute-binding
FT                   protein family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96811"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB52"
FT                   /inference="protein motif:COG:COG0725"
FT                   /protein_id="ADG96811.1"
FT                   /translation="MGGPLSAPVPMLVSSRQFSAVTLPPMAETQGAHRRSRSMVLAICF
FT                   ALGGASAVSAPPCAADPDGQLTVATSGGTAAALRALAAVYARGGGERVRLVFGPSMGET
FT                   PQTIPARIARGERIDVVVMVGSAVDRLADDGQLTGPIRPVACSHIAMAVRAGAPRPDIS
FT                   TLDSLRRALLEARSVAYSDSASGVFVATQLFPRLGVSDTMRGKAFQVPAVPVGEVVAQG
FT                   RAELGFQQLSELLPVKGIDVVGLLPSGAQLGTTYSGAAVSSSAHKDEAESFLSFLGGEQ
FT                   ARGVMETSGLEQGGCPEPDQDQDTD"
FT   gene            305499..305993
FT                   /locus_tag="Srot_0325"
FT   CDS_pept        305499..305993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0325"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_5528 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96812"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB53"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96812.1"
FT                   /translation="MKVAVLWSLALAWPALAVFAGQRPAVADEPSEVVYRVMYPSLPPQ
FT                   ARKEYTITVRDGVAEFVVHAGSLEDPVLVRDAAVVPEDVVGELRSGEPGLAGPWGPAPL
FT                   CVGAFESELDVTTGQGPRHVTGSGCGGRAGAAIEAYIGPVKRLFDLDRLLGERRLAPDD
FT                   Q"
FT   gene            306253..306525
FT                   /locus_tag="Srot_0326"
FT   CDS_pept        306253..306525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0326"
FT                   /product="protein of unknown function UPF0233"
FT                   /note="PFAM: protein of unknown function UPF0233; KEGG:
FT                   nfa:nfa760 putative septation inhibitor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96813"
FT                   /db_xref="GOA:D6ZB54"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB54"
FT                   /inference="protein motif:PFAM:PF06781"
FT                   /protein_id="ADG96813.1"
FT                   /translation="MPKSKVRKKTDFTINPGAAGAGSARTAPSSTWYVALMLGFMLAGL
FT                   AWLVVYYIAAADLDALKWMADLQFWNLAIGFGLMVVGLLMTMRWH"
FT   gene            306563..307204
FT                   /locus_tag="Srot_0327"
FT   CDS_pept        306563..307204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0327"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="KEGG: mab:MAB_0032 para-aminobenzoate synthase
FT                   component II; TIGRFAM: glutamine amidotransferase of
FT                   anthranilate synthase; PFAM: glutamine amidotransferase
FT                   class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96814"
FT                   /db_xref="GOA:D6ZB55"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB55"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ADG96814.1"
FT                   /translation="MTARVLVVDNYDSFVFNLVQYLRQLEAAVSVWRNDDPRLADPDGA
FT                   IAEYDGVLVSPGPSSPEKAGASIPVVLSAARQRKPLLGVCLGHQAIGVAFGGVVGRAPE
FT                   LLHGKTSKITHTDSGVFAGLPQGFIATRYHSLSIQEDTLPSVLAVTARSESGVIMGVAH
FT                   RELPVQGVQFHPESILTQGGHRMLANWLGDCGRPVEDSLVRELAAHVLPA"
FT   gene            complement(307356..308753)
FT                   /locus_tag="Srot_0328"
FT   CDS_pept        complement(307356..308753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0328"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mab:MAB_0844 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96815"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB56"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96815.1"
FT                   /translation="MQTKNPIGSPRRQGGRERSLFAAARAFGAVLVCAQAAVSSLPPQA
FT                   GPALAVAAGRAAAPMPSDARRDAMPGLALLAAAQAKHARPTEERPADEHRTGARGAQEN
FT                   SAEAGRRAPRAQARPASGTTTLSLREPADSEENDDALPSDLSRGAGYDQVTELALQDPA
FT                   TAEALHTMARFERDPANSAAVGPDNGDPDNDDPDSGGEPPANPALAGVLSLNNGPILYQ
FT                   PPCPFGWPPPDRYGGLADIIELAPMAGDFVSEAFAPAAAWQPMAQLFGPLIAIIQPTIK
FT                   PNKYWIDPTIINVQNPINAIHYLFFGWYDVWHRQKFLQEEVEWANEVAPWLQQVYQTPQ
FT                   AACWVAFLGMFERLVETGNPWPRGWYVEDHATTWDVDKIGPYEPASPGSRPRVLEQLDH
FT                   QLAIEDGDAPPERAPAPAAPAPAAPAPSAPQQPRAQEPPRNVPSGPQEQTPPPEPFPSI
FT                   EAGEHIR"
FT   gene            complement(308783..309640)
FT                   /locus_tag="Srot_0329"
FT   CDS_pept        complement(308783..309640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0329"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_0843 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96816"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB57"
FT                   /inference="similar to AA sequence:KEGG:MAB_0843"
FT                   /protein_id="ADG96816.1"
FT                   /translation="MNLTAHAVRALTALSLALGVCGCGNSQPQQPDRGGVELVGLFRFD
FT                   PAAYLGPDKAPTGTWFQMLTPAGGVMSNANPGSPVWQVNGKPVPGAYTSLAPGVGGGLR
FT                   AGGYQSLPDPAFAGTPTDPKAGDSLADSVTQPTPFFLVKFSISTNATDPQTQRPVGPPK
FT                   VLLRTDGTLAADLSSWAATWNGQYFNQGAPKPRPAKDAQVQGAAQVKQVWDWAAQKFLD
FT                   APVADNIPQGDWATGSYDPATRHYSLQWRSLIVGGPFDKFTGLWHLEGVFEPSTGPVPH
FT                   GPSS"
FT   gene            complement(309637..310650)
FT                   /locus_tag="Srot_0330"
FT   CDS_pept        complement(309637..310650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0330"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_0842 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96817"
FT                   /db_xref="GOA:D6ZB58"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB58"
FT                   /inference="similar to AA sequence:KEGG:MAB_0842"
FT                   /protein_id="ADG96817.1"
FT                   /translation="MVELPKHGPELSKHEETAKKPDRGRARAAWLGEYWLWGVLVLLGA
FT                   AFMLAPIRLGMYSESAEGQRMVERFTPVLTDQRLHQLENHLAVIEAARAETAERRLPHD
FT                   DLSHSNTISFVAQFPETEARFSSWIATMRADEGAFGQLRSLPPFGLFPFVFGFAGLALV
FT                   VIGMTGLFSASARTRTALRSAAALVGVLLVLFPVTAGVFAHSSAGTKLLRDFRPILTEE
FT                   NVRWAQSEFVVIGPSSAELLNDLHTHPGANLPATKAFVDQWATISADFANVIEEFADNL
FT                   GHFQALERLNETTKPLGLDAFDEFGWFYLVPGLALVLVVGADVLLSRNRNNAQEQV"
FT   gene            complement(310774..311457)
FT                   /locus_tag="Srot_0331"
FT   CDS_pept        complement(310774..311457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0331"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_0841 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96818"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB59"
FT                   /inference="similar to AA sequence:KEGG:MAB_0841"
FT                   /protein_id="ADG96818.1"
FT                   /translation="MSISARAVAARCAAAAALASAALIASPPANAEGLNGLFSIAPGSC
FT                   VGSPQGSYFRMILPAGGEDGPFLGNSDSPCGDNTVTPLAPGTDGGLITGKYQPQPAAPF
FT                   ARNGDATAGTVTRPVRFYGVLFATSTNQTDPQTKEQTALPVINRDGNTLSGDLSAFAVT
FT                   WNNQVFNQGAPKPGGDLPGHTTPVKGVIDTNGNYTLTWTSQIVSGPFDGFTGLWHLQGH
FT                   FGGSR"
FT   gene            complement(311655..313496)
FT                   /locus_tag="Srot_0332"
FT   CDS_pept        complement(311655..313496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0332"
FT                   /product="Hemolysin-type calcium-binding region"
FT                   /note="PFAM: Hemolysin-type calcium-binding region; KEGG:
FT                   pfs:PFLU1373 putative hemolysin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96819"
FT                   /db_xref="GOA:D6ZB60"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR028208"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB60"
FT                   /inference="protein motif:PFAM:PF00353"
FT                   /protein_id="ADG96819.1"
FT                   /translation="MALTWKDILADISGPGNALVQAIRRRGEGFPEIGAHIRGHESLLA
FT                   GWAGAARTSADAVFAQNHAYTGAAGSAAAQLASALGRVVDERAELLRLASNIVEDGAQL
FT                   RFTFSDTGEINDFYGASGLWSELPDDEQAQYLALREELPRRVADVIAQGNALDDEAATA
FT                   LTSAGGLAAPSALGSGEGEAQSQGDGLAFTRDQGMVVFQTGDGDDTVSVQQASGGRLVV
FT                   TVNGRSQTLSAQDSQDVLIQTQGGNDRVSVDPHVAVRVRFQLGDGADVIDDQAVGGSYI
FT                   DAGKGDDTVTLGQGHNTVYLGSGNNTVTGSKGADYINGGSGNNKINAGSGNSVLYGGTG
FT                   QNTINAGAGRNTIYTGTGEATINNQGGQDTIYAQAGAHVNAGFGTNRTVTIQPLEIPDT
FT                   ITVQGSPEFQRRMQDDLELLAASPDGQHMLRALGSSGHNLLIDDGHLLNDGKVLYNNGY
FT                   TAPAVGDQPTNSSDFFYDMERHRPGPGTDAIISIDTTLTNLGALAQGPKPDYHELNPAV
FT                   VLYHEMAHAYDDTHGSMMPGEYGPSGTDPIDSQNIGGWNPQYLANAEHEAVGLPLDWDG
FT                   DPKTPEVAVPDSVHPHDLTENALRDEMGIPDREHYLG"
FT   gene            complement(313496..313816)
FT                   /locus_tag="Srot_0333"
FT   CDS_pept        complement(313496..313816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0333"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rci:RRC34 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96820"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB61"
FT                   /inference="similar to AA sequence:KEGG:RRC34"
FT                   /protein_id="ADG96820.1"
FT                   /translation="MADNGVLTVNAEELNSYAGAIRGETPAAQALSQNAAEALSSNGAA
FT                   LGGNAAKAAAALAEAWAAADEAYLRRLESTAEQIEASAALYAGNDDSAAHAVRLNEQDG
FT                   DR"
FT   gene            complement(313958..314125)
FT                   /locus_tag="Srot_0334"
FT   CDS_pept        complement(313958..314125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0334"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein LOC100222145"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96821"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB62"
FT                   /inference="similar to AA sequence:KEGG:100222145"
FT                   /protein_id="ADG96821.1"
FT                   /translation="MPWTLTTFLAKRKAPLCGTLPARAPWPPEETERLASGTERAQLLE
FT                   RRQGGRDGLA"
FT   gene            314476..314970
FT                   /locus_tag="Srot_0335"
FT   CDS_pept        314476..314970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0335"
FT                   /product="RDD domain containing protein"
FT                   /note="PFAM: RDD domain containing protein; KEGG:
FT                   sgr:SGR_2715 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96822"
FT                   /db_xref="GOA:D6ZB63"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB63"
FT                   /inference="protein motif:PFAM:PF06271"
FT                   /protein_id="ADG96822.1"
FT                   /translation="MYAQEENMAGKPRTSSSPAGPRPQIATWGQRAGACLIDFLILLPF
FT                   VVLDEMVKAHMASSGLYAGTSGGAAVASALLMLGLMVVWIWNVVVQQGRTGQTVGKETM
FT                   KIRLVGASSGEPVGKGRCFARQTAHLLDALPLFTGYLWPLWDENRQTFADKAARTVVVQ
FT                   M"
FT   gene            complement(315004..318279)
FT                   /locus_tag="Srot_0336"
FT   CDS_pept        complement(315004..318279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0336"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="TIGRFAM: lysyl-tRNA synthetase; KEGG: rop:ROP_35510
FT                   putative lysyl-tRNA synthetase; PFAM: tRNA synthetase class
FT                   II (D K and N); protein of unknown function DUF470; protein
FT                   of unknown function DUF471; protein of unknown function
FT                   DUF472; nucleic acid binding OB-fold tRNA/helicase-type"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96823"
FT                   /db_xref="GOA:D6ZB64"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR024320"
FT                   /db_xref="InterPro:IPR031553"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB64"
FT                   /inference="protein motif:TFAM:TIGR00499"
FT                   /protein_id="ADG96823.1"
FT                   /translation="MTAGAVEEKKTGARGELRPPRPAAGDKRRRKGPLHLVPHRSGMAI
FT                   AAFSVLSFLFSVSPHLRRWAETPRVYLDTYFFAVPDTSFAWAFVLGILAAALAERKRLA
FT                   WLTLLVTLVVFSWYNVVQLLDGERLWPIIGLATHCAAVALLLAAHGEFSTKVRRVAPLR
FT                   ALVALFIGLLVATGLGWALVEAFPHTVPPDERLAYTLNRVVIFTAFERHDFSGYSYGFV
FT                   NTLLGLFGAFALIAAIIVLFRSQRLASTLTVEEERSIRSLLSLYGEDDSLGYFATRRDK
FT                   SAVFAPNGKAALTYRVEVGVCLASGDPIGEERSWQGAIGAWLATCESYGWTPAVMGASE
FT                   RGAIAYREAGLSALQLGDEAILNPRSFSLDGPARKVARQAVTRVRRAGITVRVRRHSQL
FT                   SEEELAATVRRADQWRIGAERGFSMALGRLGDGTDGDCMLVEALGPDGDVVGLLSLVPW
FT                   GRSGVSLDVMRRDPKSPNGVMDLMICELALHAKQLGVSKISLNFAVFRNAFEEGSRLGA
FT                   GPMIRWWRGVLLFFSRWTQLEAMYRFNHRFGPEWVPRYVCFEEARVVPRVAMASGIAEG
FT                   FLVVPKFGGKSEPRGQHPVPPEALLAATALPEEDKQDHPRLPQQVRVRIGKLERLKEQG
FT                   VNPYPECEPPTSTVRDALAAGRSRSGRQVRVSGRVLRERDHGGVVFVDLSDSSGAAQVV
FT                   LEERELPDGKLNAFRKEIDLGDLISVEAAPGVSRTGTASLMARDWRLNAKCLRPLPDKR
FT                   RGLTDPEAKVRLRHVELMTNPQARDALAKRGAVLRTLREQLWGEGFLEVETPVLQRVHG
FT                   GANAEPFRTHINAYDLPLYLRIAPELYLKRLLVGGMERVFEIGRVFRNEGVDATHNPEF
FT                   TLLEAYQAHSDYRGMRDLTEQMLRASAQAVGHAGLLAAPGPWPMIPMLTAVSQALGDEV
FT                   DEHTPAAKLRQHLVERGFECRPDWDSGQLLLELYERLVEHTTTTPTFYSDFPLSVSPLT
FT                   KQHPDRPGVTQRWDLVVGGMELATAYSELNDPVEQRRRLQAQSEAAASGDPEAMELDED
FT                   FLAALEHAMPPSGGLGVGVDRVVMLLTGRTIRETLAFPLVKPK"
FT   gene            complement(318303..318785)
FT                   /locus_tag="Srot_0337"
FT   CDS_pept        complement(318303..318785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0337"
FT                   /product="regulator of ribonuclease activity A"
FT                   /note="KEGG: mav:MAV_0174 ribonuclease activity regulator
FT                   protein RraA; TIGRFAM: regulator of ribonuclease activity
FT                   A; PFAM: Dimethylmenaquinone methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96824"
FT                   /db_xref="GOA:D6ZB65"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR010203"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB65"
FT                   /inference="protein motif:TFAM:TIGR01935"
FT                   /protein_id="ADG96824.1"
FT                   /translation="MTAVNFTPTADLVDQIGEQVRSCDTQFRQYGGRRQFAGPVRTIRA
FT                   FQDNALIKSTLSTPGNGAVLVVDGSASVHTALVGDVIAKLAEDNGWAGLVLNGAVRDVA
FT                   ALAGLDLGVKALGSNPRKSGKTGAGELDVPVEFGGVVFRPGDLLHSDEDGIVLTER"
FT   gene            318882..319343
FT                   /locus_tag="Srot_0338"
FT   CDS_pept        318882..319343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0338"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: cef:CE0172
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96825"
FT                   /db_xref="GOA:D6ZB66"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB66"
FT                   /inference="protein motif:PFAM:PF04138"
FT                   /protein_id="ADG96825.1"
FT                   /translation="MPDDSTAGLRTQALRFLVTGVFSAVVDYGLVMALSQLGAAPNAAN
FT                   IVGFVVGTTVAYLINRRWTFQAEPSAKRFAQVALLYTAAFLLRAGIFAGALALARSWEV
FT                   SKFLAESGAWVLAQGTVTVMNFLVQRMVIFRAPARLPDAPGQASRPGGA"
FT   gene            complement(319323..319967)
FT                   /locus_tag="Srot_0339"
FT   CDS_pept        complement(319323..319967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0339"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: proteophosphoglycan ppg4"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96826"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB67"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96826.1"
FT                   /translation="MSEQKDATRKRPFVEESPSWRFPKITAQTPKEEPKRRVPATLFGG
FT                   RLRTSTFALLLLYVILDVSKKPIPTAQSPAQPWAPPTNAVFGSDGNWTVPAQVPTSQQY
FT                   QYRPTQPTSTRRPETTETSTPTTSPTPSGSESTSGSPNSSDSPDGPEPRHSRPRGQDDS
FT                   STSTAPSATGSATTPADSRPSGSAEPRPNQTRSRTASGEEGHSSGSSSARP"
FT   gene            complement(319964..320944)
FT                   /locus_tag="Srot_0340"
FT   CDS_pept        complement(319964..320944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0340"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   mbt:JTY_3124 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96827"
FT                   /db_xref="GOA:D6ZB68"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB68"
FT                   /inference="protein motif:PFAM:PF00924"
FT                   /protein_id="ADG96827.1"
FT                   /translation="MHANLSAPAYSEWTKWLAKFGVQNFGDWMLTRGVRIVMAMIAAVL
FT                   LARFLRWAAGIFGRGGLFSQKHSGVRSEGSRQRETLAATIAWALTVLVYFVAGLRIAKL
FT                   LEFDLTGLTVPATAAGAGLGFGAQRIVQDLLSGFFIIAEKQYRIGDLVQLSVLGTTYDP
FT                   VGTVEEVTLRVTKLRSSEGQLFTVPNGQIVKSTNMSKDWSQAVVDIPVPNSTDIGLVRE
FT                   KLVEICAAAKEDPNLATLLRGEPVYTGVESIELDRTSMRIVANSVPGQQFVLSRRLRAR
FT                   ILSDLRKEGIATMASPGPAQPEDASKKTVRPPRPEEDTAPQERVR"
FT   gene            complement(320956..321930)
FT                   /locus_tag="Srot_0341"
FT   CDS_pept        complement(320956..321930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0341"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   mjl:Mjls_5373 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96828"
FT                   /db_xref="GOA:D6ZB69"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB69"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADG96828.1"
FT                   /translation="MVCVSPPLSPERPFGTERVWAVIVTHRRASTLRRSLAALQAQTAP
FT                   LAGLVVVDNAAEQEVAELVAELWPTARYIGSKRNLGGAGGFALGILTVLAEGADWVWLA
FT                   DDDGRPESPETLGALLSCARRHGLAEVSPAVVDEADPDRLAFPLRRGLRWRRRRSELGD
FT                   EELLPGIASLFNGALFRTDALFAVGVPDLRLFLRGDEVEVHRRLVQSGLRFGTCLHAAY
FT                   LHPQGSDEFLPILGGAMHAQYPSDEVKRFYTYRNRGYLQAQRGMRKLVAQEWARFGWFF
FT                   LVTRRDLGGFREWARLRRIGRQERFGDREPQRHQRASPAAPVD"
FT   gene            322031..322213
FT                   /locus_tag="Srot_0342"
FT   CDS_pept        322031..322213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0342"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_4988 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96829"
FT                   /db_xref="InterPro:IPR028037"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB70"
FT                   /inference="similar to AA sequence:KEGG:Mvan_4988"
FT                   /protein_id="ADG96829.1"
FT                   /translation="MPGFLEKVKSFIKKDPAKVEQAIDKAGDLIDKQTQGKYADKVDKV
FT                   QDVAKKAAEKVSEGE"
FT   gene            322427..322885
FT                   /locus_tag="Srot_0343"
FT   CDS_pept        322427..322885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0343"
FT                   /product="ribosomal protein L13"
FT                   /note="KEGG: nfa:nfa8660 50S ribosomal protein L13;
FT                   TIGRFAM: ribosomal protein L13; PFAM: ribosomal protein
FT                   L13"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96830"
FT                   /db_xref="GOA:D6ZB71"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB71"
FT                   /inference="protein motif:TFAM:TIGR01066"
FT                   /protein_id="ADG96830.1"
FT                   /translation="MPTITHTTYSPKAADLNHQWHVIDATDVVLGRLAVTAATLLRGKH
FT                   KPTYAPHLDNGDFVVIVNAGKVALTGNKRADKLVHRHSGHPGGLKTRSIGQLLDSDPRR
FT                   VVEKAVKGMIPRNKLGRAVERKLKVYAGPEHPHQAQQPVPYAITQVSQ"
FT   gene            322882..323442
FT                   /locus_tag="Srot_0344"
FT   CDS_pept        322882..323442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0344"
FT                   /product="ribosomal protein S9"
FT                   /note="PFAM: ribosomal protein S9; KEGG: nml:Namu_1177
FT                   ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96831"
FT                   /db_xref="GOA:D6ZB72"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB72"
FT                   /inference="protein motif:PFAM:PF00380"
FT                   /protein_id="ADG96831.1"
FT                   /translation="MSADENQGRAVSEEQETVTEDYLTDDENAALDAIESAEDETQGAG
FT                   SAPAREKAPLREFTEEIITVGRRKEAVVRLRLSLGTGKFTLNGRSLENYFPNRVHQQLV
FT                   KSPLVHADREGSVDVRATLHGGGISGQAGALRLALSRALIEASPEDRPALKVAGFLTRD
FT                   ARATERKKYGLKKARKAPQYSKR"
FT   gene            323459..324820
FT                   /locus_tag="Srot_0345"
FT   CDS_pept        323459..324820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0345"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="TIGRFAM: phosphoglucosamine mutase; KEGG:
FT                   gbr:Gbro_1687 phosphoglucosamine mutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; phosphoglucomutase/phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96832"
FT                   /db_xref="GOA:D6ZB73"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB73"
FT                   /inference="protein motif:TFAM:TIGR01455"
FT                   /protein_id="ADG96832.1"
FT                   /translation="MTALFGTDGVRGVANTELTPELALTLGSLAGSRLRGESGLAVVGR
FT                   DPRISGAMLEACVCAGLASSGVRVLRAGVLPTPAVSWLVKDLGADLGVVVSASHNPMPD
FT                   NGLKFFGPGGGKLDAETENLLAADVSRVSKGGKASWGWGEGERPTGAGVGDLVDFPEGA
FT                   ARYVSRFAPITPKAGQLRVVVDCANGATSRLAAQVYEATGAEVITLNAEPDGLNINDRC
FT                   GSTHLDGLRAAVLEEGADLGLAHDGDGDRCLAVAEDGDVVDGDAIMAVLALGLHERGQL
FT                   RHNKLVVTVMSNLGLHIAMRAAGVELEVTQVGDRHVTDALREGGYSIGGEQSGHVVIPE
FT                   LGETGDGMVTGLRLISRIVESGKSLSELASVVQVYPQVLVNVPVVDKLAAASDLSVLDA
FT                   VASAQERLGGKGRVLLRPSGTEQLVRVMVEAESALSAHEVAEQVAGLVRATNLK"
FT   gene            325040..325378
FT                   /locus_tag="Srot_0346"
FT   CDS_pept        325040..325378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0346"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV_6580 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96833"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB74"
FT                   /inference="similar to AA sequence:KEGG:SAV_6580"
FT                   /protein_id="ADG96833.1"
FT                   /translation="MQAAEVRRIGAAVQGDGNRVGQIGADVAAAAELLACALSDTPVAP
FT                   QAHGMSSGFGQLAESMNQYHDYLAAFGQALIAAAATYEKTDERNARAFAAGDSASGQAG
FT                   AAFLGHNN"
FT   gene            325404..327074
FT                   /locus_tag="Srot_0347"
FT   CDS_pept        325404..327074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0347"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: col-102; COLlagen"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96834"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB75"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96834.1"
FT                   /translation="MTTAAKTGHDLIQDGALALGFQAIDQVVAAADALRSIGVQCQAHA
FT                   SGTDLRRRYEQWGPLGVQKIARAAELLDNARTGLEELRADAGSAADRLAGAWADTAGRA
FT                   ACENYQAASARADADLAKVGQSSRALGVYHGALVQLLDSLRTQAQLILDNLLASLGQYR
FT                   TTDAVLQAVRQVQDVMGQRPAAPNARDVVDAMRQQLQNQVATPTEYAAAQLRRLLDMAQ
FT                   QQGAAATELVASALRGVNTDPYLAPEFPVADEPDCGCLGDHDEKKPEPPATVAAAQSLP
FT                   AAGGWSGGGPSGSPGASGGAQGSGGADAPGSSGPSGKGVGPDDSVEGDEAAHAAGPAGD
FT                   DTASEESASAPDLGFLGDIGSAVGSAIGSIADAAGQIVTGLAGALGSGVGAVGTALSGT
FT                   DFSKLDGDDAKNATEASADESVAADEAEDDVDAESFDVDPDAQGASGSGLDAEADLDSA
FT                   EEAGDDAASLSAHSPTATPENDAAFAQPAGDACPAAAARQHAEPMSAAGPAQVGHGEFE
FT                   IAANQLQAPAPKEDAAERRADAVPATTPVSAQPSTIPSF"
FT   gene            327084..327581
FT                   /locus_tag="Srot_0348"
FT   CDS_pept        327084..327581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0348"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: KLTH0D01606p"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96835"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB76"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96835.1"
FT                   /translation="MDAAEQLYHLQRENQKQIQQLQHDTTQGFAYLRKSAEASARGVRQ
FT                   SLSATGPVSSRSADRGWDSSTRDVGGPTAPQQAKPFVEPIPAGAPAELRNILIRNQHME
FT                   LRWQREFAARLRRAGEDRAAAPQRQAGQVRQAEQRRAAQPDARKGRGWDDSTRRIGWSA
FT                   QD"
FT   gene            complement(327593..328423)
FT                   /locus_tag="Srot_0349"
FT   CDS_pept        complement(327593..328423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0349"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rer:RER_19100 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96836"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR041127"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB77"
FT                   /inference="similar to AA sequence:KEGG:RER_19100"
FT                   /protein_id="ADG96836.1"
FT                   /translation="MAKNPKPLLARLARTGPNRVARGDLGAAGLPGLVFSPVSGSNLPA
FT                   IVFAHGWMAHPKRYHRTLRHLASWGFIVAAPSAHRGLFASDKDFAADLSRAVEIVRAAS
FT                   IGANQARAQRVGLVGHGLGASASVLAAAKDPSVAAVAALWPSKTTAATVQAAEDVAAAG
FT                   LILTTVGEELSLTSNATELALAWGAVAALRAIPDFAPEDLPERRGPRGWFELDLGAGRS
FT                   VAHAQLTGWLLATLAKDKTYAAFADPDASLPGAAPLDASAVERNPVNAFRALLS"
FT   gene            328442..328774
FT                   /locus_tag="Srot_0350"
FT   CDS_pept        328442..328774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0350"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpu:BPUM_3339 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96837"
FT                   /db_xref="GOA:D6ZB78"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB78"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96837.1"
FT                   /translation="MSKAEKSITWTLWALLLIASTAVGVFGLVIGTIDVVLVIIGAANG
FT                   QDVDGWASLAWYFVCGALLVALPWSILGAVVAMARRRKRVWFWPVAALGVVVLLASGLG
FT                   RMCGVL"
FT   gene            328842..330692
FT                   /locus_tag="Srot_0351"
FT   CDS_pept        328842..330692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0351"
FT                   /product="glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /note="KEGG: rop:ROP_62370 glucosamine-6-phosphate
FT                   synthase; TIGRFAM: glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: sugar isomerase (SIS);
FT                   glutamine amidotransferase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96838"
FT                   /db_xref="GOA:D6ZB79"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB79"
FT                   /inference="protein motif:TFAM:TIGR01135"
FT                   /protein_id="ADG96838.1"
FT                   /translation="MCGIIGYVGHRQASPVLMEALRRMEYRGYDSAGVAVVADDRTLAT
FT                   AKKAGRIANLERVLAAMPQVPGQLGMGHTRWATHGRPTDRNAHPHLDPAGQVAVVHNGI
FT                   IENHLRLRMELEAEGVEFASDTDSEVAVHLVARAVADGPTKGDFVASVRSVVQRLHGAF
FT                   TLVFAHAEHPGTIVAARRSTPLILGVGQGEMFLASDVAAFIEHTREAVELGQDEVVAIT
FT                   CDGYQIWSFGGEQRTGKPFHIDWDLAAAEKSGYEHFMLKEIAEQPQAIADTLLGHFDGG
FT                   RVVLDEQRFTDQDLRDVDKIFVVACGSAHLSGLIAKYAIEHWTRLPVEVELASEFRYRD
FT                   PVLDSSTLVLAISQSGETLDTLEAVRHAKEQGAKVLAICNTNGAQIPREADGVLYTHAG
FT                   PEIAVASTKGFITQVVANYLVGLALAGARGTKYPDEVAREIAELEAIPDLLRHVLGQME
FT                   PVRELATQLSGASTILFLGRHMGYPVALEGALKLKELAYMHAEGFAAGELKHGPIALVE
FT                   EGVPIVVVAPPVKSMLHAKVLSNIQEVQARGARTIVIAEEGDDAAAPHADHLFTVPAVS
FT                   TLWQPLLAVVPLQVFAAQVAIARGLDVDKPRNLAKSVTVE"
FT   gene            330738..332276
FT                   /locus_tag="Srot_0352"
FT   CDS_pept        330738..332276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0352"
FT                   /product="carbohydrate kinase, YjeF related protein"
FT                   /note="KEGG: nfa:nfa8780 hypothetical protein; TIGRFAM:
FT                   carbohydrate kinase, YjeF related protein; PFAM: protein of
FT                   unknown function UPF0031; YjeF- family domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96839"
FT                   /db_xref="GOA:D6ZB80"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB80"
FT                   /inference="protein motif:TFAM:TIGR00196"
FT                   /protein_id="ADG96839.1"
FT                   /translation="MPSYYPAALVKRADESLIRALAPGVPMRRAAFGLAQVVLRELRDH
FT                   AGGAVGQKVWLVVGVGDNGADALWAGAFLKRRGVDVRALLLNPRRAHPAGLAAFRRAGG
FT                   KFVDDVPDAPAPFGGGPGRGVVVDGVVGLSGKGPLRGHAAEIFSRPSGHRVVAVDLPSG
FT                   VDPDTGAVAGPAVTADVTVAMGVFKQAHALNPGRCGRLELVDIGYPEAGFGPLGVLDGA
FT                   RGLTALGQERLAALLPAPGPGDDKYTQGVLGVVAGSPTYPGAGALCASGALATTSGMVR
FT                   AVGPGAKALVAVHPELVVSEDVESTGRVNAWVLGPGADESTRALLLRALATDLPVVADA
FT                   SALRLVPDAIKRRSAPTVVTPHEREFEAFAGRPVGADRAAAAAALATECGATVLLKGHV
FT                   TIIAEPGGQVLVNIAGNSWAATAGSGDVLSGMIGALLASAAAEHAAPVAAAIHSRAAAL
FT                   AAGAEPGAPITASALAARIPDAIRSARASGLARRTPSVRAAGRTGDGNAIGSYP"
FT   gene            332273..333466
FT                   /locus_tag="Srot_0353"
FT   CDS_pept        332273..333466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0353"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="TIGRFAM: alanine racemase; KEGG: rha:RHA1_ro06180
FT                   alanine racemase; PFAM: alanine racemase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96840"
FT                   /db_xref="GOA:D6ZB81"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB81"
FT                   /inference="protein motif:TFAM:TIGR00492"
FT                   /protein_id="ADG96840.1"
FT                   /translation="MIPAVQATVDHHAIAHNVRLLAQASAPAQVIAVLKANAYGHGAVP
FT                   VARTALAAGAAQIGVATLAEAFELRQGGIEAPIIAWLHAFDPDEAVAVFAEAIASGIEL
FT                   GVSTSSQVRAVAEAALRADQLAVVAVKVDTGLNRGGFARGEWRKAFADLANAEAAGAVQ
FT                   VRGVFSHLANADRPEYRTNAEQARSLREAVSFARAAGLAPELVHLANSPAVLTRPKALV
FT                   NELPVFNATRPGVAVYGLSPIMGRDFGLIPAMTLTARVGLTKRIHAGDGVSYGHDFVAA
FT                   SDTTLALLPIGYADGLQRALAGKFEVSIGGRRYPGVGRVCMDQVLVDLGPGEPKVREGD
FT                   TAVLFGPGSDGEQTADDWARAAGTINYEIVTQLRGRVQLRHIHQREPVDQLRHTHHA"
FT   gene            333459..333896
FT                   /locus_tag="Srot_0354"
FT   CDS_pept        333459..333896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0354"
FT                   /product="protein of unknown function UPF0079"
FT                   /note="PFAM: protein of unknown function UPF0079; KEGG:
FT                   gbr:Gbro_1713 protein of unknown function UPF0079"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96841"
FT                   /db_xref="GOA:D6ZB82"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB82"
FT                   /inference="protein motif:PFAM:PF02367"
FT                   /protein_id="ADG96841.1"
FT                   /translation="MPEPSERVLATAHETFSLGHELAAQLRAGDVVVLVGPMGAGKTTL
FT                   TRGIAHGLGVSGRVQSPSFVIVHTHPPAQGGLALAHVDAQRLGGHAEFQALELEDALAA
FT                   GVVVVEWGEGHAEGLGSRALEVRIEPDWETDVRRISWWWRP"
FT   gene            333940..334647
FT                   /locus_tag="Srot_0355"
FT   CDS_pept        333940..334647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0355"
FT                   /product="peptidase M22 glycoprotease"
FT                   /note="PFAM: peptidase M22 glycoprotease; KEGG: nfa:nfa8820
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96842"
FT                   /db_xref="GOA:D6ZB83"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB83"
FT                   /inference="protein motif:PFAM:PF00814"
FT                   /protein_id="ADG96842.1"
FT                   /translation="MLALTLDTSTSDSSVGLVFWPPGGTGWRTLGEERVPGNVHVEQLA
FT                   PMLERRLREARERHGQAGAVQAVVVGLGPGPYTGLRIGIATAAAYGDAAGLPVHGVCGL
FT                   DAVAHDVSRAAPDEQDLLVVADAKRREVFWARYLGARRIGPLGVCPPAELPELLDGCVP
FT                   QLAAGATRLLDGTALQDVPRSPVAAPSPCGLAAAIAQELLSGAAPGPLAPLYLRAPDAK
FT                   PPAAPAVARNLTA"
FT   gene            334644..335108
FT                   /locus_tag="Srot_0356"
FT   CDS_pept        334644..335108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0356"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /note="KEGG: rer:RER_19180 ribosomal-protein-alanine
FT                   acetyltransferase; TIGRFAM: ribosomal-protein-alanine
FT                   acetyltransferase; PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96843"
FT                   /db_xref="GOA:D6ZB84"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB84"
FT                   /inference="protein motif:TFAM:TIGR01575"
FT                   /protein_id="ADG96843.1"
FT                   /translation="MTAWATVDALREVDLPRVVEIDQLLFQQEGPWTLAMFQGDLKAAH
FT                   TRYFAARDLQGAVLGFAGVALLADAAEVITIGVDPVVQRTGAGRALLGALLYEAEGRDV
FT                   FLEVRVDNEPAIALYTAEGFEKVSVRKNYYRRVGKDAVVMRRPAEFGGGA"
FT   gene            335105..336124
FT                   /locus_tag="Srot_0357"
FT   CDS_pept        335105..336124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0357"
FT                   /product="metalloendopeptidase, glycoprotease family"
FT                   /EC_number="3.4.24.57"
FT                   /note="TIGRFAM: metalloendopeptidase, glycoprotease family;
FT                   KEGG: mav:MAV_4367 O-sialoglycoprotein endopeptidase; PFAM:
FT                   peptidase M22 glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96844"
FT                   /db_xref="GOA:D6ZB85"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB85"
FT                   /inference="protein motif:TFAM:TIGR00329"
FT                   /protein_id="ADG96844.1"
FT                   /translation="MIVLGIESSCDETGAGIVRVESDGALTLLADEVASSVREHVRFGG
FT                   VVPEIAARAHLEAMRPTVRRALRAAQIDKPDAVAVTVGPGLVGPLSVGVASAKAYALAW
FT                   GVPLYAVNHLGGHIAVDQIEHGPLPPAVALLVSGGHTQILKAHSMVEPLVELGATVDDA
FT                   AGEAFDKVARLLGLGYPGGPVVDALAQTGDPDAVRFPRPMTGPKDARYDFSFSGLKTAV
FT                   IRYLQAHPDAEKADVAAGFQEAAADVLTAKAVAAAKEHGASTLVLGGGACANSRIRGLA
FT                   QQRCAAEGIELRVPRPRLCTDNGAMIAAFGAGFAAAGAKPSPSDVGPLPGLDVGVSLL"
FT   gene            336132..336887
FT                   /locus_tag="Srot_0358"
FT   CDS_pept        336132..336887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0358"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mav:MAV_0687 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96845"
FT                   /db_xref="InterPro:IPR024524"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB86"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96845.1"
FT                   /translation="MCHNFPWENYAYAVFLAYLDESYDERVYWIVAVACPSDCVIPLSV
FT                   ALDEVVAAAVRDFPLEDENAELHGYELFQGKGHWAPLAGRLRARIRVYRDALAVFESFP
FT                   EVQIFIRGIDRERQRQRYSKVVHPHVVVLGHLLERLDEHGEGRQAPILVVADEIADAKE
FT                   HKTHQGHLWHYQRASTSGYRARKLNWIADTIHFAPSNFSRLLQLADLVAYLNFRVHSGR
FT                   DKDPRAIETNEMLCSLYMPRVRHRLCWCP"
FT   gene            complement(337238..337846)
FT                   /locus_tag="Srot_0359"
FT   CDS_pept        complement(337238..337846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0359"
FT                   /product="Exonuclease RNase T and DNA polymerase III"
FT                   /note="KEGG: rop:ROP_11290 oligoribonuclease; PFAM:
FT                   Exonuclease RNase T and DNA polymerase III; SMART:
FT                   Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96846"
FT                   /db_xref="GOA:D6ZB87"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB87"
FT                   /inference="protein motif:PFAM:PF00929"
FT                   /protein_id="ADG96846.1"
FT                   /translation="MGDTKDRLLWVDCEMTGLRPGFDQLIEIAALVTDGELNIIDDGID
FT                   LVIHAEEDKLAQMDEYVTNMHASSGLTEAVRASELSLAEAEERVLAYVKERFPAPRTAI
FT                   LAGNSIATDRSFLAKDMPELDAWLHYRMVDVSTIKELSRRWYPRIYFNQPEKGLAHRAL
FT                   ADIVESVRELRYYRSTAFVAQPGPSSEEIESVVKELTTG"
FT   gene            complement(337849..338634)
FT                   /locus_tag="Srot_0360"
FT   CDS_pept        complement(337849..338634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0360"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   rop:ROP_11270 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96847"
FT                   /db_xref="GOA:D6ZB88"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB88"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADG96847.1"
FT                   /translation="MPLPPPAPGQPAVITGASDGIGKAIAFELAALGRPVLLVARRGEL
FT                   LEKTAEQIRARHGVDAQIRAVDLVDRDARRKFLDELAEMDVSVLVSNAGVVTAGLWHGR
FT                   LDPALERAEVELNVVAAYEVVLAALPKMLERGSGGVVVTGSIAGNGPAPITTTYSATKA
FT                   FLNTFAESLHFDVRGRGVNVTLLAPGVVHTGLLTGPLTRVPGFLCATAEQTAKAAVEGV
FT                   ARNKLRVAPIAAHKVQSALANYLPRPLWARAMYRFYGGK"
FT   gene            complement(338714..340795)
FT                   /locus_tag="Srot_0361"
FT   CDS_pept        complement(338714..340795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0361"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; FAD-
FT                   dependent pyridine nucleotide-disulphide oxidoreductase;
FT                   KEGG: mtb:TBMG_02806 NADPH dependent 2,4-dienoyl- CoA
FT                   reductase FadH"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96848"
FT                   /db_xref="GOA:D6ZB89"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB89"
FT                   /inference="protein motif:PFAM:PF00724"
FT                   /protein_id="ADG96848.1"
FT                   /translation="MNTSIRRPAAEQPALPYPNLLSELDLGRTRLKNRVVMGSMHTGYE
FT                   DYPWMIDKLAAYYGERAAGGVGLIVTGGYAPNYLGSTVPLFGQFTTKLVAKSHRKITDA
FT                   VHEHGAKILLQILHTGRYAFHPLAVSASATSAPTTPFRAWKMPGWLIRSTIRDYARAAK
FT                   LAKAAGYDGIEVMGGEGYLINQFLAPLTNKRTDEWGGTPQKRRRFPVEITRQIRAAVGP
FT                   DFILQFRISLVDYVPEGQTWEEIVALAKELEEAGVDIFNTDIGWHEARVPTIVTSVPSG
FT                   AFVEYTHALAQQVDVPVIASNRINMPEAAEQILAETDVDLISMARPLLADPNWVNKAKA
FT                   GQSDLINTCIACNQACLDHAFAHKTVSCLLNPRAGRETQLQLLPTRKAKKVAVVGAGPA
FT                   GLATAVSLAERGHSVTLIEGDDRIGGQFLIASKIPGKEEFRHTLRYFQKQLEHHKVQVR
FT                   LNTRITAAQLSAEGFDDVVVATGVAPRMPRIPGVEHPMVLSYADVVKEGKPVGKRVAVI
FT                   GAGGIGFDVSEFLTTEDSPTLHLKEWRQEWGVSDPVDPARGGPRGGIVAPKPGPSPREV
FT                   YLLARTPGPLGRKLGKTSGWVHRAAIKAKKVVQLSGVNYEKIDDQGLHITFGEEHKDPR
FT                   VLEVDNVVICAGQESQRGLYDELVAKGVRAHVVGGALLAGELDAKRAIRQGTELAAAL"
FT   gene            complement(340840..341400)
FT                   /locus_tag="Srot_0362"
FT   CDS_pept        complement(340840..341400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0362"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: Transcriptional regulator PadR-like;
FT                   transcriptional regulator PadR family protein; KEGG:
FT                   nfa:nfa12910 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96849"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR018309"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB90"
FT                   /inference="protein motif:PFAM:PF10400"
FT                   /protein_id="ADG96849.1"
FT                   /translation="MALEHALLVSLAERPSTGYDLARRFDKSISFFWSASHQQIYRTLQ
FT                   RIVAAEWATCEVVRQNGKPDKKVYSISEEGKAELAKWVNKPSSGPILRWELPVKLRGLA
FT                   HGDPDVLVKDLRAHREQAVRTLAHYRDSEARHFPAAPLTGAPLYQRLVLEAGIRQAEAL
FT                   IAWLDEAAAALEPHSPQPSEDAI"
FT   gene            complement(341452..341931)
FT                   /locus_tag="Srot_0363"
FT   CDS_pept        complement(341452..341931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0363"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96850"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB91"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96850.1"
FT                   /translation="MRVFRADTMPPWWLGALSALGLGAAVASADFPMSRRERFLARAAR
FT                   IAGSAACAGAGAEQLRRAASLPPPIPISQRAGAAIACAASLSTTPLIGERCVDKAARAL
FT                   SARGASWPRARLGALIAATALLGELLQRFPAPPTPKTPPPRRRLVRPNPGTIIRN"
FT   gene            complement(342052..343935)
FT                   /locus_tag="Srot_0364"
FT   CDS_pept        complement(342052..343935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0364"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: nfa:nfa21480 putative ABC transporter; PFAM:
FT                   ABC transporter related; ABC transporter transmembrane
FT                   region; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96851"
FT                   /db_xref="GOA:D6ZB92"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB92"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG96851.1"
FT                   /translation="MSEQDWRGVANEDEDPDKKGNLVLARRSRALLVDLTRPHAGKLWT
FT                   LGALVVADNACFVLIPLVVAYGLDKGIGQAAQSAGAPAAQMLGVRVGGGWAALAFAVAA
FT                   LLLLALFGAWLNYASQTRAAALAQSILLELRTRVFTHAQRLSVAFHERYTSGKVIARLG
FT                   NDMDTLMEFLSGSVVESMNAALSLVSMTLILFWLDVPLALVGLAGFVPMVVMTRRSGRL
FT                   QRISQRRARRAIARVITHYVDAMSGIRAVQSYRREQRNEEILAAESAEYQATTVEATVN
FT                   MANYIGFSRLVDNLSTVAVLLVGSWRVIHGEIQVGVLAAFLMYLRNFYEPLETLAQVFN
FT                   MYQSAASALEKISGVLEERPAVPEPEHPVVPANDEGGVVLDRVTFSYSPQGPPVLPDCS
FT                   LSIAPGQVVAMVGETGAGKSTIAKLIARFYDPTSGSVRLDGVDLRDIADAELRKRIVMV
FT                   TQEPYLFSGTVLENIRLGKADAELAEVIAAARAVGADEFISALPEGYHTCVQKRGDRLS
FT                   AGERQLVAFARVFLAAPKVIVLDEATASLDIPSERVVQRALGALLDGRTAIIVAHRLST
FT                   VEIADRVLVVGEGRILEDGPPAELLRGQGGAEGSPTGYFAQLHTAWQRSLA"
FT   gene            complement(343928..345745)
FT                   /locus_tag="Srot_0365"
FT   CDS_pept        complement(343928..345745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0365"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: nfa:nfa21470 putative ABC transporter; PFAM:
FT                   ABC transporter related; ABC transporter transmembrane
FT                   region; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96852"
FT                   /db_xref="GOA:D6ZB93"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB93"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG96852.1"
FT                   /translation="MNEGMAQTTPGVRALVRLWPYVRPYAGRIGLSLGLVLLSVLTSVC
FT                   IPLMVKHVVDGPIARNDTRGLVWPIVVVSALGLVDAGAIWGRRRVGARPSAELETSMRA
FT                   RVFAHAQRLAIGEHAEWDSGQLLSRGVEDLRQLRRFAAFFGPFFIVNTVAIVATTATML
FT                   VLCWPLGVILIVCEVPMLVATSKLERSWRRVSRQVQDLVGDITTTVEESVLGVRVLKAF
FT                   GAGPGFIARYRAQADELRALELRETRLKASLWMVSGATPVFTVTAMLLVSGWGVAKGQW
FT                   TLGTLVAAISLVMYLNWPLTSIALLLGDLFSTVNAAVRHWELMDRPVSVTDPIRPRALP
FT                   QPVRGELAFEHVGFTYPDAKAPVLTDVSLQLRPGEILALVGPTGSGKSTLANLVPRLLD
FT                   VTSGRITLDGVDIRELRLADLRAQIAVAFEEPVLFSASVRENVALGQPDATDGAVADAL
FT                   EIASAAEFVAKLPWGASTRVGEQGLSLSGGQRQRLALARSVLGQPKVLVLDDPLSALDV
FT                   DTEAQVQAKLRRAVQDSEGAQGAAAPETRPWAPTTLLVAHRPSTAALADRVALLWDGRV
FT                   EAVGSHEELLAASERYRHVMGAIREQADV"
FT   gene            complement(345806..346117)
FT                   /locus_tag="Srot_0366"
FT   CDS_pept        complement(345806..346117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0366"
FT                   /product="monovalent cation/proton antiporter, MnhG/PhaG
FT                   subunit"
FT                   /note="KEGG: mva:Mvan_0739 putative monovalent cation/H+
FT                   antiporter subunit G; TIGRFAM: monovalent cation/proton
FT                   antiporter, MnhG/PhaG subunit; PFAM: Na+/H+ antiporter
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96853"
FT                   /db_xref="GOA:D6ZB94"
FT                   /db_xref="InterPro:IPR005133"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB94"
FT                   /inference="protein motif:TFAM:TIGR01300"
FT                   /protein_id="ADG96853.1"
FT                   /translation="MDLAAALFIFAGSVLALTAALGIVRFPDTLTRMHAAAKPQALGLV
FT                   LSCVGAAIRLRHSIDLGMLVLIALFALLTSPVLAHLIGRLAYRELLEDQAALQARQKL"
FT   gene            complement(346117..346386)
FT                   /locus_tag="Srot_0367"
FT   CDS_pept        complement(346117..346386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0367"
FT                   /product="putative monovalent cation/H+ antiporter subunit
FT                   F"
FT                   /note="KEGG: mab:MAB_0632c putative monovalent cation/H+
FT                   antiporter subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96854"
FT                   /db_xref="GOA:D6ZB95"
FT                   /db_xref="InterPro:IPR007208"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB95"
FT                   /inference="similar to AA sequence:KEGG:MAB_0632c"
FT                   /protein_id="ADG96854.1"
FT                   /translation="MDWLWISSAVLLCAAALLTTWKVAFGPKTLDRLVSVDTLVAVVMC
FT                   ALNGWAAYSMDSTVVYGTTALSLLGFIGSLSVVRFRVKDKRRRS"
FT   gene            complement(346386..346919)
FT                   /locus_tag="Srot_0368"
FT   CDS_pept        complement(346386..346919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0368"
FT                   /product="cation antiporter"
FT                   /note="KEGG: gbr:Gbro_0668 cation antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96855"
FT                   /db_xref="GOA:D6ZB96"
FT                   /db_xref="InterPro:IPR002758"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB96"
FT                   /inference="similar to AA sequence:KEGG:Gbro_0668"
FT                   /protein_id="ADG96855.1"
FT                   /translation="MSRLGSKEQIRELVVRGGAIIWLIVVWVLLWGEATPLIVGSGVLV
FT                   SVSVIVFLPLPRVPVGTRVRLGSLFVLCLLIARDLVVSSFQVAWYAVRPAGAPPSGIQW
FT                   VKLRMSSDLVLTLAILALTLIPGTVVLAIDRVHRRVQVHLIPSRNEADVKKFEAQTAAL
FT                   ERWFSRAFEQGKGK"
FT   gene            complement(346916..348481)
FT                   /locus_tag="Srot_0369"
FT   CDS_pept        complement(346916..348481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0369"
FT                   /product="NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   KEGG: mgi:Mflv_0164 putative monovalent cation/H+
FT                   antiporter subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96856"
FT                   /db_xref="GOA:D6ZB97"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB97"
FT                   /inference="protein motif:PFAM:PF00361"
FT                   /protein_id="ADG96856.1"
FT                   /translation="MNLAQVLVPAPVIVPMAGAAGTLILSRRPRLALLTASSTLIATLA
FT                   ASVGLLFLVDTRGEQRVFLGGWGKTAHSPGPLGVELSGDRLSALMLVVSACVLFAVLVY
FT                   AVSQGVRDGDGNEPVSIFLPTYLALTAGVCDAFLAHDIFNLYVGFEVLLASSYVLLTIG
FT                   GGGARIRAGISYVMVSILSSTVFLIGIALIYATTGSLNFDQVGASLQNAPSGLRSALFA
FT                   VLLVAFGVKSAIFPLSAWLPDSYPTAPAPVTAVFAGLLTKVGVYAIIRAHTLLFPGAGL
FT                   DAVLLVAALGTMVIGILGALAQSDMKRVLSFTLVSHIGYLVFGVALSTPQGLAGTVYYV
FT                   AHHILVQTTLFLVVGLIERQAGASSLRRLGGLGAASPLLAALFLIPALNLAGIPPFSGF
FT                   IGKLVLTQAAVAHGGALAWILIAGGMVTSLLTLYTIMRVWNLAFWRRREDAPEGELSNA
FT                   APPTMSSELVDIAYADRADVGRMPYGMVGSTIALVVLGLGLAFAAGPILGIAERAAVET
FT                   RGAP"
FT   gene            complement(348478..348912)
FT                   /locus_tag="Srot_0370"
FT   CDS_pept        complement(348478..348912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0370"
FT                   /product="NADH-ubiquinone oxidoreductase chain 4L"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase chain 4L; KEGG:
FT                   nfa:nfa52910 putative monovalent cation/H+ antiporter
FT                   subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96857"
FT                   /db_xref="GOA:D6ZB98"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB98"
FT                   /inference="protein motif:PFAM:PF00420"
FT                   /protein_id="ADG96857.1"
FT                   /translation="MSANMTLVVLIGLLGATGVNLLLRRTLTKMLIGTILLGNAVNLLI
FT                   LAAGGPSGAPPIVGAAPGEPTADPLAQAMILTAIVISLGVAAFVLALAYRSYRLQTDED
FT                   VDDDVEDESVAQRAEFDGEAEPDDEPAKVDVGDTEGQLRT"
FT   gene            complement(348909..351779)
FT                   /locus_tag="Srot_0371"
FT   CDS_pept        complement(348909..351779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0371"
FT                   /product="NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   Na+/H+ antiporter MnhB subunit-related protein; KEGG:
FT                   rha:RHA1_ro02165 putative monovalent cation/H+ antiporter
FT                   subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96858"
FT                   /db_xref="GOA:D6ZB99"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR007182"
FT                   /db_xref="InterPro:IPR025383"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZB99"
FT                   /inference="protein motif:PFAM:PF00361"
FT                   /protein_id="ADG96858.1"
FT                   /translation="MIEWVFDVLLAHAFAAFLAPALVARWGRQAFLALAFVPAASLAWV
FT                   LSATRGGQVELREHHTWIPQAAMDVDLMLDPLGVIMCLPVLGVGAVVLAYCSRYFAPDE
FT                   PKLGALAGQLTGFAGVMFGLIVSDNTLLLFMFWEITSVLSYLLVGHQGHKLVARRAALR
FT                   ALNITTLGGLAMLVGVIILGEQTGSYLLSEMLRHPVGGALGQTGVALVLVGAFTKSALV
FT                   PWHLWLPGAMAAPTPVSAYLHAAAMVKAGVYLVARLAPAYAHAPVWHWMVLPFGLATAL
FT                   LGGWRALRAWDAKLVLAFSTISQLGLMTMLVGSDSEASRAAGLVMLLAHSLFKAALFMT
FT                   VGGVDRTAGSRHLPKLSRMGPRAAPLVAAAALAGASMAALPPFLGFVGKHAAFDSLLTE
FT                   HAPVWELAPLALLEVAAAALTTGYSLRLSWGLYAHKRGAEPALRPAVALWAPPAILALL
FT                   GLVASFTLPMWSWIVNAAAVGPVFGGDAQTGPSELTAFGQLGAGAALVAVALVIGCGLF
FT                   AVNPNLPKSRRRLGNADEVYDEIMRLLSALALRVTAFVQRGSLPIAQATTLTVLTVFPL
FT                   AMLFSGPRNPIKWHPYDSPFQLVVAVMMMIGAVAAVALTHRIGAVLAAGVTGYGCGVLF
FT                   SLHGAPDLALTQFLVETLTLVVFTLVLRKFDARTNEPIPVFSYAVRIVFSLAVGGALSL
FT                   LALFAISARGAGAPALAGSLAAEGLARAHGSNTVNVIIVDIRAWDTFGEISVLLVAATG
FT                   VASLVFVNRRYGSLPRLAQAPAQAGKQVSWLRSSEFTDPRQRSIILEIATRMVFPTIMT
FT                   LSVYFFFSGHNAPGGGFAGGLVAGLALVLRYLAGGRYELGETLPVEAGKILGAGLALTA
FT                   ATAAGSVLVGLPALSSASVALDLPVLGALRLNTSSLFDLGVYLIVVGMVLDILRSLGAR
FT                   LDEGDDVDAEQPGARPSPAAGAGRPA"
FT   gene            complement(351812..353710)
FT                   /locus_tag="Srot_0372"
FT   CDS_pept        complement(351812..353710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0372"
FT                   /product="serine/threonine protein kinase with PASTA
FT                   sensor(s)"
FT                   /note="KEGG: nfa:nfa800 putative serine/threonine protein
FT                   kinase; PFAM: Serine/threonine-protein kinase-like domain;
FT                   PASTA domain containing protein; SMART: serine/threonine
FT                   protein kinase; Tyrosine- protein kinase, subgroup,
FT                   catalytic domain; PASTA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96859"
FT                   /db_xref="GOA:D6ZBA0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBA0"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADG96859.1"
FT                   /translation="MSTPKHLGGRYTLGEAIGYGGMSEVHIARDERLGRTVAIKLLRPD
FT                   LARDPRFYLRFRREAQNAAALNHPMIVSVFDTGESASDQGPMPYIVMEYVDGQTLREAL
FT                   QNGPLTTQEVLSWIADVAAALDFSHHNGIVHRDVKPGNIMIDKTGQVKVMDFGIARAIS
FT                   DATITATQTATVIGTAQYLSPEQARGETVDPRSDVYSLGCVLYELLAGAPPFTGDTPLA
FT                   IAYQHVREDPKPPSSLKKTLTPDIDAVVLKAMSKNPANRYQSAAELRSDVLKLLAGERP
FT                   SAPRVMSEAERNSLLSSGEITGPTHKPLREHGQPVAEPGSRPRGVYAALVVAVIAALVA
FT                   AYFAISNIHPVPAGYAMVPNVAGMSEQQATDALRTSGVRYKIDHQESVETKQGNAIGTT
FT                   PQGGSAVDKNAEVTLTISSGPGQTVVPDLRNVPYGEAITRLSAAGLVEDPNRPPPEFSD
FT                   EIDKDRVISTQPAANKTALKGTKVQLILSKGPENTQIPNVVGQQSDAATKAITDAGLAP
FT                   PAFVEQSSTEPYGKVLSQDPQPGSDAKRKSVVTLTISKGDQIAMPDLTGMTEQEARTAL
FT                   RKAGFSGQVTTQSTQGNGIILPDPNKVPGQIFRQDPAPGTAFPKLGTVTIDMYHSG"
FT   gene            complement(353707..355227)
FT                   /locus_tag="Srot_0373"
FT   CDS_pept        complement(353707..355227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0373"
FT                   /product="penicillin-binding protein transpeptidase"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   KEGG: mgi:Mflv_0810 penicillin-binding protein,
FT                   transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96860"
FT                   /db_xref="GOA:D6ZBA1"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBA1"
FT                   /inference="protein motif:PFAM:PF00905"
FT                   /protein_id="ADG96860.1"
FT                   /translation="MNTSLRRIGLVLAWLAPLVLIANITYVQAWWSIDLRNNAHNKRAL
FT                   YREYSEPRGKITAGGTLLAYSDPSDDRFHYLRKYNEPLAYAPVTGYYSMLFDRTELELK
FT                   ENDVLNGKDSRLFSQRLLDFLASHGQRGGMVNTTIDAKLQEVAYRQLSSGCPGGCVGSV
FT                   VALDPKNGAILAMASSPSYDPNQLSSHNLDETAKYYESLSHDPNQPLLNRAIEQAYPPG
FT                   STFKIVTTAAALSYGISPDLKLTAAGSIPLPGTANATIPNYGGQACPDSIGGEVTLRQA
FT                   FAYSCNTAFVQLMTQKIPKADAVLRGMATQLQLTEKQSIPMSVVPSQLVSPEEPDLLQK
FT                   DPAALGQSVIGQRDVQLTPLMNAEITACVANGGFLARPFVVRQEFGPDLKPLSDDQTTR
FT                   SVLVPAMRPQTAKTLTDFMVESERRSGGKGKDPKLDIASKTGTADNPHNKSPYTWYVAF
FT                   APASRPVIALAVLVEGSDALGPGATGASVAGPIGRAVIAQALADGGRR"
FT   gene            complement(355224..356813)
FT                   /locus_tag="Srot_0374"
FT   CDS_pept        complement(355224..356813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0374"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein; KEGG: rop:ROP_35140
FT                   putative cell division protein RodA"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96861"
FT                   /db_xref="GOA:D6ZBA2"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBA2"
FT                   /inference="protein motif:PFAM:PF01098"
FT                   /protein_id="ADG96861.1"
FT                   /translation="MSAAGSAVRSETAPGQGKSQAPSGSHLAPRNRRNVELALLAVAVA
FT                   LVLAALALVDANLHRPMLGDLARIALVYSLMMGGAHLAIRFFAPYADPLLFPIVALLNG
FT                   VGLVLIFRIELEVRDPGSEAVRQSILSFDTNPQLVWTFVSVAAFSLVLGFLKDYRALSR
FT                   YGYTLGALGVLFLAVPIFAAPINGSNVWLHLGFLTIQPGEFAKIALIVCSASLLVAKRD
FT                   LFVTAGNHVWGLDLPRMRDLGPLLLAWGLAIATLFLQHDLGMGLLIFVTALLMLYIATE
FT                   RASWLLIGLLMLVVAGAFAFTQIHHVQERAQAWANPLTDCDNVGYQLCEALFGLAVGGL
FT                   GGTGLGAGSPARVPEAHNDFILAAAGEELGLIGLAAVILLYYLLVDRGFRIALTVRDSF
FT                   GKLLAAGLVITIAIQVFIIAGGVTDLIPLTGLTTPFMSSGGSSLLSNYILMALLIKISH
FT                   EARKPGSLPVAAPNSGGKAKNNRHSAQKATAWFSGADSAASEEEPTTTDLQKIPPEPKN
FT                   TADPKNTRGAAQ"
FT   gene            complement(356810..358294)
FT                   /locus_tag="Srot_0375"
FT   CDS_pept        complement(356810..358294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0375"
FT                   /product="protein serine/threonine phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /note="PFAM: Protein phosphatase 2C-like; KEGG:
FT                   rop:ROP_35150 serine/threonine protein phosphatase PstP;
FT                   SMART: protein phosphatase 2C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96862"
FT                   /db_xref="GOA:D6ZBA3"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBA3"
FT                   /inference="protein motif:PRIAM:3.1.3.16"
FT                   /protein_id="ADG96862.1"
FT                   /translation="MSLVLRYAARSDRGLVRGNNEDAAYAGARLLALADGMGGHEAGEV
FT                   ASSLVINSLAPLDDEEPGGEILSKLENAVRAGNIAIAEHVAEHPERDGMGTTLSALLFT
FT                   GTSIGLAHVGDSRAYLLRGGELTQITRDDTYVQSLIDDGRITAEEAHSHPQRSLILKAL
FT                   TGHEVQPTLNVREALAGDRYLLCSDGLSDVVSASTIETVLGEGDVDTAADKLVDLALRS
FT                   GGPDNITVVVAEVADSGFAQTQPIIAGSALGEEQQHAPPPDSAAGRAAALGQQQRTPVK
FT                   VSAAEESADKPRRHWRLIAVLAVLLVALIAAAYGGRALLRSNYYTGSENGSVVIYRGVS
FT                   GSLFGVRLQALDERVCFREPAVPGEKAKAEFLRAGESRPGCAPLRLTDLEVATRSSVPN
FT                   LPSGGHDEVQGQVRLLLEHLLPNCADHARAPLSAPAAPAPMPSIALPAPPPPSGEPAPS
FT                   SQSPFPSIEPSIELPAPPSEVLRAWKPGIDCRERLG"
FT   gene            complement(358386..358859)
FT                   /locus_tag="Srot_0376"
FT   CDS_pept        complement(358386..358859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0376"
FT                   /product="FHA domain containing protein"
FT                   /note="KEGG: nfa:nfa850 hypothetical protein; PFAM:
FT                   Forkhead-associated protein; SMART: Forkhead-associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96863"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBA4"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ADG96863.1"
FT                   /translation="MQQQALIWQAGRAAFLALLWLFVFAVVRVIRSDIANASGSRVPAQ
FT                   SKSPSSGFFANFGRGRQAKYLVVTRGALRNTRIALGDAPVLIGRADDSTLVVTDEYASS
FT                   RHARLLKRGEDWFVEDLGSTNGTYLDRVKVTAAVRVPLGSPIQVGKTVVELRA"
FT   gene            complement(358901..359644)
FT                   /locus_tag="Srot_0377"
FT   CDS_pept        complement(358901..359644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0377"
FT                   /product="FHA domain containing protein"
FT                   /note="KEGG: saq:Sare_0047 FHA domain-containing protein;
FT                   PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96864"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBA5"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ADG96864.1"
FT                   /translation="MVQRIERTLEGAIGDAFARVFGGNLQVSEVQAGLQREAASNVRTG
FT                   ADGQPGTSDQYMIRIGQDDVAHFEEHYHEVTRVLTRHLEQFIAAQGWAVRRPVSVLIEV
FT                   SPQMRPGQLRISSSASEPGGPGAAAPQQPAAPARTTAPPPSPSSSHRQSARRALRLTEG
FT                   SGRQHQLPLGVTVIGRGSGAGVRLDDKSVSREHCRIWWDGQRAVLNDLGSTNGTSVNGE
FT                   RVAEWELADGDVVNVGQSLVIVRFG"
FT   gene            359963..360048
FT                   /locus_tag="Srot_R0010"
FT                   /note="tRNA-Leu1"
FT   tRNA            359963..360048
FT                   /locus_tag="Srot_R0010"
FT                   /product="tRNA-Leu"
FT   gene            360511..360789
FT                   /locus_tag="Srot_0378"
FT   CDS_pept        360511..360789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0378"
FT                   /product="phosphopantetheine-binding protein"
FT                   /note="PFAM: phosphopantetheine-binding; KEGG:
FT                   msm:MSMEG_2132 acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96865"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBA6"
FT                   /inference="protein motif:PFAM:PF00550"
FT                   /protein_id="ADG96865.1"
FT                   /translation="MSMDVAEKLEQVLREDLSVRASQITRDALLVDDLGIDSVGFALGL
FT                   VVIEEKLGVALSEDQLLVCNSFGDLVDIVSSMKNAGSAPVAEAKPAV"
FT   gene            360806..362431
FT                   /locus_tag="Srot_0379"
FT   CDS_pept        360806..362431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0379"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mav:MAV_2874 acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96866"
FT                   /db_xref="GOA:D6ZBA7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBA7"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADG96866.1"
FT                   /translation="MTDAQGNRLAAKISEAMLSTSADLVIMDAETREWSRFPWGEVHAR
FT                   AEAVAADLLDRADGPVGTLGLIGNPTVDIVASVLGAWLAGGSVSLFPGMVRGADLGRWA
FT                   ETTLGRCAQIGVRTIFSYGRELEQLRAVQSGVRTEDVARIGAKPRPQSFVPPRTGDDST
FT                   PAVLQNSSGSTGQPKTAILSRGAFLSNIAAVADRTLLGKEDVVCSWLPLYHDMGLITLV
FT                   SAMWAGAPLWLAPSGAFSAAPLKWLDWITESGATYVKAPNFAYDIIGRYGDKIDRGVDL
FT                   GTLRVAVSAAELIHCDSFERFLAATAPVGFNPGSAMTAYGLAEATCAVAASRPGAGARF
FT                   DDVSVTMPDGGQSRRRYARLGAALDGMRLRIAPPAAPVPAINGREVGEIEVTGACMMNG
FT                   YLGADPIRRDEWFKTGDLGYLLDGELVVVGRFKELIVLAGRNVYPTDIERAAASVEGVR
FT                   AGRVAAVGLDEGGLRPRLALALEYKGSDLDTARRRVVQRVAADCGIVPAEVVFAAPGEL
FT                   PVTTSGKLRRLDVKHMIETGGGLR"
FT   gene            362428..363603
FT                   /locus_tag="Srot_0380"
FT   CDS_pept        362428..363603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0380"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   msm:MSMEG_2130 putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96867"
FT                   /db_xref="GOA:D6ZBA8"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBA8"
FT                   /inference="protein motif:PFAM:PF02770"
FT                   /protein_id="ADG96867.1"
FT                   /translation="MTSVDVSRRAQERLSPEGFQDLLRSVVDDEVRAWVEEAEKDERFP
FT                   RKLIERFGERGVFEDKWASGALPDVAKLVELGFALGGLGSVGISVGVSLHDSAISVLRR
FT                   FGRTDYLREVAESAIRGETLLCIGASEEIGGSDLQISETMVRSHDGGYQINGSKKFVSL
FT                   APVADHIVVVARSADSAPEGQKGNVMLLLVPTAQTAVREPYRKLSAGPLETAWVDIDTW
FT                   VPAEALIARPGAGLAAISWGLSHERLGVAAQIVALCERALGITLARMTDRVQFGSTLIE
FT                   HQALRLRFADLWSRVNMMRYSLAGIAATGEMNLRTAAAVKVTAARLGEEVLSECLHIFG
FT                   GSGYLVDHTPIGRWWRDMKLARVGGGTDETLWEFVATAMKPDVEGYRSLCP"
FT   gene            complement(363727..364467)
FT                   /locus_tag="Srot_0381"
FT   CDS_pept        complement(363727..364467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0381"
FT                   /product="Siderophore biosynthesis protein, conserved
FT                   region"
FT                   /note="PFAM: Siderophore biosynthesis protein, conserved
FT                   region; KEGG: mjl:Mjls_1700 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96868"
FT                   /db_xref="GOA:D6ZBA9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR019432"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBA9"
FT                   /inference="protein motif:PFAM:PF10331"
FT                   /protein_id="ADG96868.1"
FT                   /translation="MSPTTLKPAAERSLDAHSELGQAILHRVSRPWPVLYRLIAPDPSV
FT                   PAPPEPNLDPPFAVRRVDPDSEDTAIIAAWMRQPALVRGWEQDWPDERWYDQLKAQVES
FT                   NYSHPYLILFRDKPIGYLECYRPAQDSIGATYAADPHDLGMHGAIADEAMASKGFMVML
FT                   LPRLIKSFFELEPQCRRIMFDPEHKNVETRRVFEHVGCVFLGEHQMPNRRMALYTLPRT
FT                   PADVPESWPLEAEEPAAKTEEQPE"
FT   gene            364559..364969
FT                   /locus_tag="Srot_0382"
FT   CDS_pept        364559..364969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0382"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bld:BLi01628 CcpC"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96869"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBB0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96869.1"
FT                   /translation="MAIVNHHERARKLAGSAELDSWISKCAHYDEVEHWDAADIKISLT
FT                   QKTVVERQQDPGLSQAHGVGIKIFSPSVVWHVSGVPLPDQVYTVADEYAYVAFVRGVIV
FT                   FADCKQFEGKQDYLPTMQKMFLETYQKVQALP"
FT   gene            365183..365698
FT                   /locus_tag="Srot_0383"
FT   CDS_pept        365183..365698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0383"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96870"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBB1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96870.1"
FT                   /translation="MRKRHLVLSAILALLGSGAFGAAPASAESDPAACAALNDLQPKLE
FT                   AQVSSINGISSKEREIRENTNDPDEKIASREGQLSQTIDIQNGTADQLRGVADTVENPQ
FT                   VQGVLNNWADALNGFSDALQDRLDNGLGEDPDPQSASWLHATAQRVNLAADAFRATLKS
FT                   VCAAPPNS"
FT   gene            365729..370291
FT                   /locus_tag="Srot_0384"
FT   CDS_pept        365729..370291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0384"
FT                   /product="Glutamate synthase (ferredoxin)"
FT                   /EC_number="1.4.7.1"
FT                   /note="KEGG: rop:ROP_35350 glutamate synthase large
FT                   subunit; PFAM: ferredoxin-dependent glutamate synthase;
FT                   glutamine amidotransferase class-II; glutamate synthase;
FT                   glutamate synthase alpha subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96871"
FT                   /db_xref="GOA:D6ZBB2"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBB2"
FT                   /inference="protein motif:PRIAM:1.4.7.1"
FT                   /protein_id="ADG96871.1"
FT                   /translation="MNRSPSPQGLYHPSEEHDSCGVAMIVDIHGRRSHELVAKAIAALV
FT                   NLDHRGAAGAEPNTGDGAGALIQVPDRFLRAVAGFELPEVYATGIAFLPQGGSDAEQAA
FT                   RAVEKIVESEGLATLGWREVPVNDSSIGALARDAMPTFRQIFIADPRGQLDGLDLERRL
FT                   YIVRKRVEHELRWGDERVYFPSLSARTLVYKGMLTTLQLREFYTDLQDERVESAVAIVH
FT                   ARFSTNTFPSWPLAHPYRFIAHNGEINTVAGNSNWMRARESLIRSDVFGGPEAWQKIFP
FT                   IVTPGASDTARFDEVVELLTLAGRPLPHAMLMMVPEAWENNPDMPKAHRDFYRYHASLM
FT                   EPWDGPAAMCFTDGSLVGALLDRNGLRPGRVWVTDDEVMVASEAGAFPVAQEKIIQKTR
FT                   LRPGRMLLVNMAEGRIITDEEVKDELSAAQPYGEWLHEQIALRDLPERETVRMNHERVL
FT                   NRQQVFGYTTEDVNILIKPMAMTGQEGIGSMGTDTPIAALSERPRLLFDYFQQLFAQVT
FT                   NPPLDAIREEIVTSLYGSLGPERDVLNPEPLSCRQVQLEQPILSNDDLARLVAANDDGK
FT                   YPWLRSTVIPGLYPVAKGGDGIAAALDVIRSQASDAIAGGARLIVLSDRNSNESLAPIP
FT                   SLLLTAAVHHHLIREKTRTKIGLIVETGDAREVHHMAALLGCGAAAVNPYLALETLHDL
FT                   VERKLMPGFTYAKAEANYLKATSKGVLKIMSKMGISTLASYTGAQLFQVIGLDQGLVDE
FT                   YFTGLRSQLGGVGLAELAADVGVRHHRAFIERPEERAHRELEVGGEYQWRREGEYHLFN
FT                   PETVFKLQHSTRTGRYDVFKEYTRAVDERAEKIGTLRGLFEFDPRGRAPIPVEEVEPVS
FT                   EIVKRFSTGAMSYGSISAEAHETLAIAMNRLGGRSNSGEGGEDEDRFTPDENGDWRRSA
FT                   IKQVASGRFGVTSHYLANCTDIQIKMAQGAKPGEGGQLPGHKMYPWIAKTRHSTPGVGL
FT                   ISPPPHHDIYSIEDLAQLIYDLKNANPQARIHVKLVSEIGVGTVAAGVSKCHADVVLIS
FT                   GHDGGTGASPLNSLKHAGAPWELGLAETQQTLLLNGLRDRIVVQVDGQMKTGRDVVVAA
FT                   LLGAEEYGFATAPLVVEGCVMMRVCHLDTCPVGVATQNPVLRARFDAKPEFVVNFFEFV
FT                   AQEVRELLASLGFRTLQEAIGQSQHLNTSRALARWSGEKAGKLDLSPILHQPESPFMNQ
FT                   APYCTSKQEHGLEKALDQVLISQARDAIDNGAEVLIESKIGNLNRSVGTMLGYEVTKAH
FT                   GAAGLAEHAITVDFTGIAGNSFAAFVPKGVTLRLRGEANDYVGKGLSGGNVTIRPAEES
FT                   SDRLVAERNIIAGNVVLFGATSGHAFIRGMVGERFAVRNSGATAVVEGIGDHGCEYMTG
FT                   GKVVILGPVGRNFAAGMSGGVAYIYNPDTTLERRVNPEFVNLEDVDGSDQEWLRAILAR
FT                   HVDETGSSVASRALADWETERRNFVKVMPRDYKRVLITIERAKREGRDPNQAIMEATRG
FT                   "
FT   gene            370330..371778
FT                   /locus_tag="Srot_0385"
FT   CDS_pept        370330..371778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0385"
FT                   /product="glutamate synthase, NADH/NADPH, small subunit"
FT                   /note="KEGG: mul:MUL_5036 glutamate synthase subunit beta;
FT                   TIGRFAM: glutamate synthase, NADH/NADPH, small subunit;
FT                   PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96872"
FT                   /db_xref="GOA:D6ZBP5"
FT                   /db_xref="InterPro:IPR006005"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBP5"
FT                   /inference="protein motif:TFAM:TIGR01317"
FT                   /protein_id="ADG96872.1"
FT                   /translation="MPDPSGFLKHTMAQLPARRPVPLRLRDWNEVYQEFDETTLRNQAS
FT                   RCMDCGIPFCHQGCPLGNLIPDWNDLSRTGQWRDAIERLHATNNFPEFTGRLCPAPCES
FT                   ACVLGINQDPVTIKQIEVEIIDRAFEEGWVPPVHPHQLTGKRVAVVGSGPAGLAAAQQL
FT                   TRAGHMVTVFERDERIGGLLRYGIPDFKMEKRHIDRRLVQMEAEGTIFRVGVNVGVDVT
FT                   VEKLRASYNAVVLAVGALEPRELDVPGRDLDGVVQAMDYLPEANRALYEGRAARIDARG
FT                   KRVVIIGGGDTGADCLGTALRQGAASVHQFDINPEPPKSRDETMPWPTYPRVLRSSAAH
FT                   QEGGERVFAANTIEFIGRDGALVGLKAHEDVRREGRSIVSVGGEFTQEADLVLLALGFT
FT                   GPQRPDLLDKLGVELTERGDVKRDENYQTSVEGVFVAGDGGRGQSLIVWAIAEGRAAAA
FT                   AVDEWLEGETALPRPIAPHAQPLG"
FT   gene            complement(371891..372517)
FT                   /locus_tag="Srot_0386"
FT   CDS_pept        complement(371891..372517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0386"
FT                   /product="beta-Ig-H3/fasciclin"
FT                   /note="KEGG: rer:RER_19270 hypothetical protein; PFAM:
FT                   beta-Ig-H3/fasciclin; SMART: beta-Ig-H3/fasciclin"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96873"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBP6"
FT                   /inference="protein motif:PFAM:PF02469"
FT                   /protein_id="ADG96873.1"
FT                   /translation="MLSTLKNSFAAAGVVAVATMGLAGLTNDSSALPGISAASAQGYSS
FT                   ALVGAGCKAYAAKVPAGPGSVAGLAADPVAVAASHVPLLTTLTSAVSGKLNPEVHLVDT
FT                   LDGGEFTVFAPVDSAFAKIDHATIDSLKTDSPTLTKILTYHVVPGQIEPEDIDGEHATV
FT                   EGGAVTVTGSGDDLKVDGASVICGGIHTANATVYLIDTVLMPPTE"
FT   gene            complement(372770..373567)
FT                   /locus_tag="Srot_0387"
FT   CDS_pept        complement(372770..373567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0387"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: nfa:nfa2180 putative ABC transporter ATP-
FT                   binding protein; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96874"
FT                   /db_xref="GOA:D6ZBP7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBP7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG96874.1"
FT                   /translation="MTVSVDLAQAWVEIPIFDAKTRSLKKAVLSKAGGTIAGSSKFPIV
FT                   EALRDITLSLHEGDRIGLVGHNGAGKSTLLRLLAGIYEPTRGTAVVRGRVAPVFDLGVG
FT                   MDPEISGYENILIRGLFLGQTRKSMLRKIKEIAEFSELGDYLDMPMRTYSTGMRIRLAL
FT                   GVVTSIDPEILLLDEGIGAVDADFMKKARERLQALVRRSGILVFASHSNEFLAQFCERA
FT                   LWVDHGSIRMSGGIEEVVTAYEGPAAGASVAHVLANPGWDETP"
FT   gene            complement(373577..374437)
FT                   /locus_tag="Srot_0388"
FT   CDS_pept        complement(373577..374437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0388"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: rer:RER_02600
FT                   ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96875"
FT                   /db_xref="GOA:D6ZBP8"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBP8"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADG96875.1"
FT                   /translation="MSGTAAEHGFAPARASSRSFSRAWDDLRRGVEGRELWLQLGWQDI
FT                   KQRYRRSVLGPFWITISTGTIAICLALLYSMLLGQDLRDFLPHVTVGLIIWNLIQNSVE
FT                   EGSEVFIVNEGLIKQLPAPISIHIYRLIWRQALLMAHNLVIYVILIAVFPPRHWSWSML
FT                   LAFPALALLLLNAVWVAMVAGVVATRFRDVVPMVSNITQLLFYLTPIVWTTQGLTKQGG
FT                   AVARRARLVEINPLYHYVDILRAPMIGAPQAAYHWWIVIALTAAGFGCMLVVMRQYRSR
FT                   VAYWV"
FT   gene            complement(374557..375027)
FT                   /locus_tag="Srot_0389"
FT   CDS_pept        complement(374557..375027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0389"
FT                   /product="Protein of unknown function DUF2587"
FT                   /note="PFAM: Protein of unknown function DUF2587; KEGG:
FT                   mjl:Mjls_5371 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96876"
FT                   /db_xref="GOA:D6ZBP9"
FT                   /db_xref="InterPro:IPR019695"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBP9"
FT                   /inference="protein motif:PFAM:PF10759"
FT                   /protein_id="ADG96876.1"
FT                   /translation="MTEENHQSHNIVILDQPHAEDGLDRLVEQPAKVMRIGSMVKQLLE
FT                   EVKGAPLDEASRARLREIHTRSIEELQEGLAPSMREELQRLTLPFTEGETPSEDELRIA
FT                   QAQLVGWLEGLFHGIQTTLIAQQLAARAQVDQSRHEALPPGHSAGPGSGQYL"
FT   gene            complement(375043..376023)
FT                   /locus_tag="Srot_0390"
FT   CDS_pept        complement(375043..376023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0390"
FT                   /product="NAD(P)H quinone oxidoreductase, PIG3 family"
FT                   /note="KEGG: mgi:Mflv_1189 alcohol dehydrogenase; TIGRFAM:
FT                   NAD(P)H quinone oxidoreductase, PIG3 family; PFAM: Alcohol
FT                   dehydrogenase zinc-binding domain protein; Alcohol
FT                   dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96877"
FT                   /db_xref="GOA:D6ZBQ0"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBQ0"
FT                   /inference="protein motif:TFAM:TIGR02824"
FT                   /protein_id="ADG96877.1"
FT                   /translation="MRAIVVPSADGEAMFLAEAPRPEPGPRDVLIEVAAAGVNRADLAQ
FT                   RAGAYPPPPGASQILGLEVAGRIAEIGGEVTDWAVGDEVCALLAGGGYAQYAVAHEACV
FT                   LPVPPGATLAEAAGLPEVAATVWLNLGMIGGLAPGRRVLIHGGGSGVGTHAVQLVRAVG
FT                   AEAAVTASQGKADRCRELGAQIVIDYRTEDFADVLRRRWPDGADLVLDHIGGPYLARDL
FT                   KVLGLDGKILLIASIGGRHAEQIDLGALQLKRASVIGSTLRNRATGGTLGKAAIIAQVR
FT                   EHVWPLIAEGTVKPVLDRTFPLAEAEAAHRALAAGEIFGKTVLLA"
FT   gene            complement(376056..376775)
FT                   /locus_tag="Srot_0391"
FT   CDS_pept        complement(376056..376775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0391"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mav:MAV_1611
FT                   transcriptional regulator, TetR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96878"
FT                   /db_xref="GOA:D6ZBQ1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBQ1"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG96878.1"
FT                   /translation="MQSRTRASSNAKTPRKTAVKKTSAAKKTPAAKKNPASRIPIPKRQ
FT                   RRPTRAEVRKRLLDAALIVFGELGYTAASLDIVAAAAGLTKGAVYSNFSSKDELYFAMI
FT                   EDQLERRVAETNFAASGSADLDEISRFFTSNIFKERHWRLVWLEYWARVVREEELRQPY
FT                   LQARQQFATRIKEAFGPVRENLAKEAAGKKPSVELTEEELATVLLAVNEGLTVQALPDP
FT                   EKYPKELLGKLLRKLLS"
FT   gene            377157..377245
FT                   /locus_tag="Srot_R0011"
FT                   /note="tRNA-Ser1"
FT   tRNA            377157..377245
FT                   /locus_tag="Srot_R0011"
FT                   /product="tRNA-Ser"
FT   gene            complement(377261..378295)
FT                   /locus_tag="Srot_0392"
FT   CDS_pept        complement(377261..378295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0392"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mgi:Mflv_2547 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96879"
FT                   /db_xref="GOA:D6ZBQ2"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBQ2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96879.1"
FT                   /translation="MNSPITPRHPGGPGHAGQHFQQRPASSAQPPYGGQQPPPPYGHGQ
FT                   PPPPPPSAQYPAHYAQHPPMPAPKRKNKALLWSLTGGGLAAVLVVAAVALLLGKSGRRD
FT                   AADGQSALSSLAGHEDGPGHTSTGTGSSSLLNRDPQELLPLLPAPSDFPAGTPVQPSID
FT                   APGEANADERVKPLPPEATNPPGCWSHLEIRRNRDDLPDITRIVTAVAKDAKGQVIAGA
FT                   QIAKENNNVNALEQARAWLGQCREFDYIYQIQPGEAPVHFRVAPLPGPAGFSDPFFGVE
FT                   FTELGPQGPRGHEYFFAARIRGLLVLSEGVCDLSSCDESQNAQMRQQIPIMFSKVVQGL
FT                   RNMR"
FT   gene            378552..379094
FT                   /locus_tag="Srot_0393"
FT   CDS_pept        378552..379094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0393"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfu:PF1233 putative chitinase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96880"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBQ3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96880.1"
FT                   /translation="MRGTKASRGLVVAAALMFGALGSSLAVADPEPAPAPAVPTAETPT
FT                   MTTETPTPVSPESTAPVPAGTTGGSACAVIRSNKTQIDDATWPLKVATKVEGWDWSGDA
FT                   VEARARIDSQLPQYLANLQEGAKQNDETGSALHDAVEAGHELITTIDHNGDAGDTAGAI
FT                   SAFDKALNDALRSCIQQ"
FT   gene            complement(379208..379723)
FT                   /locus_tag="Srot_0394"
FT   CDS_pept        complement(379208..379723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0394"
FT                   /product="Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline
FT                   decarboxylase"
FT                   /note="PFAM: Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline
FT                   decarboxylase; KEGG: msm:MSMEG_6116 putative OHCU
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96881"
FT                   /db_xref="InterPro:IPR018020"
FT                   /db_xref="InterPro:IPR036778"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBQ4"
FT                   /inference="protein motif:PFAM:PF09349"
FT                   /protein_id="ADG96881.1"
FT                   /translation="MHQGIGLEGLNALEPKSAVSALFECCHCVVLAERLAKARPYASRS
FT                   DLFSLADHELFRVDEETLGQIVASHPGVGSRPKSKASEGEQCAIWDQDHAVMSRLHAVV
FT                   GQYEAHFNRPFLIYAGELSAGEVIAVAEQRLHNDEETEGKVVRNELAKVHRHRLERMLG
FT                   PEGGYPLW"
FT   gene            379835..380629
FT                   /locus_tag="Srot_0395"
FT   CDS_pept        379835..380629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0395"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to DNA-binding protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96882"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBQ5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96882.1"
FT                   /translation="MRLLRTGLFCVLLLVFPVLTGCAAPALLMAARIADTAGGGAASGG
FT                   WQGYLPKAEDFPGGWDVSSEEVLRGGASAMSSPIDSLRLVFGSPPKECSLPESLYKAQK
FT                   HPSVTGVKAPDTGGGNDFIAKSLSGDMHAVTVEIGPAAGKESLVETVRGLAARCGSFQF
FT                   SKNSSYDDDFRVDGSMKPADPKLGFGDAAGLVFAFAPNINMAFGGPGTGSALDFGFTET
FT                   VYAAKIKGASVVAVSFSFKDPAADSALVLKLFRDTAKRVNAT"
FT   gene            complement(380633..381127)
FT                   /locus_tag="Srot_0396"
FT   CDS_pept        complement(380633..381127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0396"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="KEGG: msm:MSMEG_6114 inorganic pyrophosphatase;
FT                   PFAM: Inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96883"
FT                   /db_xref="GOA:D6ZBQ6"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBQ6"
FT                   /inference="protein motif:PRIAM:3.6.1.1"
FT                   /protein_id="ADG96883.1"
FT                   /translation="MSAEFDVVVEIPKGSRNKYEVDHATGRVTLDRYLYTSFGYPSDYG
FT                   YIENTLGEDGDPLDALVLLPESVFPGVVVRARAVALFNMTDEAGGDAKVLAVPAGDPRW
FT                   DSVQDLADVSAFDLDAIKHFFSHYKDLEPGKSVQAADWADRAAAEAEIQRSVERAKASG
FT                   H"
FT   gene            381151..382635
FT                   /locus_tag="Srot_0397"
FT   CDS_pept        381151..382635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0397"
FT                   /product="D-alanyl-D-alaninecarboxypeptidase/
FT                   D-alanyl-D-alanine-endopeptidase"
FT                   /note="KEGG: rer:RER_06180 D-alanyl-D-alanine
FT                   carboxypeptidase; TIGRFAM: D-alanyl-D-alanine
FT                   carboxypeptidase/D- alanyl-D-alanine-endopeptidase; PFAM:
FT                   peptidase S13 D-Ala-D-Ala carboxypeptidase C"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96884"
FT                   /db_xref="GOA:D6ZBQ7"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBQ7"
FT                   /inference="protein motif:TFAM:TIGR00666"
FT                   /protein_id="ADG96884.1"
FT                   /translation="MEFLARGTIPVPPSAVCAAWAISRYCVDMAPQQRSAPARPKHLAR
FT                   GVVVILVALVVVGVGLWGFQAYQSANAAAPAPAEPSPRSALRPEIRPVSPDAPSPAAAA
FT                   VAAVLDPLGDNPLLARFSGVVLDGVSGAALWQRDPDAAMTPASTMKLLTAASAVLSLPL
FT                   GARLATRVVAGSDPGQVVIVGAGDPTLSAAPDGEQSFYPGAARLDDLVAQVKQHHPGPV
FT                   DEVLVDDSAYEGPNFAQGWLPGDVADGFITPMDPLMLDGGRLDRSRDESPRTTTPALDT
FT                   GKELARRLGADPERTRLAPAPAGAVALAQVQSAPLRERILQFMLASDNVLAEAVGREVA
FT                   RGAGKPASFSGAVAAENEVLGKAGVDLAATRRLDSNGLSLDDRLSARTLARVLALATGR
FT                   SSGLRPLLDMLPVAGATGTLAERFRDPLSGQNTAGAGFVRAKTGSLDDVSTLAGETADQ
FT                   DGRMLVFAFLSNDGATWDTRAALDALASALRGCGCR"
FT   gene            382620..383612
FT                   /locus_tag="Srot_0398"
FT   CDS_pept        382620..383612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0398"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="KEGG: nfa:nfa3880 hypothetical protein; TIGRFAM:
FT                   tRNA(Ile)-lysidine synthetase; PFAM: PP-loop domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96885"
FT                   /db_xref="GOA:D6ZBQ8"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBQ8"
FT                   /inference="protein motif:TFAM:TIGR02432"
FT                   /protein_id="ADG96885.1"
FT                   /translation="MRLPVSSPAQPGGVVLWELRKALRAWLAQHAPAQARVCVALSGGA
FT                   DSLALTAALAREHTAVEALVVDHGLQPESAQTAARAAQLALDLGCSGSRVLPVTVNGAG
FT                   GLEAAARTARQAALRQAGAGSPVLLGHTLDDQAETVLLGLARGSGPRSIQGMRAWDDPW
FT                   GRPLLGVRRAMTRAVCAELGVQPHEDPMNTDPRFVRARLRAEVLPLLEDVLQGGVAEAL
FT                   ARTADAVRADNGHLDEEAAAVYAKIGGAKIAVTDVAGLPGPIRRRVLRLWLMGNGAGAL
FT                   TETQIRSVDALASAWRGQGPVAVPAAGPQGGGRRLMARRSYGRLELEIR"
FT   gene            383634..384239
FT                   /locus_tag="Srot_0399"
FT   CDS_pept        383634..384239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0399"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="TIGRFAM: hypoxanthine phosphoribosyltransferase;
FT                   KEGG: mjl:Mjls_5161 hypoxanthine phosphoribosyltransferase;
FT                   PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96886"
FT                   /db_xref="GOA:D6ZBQ9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBQ9"
FT                   /inference="protein motif:TFAM:TIGR01203"
FT                   /protein_id="ADG96886.1"
FT                   /translation="MNESAVAAAPQANWYDADVLSVVLTEEQIAARTTQLAHQIAQNHP
FT                   YRPGQPRSEDLLLVTVLKGAVMFTADLARSLPIPSQLEFMVVSSYGAATKSSGVVRIVK
FT                   DLDRDIRGRDVLVVEDVVDSGLTLSWLLRHLAAREPKSLEVCALLRKPEAQEAPVALDY
FT                   VGFDIPNVFVVGYGLDFDERYRDLPYLGELDPAAVERP"
FT   gene            complement(384350..385252)
FT                   /locus_tag="Srot_0400"
FT   CDS_pept        complement(384350..385252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0400"
FT                   /product="CDP-diacylglycerol/serine
FT                   O-phosphatidyltransferase"
FT                   /EC_number="2.7.8.8"
FT                   /note="TIGRFAM: CDP-diacylglycerol/serine O-
FT                   phosphatidyltransferase; KEGG: mab:MAB_0638c putative
FT                   CDP-diacylglycerol-- serine O-phosphatidyltransferase;
FT                   PFAM: CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96887"
FT                   /db_xref="GOA:D6ZBR0"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBR0"
FT                   /inference="protein motif:TFAM:TIGR00473"
FT                   /protein_id="ADG96887.1"
FT                   /translation="MISAAPRPLRPGVRLLPSVMTVSAICLGLSAAKFAMDHRTEVALT
FT                   LIAAAAVLDGLDGRVARLLDATSKMGAELDSLADALNFGVSPALVIYIALLKDGAAARW
FT                   NSAVGWIAVLLFVVCAVLRLARFNTLTDNDDAPPYAKEYFVGVPTPAGALTACAPIAAA
FT                   LQWHSGWWTNPFLVSAWVMFIGLLMISRVPTLALKSVSVPPRLAAVLLVSSAAAVATLI
FT                   AAPYVFLIVLILVYIAHIPFAWRSWRWVTARPDAWELRPPQRRAMRRAMRRAESPHPRA
FT                   RVAPQPRSARRLGLRRPKS"
FT   gene            complement(385249..385983)
FT                   /locus_tag="Srot_0401"
FT   CDS_pept        complement(385249..385983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0401"
FT                   /product="phosphatidylserine decarboxylase related protein"
FT                   /EC_number="4.1.1.65"
FT                   /note="TIGRFAM: phosphatidylserine decarboxylase related
FT                   protein; KEGG: mmi:MMAR_0754 phosphatidylserine
FT                   decarboxylase; PFAM: phosphatidylserine
FT                   decarboxylase-related"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96888"
FT                   /db_xref="GOA:D6ZBR1"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033175"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBR1"
FT                   /inference="protein motif:TFAM:TIGR00164"
FT                   /protein_id="ADG96888.1"
FT                   /translation="MALPPRRQGATGPSAELERFLDLIKATLPPPHPAGYPFIFAGLGA
FT                   AALSAAAPGRAGAALRRGGLAAAAACAVFFRNPRRAAPDDPSLVVAPADGRVSLVDTAA
FT                   PPGELGFGDEPRTRVSIFLSVFDVHVQHAPVAGQVLAATHRAGAFVSAERPEASERNER
FT                   QSLVIEEALTRKPVVVVQIAGLLARRIVCDATAGSSLRRGEVYGLIRFGSRVDVYLPAG
FT                   TKPLVKVGQRAVAGETALAALA"
FT   gene            complement(386014..387285)
FT                   /locus_tag="Srot_0402"
FT   CDS_pept        complement(386014..387285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0402"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="KEGG: gbr:Gbro_0677 molybdenum cofactor synthesis
FT                   domain protein; TIGRFAM: molybdenum cofactor synthesis
FT                   domain protein; PFAM: MoeA domain protein domain I and II;
FT                   molybdopterin binding domain; MoeA domain protein domain
FT                   IV"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96889"
FT                   /db_xref="GOA:D6ZBR2"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBR2"
FT                   /inference="protein motif:TFAM:TIGR00177"
FT                   /protein_id="ADG96889.1"
FT                   /translation="MRSVEEHQRRVAELIRAPKPVRLPLGQALGRVLAEDITAQIPLPS
FT                   FDNSAMDGYAARAEDLAGASEQHPVVLPVAADIPAGSPATFALAPQSVHRIMTGACLPP
FT                   GADAILPFESTDRGAEFVRAHAPAKPGAHIRRAGEDLRRGERALAAGARLRAPQIGLIA
FT                   ALGFAEVAVFAPLQVLVLSTGSELTAPGQPLERGRIYESNSPMLAAAVEETGAVAHRLR
FT                   FVPDSVAAFHARIGQALAELGEVDLILTSGGVSAGEYEVVKQAFAEGQTEFGQVEFVSV
FT                   AMQPGKPQGCGVYSPARRAHAESAPPTAGAATALVALPGNPVSAQVSFEVFLREPLAAA
FT                   MGHPRPRRQVLRLPLAEPVPRSPAGKRQFLRGVLAQDRSSVSPFGPPGSHFLRSMALSD
FT                   CLVDIPAGTTSLPEGAEVDVWDLG"
FT   gene            387429..387602
FT                   /locus_tag="Srot_0403"
FT   CDS_pept        387429..387602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96890"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBR3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96890.1"
FT                   /translation="MSRQLKIQHLDLSGCSAEELEEFELTQLLATGLCDEYQDSSDDIL
FT                   SAIDHQHLPHAS"
FT   gene            complement(387754..388467)
FT                   /locus_tag="Srot_0404"
FT   CDS_pept        complement(387754..388467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0404"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   mlb:MLBr_02522 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96891"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBR4"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ADG96891.1"
FT                   /translation="MGEPAENKRAAAHNERVIRPLLAALALAFCGALAPQAAAAPSAPA
FT                   SAPWFASWVGAATQVVAVTADGDSAQAVVGAWEKTGGTWANTTGDVPGWIGAAGLIRKA
FT                   EDDIPATPVGVFSLPAAFGTDPAPPTGLPYRQTGPNDWWVGDVKSPLYNSFATCKPGTC
FT                   PFNESASEQLDDDSYSLAVVMGVNPGRIPGAGNAYFLHVAADAPTEGCVSMEKPALSEI
FT                   IAWLRPGAVIAIRQA"
FT   gene            complement(388468..389142)
FT                   /locus_tag="Srot_0405"
FT   CDS_pept        complement(388468..389142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0405"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   mab:MAB_4299c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96892"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBR5"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ADG96892.1"
FT                   /translation="MAPAVRRALVSIASAIAPLALAASATAAPTMAAAPPWFAGQVGGA
FT                   QQVVAVLGDQTGHANVEVWGKYNGQWWSMTGPLPGHVGSAGVTDHARDGYPATPAGVFT
FT                   LPWAFGTDPAPATALPYHRTGPNDWWVGDVKSPLYNSFSQCAPGSCPFSEKESEQLAIP
FT                   QYALAVVMGVNPQRTPGAGGAFFLHVQDGGPTAGCVSIDKEALRSLITWLKPGAVIAIR
FT                   RA"
FT   gene            complement(389307..390059)
FT                   /locus_tag="Srot_0406"
FT   CDS_pept        complement(389307..390059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0406"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   mab:MAB_4299c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96893"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBR6"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ADG96893.1"
FT                   /translation="MTLPPGTLDYKDVTAHSSQARGASAPRPRLLTRALLALAGTVAAV
FT                   PLAAAADSAPSLAGSPPWFANQVGGAQQVVAVAGDQTGHANVEVWGKYNGQWWSMTGPL
FT                   SGHIGSAGVADVASEDVPATPTGVFSLPWAFGTEPAPATALPYHRTGPNDWWVADVNSP
FT                   LYNQFQTCAPGSCPFNESKSERLDVPAYALAVVIGVNPQHVPGAGSAYFLHLDGDGPTA
FT                   GCVAISEADLRSLITWLRPGAVMAVQGS"
FT   gene            complement(390056..390718)
FT                   /locus_tag="Srot_0407"
FT   CDS_pept        complement(390056..390718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0407"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nca:Noca_2749 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96894"
FT                   /db_xref="GOA:D6ZBR7"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBR7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96894.1"
FT                   /translation="MPIATLALGQRECKEQSGGQRLAAKYALPMRLFRRASGLLSLPLT
FT                   AAVAVWAITSGWSAEFFISFFLTAVLPSTVLCITRYRRERELTAGMSWAQAVSLLGLFV
FT                   FGLTAVENGGESRRGEWPGSHSRWTRLTGWSPDSASASESVARLALGVALLAWLALFVL
FT                   LILDLRRHLVTGWNTRPDPFPSGPANRRRDLRAKSSAGQRAQIPNRSRRNDEPGARG"
FT   gene            390844..392469
FT                   /locus_tag="Srot_0408"
FT   CDS_pept        390844..392469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0408"
FT                   /product="chaperonin GroEL"
FT                   /note="KEGG: rha:RHA1_ro02146 chaperonin GroEL; TIGRFAM:
FT                   chaperonin GroEL; PFAM: chaperonin Cpn60/TCP-1"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96895"
FT                   /db_xref="GOA:D6ZBR8"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBR8"
FT                   /inference="protein motif:TFAM:TIGR02348"
FT                   /protein_id="ADG96895.1"
FT                   /translation="MAKIIAFDEEARRGLERGLNALADAVKVTLGPKGRNVVLEKKWGA
FT                   PTITNDGVSIAKEIELEDPYEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVKEGLR
FT                   NVAAGANPLGLKRGIEKAVEAVTEKLLSSAVKVDTKEQIAATAGISAGDPAIGELIAEA
FT                   HDKVGNNGVITVEESNTFGLQLELTEGLRFDKGYISGYFVTDPERQEAVLEDPYILLVS
FT                   SKISTVKDLLPLLEKVIQAGKPLVIIAEDVEGEALSTLVVNKIRGTFKSVAIKAPGFGD
FT                   RRKAQLADIAILTGGEVISEEVGLSLESAGLELLGRARQVIVTKDETTIVEGAGDSSAI
FT                   AGRVAQIKTEIENTDSDYDREKLQERLAKLAGGVAIIKAGAATEVELKERKHRIEDAVR
FT                   NAKAAVEEGIVAGGGSALLQAAPALDSLGLSGDEATGANIVRVALEAPLKQIAFNAGLE
FT                   PGVVVDKVRNLPAGSGLNAATGEYEDLLAAGINDPVKVTRSALQNAASIAGLFLTTEAV
FT                   VADKPEKAAAPAGDPTGGMGDMGF"
FT   gene            392655..393560
FT                   /locus_tag="Srot_0409"
FT   CDS_pept        392655..393560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0409"
FT                   /product="protein of unknown function DUF344"
FT                   /note="PFAM: protein of unknown function DUF344; KEGG:
FT                   mab:MAB_4135c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96896"
FT                   /db_xref="GOA:D6ZBR9"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBR9"
FT                   /inference="protein motif:PFAM:PF03976"
FT                   /protein_id="ADG96896.1"
FT                   /translation="MSQASAAEPHPHVDLADTSGFTVLDDDDDDPLLLAPGGTAVDTWR
FT                   EGYPYEERLSRHQYEQEKRLLQIELLKLQQWSKKTGQRHVILFEGRDAAGKGGTIKRFM
FT                   EHLNPRGARVVALEKPTERELTQWYFQRYAQHLPAAGEMVFFDRSWYNRGGVERVMGFC
FT                   TPVQHAEFLRQAPMFEQMLAEDGISLTKFWFSVSRLEQRTRFAIRQVDPVRQWKLSPMD
FT                   LASLDKWDAYTAAKEEVFRFTDLAAAPWIVVKSNDKKRARLGAMRHVLSKFEYENKDHE
FT                   IVGAPDPLIVGRAADLLRGE"
FT   gene            complement(393633..394007)
FT                   /locus_tag="Srot_0410"
FT   CDS_pept        complement(393633..394007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0410"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: svi:Svir_06680 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96897"
FT                   /db_xref="InterPro:IPR032371"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBS0"
FT                   /inference="similar to AA sequence:KEGG:Svir_06680"
FT                   /protein_id="ADG96897.1"
FT                   /translation="MIDAHAEHDYEGPVQVEVDGHTFTAQAVLRGHQQPLDGRFRWYGR
FT                   IKADAALKEIVGERANGSVTTEHGTAKGVLDDLDFWDRYRVVGRSRPPFHVPSSIEEAE
FT                   AEAAEHEAQLLASQSQGTAQ"
FT   gene            complement(394051..395118)
FT                   /locus_tag="Srot_0411"
FT   CDS_pept        complement(394051..395118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0411"
FT                   /product="Oxidoreductase FAD-binding domain protein"
FT                   /note="PFAM: Oxidoreductase FAD-binding domain protein;
FT                   oxidoreductase FAD/NAD(P)-binding domain protein;
FT                   ferredoxin; KEGG: mab:MAB_3918c putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96898"
FT                   /db_xref="GOA:D6ZBS1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBS1"
FT                   /inference="protein motif:PFAM:PF00970"
FT                   /protein_id="ADG96898.1"
FT                   /translation="MTAAPAADRSQLGAHVRQLTIAEVVQETKDAVSIAFRIPDDMVEA
FT                   FKYWPGQYLTLRIPSERTGSVARCYSICSSPHLDDDEILVTVKRTPEGYASNWLCDNAA
FT                   PGMSIPVLPPSGTFYPRSFGHDLLMFAAGSGITPIISIIKSALAAGTARVALFYANRDP
FT                   ESVIFAKQLAVYAEEFPDRFVVQHWLESEQGRPSAEALAAFTGGRQHSRVFMCGPAPFM
FT                   DAVAAAATGAGVEPAQLHREAYFSLDTDPFAPVEVRNTSELPPARVTVQLDDGEHVLAW
FT                   DRETPLLNHLLEQGLDVPYSCRQGECSSCVCSILDGEVRLLRNETLVDEDIRLGLTLAC
FT                   QAVPETDEVIIAFDQ"
FT   gene            complement(395118..396203)
FT                   /locus_tag="Srot_0412"
FT   CDS_pept        complement(395118..396203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0412"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_3921c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96899"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR025859"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBS2"
FT                   /inference="similar to AA sequence:KEGG:MAB_3921c"
FT                   /protein_id="ADG96899.1"
FT                   /translation="MTSTLEPHVNTGAARAAQAIGTTLSTGASQTRAKRIGDREKTAAR
FT                   LLRSSVERSYDAEVDIDWDEPWLPGKLFYPEHRLTLYGTRIWDQLSPEQRVELGKHEMV
FT                   RVFAFGILVEGVLSVMLYRNIAAGNLVDDSTRYMLTEIGDETRHSIMFSRAVNKIGVEP
FT                   ALFPPRITKMIMGIVSNMPLGAWSYGWTLLFEEVLDRLQREAVADDTVQPHLRQLFKIH
FT                   VLEEARHITFAREELVRSYQAAGRVRKGLDRLLVAGATALVAPLTFWPALYRRAFGISA
FT                   FRGFLAVQLSENYRANAQFICEPMIRFFHEAGMIDGWFTKRIWKLSRALPDDVHEDVFG
FT                   EPRKESTPSLFGRILRRLVGA"
FT   gene            396504..397058
FT                   /locus_tag="Srot_0413"
FT   CDS_pept        396504..397058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0413"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gbr:Gbro_0370 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96900"
FT                   /db_xref="GOA:D6ZBS3"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBS3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96900.1"
FT                   /translation="MAEDDPWAVPHTDLAALRAAENAGRRKIWPWVAVATVFVLGLAVG
FT                   AAVLAWFAKDSLDELRSTGKLGQVVYLRAHAYAEQGAANNAETADITYTVVRHLANKSQ
FT                   PQTQTFARTVSLPWEPPTQGTAVDLEGSLVEVVLTVKVPQKSNGNLAGPTCSMSLDNDL
FT                   LDNKTAAGYGNEVTCHWKFSK"
FT   gene            397097..397963
FT                   /locus_tag="Srot_0414"
FT   CDS_pept        397097..397963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0414"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: rer:RER_15340
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96901"
FT                   /db_xref="GOA:D6ZBS4"
FT                   /db_xref="InterPro:IPR017208"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBS4"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADG96901.1"
FT                   /translation="MRVRRIDLTHEAYTYMRVFASEDNPAAPVLLVVPGYGTPAAALDK
FT                   FAARVLQEGVQVVTFDLRGQGASRPRPNPFLNWGWKRHFQDDLPLIVADVHELFPEAPV
FT                   YVFAHSLGGHLASLYVSQHPGEVDGLILLATGISHRRNHASPLTAALVSLGVVGMNLGA
FT                   QLFRVYPAVFAKFDGGYGRQPRGMLWDSGLVILTGKFQPARIEFDAQEALSEIDIPVLG
FT                   ATLEADPYVPPKVLQDFLRLFTGAKPTQEHIQKRLGHAGWIGRPQLVVELVAQWVKAKE
FT                   KEKADKE"
FT   gene            complement(398008..399066)
FT                   /locus_tag="Srot_0415"
FT   CDS_pept        complement(398008..399066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0415"
FT                   /product="Inosine/uridine-preferring nucleoside hydrolase"
FT                   /note="PFAM: Inosine/uridine-preferring nucleoside
FT                   hydrolase; KEGG: mkm:Mkms_1195 inosine/uridine-preferring
FT                   nucleoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96902"
FT                   /db_xref="GOA:D6ZBS5"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBS5"
FT                   /inference="protein motif:PFAM:PF01156"
FT                   /protein_id="ADG96902.1"
FT                   /translation="MAIPVFADVDTGIDDVWALLTLLSHPEADLVAVACTAGNVHVDQV
FT                   CANTLAVLELAGRADIPVSQGRQAPLRLAPGERFDIADDTHGGCGLGYAAVDEAQAWTT
FT                   PYDAAEAWARAARSKPGELVGLVTGPLTNLALALRAEPELPRLLRRLVVMGGSFDYPGN
FT                   TTPVAEWNISVDPEAAKEVFDAWSDAVEHTPGPPIALPLICGLNLTERIILTPELLGKL
FT                   GELVEGAPRPALSQNDPRGKRSNAHNPLLRLLEDATRFYFEFHHDQGDGYIAHMHDPFA
FT                   AEAAIDPEIVLSAPAAVDVELLGLITRGMTVADWSGKWRREPNAAIAVATDTGGFFDRV
FT                   IPRLAAFLRQRG"
FT   gene            complement(399069..400970)
FT                   /locus_tag="Srot_0416"
FT   CDS_pept        complement(399069..400970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0416"
FT                   /product="GTP-binding protein TypA"
FT                   /note="KEGG: mab:MAB_1310 GTP-binding translation
FT                   elongation factor; TIGRFAM: GTP-binding protein TypA; small
FT                   GTP- binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain 2 protein;
FT                   elongation factor G domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96903"
FT                   /db_xref="GOA:D6ZBS6"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBS6"
FT                   /inference="protein motif:TFAM:TIGR01394"
FT                   /protein_id="ADG96903.1"
FT                   /translation="MTHTEFRNIAIVAHVDHGKTTLVDAMLRQSGALAERGEATDRVMD
FT                   SGDLEREKGITILAKNTAVHRHNKDGSVTVINVIDTPGHADFGGEVERGLSMVDAVVLL
FT                   VDASEGPLPQTRFVLRKALESSLPVILVVNKTDRPDARIDEVVEHTHDLILDIASELPP
FT                   EAAKAAEHALDLPILFASGRAGVASKTQPADGTVPEGDNLDPLFDELLEVVPPPSGDRN
FT                   APFQALVTNLDASPFLGRLALLRIHNGQLRKGQTVAWMREVNGEPQVSNVRISELLVTT
FT                   GVERSPTDLAVAGDIVAVAGIPEIMIGDTLADAEHPVALPRIAVDEPAISVTIGTNSSP
FT                   LAGRVSGHKLTARMVRARLDQELIGNVSIKVIDIGRPDAWEVQGRGELALAILVEQMRR
FT                   EGFELTVGKPQVVTRIVDGKVHEPYERLTVDAPSEFIGAITQLLADRKGSLDDMASHGA
FT                   DSTRMTFRVPSRGLIGFRTEFLTTTRGTGIANAEFEAYGPWAGEIRGRHTGSLISDRAG
FT                   AVTAYALINLADRGTFFVSPGDLTYEGMVVGLNPRAEDLDVNITREKKLTNMRASTSDA
FT                   TETLVKPMEIDLEIAMELCANDECVEVTPEIIRIRKAELLASDRAKSRSRAKAANNN"
FT   gene            400973..401239
FT                   /locus_tag="Srot_0417"
FT   CDS_pept        400973..401239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0417"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nfa:nfa47600 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96904"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBS7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96904.1"
FT                   /translation="MEIVSGSSVLGESTGPDAARWSSPLRKKGRLICVKAKKFASLQPK
FT                   KKCCKSQPRCLRCPVVLMRVEKAVDLDHAEKVPKWLLIQARKK"
FT   gene            401209..401787
FT                   /locus_tag="Srot_0418"
FT   CDS_pept        401209..401787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0418"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bfa:Bfae_14360 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96905"
FT                   /db_xref="GOA:D6ZBS8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBS8"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADG96905.1"
FT                   /translation="MAPDPGEEEVTSVTLFRLCQDDWERHRAIRLEALRTAPDMYSTKL
FT                   EDMVDQPESFWREIMGKNRYFYVRTGSDVVGLAGLATPTGHAAASADKGTALTEQLPAS
FT                   TGMLISVFVAARARGRRLGALLSQAVIGQARAEGLRAVFLEVAEHNDVARRVYEELGFS
FT                   YTRRARPTFAPGLSHQELEMRLDLLAAPR"
FT   gene            complement(401784..402443)
FT                   /locus_tag="Srot_0419"
FT   CDS_pept        complement(401784..402443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0419"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ape:APE_1216 surface layer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBS9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96906.1"
FT                   /translation="MGVARTPALAALACFLAFGAAPLAGSPPAAAAPPCPALDDVEEKI
FT                   GDMQFDLENLRLVMNNAYASIDVKKHDEDFRLKTMINAFGYLGRAVAAAGDPGLSQQFE
FT                   AVTPDYEHMRDAVEGQFVVVQDDHDDFFSGVRYQSPRLAGTGADPDAYAAIDALEGGLR
FT                   DLSAALDPLREQGGCPAPGEGGAGADDESGAPDEDEPQCRFHPGSNQCDATGSILH"
FT   gene            402690..404786
FT                   /locus_tag="Srot_0420"
FT   CDS_pept        402690..404786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0420"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.6.4.3"
FT                   /note="SMART: AAA ATPase; TIGRFAM: ATP-dependent
FT                   metalloprotease FtsH; KEGG: nfa:nfa3980 putative cell
FT                   division protein; PFAM: peptidase M41; AAA ATPase central
FT                   domain protein; peptidase M41 FtsH extracellular"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96907"
FT                   /db_xref="GOA:D6ZBT0"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBT0"
FT                   /inference="protein motif:TFAM:TIGR01241"
FT                   /protein_id="ADG96907.1"
FT                   /translation="MNRSALIRIVVIVAAALAIWRIFSYVSDDTRGFQQVDTSVAMKQL
FT                   DDPANVESAVLEDSEQRLRLKLKHASSDTGGKTDVYAAIPGGALDKVFEQLEQLRKANG
FT                   SAAKYNVVNNDPGFLSQALVLYGPILLIGVLFYFAITRMQNSPRGFGFGRSRAKQLSKD
FT                   VPKVTFADVAGADEAVEELYEIKDFLQNPARYQALGAKIPRGVLLFGPPGTGKTLLARA
FT                   VAGEAGVPFFTISGSDFVEMFVGVGASRVRDLFEQAKQASPCIIFVDEIDAVGRQRGAG
FT                   FGGGHDEREQTLNQLLVEMDGFSERQGVIVMAATNRPDILDPALLRPGRFDRQIPVGNP
FT                   DIAGRRAILAVHGKGKPIAPDADLEGLAKRTVGMSGADLANVLNEAALLTARENGQLIT
FT                   TAALEESVDRVIGGPRRKSRIISELEKKIVAYHESGHTLAGWAMPGLDPVYKVTILARG
FT                   RTGGHAVTVPEDDKGLATRSELIARLVMLLGGRAAEELVFHEPTTGASSDIDRATKVAR
FT                   TMVMEYGMSARLGAVRYGDEQEDPFLGRAMGQRSDYSHEVAKEIDAEVRDLIEAAHTEA
FT                   WAVLVEYRDQLDALATQLLEKETLHQKELEEILAGVQKRPKITAFDVFGDRAPSDRPPV
FT                   KTPRELAVERGEPWPPVPPHVPAHAAGQDQGPAPDAPSPSRVPAPASASLASGPRAAQP
FT                   HQAG"
FT   gene            404802..405395
FT                   /locus_tag="Srot_0421"
FT   CDS_pept        404802..405395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0421"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="TIGRFAM: GTP cyclohydrolase I; KEGG: gbr:Gbro_4016
FT                   GTP cyclohydrolase I; PFAM: GTP cyclohydrolase I/Nitrile
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96908"
FT                   /db_xref="GOA:D6ZBT1"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBT1"
FT                   /inference="protein motif:TFAM:TIGR00063"
FT                   /protein_id="ADG96908.1"
FT                   /translation="MESFEQTKSAFDDNRAEAAVRELLIAVGEDPDRPGLSRTPARVAK
FT                   LYRELFSGLEQNPEDVLGESFAADHDELVLVKDIRVQSVCEHHLLSFHGNAHVGYIPGV
FT                   GGSVVGFSALSRLVDLYARRPQIQERLTSQVADALMEHLRPRGVIVVVEAEHLCMQVRA
FT                   DRQQSARVTTSAVRGLLRTNPSSRAEALGFILRA"
FT   gene            405392..406249
FT                   /locus_tag="Srot_0422"
FT   CDS_pept        405392..406249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0422"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="TIGRFAM: dihydropteroate synthase; KEGG:
FT                   nml:Namu_0850 dihydropteroate synthase; PFAM:
FT                   dihydropteroate synthase DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96909"
FT                   /db_xref="GOA:D6ZBT2"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBT2"
FT                   /inference="protein motif:TFAM:TIGR01496"
FT                   /protein_id="ADG96909.1"
FT                   /translation="MTPALTIMGVLNCTPDSFSGDGLASAPRGAGEAAVRAGLRLVAEG
FT                   ADIVDVGGESTRPGAAQVDPSEQLERILPAVRGLAAAGVFVSVDTCAAAVARAALAQGA
FT                   RMVNDVAGGLCDPELLTAAAEAGAWLVLGHWPGAPARDHGYRPGGTTAALVAQELSERA
FT                   GAALAAGVARDRIILDPGLGFGKNTEENWALIRGVHELRATGFPVLIGASRKRFLGSGL
FT                   PLASGHAEADQAELVWREAGTTAVTALAATLGAWGVRVHAPRPNRAAARAAAEFTGEGA
FT                   HHHG"
FT   gene            406242..406631
FT                   /locus_tag="Srot_0423"
FT   CDS_pept        406242..406631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0423"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="KEGG: mva:Mvan_5369 dihydroneopterin aldolase;
FT                   TIGRFAM: dihydroneopterin aldolase; PFAM: dihydroneopterin
FT                   aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96910"
FT                   /db_xref="GOA:D6ZBT3"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBT3"
FT                   /inference="protein motif:TFAM:TIGR00525"
FT                   /protein_id="ADG96910.1"
FT                   /translation="MADRIELRGVSVWARHGYGDEEREADQEFLVDLTVWCDLAKAARS
FT                   DDLEDTLDYGALAVRAAQIVGGPPRKLIEGLAAEIAEDVMRDPRVYAVEAAVHKPKAPI
FT                   PVPFADVAVIARRSRRTGPAENSRL"
FT   gene            406776..407309
FT                   /locus_tag="Srot_0424"
FT   CDS_pept        406776..407309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0424"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="TIGRFAM:2-amino-4-hydroxy-6-
FT                   hydroxymethyldihydropter idinepyrophosphokinase; KEGG:
FT                   nfa:nfa4020 putative 2-amino-4-hydroxy-6-
FT                   hydroxymethyldihydropteridine pyrophosphokinase; PFAM:
FT                   78-dihydro-6-hydroxymethylpterin- pyrophosphokinase HPPK"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96911"
FT                   /db_xref="GOA:D6ZBT4"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBT4"
FT                   /inference="protein motif:TFAM:TIGR01498"
FT                   /protein_id="ADG96911.1"
FT                   /translation="MTTAVLSLGSNLGNRLGFLQLAVASLGDRVLAASSVYETDPWGTA
FT                   GPNFFNAVLMASDPALDARGWLDEAFRAEALAGRTRETVWGPRTLDVDVIACYDEDGAP
FT                   VVVDEPTLSVPHPRAHQRAFVLVPWLQVQPQARLAVGGEDISVRELIAQLAQAERASVR
FT                   HTPLTLSAFTAHVS"
FT   gene            407306..407779
FT                   /locus_tag="Srot_0425"
FT   CDS_pept        407306..407779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0425"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rop:ROP_43280 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96912"
FT                   /db_xref="GOA:D6ZBT5"
FT                   /db_xref="InterPro:IPR021517"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBT5"
FT                   /inference="similar to AA sequence:KEGG:ROP_43280"
FT                   /protein_id="ADG96912.1"
FT                   /translation="MNRDVIVGCVACVAVGALWALCGPGITTMPQRLSSAAPLMLLGLM
FT                   EAGLGSYLKSRVRGNRIGLGPGLTPPVFVARVGRLASATVFMGAAFAGFWGSLAVYSFL
FT                   RAHQLLAAERNLPADLFGVAGAATLVAGAFWSRRCCRAPGDGSAGSCAGGAAP"
FT   gene            407927..408613
FT                   /locus_tag="Srot_0426"
FT   CDS_pept        407927..408613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0426"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GI18025 gene product from transcript GI18025-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96913"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBT6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96913.1"
FT                   /translation="MAPGHAMADPDDDTTPATSTSAPATGDAPAADEAPATSGSPTTTS
FT                   SYNPYATSSSPKPSAEDQDEAAPTAEPGDEDEDAPARPSVSASPAPAPSPAPASPEASP
FT                   APKPTNPAQVKAAACTFSREVTAQVAKDTKQFNELAAVENASWSDEDLAAASESARAGY
FT                   QTALDKIRSTVPTSGYPSDITAALTDLAHAADDWIYLIDNQNGDMIQGAISEYNDAVGR
FT                   LRTTCQ"
FT   gene            408798..410156
FT                   /locus_tag="Srot_0427"
FT   CDS_pept        408798..410156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0427"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_0539 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96914"
FT                   /db_xref="GOA:D6ZBT7"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBT7"
FT                   /inference="similar to AA sequence:KEGG:MAB_0539"
FT                   /protein_id="ADG96914.1"
FT                   /translation="MTESVAPKRRKASRKGATLSVAYALCFVFAVGASVAVVYTGNDML
FT                   MRFGLVFALWAALGWAFIADQSRRKAELVSAKASDYKLIYDLQLEREIAARHHYELSLE
FT                   GELRRQLTAEADSATHSALAELQQQVALLRGQLQELLDQDLEYDQPALKARATRLDELL
FT                   VAKQSLAPTESQPRKRAAQAQDDAASPRLWLPSQPDQARREQPLVQEPSAPETVVEQEA
FT                   QGSGAQGKEAQEPAAEQWRHDEQQAAWPQQPEAWLQDQRRQPSSLQALVDPEPQERPAG
FT                   WQQPKAPPMAGMEPAAAAGQTVDYPSWYSQSEAAPSAVVEPQQQQQPGAAGQDAGKAPG
FT                   SGRHEQRDAEPQPRSEPSSGKAGKSKHADKADRAKPAESRGGRRAKPAAGEDSSVPAQE
FT                   QSAAADTLAAAHASGHSVNELLSRLSPDEAAGYHGRRRRARAQDAAVSDEDMR"
FT   gene            410236..411108
FT                   /locus_tag="Srot_0428"
FT   CDS_pept        410236..411108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0428"
FT                   /product="pantoate/beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /note="TIGRFAM: pantoate/beta-alanine ligase; KEGG:
FT                   svi:Svir_35550 pantothenate synthetase; PFAM:
FT                   Pantoate-beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96915"
FT                   /db_xref="GOA:D6ZBT8"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBT8"
FT                   /inference="protein motif:TFAM:TIGR00018"
FT                   /protein_id="ADG96915.1"
FT                   /translation="MSLGHTGPVLCHSPQQLRELADRLRAVGKHIALVPTMGALHHGHL
FT                   ALVEHAKRLPHATVVASVFVNPLQFGQGEDFERYPRPLAADLEALRQKKVRVVYTPAPA
FT                   AMYPLDGGGTQVVPGPLADELEGALRPGHFTGVLTVVMKLLAACGATWAVFGEKDYQQL
FT                   TLIRQMIRDLDLPVSAIGVPTVREEDGLALSSRNVYLSPHERQQAAGLSAALRAGAAEG
FT                   ERGPDAVLGAARATLEGYPGLAVDYLELRDPDLRQCPQRGPARLLVAARCGTTRLIDNM
FT                   PVSLGDGGR"
FT   gene            411108..411887
FT                   /locus_tag="Srot_0429"
FT   CDS_pept        411108..411887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0429"
FT                   /product="transcriptional activator, Baf family"
FT                   /note="KEGG: ami:Amir_0327 putative transcriptional
FT                   acitvator, Baf family; TIGRFAM: transcriptional activator,
FT                   Baf family; PFAM: Bvg accessory factor"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96916"
FT                   /db_xref="GOA:D6ZBT9"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBT9"
FT                   /inference="protein motif:TFAM:TIGR00671"
FT                   /protein_id="ADG96916.1"
FT                   /translation="MLLVLDIGNSNVSFGLYEGSGSAARLVGSWRAHTDPKLTGDEIYL
FT                   AAEGFLGEHIDRVDGVSALSTVPALLRELRLMIPRYFPGRRSLVVEPGVRTGVPLLVDN
FT                   PKGVGADRVVNALAAFQQCQSACVVVDAGTTTVVDAVSAKGEFLGGAIAPGMAISVDAL
FT                   SQWAATIPKVELVRPRSVIGKSTVESLQSGVLFGFAGQVDGLVRRMIGEIGEARVVLTG
FT                   GLAPLLVDELATPFAHEPALTLTGLRMVFERHIRSAR"
FT   gene            412032..412520
FT                   /locus_tag="Srot_0430"
FT   CDS_pept        412032..412520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0430"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa4100 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96917"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBU0"
FT                   /inference="similar to AA sequence:KEGG:nfa4100"
FT                   /protein_id="ADG96917.1"
FT                   /translation="MGAQLQRRKTTAVAFFPHTLPTSSAGPLASAALFPERLAAHDVPL
FT                   ALGRGAVLVDIRAQTARSRQGVLTGALAIDPFVLAARCAPGGEESLRRARDTAVWWVVV
FT                   SANGQSSLLAARRLRAAGLERVSDVVGGFAALRDARMALSASSAAHAKREQSTFAANL"
FT   gene            412542..414053
FT                   /locus_tag="Srot_0431"
FT   CDS_pept        412542..414053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0431"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="TIGRFAM: lysyl-tRNA synthetase; KEGG: rer:RER_06410
FT                   lysyl-tRNA synthetase; PFAM: tRNA synthetase class II (D K
FT                   and N); nucleic acid binding OB-fold tRNA/helicase-type"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96918"
FT                   /db_xref="GOA:D6ZBU1"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBU1"
FT                   /inference="protein motif:TFAM:TIGR00499"
FT                   /protein_id="ADG96918.1"
FT                   /translation="MTEQTSEDLDLPEQLRIRREKRDRVLARGEEPYPVELPVTHGLAQ
FT                   IREEFADIETGASTGVVVAVAGRVIFQRDAGKLLFATLQAGDGARLQAMVSLAGVGEEP
FT                   LALWKSDVDLGDIVFVRGEVVSSKRGELSVLADSWQFAAKALRPLPVAHKELSEEAQVR
FT                   QRYLDLIMRPEARSVARTRVAVLREMRCALERRGFLEVETPILQTIQGGASARPFIAHS
FT                   NALDIDFYLRIAPELFLKRCLVGGLDRVFEINRNFRNEGIDATHSPEFTMLEAYEAYGT
FT                   YDTVAALTRELVQEVAHAVFGSTELVLADGSVYDVGGDWAVLEMYPSLSDALGTEVDPQ
FT                   TRVGRLRELALKAGLAEEKINSLGHGKLVEELWEHLVGDHLRAPTFVRHFPAETSPLTR
FT                   QHRSIDGVVEKWDLYVRGFELATGYSELVDPVVQRERFQAQALLRSSGDGEAMPLDEDF
FT                   LAAMEHGMPPAGGLGLGVDRLMTAFTGLGIRDTVLFPITRPNSSA"
FT   gene            414341..414682
FT                   /locus_tag="Srot_0432"
FT   CDS_pept        414341..414682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0432"
FT                   /product="Lsr2"
FT                   /note="KEGG: mjl:Mjls_5143 Lsr2"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96919"
FT                   /db_xref="InterPro:IPR024412"
FT                   /db_xref="InterPro:IPR042254"
FT                   /db_xref="InterPro:IPR042261"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBU2"
FT                   /inference="similar to AA sequence:KEGG:Mjls_5143"
FT                   /protein_id="ADG96919.1"
FT                   /translation="MAKKVTVTIIDDVDGQSVAAETVSFGLDGVSYTIDLSDKNAKKLR
FT                   DVLEPWISSATKVGGRRKSGVSPAKVAAKVDKEQLGPIREWARANGYEVSPRGRVPQHI
FT                   IDAYNAKER"
FT   gene            414939..417467
FT                   /locus_tag="Srot_0433"
FT   CDS_pept        414939..417467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0433"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="KEGG: msm:MSMEG_6091 negative regulator of genetic
FT                   competence ClpC/MecB; PFAM: ATPase AAA-2 domain protein;
FT                   Clp domain protein; AAA ATPase central domain protein;
FT                   UvrB/UvrC protein; Clp ATPase-like; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96920"
FT                   /db_xref="GOA:D6ZBU3"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBU3"
FT                   /inference="protein motif:PFAM:PF07724"
FT                   /protein_id="ADG96920.1"
FT                   /translation="MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVA
FT                   AKSLESLGISLEAVRSQVEEIIGQGQQGPSVHIPFTPRAKKVLELSLREALQLGHNYIG
FT                   TEHILLGLIREGEGVAAQVLVKLGADLSRVRQQVIQLLSGYSGGGKEPEAAGAGGRGGE
FT                   AGTPSTSLVLDQFGRNLTRAALDGKLDPVIGREKEIERVMQVLSRRTKNNPVLIGEPGV
FT                   GKTAVVEGLAQAIVHGEVPETLKDKQLYTLDLGSLVAGSRYRGDFEERLKKVLKEINSR
FT                   GDIILFIDELHTLVGAGAAEGAIDAASILKPKLARGELQTIGATTLDEYRKYIEKDAAL
FT                   ERRFQPVQVGEPSVEHTIEILKGLRDRYEAHHRVSITDSALAAAASLADRYINDRFLPD
FT                   KAIDLIDEAGARMRIRRMTAPPDLREFDEKIANTRRQKESAIDEQDFEKAAGLRDTEKK
FT                   LVAQRAEREKQWRSGDMDVVAEVDEEEIAEVLANWTGIPVFKLTEEETARLLRMEDELH
FT                   KRIIGQRDAVAAVAKAIRRTRAGLKDPKRPSGSFIFAGPSGVGKTELSKALANFLFGED
FT                   DALIQIDMGEFHDRFTASRLFGAPPGYVGYEEGGQLTEKVRRKPFSVVLFDEIEKAHHE
FT                   IYNTLLQVLEDGRLTDGQGRTVDFKNTVLIFTSNLGTSDISKAVGLGFSSGEGNTSNYE
FT                   RMKQKVQDELKKHFRPEFLNRIDEIVVFHQLTNEEIVKMVDLMITRVAAALKAKDMEIE
FT                   LSAQAKGLLAKRGFDPVLGARPLRRTIQREIEDQLSEKILFGEFGAGQKVLVDVEGWDG
FT                   ESAGEDAKFVFRAAAAAEPVLAGAGEPAGE"
FT   gene            417521..418438
FT                   /locus_tag="Srot_0434"
FT   CDS_pept        417521..418438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0434"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mgi:Mflv_1435
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96921"
FT                   /db_xref="GOA:D6ZBU4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBU4"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADG96921.1"
FT                   /translation="MFDQAVASARIFEHKARHSGRSPGLGRTILLLHGLMGRGSTWFRH
FT                   VPWLQELGRVITYDAAWHQGRDVDGGSVATERFVAEAAAVLEAHADMPAVVIGHSMGGL
FT                   HAWCLAAARPDLVRALVVEDMAPDFRGRTLGPWEPWLRSWPVDFPDAASVDSLVGEVAG
FT                   RYFRESFDRLPGGGYRLHGHIDAWCAIAAQWGERDYWPEWEAVSAPALLIEATGGVTPE
FT                   GQMRAMAQRKRDQGGPLVRHAALDTGHLAHDTEPQACRQLVAAFLAQDVDRSGHDERHR
FT                   GERDHALRRHECFGPMGERHGVGR"
FT   gene            complement(418319..419077)
FT                   /locus_tag="Srot_0435"
FT   CDS_pept        complement(418319..419077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0435"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_2694 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96922"
FT                   /db_xref="GOA:D6ZBU5"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBU5"
FT                   /inference="similar to AA sequence:KEGG:MAB_2694"
FT                   /protein_id="ADG96922.1"
FT                   /translation="MSTADEEPGQRRPPHGARKAAGSTAHLAAELEEHTPSWLRPHNPE
FT                   NRLPVLAAMLVAVALQLAVADSYALHPRWLLFGLESVLLVVLIVLNPIRLTRHPKLSRA
FT                   FSIALVAGISVDNAVSSALLDENILTGRTGKDAVSLLGSGAAVYVTNIIAYGIWYWLLD
FT                   RGGPFARHEGRHPNPSFLFPQMTLGRLAPKNWVPRFFDYFYVSFTNATAFSPTDTMPLT
FT                   HWAKALMAAQSMVALATMALVVARAVNVLG"
FT   gene            419154..419573
FT                   /locus_tag="Srot_0436"
FT   CDS_pept        419154..419573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0436"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96923"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBU6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96923.1"
FT                   /translation="MAHDDVENPDADDTAARFEENMRAGEALQPADVRAAAARYRHLAD
FT                   GILDHFHNLAATADDCEEEVPEGLDDLQRKAEHLRGYADRLLDFADRAEEAKSVVARLR
FT                   GLPSAQLSEKDKHELAKSLRDLYEPLPQMFGLDEH"
FT   gene            419760..420581
FT                   /locus_tag="Srot_0437"
FT   CDS_pept        419760..420581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0437"
FT                   /product="high-affinity nickel-transporter"
FT                   /note="PFAM: high-affinity nickel-transporter; KEGG:
FT                   mab:MAB_1897c high-affinity nickel- transporter NicT"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96924"
FT                   /db_xref="GOA:D6ZBU7"
FT                   /db_xref="InterPro:IPR004688"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBU7"
FT                   /inference="protein motif:PFAM:PF03824"
FT                   /protein_id="ADG96924.1"
FT                   /translation="MLHFGVLVTALLLGVRHAFDGDHITAIDNVVRRLVAKGRSARTVG
FT                   TWFALGHSAVVFLMAVATVAGAKFAGSLLDEHSPARRALGLFGSLASVVFLLVLGLMNL
FT                   RVLVAAFQGRERQPGGWLLQRAQLVTQPWQMFFVGFLFGLGFDTASEIALLVLAGAAAA
FT                   SGASVWLALAIPVCFAAGMTFFDTLDGWLMGYAYRGALRDERAARWYNIAITGLSVFLA
FT                   LGVGTVELVGLIAGEDIVDLEHVGYVAVALFFALWAGWFLLAARRRNPVEL"
FT   gene            420583..421941
FT                   /locus_tag="Srot_0438"
FT   CDS_pept        420583..421941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0438"
FT                   /product="domain of unknown function DUF1731"
FT                   /note="PFAM: domain of unknown function DUF1731; NAD-
FT                   dependent epimerase/dehydratase; KEGG: sen:SACE_4096
FT                   nucleoside-diphosphate sugar epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96925"
FT                   /db_xref="GOA:D6ZBU8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBU8"
FT                   /inference="protein motif:PFAM:PF08338"
FT                   /protein_id="ADG96925.1"
FT                   /translation="MRYKVSSVVQAPPEEVFAWFAAPGAAQRLTPPWSGVRFEREADDL
FT                   ADGRAVLRLPLGARWTAEHDPAGFVPGRQFVDEASSFPVRQLTGGWRHVHTFTPVGDGA
FT                   TLVGDEVSSFAPGRVLRPVFAFRHRQLAGDLAALRRARAWRDAQAPPLTVAVTGSGGTV
FT                   GQALSALLTTSGHRVVKLVRRGPRHPGERRWDVDEPAADLLDGVDVVVHLAGESIAGRF
FT                   DAEHRRAVFDSRVGPTRKLAERVAGSKSTSALVCASAVGVYGADRGDLALDEDAERGDG
FT                   FLAEVVVAWESACAPAKEAGTRVAHIRTGVVQSGQGGVLRLLWPLFWLGLGGKLGDGAQ
FT                   WLAWIALDDLVDIYRRAVVDEDLRGPVNAVAPQPVRNAAYTKALADVLGRFAVLPVPKF
FT                   GPRLLLGAEGAAELAFASQRVVPARLQKLGHTFRYPAIREALAHELGRETPPE"
FT   gene            421938..423272
FT                   /locus_tag="Srot_0439"
FT   CDS_pept        421938..423272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0439"
FT                   /product="Deoxyribodipyrimidine photo-lyase"
FT                   /EC_number="4.1.99.3"
FT                   /note="KEGG: ami:Amir_0529 deoxyribodipyrimidine photo-
FT                   lyase; PFAM: DNA photolyase FAD-binding; DNA photolyase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96926"
FT                   /db_xref="GOA:D6ZBU9"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBU9"
FT                   /inference="protein motif:PRIAM:4.1.99.3"
FT                   /protein_id="ADG96926.1"
FT                   /translation="MSRPDLCWFRRDLRLADQPMLLEVAKEAVGLFVLDPRLTRGSGQA
FT                   RLDYLFSALAALDETLGGRLVVAEGDPARVVPDVARELNVGAVRCTEDFAPYGRARDAA
FT                   VAAALKAQGRELRPAGSPYAISPGRVRNGSGNPYRVFTPFRRAWSAHGWPRPAQTGADS
FT                   TRWLAAEVSCQTELPSPRLVREAGEQAAAARWTAFLEGALAGYAQNRDFPAVDGTSRLS
FT                   AHLKFGALHPRTLLRDIAAADADDTDKDVFVTELAWRDFYADVLSHHPRTAWHNVDRRF
FT                   DRFAWSDSQEHFAAWQRGETGYPIVDAGMRQLAAEGWMHNRVRMITASFLTKDLHLPWQ
FT                   WGARHFIRLLVDGDLASNSHGWQWTAGTGTDAAPYFRVFNPTAQGKKFDPGGEYIQRWV
FT                   PQLRDMPGPKAHEPNPRPAGYPPPIVDHAQERAEALLRYEAVKGR"
FT   gene            complement(423279..423791)
FT                   /locus_tag="Srot_0440"
FT   CDS_pept        complement(423279..423791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0440"
FT                   /product="TspO and MBR like protein"
FT                   /note="PFAM: TspO/MBR family protein; KEGG: mva:Mvan_0268
FT                   TspO and MBR like proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96927"
FT                   /db_xref="GOA:D6ZBV0"
FT                   /db_xref="InterPro:IPR004307"
FT                   /db_xref="InterPro:IPR038330"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBV0"
FT                   /inference="protein motif:PFAM:PF03073"
FT                   /protein_id="ADG96927.1"
FT                   /translation="MTPYTLLMNNASSDKRQDLLALTASALATTAVAGLGSAASVRARE
FT                   DYAKLRQPPWAPPGWVFGPVWTALYTMMTVAAWLVWREEPREGARPALRAYAVQLGLNA
FT                   IWSPLFFGLGKRGAAFVDIVLLWGAIVATVRLFARRSPLAAALLVPYLAWATFATALNW
FT                   SAWRLNK"
FT   gene            complement(423788..424735)
FT                   /locus_tag="Srot_0441"
FT   CDS_pept        complement(423788..424735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0441"
FT                   /product="HhH-GPD family protein"
FT                   /note="KEGG: fal:FRAAL6530 A/G-specific adenine
FT                   glycosylase; PFAM: HhH-GPD family protein; SMART: HhH-GPD
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96928"
FT                   /db_xref="GOA:D6ZBV1"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBV1"
FT                   /inference="protein motif:PFAM:PF00730"
FT                   /protein_id="ADG96928.1"
FT                   /translation="MISSAAHPSGFEFSDGGRWPQAAQALIRWFGEHARALPWREPGVT
FT                   PWGVLLSEIMLQQTQVDRVRPIWEEWVCRWPSPAALAAQPLAEALRAWGRLGYPRRAAR
FT                   LHEASRVIVAEHDGEVPDELDALLALPGVGAYTARAVLAFAFGQRAPVVDVNVRRVLCR
FT                   VRRGEADGPARAQDLPDTLALLPQDPAAASALSAALMELGQTVCLPHAPNCAACPVHPC
FT                   RWARAGKPAAPEPAARRAPRYAGSDRQARGALLAALRASAEPLRKAELDQAWLANPVQR
FT                   ERALRSLVEDGLVHVADGGRVALGAADGRANAAE"
FT   gene            424806..425420
FT                   /locus_tag="Srot_0442"
FT   CDS_pept        424806..425420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0442"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gbr:Gbro_0965 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96929"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBV2"
FT                   /inference="similar to AA sequence:KEGG:Gbro_0965"
FT                   /protein_id="ADG96929.1"
FT                   /translation="MRRRSLALGVGAIILVAIIAAVFVFARQGGAKPPVRSTALPSANA
FT                   SSSQSEPPAASSADAPPPPSPTLAQAGQLCSDDVLAVVVSADKATYNVGEQPKFKGVVT
FT                   NGSALPCQRDVGDGMQAFIVSTLDGSDRVWSSQDCAPTNGQSLQMLKPGQQVAFQATWT
FT                   GKTSSPGCQEERVDIQPGYYRVVAQLGQKVSAPATFNVVAP"
FT   gene            complement(425448..426863)
FT                   /locus_tag="Srot_0443"
FT   CDS_pept        complement(425448..426863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0443"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: kra:Krad_0603 DNA repair
FT                   protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96930"
FT                   /db_xref="GOA:D6ZBV3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBV3"
FT                   /inference="protein motif:SMART:SM00382"
FT                   /protein_id="ADG96930.1"
FT                   /translation="MARTSAQESRHRCGECGSIQVKWLGRCPRCGAWASLVPICETAEG
FT                   RAASVEPMTQILGSEALTRPTGVREFDRVLGKGLVAGSVVLLAGEPGVGKSTLLLETAK
FT                   QWALAGRRCLYVSGEESPAQARARAERIGAVHEKVLFTAETQLEAILASCVEHTPELVV
FT                   VDSVQMLRCAGEAPGAISQIQEAVRRFSALAKALDISVVLIGHVTKEGEIAGPRFLEHL
FT                   VDVVLTFAGEQHSRLRLLRGVKNRFGPSDEVGCFEQNEHGISGVADPGSFLIGRREHPV
FT                   AGSVATVVMHGRRPLLGEVQALVAPSSRGGKTVVSGLRSDRVAKIVGVLSARCGLDLRE
FT                   KDVYLSTVGGMSMHEPSADLAIALAIAGAAVGEALPLGLVVFGEVALTGEAVPVTATEQ
FT                   RLAEAARLGRKSAIVPAGGELGRDQKSATGLTLMTVSTTAMALAQLRGRKEASPAKNAI
FT                   AEQTRGEPLSAAV"
FT   gene            complement(426934..427506)
FT                   /locus_tag="Srot_0444"
FT   CDS_pept        complement(426934..427506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0444"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: car:cauri_2217 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96931"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBV4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96931.1"
FT                   /translation="MAVTTNQRRPLLALVAGLAAAAALCSCSAGWNTQTGSQLAAIDGT
FT                   SINSDLDGVGVRNAYIAVSGQEGSLSFVAVNPSIRLVRLSSVTVVYPSGKRQNLSALAN
FT                   KDIPAQGRLQVGPVPADASGIARADFAPSPSLDMAGEQLAPGLSVKIEFNVVAPPSHDP
FT                   DFPQEKRTSFQGPVPIIGKGESPAKKD"
FT   gene            427769..428257
FT                   /locus_tag="Srot_0445"
FT   CDS_pept        427769..428257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0445"
FT                   /product="transcriptional regulator, CarD family"
FT                   /note="PFAM: transcription factor CarD; KEGG: mmi:MMAR_5083
FT                   transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96932"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBV5"
FT                   /inference="protein motif:PFAM:PF02559"
FT                   /protein_id="ADG96932.1"
FT                   /translation="MNFKIGDTVVYPHHGAALVEAIEVRTIKGVEKEYLVLKVGHGDLT
FT                   VRVPAENAEYIGIRDVVSDEGLDKVFNVLRDVHTEEPTNWSRRYKANIEKLASGDVHKV
FT                   AEVVRDLWRREQGRGLSAGEKRLLAKARQVLVGELALAESSDDAKAEGLLDEVLAQAS"
FT   gene            428274..429482
FT                   /locus_tag="Srot_0446"
FT   CDS_pept        428274..429482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0446"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="KEGG: nml:Namu_0867 2-C-methyl-D-erythritol 4-
FT                   phosphate cytidylyltransferase; TIGRFAM:
FT                   2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase;
FT                   2C-methyl-D-erythritol 2,4- cyclodiphosphate synthase;
FT                   PFAM: MECDP-synthase; 4-diphosphocytidyl-2C-methyl-
FT                   D-erythritol synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96933"
FT                   /db_xref="GOA:D6ZBV6"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR026596"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBV6"
FT                   /inference="protein motif:TFAM:TIGR00453"
FT                   /protein_id="ADG96933.1"
FT                   /translation="MGKVAAIIVASGSGSRLGAVDEAGEPCPKAFVFVGGHSMLARSVS
FT                   AAWRSGIVDEVVAVVPADRTAQARSAVDPRTRLVSGGATRTESVRAGLSQIAAADVVLV
FT                   HDAARALAPAQLFRSVAEAVVAGHAAVVPAVGVADTVKEVGPDGSVVRTLDRSCLRGAQ
FT                   TPQGFAADVLRQAHRGAVARDGASELDDAGLAELAGARVTAVEGDPLAFKITTPEDLVL
FT                   AEALARTTRGGAVETLLPRVGSGVDVHPIELGRPCWVAGLLFPESDGCAGHSDGDVAAH
FT                   ALVDAVLSAAGLGDLGTVFGVDRPQMRGASGELLLTEARKLVEQAGFVIGNAVVQVVGN
FT                   TPRLGPRRVEAQELLSAILGAPVSVAATTTDGLGLTGRGEGRAAVANALVYPASPRNAK
FT                   IAG"
FT   gene            429479..430882
FT                   /locus_tag="Srot_0447"
FT   CDS_pept        429479..430882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0447"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="TIGRFAM: cysteinyl-tRNA synthetase; KEGG:
FT                   gbr:Gbro_0973 cysteinyl-tRNA synthetase; PFAM:
FT                   Cysteinyl-tRNA synthetase class Ia; Cysteinyl-tRNA
FT                   synthetase class Ia DALR"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96934"
FT                   /db_xref="GOA:D6ZBV7"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBV7"
FT                   /inference="protein motif:TFAM:TIGR00435"
FT                   /protein_id="ADG96934.1"
FT                   /translation="MTLRLYDTRTRVVREFAPLRPGQVSVYLCGATVQGKPHVGHLRSA
FT                   VVFDVLRRWLLAKGFDVLFIRNVTDIDDKILAKAAEAGRPWWEWAATHEREFSNAYNRL
FT                   GVLPPSAEPRATGHITQMTTCIERLIERGHAYTGAGDVYFDVRSLPEYGKLSGHQPDDV
FT                   HQGESAGAGKRDPRDFTLWKGSKPGEPWWPTPWGPGRPGWHLECTAMATAYLGSEFDIH
FT                   CGGMDLVFPHHENELAQAHGAGDQFARFWLHNGWLSLGGEKMSKSLGNVLSLEELLTAV
FT                   RPQELRYYLGCAHYRSTQEFSIEAVVEAAVAYQRLESFVLRAAEQFGEIPVGQVADEFA
FT                   SALDDDLAVPKALAELQRQAKQGNTELADADPAAAATAASVRAMLAVLGCDPFDPMWAS
FT                   GREREEKAAFRAVDVLVEAELSRREAARAGKDWATADDVRDRLRKAGIIVTDGPDGPKW
FT                   SLETNGGQP"
FT   gene            430882..431772
FT                   /locus_tag="Srot_0448"
FT   CDS_pept        430882..431772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0448"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="KEGG: mjl:Mjls_5122 RNA methyltransferase; TIGRFAM:
FT                   RNA methyltransferase, TrmH family, group 3; PFAM:
FT                   tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
FT                   methyltransferase substrate binding"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96935"
FT                   /db_xref="GOA:D6ZBV8"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBV8"
FT                   /inference="protein motif:TFAM:TIGR00186"
FT                   /protein_id="ADG96935.1"
FT                   /translation="MAPGPRRRGLRGKGPTPPATARTGHPAARRAAAQEAAKTRARAVR
FT                   QAADAPEWVLGRNPVLECLRAKVPAVELLVASGIDADERVAESVRIAGNVGVPVTEVAR
FT                   FELDRRSSGAPHQGIGLRVRPYEYHHPEDLLTEAENSGRPALFVALDHISDPRNLGAVV
FT                   RSAAAFGGHGVLIPNRRSASLTAIAWRTSAGAAARLPVAQAPNLARSLKQWQERGLLLV
FT                   GLDAEGDTSLDDFTGTEPLALVVGSEGKGLSRLVRESCDFVVSIPMSGQVESLNVSVAT
FT                   GVVLGEIARQRRNAR"
FT   gene            complement(431859..433121)
FT                   /locus_tag="Srot_0449"
FT   CDS_pept        complement(431859..433121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0449"
FT                   /product="phosphoribosylamine/glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="TIGRFAM: phosphoribosylamine/glycine ligase; KEGG:
FT                   rop:ROP_48670 phosphoribosylamine--glycine ligase; PFAM:
FT                   Phosphoribosylglycinamide synthetase, ATP- grasp (A)
FT                   domain; Phosphoribosylglycinamide synthetase, N- domain;
FT                   Phosphoribosylglycinamide synthetase, C-domain"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96936"
FT                   /db_xref="GOA:D6ZBV9"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBV9"
FT                   /inference="protein motif:TFAM:TIGR00877"
FT                   /protein_id="ADG96936.1"
FT                   /translation="MRVLVIGSGGREHAFCIALKRDPAVSEIHAAPGNAGTARLAVNHT
FT                   VDVADPASVAHLAEQLEADLVIVGPEVPLVLGAADAVRAKGIACFGPSAQAAQIEGSKS
FT                   FAKDVMAAAGVRTARSETVDSTASLDAALDRFGPIWVVKDDRLAAGKGVVVTEDRAHAR
FT                   AHAVELLERGHPVLLESYLDGPEVSLFCLVNGDQVTPLQPAQDFKRAYSGDMGPNTGGM
FT                   GAYTPLPWLSQQTVDEIVDDIVCPVAVELLRRGCAYSGLLYAGLAIGSDGPAVVEFNCR
FT                   FGDPETQPVLALLRTPFGQLLRSVADGTFLETSELSWEPGYAVGVVLAAEHYPAKPHLG
FT                   DTITGALGEGLVLAGVDERDGALVSTGGRVLTAVGLGRDLTAARAQAYERMGGVHLPGG
FT                   HFREDIALAASNGEVTIPAKR"
FT   gene            433259..433672
FT                   /locus_tag="Srot_0450"
FT   CDS_pept        433259..433672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0450"
FT                   /product="histidine triad (HIT) protein"
FT                   /note="PFAM: histidine triad (HIT) protein; KEGG:
FT                   rer:RER_10000 HIT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96937"
FT                   /db_xref="GOA:D6ZBW0"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBW0"
FT                   /inference="protein motif:PFAM:PF01230"
FT                   /protein_id="ADG96937.1"
FT                   /translation="MPSVFSAVIAGDLPGYFVWQDEDVVAFLSNAPISTGHTLVVPRQE
FT                   VDNWQSVDPELFGKVMRVAQIIGQAVTTAFGAPRAGQLIAGFEVPHLHVHVFPAWGLGD
FT                   FSFANADHAATAEQFEAAAQKIRAALAGESNSG"
FT   gene            433812..434297
FT                   /locus_tag="Srot_0451"
FT   CDS_pept        433812..434297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0451"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: maq:Maqu_2040 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96938"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBW1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96938.1"
FT                   /translation="MLVVAIAVLGHRMWFPSAEPRTSNRDFEQAKANVIRVTAWVAGVA
FT                   RDAEGRGSKQGCRAGTLGEGPPWLWSQEYDLPYSEQTAHDLTARLRQLRDEGWSYVETK
FT                   PELEQVHTKLGVQVSNSEQVSIDAWRSSKVNIEDDAKAGVAPQQHTMSIIGLSECTN"
FT   gene            434362..435141
FT                   /locus_tag="Srot_0452"
FT   CDS_pept        434362..435141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0452"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hsm:HSM_1237 carbohydrate kinase FGGY"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96939"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBW2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96939.1"
FT                   /translation="MSATPEHPSRSKSNEYHFDIHGKPIDASWWATLQAMGAQYSLICR
FT                   SVVRGWLVTTEWTGKEWYLPKQGLPRIFRTNVHDPKGQNQYSAHWGSREEAADGHASVE
FT                   DMILRALRLAVEGPGDWDLDDEEAPDEEPRQIDGYYDIEGRLLTYEQFRALRALGSWYS
FT                   DVAPRERLYGWTVETMWTGWDRQEEDHPDERPMVVTTEVDCDYKHFARGGWPDANSARV
FT                   GHVQIRGLVGQFALGQLSREEMLVCFDALWTPRPRGG"
FT   gene            complement(435138..435926)
FT                   /locus_tag="Srot_0453"
FT   CDS_pept        complement(435138..435926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0453"
FT                   /product="tryptophan synthase, alpha subunit"
FT                   /EC_number="4.2.1.20"
FT                   /note="TIGRFAM: tryptophan synthase, alpha subunit; KEGG:
FT                   rer:RER_33520 tryptophan synthase alpha chain; PFAM:
FT                   tryptophan synthase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96940"
FT                   /db_xref="GOA:D6ZBW3"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBW3"
FT                   /inference="protein motif:TFAM:TIGR00262"
FT                   /protein_id="ADG96940.1"
FT                   /translation="MSVPNSSADVIAACQAEGRAALIGYLPAGYPDLKTSQRAFEILAE
FT                   EGCDLLEIGVPYSDPVMDGPVIESAAVAALTAGFRLKDLFPLVENLSKKDIPALVMTYW
FT                   NPVFRYGVDRFADDLENAGGLGLITPNLIPEEAEAWFQASDRLNLDRVFLVAPSSTPER
FT                   LILTTNSCRGFIYAASTMGVTGARNDVSMDAAELVARVRKASGIAVGVGIGVSNGAAAR
FT                   YVAGYADAVIVGSALVAALGKGEDALRALVRELAEGVRGN"
FT   gene            complement(436007..437251)
FT                   /locus_tag="Srot_0454"
FT   CDS_pept        complement(436007..437251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0454"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /note="KEGG: mmi:MMAR_2414 tryptophan synthase subunit
FT                   beta; TIGRFAM: tryptophan synthase, beta subunit; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96941"
FT                   /db_xref="GOA:D6ZBW4"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBW4"
FT                   /inference="protein motif:TFAM:TIGR00263"
FT                   /protein_id="ADG96941.1"
FT                   /translation="MSPAQPLPTASEGVRVRTEHDPDAGGYFGRFGGRHVPEALMAVIE
FT                   EVTDAYEKARVDEDYLAQLDALQRDYVGRPSPLYEAKRLSEHAGGARILLKREDLNHTG
FT                   SHKINNVLGQGLLAKKMGKTRVIAETGAGQHGVATATACALLGLECVIYMGETDTERQS
FT                   LNVARMRLLGAHVMAVKTGSRTLKDAINAALRDWVTNAATTYYCFGTAAGPHPFPMMVR
FT                   DLQRVVGLETRAQVREHVGQLPDAVVACVGGGSNAIGIFDPFLRYRQVQLVGCEPAGDG
FT                   VDTERHAATLGGGSEGVFQGSFSYLLQDQDGQTVESHSISAGLDYPGVGPQHAHLKETG
FT                   RARYLPITDAQAMEAFDVLCRTEGIIPAIESAHAVAGGLLLGRELGGGSVIVVNLSGRG
FT                   DKDVDTAAKWFGMDL"
FT   gene            complement(437248..438063)
FT                   /locus_tag="Srot_0455"
FT   CDS_pept        complement(437248..438063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0455"
FT                   /product="Indole-3-glycerol-phosphate synthase"
FT                   /EC_number="4.1.1.48"
FT                   /note="KEGG: nfa:nfa18600 indole-3-glycerol-phosphate
FT                   synthase; PFAM: Indole-3-glycerol phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96942"
FT                   /db_xref="GOA:D6ZBW5"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBW5"
FT                   /inference="protein motif:PRIAM:4.1.1.48"
FT                   /protein_id="ADG96942.1"
FT                   /translation="MSHTVLETIIAGVREDVAAREAAKDFAHIKRAAHAAPDPLDAAAA
FT                   LREAGVGVIAEIKRASPSKGALADIPSPADLARLYQEGGARAVSVLTEERKFKGSLADL
FT                   DEVRAAVSIPVLRKDFIVTTYQVHEARAHGADIVLLIVAALEQNALSSLLDRVESLGMT
FT                   ALVEVHDEQEAERALAAGASVIGVNARNLKTLEVDPETFARVVPALPAEVIKIAESGCK
FT                   SSADLLNYAAAGADAVLVGEGIVTAADPLAALTELVTAGTHPSCPRPVR"
FT   gene            complement(438139..438702)
FT                   /locus_tag="Srot_0456"
FT   CDS_pept        complement(438139..438702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0456"
FT                   /product="Trp biosynthesis associated, transmembrane
FT                   protein, Oprn/Chp"
FT                   /note="PFAM: Trp biosynthesis associated, transmembrane
FT                   protein, Oprn/Chp; KEGG: rop:ROP_07410 hypothetical
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96943"
FT                   /db_xref="GOA:D6ZBW6"
FT                   /db_xref="InterPro:IPR019051"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBW6"
FT                   /inference="protein motif:PFAM:PF09534"
FT                   /protein_id="ADG96943.1"
FT                   /translation="MKRPLAWASLLLVCAGAGAYGSSRATWAVASAHDGLGAPRDVRVL
FT                   GSDFAPLTIALALLLIAAVPAVFAVKGWTLRAVALAVGLAGAGLVWAGAHWLADKPDSA
FT                   QAARLAALPERYQVDHLVVSRTSGGLPLAAGAMALGACVFILRAARAAQGLGSRFDSPA
FT                   AKKDRPEVERSAWAALDAGEDPTL"
FT   gene            complement(438740..440305)
FT                   /locus_tag="Srot_0457"
FT   CDS_pept        complement(438740..440305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0457"
FT                   /product="anthranilate synthase component I"
FT                   /EC_number="4.1.3.27"
FT                   /note="TIGRFAM: anthranilate synthase component I; KEGG:
FT                   nfa:nfa18580 anthranilate synthase component I; PFAM:
FT                   Chorismate binding-like; Anthranilate synthase component I
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96944"
FT                   /db_xref="GOA:D6ZBW7"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBW7"
FT                   /inference="protein motif:TFAM:TIGR00564"
FT                   /protein_id="ADG96944.1"
FT                   /translation="MTVRALTGNAPSNTTTRAEFEALAQGRRVVPVARRLLADAETPVS
FT                   AFRKLAGERAGTFLLESAEQGKMWSQWSFIGVRTGATLTSAGERAVWRGTPPAGVPVEG
FT                   SPLAVLDQTVRALATDPVPGLPPLTSGLVGYLGYDAVRWVEQLPERTHDDLRLPTMTML
FT                   LVTDLAVFDHRANVITLIANAFLPASSATAPDQAGLDALYAEALARLDAMTADLAAHAP
FT                   STVSVFDWPTPDFSSQLTEEEYGQNVRKVVAEIEAGEAFQVVPSQRYSMPVHADPLDVY
FT                   RVLRVNNPSSHMYLMRVPAETGETAFHIVGSSPEALLTARGRTVTTRPIAGTQPRGRTN
FT                   EDDVLFEKKLTDDPKEQAEHLMLVDLGRNDLGRVCVPGSVRVAEFRVLERYSHVMHLVS
FT                   TVSGELAPGKTALDAVLACFPAGTLSGAPKVRAMEIIEEVEITRRGLYGGVVGYFDFAG
FT                   EADTAIAIRTAVVKDGVAYVQAGGGVVLDSDPSSEYRESRNKANTVLSAIAAAQTMRSP
FT                   NEAG"
FT   gene            440369..440836
FT                   /locus_tag="Srot_0458"
FT   CDS_pept        440369..440836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0458"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; KEGG: nfa:nfa18570 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96945"
FT                   /db_xref="GOA:D6ZBW8"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBW8"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /protein_id="ADG96945.1"
FT                   /translation="MALQVGDVVQDFELPDQTGAPRKLSEFLALGPVVVFFYPKASSPV
FT                   CTAQACQFRDLGAQFRELGAQRVGISKDSVSGQAGFVSGKSLDFPLLSDKAGVAAALFG
FT                   VKGGLGGLSPVKRSTFVLDQTGKVLKAIHHEFRGKAHADEALAFLQSVVAS"
FT   gene            440833..441099
FT                   /locus_tag="Srot_0459"
FT   CDS_pept        440833..441099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0459"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; K11294 nucleolin"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96946"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBW9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96946.1"
FT                   /translation="MSGIARASSITGSALLAACAAVLALGGLAEPSPVPVPPVPPAGVG
FT                   EPAGPAPKGTVPVLQGNAQSDSDDDDDDANPPESSAPTVQPQS"
FT   gene            441213..441458
FT                   /locus_tag="Srot_0460"
FT   CDS_pept        441213..441458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0460"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: chl:Chy400_3363 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96947"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBX0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96947.1"
FT                   /translation="MKKAAHVPVLVLSAFALTFAGLVKHEPVPVPPVPPAGGEDHGGAV
FT                   PDDTRPYIPRDDDDDDGDDDDSDRVEPSAPVIPPQS"
FT   gene            441536..441847
FT                   /locus_tag="Srot_0461"
FT   CDS_pept        441536..441847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0461"
FT                   /product="translation initiation factor IF-2"
FT                   /note="KEGG: rer:RER_26320 translation initiation factor
FT                   IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96948"
FT                   /db_xref="GOA:D6ZBX1"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBX1"
FT                   /inference="similar to AA sequence:KEGG:RER_26320"
FT                   /protein_id="ADG96948.1"
FT                   /translation="MFPASARRQKRLSAAVLALAAFGMVVTGGMSAAAASGGGYGPIPV
FT                   PVHPMPQSPPAGASPKAFHPVPAPHGTIPKPAPGSRSPRPAAPTVAPGAGVDDSDDDS"
FT   gene            442001..442774
FT                   /locus_tag="Srot_0462"
FT   CDS_pept        442001..442774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0462"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   mab:MAB_3165c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96949"
FT                   /db_xref="GOA:D6ZBX2"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="InterPro:IPR041280"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBX2"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ADG96949.1"
FT                   /translation="MRKIFQRALVGAYAAVVAITAPAVAPAATASAASGVPAAAAGVVS
FT                   VSPAEGETVGVAFPVTVRFAAPVADRAAAQQSVTFSTSGPHTPEGSFRWLDDATMRWTP
FT                   TGYWPSHETVTVVAAGFPRKFRTGAQVLAVASISAHTFTVKIDGKVVKTMPASMGRPKH
FT                   PTPVGSFTTLEKQNPVVMDSRTIGIPLNSPEGYKLTVYDAVRLTWGGVYVHAAPWSAAS
FT                   QGKANVSHGCINLSTDNAAWYYNTVGIGDPVIIQA"
FT   gene            complement(442802..443509)
FT                   /locus_tag="Srot_0463"
FT   CDS_pept        complement(442802..443509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0463"
FT                   /product="6-phosphogluconolactonase"
FT                   /note="KEGG: rer:RER_30410 6-phosphogluconolactonase;
FT                   TIGRFAM: 6-phosphogluconolactonase; PFAM:
FT                   glucosamine/galactosamine-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96950"
FT                   /db_xref="GOA:D6ZBX3"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR039104"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBX3"
FT                   /inference="protein motif:TFAM:TIGR01198"
FT                   /protein_id="ADG96950.1"
FT                   /translation="MSTVEIVRSTDLHDLIAAAKERFLALVGEAIAERGTASAVLTGGG
FT                   AGIGLLKALRWADLAWDKIDLFWGDERWVPLGHPERNEGQAREALLDHVPVDPARVFPM
FT                   GAPGGDWPTPEAAAQAYAELLPATFDVHLLGMGEEGHINSIFPNSPAVRETERPVLAVL
FT                   DSPKPPPERITLTLPAIRRAREVWLLVSGAGKAAAAKAALGAAAPERVPSAGASGSERT
FT                   VWFLDEAAASQLD"
FT   gene            complement(443506..444429)
FT                   /locus_tag="Srot_0464"
FT   CDS_pept        complement(443506..444429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0464"
FT                   /product="Glucose-6-phosphate dehydrogenase subunit"
FT                   /note="PFAM: Glucose-6-phosphate dehydrogenase subunit;
FT                   KEGG: rer:RER_30420 OxPP cycle protein OpcA"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96951"
FT                   /db_xref="InterPro:IPR004555"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBX4"
FT                   /inference="protein motif:PFAM:PF10128"
FT                   /protein_id="ADG96951.1"
FT                   /translation="MSIIDLPATTTEKISKRLVALRTATGNPAVSRVLTLVVCVEDGED
FT                   VELAISAAGTANREHPCRVIIVAKGQRYAATRLDAQIRVGGDAGASEVVVLRLYGPLAD
FT                   HGDSVVIPFLLPDTPVVAWWPGLAPEVPAEDPIGALASRRVTNSITAADAAASLAKLVH
FT                   GYAPGDTDLVWARATPIRSILTASLDEPNYEPVTEAVVLGPEPSITLDLVAGWLAARLA
FT                   VPVRRGAGSLEISLHRHGGTLSLTQDRRGNGRVVRPGRPESAVSLFHQDVPALLAQELR
FT                   FMDPDEVYEQALQGFGSVTKDEEAAA"
FT   gene            complement(444584..446131)
FT                   /locus_tag="Srot_0465"
FT   CDS_pept        complement(444584..446131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0465"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /note="TIGRFAM: glucose-6-phosphate 1-dehydrogenase; KEGG:
FT                   msm:MSMEG_3101 glucose-6-phosphate 1- dehydrogenase; PFAM:
FT                   glucose-6-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96952"
FT                   /db_xref="GOA:D6ZBX5"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBX5"
FT                   /inference="protein motif:TFAM:TIGR00871"
FT                   /protein_id="ADG96952.1"
FT                   /translation="MTKAALPPAGWTNPLRDERDKRMPRIAGPCGLVVFGVTGDLSRHK
FT                   LMPAVYDLANRGLLSPSFSLVGFGRRDWDDAGFADFVRDCVQAKARTPFREETFARLAQ
FT                   GMRFVQGAFDEDASFERIADALRGLDEDRGTGGNYAFYLSVPPKDFPVVFKHLSATGLA
FT                   HPPEGSWRRAVVEKPFGHDLESAIELNGVIKEVFDERSIFRIDHYLGKETVQNILALRF
FT                   ANQLFEPIWNAHYVDHVQITMAEDIGLGGRAGYYDGIGAARDVIQNHLLQLLALVAMEE
FT                   PVSFAAHEVTTEKTKVLSAAKLSYPLDETTARGQYARGWQGGQEVCGLLEEEGFASDST
FT                   TETFAAITVEVDSRRWAGVPFYLRTGKRLGRRVTEIALVFKRAPHLPFDEAMTEELGQN
FT                   ALVIRVQPDEGVTLRFGSKVPGSAMRVRDVNMDFNYGQAFTESSPEAYERLILDVLLGE
FT                   PSLFPVTDEVELSWKILDPVLEHWGAGGAPEQYPSGGWGPKSATEMLARSGRTWRRP"
FT   gene            complement(446128..447249)
FT                   /locus_tag="Srot_0466"
FT   CDS_pept        complement(446128..447249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0466"
FT                   /product="transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /note="TIGRFAM: transaldolase; KEGG: mab:MAB_2760
FT                   transaldolase; PFAM: Transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96953"
FT                   /db_xref="GOA:D6ZBX6"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004732"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBX6"
FT                   /inference="protein motif:TFAM:TIGR00876"
FT                   /protein_id="ADG96953.1"
FT                   /translation="MSGQQNANLKALSEAGVSVWLDDLSRDRLRTGNLAELIATRSVVG
FT                   VTTNPTIFQGALSKGEAYEAQISEIVARGADVEAVITALTTDDVRAACDVFAPVYERSG
FT                   GVDGRVSIEVDPRLAHDTEGTVAQALELWKIVDRPNLLVKIPATKAGLPAITRVIAEGV
FT                   SVNVTLIFSIERHSAVIDAYIAGVQAAAAAGRDLSKIHSVASFFISRVDSEVDERLGKV
FT                   GTDAAKALLGKAALANGVLAYELYQQKFSSDEFAELKAAGANPQRALWASTGTKNPNYP
FT                   DTLYVSDLVAPNTVNTMPEKTLEAFADHGEVRLHSVVGKVQNAHDVFDQLAEAGVDMDD
FT                   VFEVLETQGVEKFIASWQELLDATAEKLNGLRG"
FT   gene            complement(447287..449431)
FT                   /locus_tag="Srot_0467"
FT   CDS_pept        complement(447287..449431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0467"
FT                   /product="transketolase"
FT                   /note="KEGG: mab:MAB_2759 transketolase; TIGRFAM:
FT                   transketolase; PFAM: Transketolase domain protein;
FT                   Transketolase central region"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96954"
FT                   /db_xref="GOA:D6ZBX7"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBX7"
FT                   /inference="protein motif:TFAM:TIGR00232"
FT                   /protein_id="ADG96954.1"
FT                   /translation="MSATAQDTANAADPALIAKHTRAAYPADWTDLDTRAVNTVRVLAA
FT                   DAVQKVGNGHPGTAMSLAPLAYTLFQRVLRHDPNDADWVGRDRFVLSCGHASLFLYIQL
FT                   YLGGFGLELDDIEQLRVFGSLTPGHPEYRHTKGVEITTGPLGQGLAHAVGMAYAARRER
FT                   GLFDPDAPAGQSPFDHHIYVVASDGDLQEGVTSEASSLAGTQQLGNLVVVYDRNHISIE
FT                   DNTAIAFDEDVAKRYEAYGWHVQHVDSGEDVVAIEAALEAAKAETARPSIIILRTIIGY
FT                   PAPKLQNTGAVHGAALGDEEVAAVKEQLGFDPEQKFQVDPEVMQRTRRLRERGAKAHQA
FT                   WDQQFEAWAAREPERKQLFDRVFANQLPKGLADALPKWQVGDKDVATRKASGDTLEALG
FT                   PLLPELWGGSADLAGSNNTTIKGSDSFGPSGISTEAWKAQPYGRTLHFGIREHAMAAIL
FT                   GGITLHGPTRAYGGTFLQFSDYMRPAVRLAALMEIDPIYIWTHDSIGLGEDGPTHQPVE
FT                   HLAALRAIPHLNVVRPADANETAFAWLALLDREQLGLSKLHGPTGLILSRQNLPILPGT
FT                   SAEGVAKGAYVLQEAEATEPQVVLIGTGSELQLAVEARKELESRGVGARVVSAPCVEWF
FT                   EAQSQQYRDQVLPPAVKARVAVEAGIALTWHRHVGDAGEIVSIEHYGASGDWKTLFREF
FT                   GFTSQAVVDAATRSLEKAKS"
FT   gene            449705..450661
FT                   /locus_tag="Srot_0468"
FT   CDS_pept        449705..450661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0468"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /note="KEGG: nfa:nfa35720 protoheme IX farnesyltransferase;
FT                   TIGRFAM: protoheme IX farnesyltransferase; PFAM: UbiA
FT                   prenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96955"
FT                   /db_xref="GOA:D6ZBX8"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBX8"
FT                   /inference="protein motif:TFAM:TIGR01473"
FT                   /protein_id="ADG96955.1"
FT                   /translation="MPVSADPVERGVSAPSLGAGRVLALARDYLALTKPRVIELLLVAT
FT                   IPVMLLAHRGTVDLRLILETLFGGWLGAASANTLNCVVDADIDKVMDRTKNRPLARGAM
FT                   SRRAALLFGLGLGSASFLWLWRSANLLAASLVVATIAFYVLVYSMFLKRRTSQNVVWGG
FT                   AAGCMPALVGWAAVTGSLDWPALVVFMVIFFWTPPHTWSLAMKYRDDYSTAGVPMLPTV
FT                   ADERLVAKRMVWYTWATVLTTFALIPVVGLLYAGVAIAAGSWFLYEAHRLSAGLAAGRP
FT                   VTPFRLFLQSNNYLAAVFVGLAVDSALAWPTVASLLS"
FT   gene            450812..452692
FT                   /locus_tag="Srot_0469"
FT   CDS_pept        450812..452692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0469"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   rop:ROP_64530 putative acid--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96956"
FT                   /db_xref="GOA:D6ZBX9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBX9"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADG96956.1"
FT                   /translation="MKKGLVQVSATSKVRSLIDLAKDVAVAAAVGVRAGMIPLLPVPRP
FT                   DYALRLVKGIDTVGPVAAAVVANAAFTPDKTALIDEHGSLTWKEVNEQANALARGWAAQ
FT                   GLKAGDSIGSISRNHRGLVLTMVAAGKIGVKVLLLNTGFAAPQLIDVMAREGAKAIAFD
FT                   SEFAGIIHRLPPEVLRTLVWEGGEDPAATAGLPTAESVSAGHSRENLPKPECLGGFTLL
FT                   TSGTTGTPKGAPRGKVNPIGSAQFLHRVPLRGGQRFLATAPLFHGTGLSQFILALVLRH
FT                   TVILQRRFNPEQTLQLIERHKAQVLVVVPTMLQRIIDLPKETLDKYDVSSIQVVFAAGS
FT                   ALSPDLSTRIMDHFGDTLYNLYGSTEVAVATVAQPWEMRAAPGTAGRPPVGVKLALLDE
FT                   HGKRITEPFKEGRIFVRSMLSFNGYTDGRNKEIIDGLMSSGDVGHFDDLGLLYVDGRDD
FT                   DMIVSGGENVFPQEVEHLLTEHPEVFEVCVIGVDDDEFGKRLKAYVAKAEGSGLDAEGV
FT                   QAHVKAHLARYKVPKEVVFVDKLPRNETGKVLRRMLLDEHNKAVSCAKEAAEKQSAPSA
FT                   TAARETVERTAQAMQSGPSALPAQDATPAQQEAAAGGSVPTQSASAAQQG"
FT   gene            452689..453690
FT                   /locus_tag="Srot_0470"
FT   CDS_pept        452689..453690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0470"
FT                   /product="DNA polymerase III delta"
FT                   /note="PFAM: DNA polymerase III delta; KEGG:
FT                   rha:RHA1_ro01286 DNA polymerase III delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96957"
FT                   /db_xref="GOA:D6ZBY0"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBY0"
FT                   /inference="protein motif:PFAM:PF06144"
FT                   /protein_id="ADG96957.1"
FT                   /translation="MTKGLHLVLGDEPLLVERAVASVLREARAHDGFVGGGVAAPVISR
FT                   LRAGDATADLLAELTSASLFAEQRVLVLEEAQQAGADPCARILDLAREQDESVTVVVCH
FT                   SGAARNRPLVNSLRELGAQTHACAKLTRAGDRLDFVRAEFREHGVRVPPAAAQALLESV
FT                   GSDLRELARACSQLASDTGGVVNVEAVRQYFQGKAEVSGFDIADLALGGETAGALAAAR
FT                   WALTSGVAPVLIADALAESALSLARVAAAGRASPEALASSLGMPPWRAKKTQGHWRIWS
FT                   SGGNDEQSALRRVDRALRLVAELNADVKGAAADIDFAVESAVRQIAGLARSG"
FT   gene            complement(453687..454106)
FT                   /locus_tag="Srot_0471"
FT   CDS_pept        complement(453687..454106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0471"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   rha:RHA1_ro01573 thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96958"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBY1"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ADG96958.1"
FT                   /translation="MSDAPAFTTRWPVPTRWADNDHYGHVNNVAYYSYFDTAVNAWLMS
FT                   ETGMDTRELQAIGVVAETSCRYLRQLSFPDQLEVGIACERLGERSVVYRLAVFTAGDDE
FT                   PAALGRFAHVYVDAVTRTPVPVPEPVRQAVRRLGS"
FT   gene            complement(454103..455242)
FT                   /locus_tag="Srot_0472"
FT   CDS_pept        complement(454103..455242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0472"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   mab:MAB_0983c zinc-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96959"
FT                   /db_xref="GOA:D6ZBY2"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBY2"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ADG96959.1"
FT                   /translation="MKTLAAVLRHEREPQPYAVSKPLALEEVDLAEPGPHELLVRIEAA
FT                   GVCHSDLSVINGHRPRPLPMALGHEAAGVVAAVGPDVRDVREGDHVVLVFMPSCGRCPA
FT                   CARRQPTLCAAAAKANSAGSLLSGGRRITDAIGGSLHHHLGVSGFAQHAVVDRSSAVVV
FT                   DRDLPMDIAALFGCAMLTGFGAVRNTAAVAPGESVAVIGLGGVGLAAVLGAKAAQAAPV
FT                   IAIDPVPAKRELALQLGATHAAAPQDAAAVVADATGGLGVRWAFEAAGKAAVMRQAFEL
FT                   AGRGGAAVFIGLPPSTEELALPAVSFVGESKSAIGSYMGSADPQQDVPALIGLWRDGAL
FT                   PVEKLKSHTLALADLNEAMDRLADGSAVRQVILPHGRGA"
FT   gene            complement(455282..455548)
FT                   /locus_tag="Srot_0473"
FT   CDS_pept        complement(455282..455548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0473"
FT                   /product="ribosomal protein S20"
FT                   /note="KEGG: rop:ROP_10050 30S ribosomal protein S20;
FT                   TIGRFAM: ribosomal protein S20; PFAM: ribosomal protein
FT                   S20"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96960"
FT                   /db_xref="GOA:D6ZBY3"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBY3"
FT                   /inference="protein motif:TFAM:TIGR00029"
FT                   /protein_id="ADG96960.1"
FT                   /translation="MANIKSQIKRIKTNEAARQRNQAVRSALRTAIRKVRTSAAAGEKE
FT                   QAAQLLVAANRNLDKAVSKGVIHKNNAANRKSALTKLVNKIDA"
FT   gene            455953..457539
FT                   /locus_tag="Srot_0474"
FT   CDS_pept        455953..457539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0474"
FT                   /product="protein of unknown function DUF404"
FT                   /note="PFAM: protein of unknown function DUF404; protein of
FT                   unknown function DUF407; KEGG: mjl:Mjls_3521 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96961"
FT                   /db_xref="InterPro:IPR016450"
FT                   /db_xref="InterPro:IPR025841"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBY4"
FT                   /inference="protein motif:PFAM:PF04169"
FT                   /protein_id="ADG96961.1"
FT                   /translation="MKPGTDKTKPEKSAKSSQSQSQSKGGQRQSQTQGGGAQLDGAFED
FT                   YTESPGFEKNFDEMFEQDGSARAPYRGVFQALEPLDSDDLNARAEALGRAFINQGITFS
FT                   LSGQERPFPLDLVPRVIAAAEWAKLEKGITQRVRALEAFLDDVYGDQEILRDGVIPRSL
FT                   IFSCQHFHRQASGIRPPNGVRIHVAGIDIIRDGQGTFRVLEDNLRNPSGVSYVMENRRT
FT                   MTRVFPDLFGTHRVRPVDDYPAHLLRALRAAAATNEDDPTVVVLTPGVANSAHFEHSLL
FT                   ARQMGVELVEGRDLFCRDNIVYMRTTEGEVQVDVIYRRIDDEYLDPLQFKPESLLGVAG
FT                   IVNAARAGNVVISSAVGNGVGDDKLVYTYVPSMIEYYLGEKPLLANVDTYRCWIPHELE
FT                   QTLDRINELVLKPVEGSGGYGIVFGPDASEKELAAMSRKIRANPRDWVAQPVMQLSTVP
FT                   TKIGDKVAPRHVDLRPFAVNDGENVWVLPGGLTRVALKEGSLVVNSSQGGGSKDTWVLG
FT                   NRSQAKTEVAS"
FT   gene            457640..458611
FT                   /locus_tag="Srot_0475"
FT   CDS_pept        457640..458611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0475"
FT                   /product="protein of unknown function DUF403"
FT                   /note="PFAM: protein of unknown function DUF403; KEGG:
FT                   rer:RER_37650 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96962"
FT                   /db_xref="InterPro:IPR007296"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBY5"
FT                   /inference="protein motif:PFAM:PF04168"
FT                   /protein_id="ADG96962.1"
FT                   /translation="MLARNAESLFWIGRYVERADDTARILDVGVHQLLEDATVDSDQQA
FT                   RGLLRILGITPPEGEELHVWSMTDLVAFDRENGNSIADSLYRARENARGAREVTSTEMW
FT                   ESLNTTFNGIADSEKLARKLGPHEFFSYVENRAALFSGLVDSTLSRDDGYLFLLLGKHL
FT                   ERIDMGIRLLLVGSGDRSDASWVSVLRAAGAHDTYLRTYRGLLNSTSVVEFLVLDRLFP
FT                   RSVFYSLHRVEECLAELDRGDLYSRVGSRNEARRIIGSARSALEYTRASDLVDDLYARL
FT                   SSVQSACLETGEAVADRYFTVEPYMLWSDVRAIGRAGGEEVA"
FT   gene            458608..459456
FT                   /locus_tag="Srot_0476"
FT   CDS_pept        458608..459456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0476"
FT                   /product="transglutaminase domain protein"
FT                   /note="KEGG: gbr:Gbro_3181 transglutaminase domain protein;
FT                   PFAM: transglutaminase domain protein; transglutaminase
FT                   domain protein; SMART: transglutaminase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96963"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013589"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBY6"
FT                   /inference="protein motif:PFAM:PF08379"
FT                   /protein_id="ADG96963.1"
FT                   /translation="MSWRLRITHTIGYAYDSPVRASFNEVRISPRNDARQNVINGRVTT
FT                   EPAGRYYRYSDYWGTFVTAFDLHAPHSELEIVGASVVETGADDKIEKPLSWDELGSPRV
FT                   TDRYYEYLGYTDFAPNHRPLLGVARRIRKQDLSPAQTVGAVVEWVRDEFEFVPQTTTAR
FT                   VTAVDAVNASKGTAQDLAHVSLVLLRGLGVPARYVTGFLYPDTKKAKVGEPVEGRASAW
FT                   VEAWFGAWQGFDPLVGAPINERHVAVGHGRDYDDVPPIKGIYTGGLATDLDVHTEITRL
FT                   S"
FT   gene            459635..460090
FT                   /locus_tag="Srot_0477"
FT   CDS_pept        459635..460090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0477"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="KEGG: rop:ROP_19730 putative Rrf2 family DNA-
FT                   binding protein; TIGRFAM: transcriptional regulator, Rrf2
FT                   family; PFAM: protein of unknown function UPF0074"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96964"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBY7"
FT                   /inference="protein motif:TFAM:TIGR00738"
FT                   /protein_id="ADG96964.1"
FT                   /translation="MQLTKFTDLGLRVTMLLAAAPSGRQLSTAHVAEQMRVPYTHAAKV
FT                   VARLAGLGVVESARGRAGGLRLAESASSRSIGWIARRLEGDGEVVECEGANPCPLREGC
FT                   RLRGALRQAQEAFFHVLDGWTVAEMIRTPTEPILRELVLATGPKKGI"
FT   gene            460090..461292
FT                   /locus_tag="Srot_0478"
FT   CDS_pept        460090..461292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0478"
FT                   /product="Oxidoreductase FAD-binding domain protein"
FT                   /note="PFAM: Oxidoreductase FAD-binding domain protein;
FT                   globin; oxidoreductase FAD/NAD(P)-binding domain protein;
FT                   KEGG: mab:MAB_3133c putative flavohemoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96965"
FT                   /db_xref="GOA:D6ZBY8"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBY8"
FT                   /inference="protein motif:PFAM:PF00970"
FT                   /protein_id="ADG96965.1"
FT                   /translation="MSLSDQAKSVLRATAPAVGAALDEIAPLFYDRLFAAHPELLRDLF
FT                   NRGNQAQGDQPKALAGSIVAFAGLALAGDEDRYGAVLDRIAHKHASLGVTAELYSVVHE
FT                   HLFAAIAQVLGEAVTPEVASAWTELYWLMAGELIARERGLYDAARVAPGEVWREARVAA
FT                   RALESADVVSLELVDPSGAGLPAFLPGQYVSVQVALPDGARQIRQYSLAGGTSEGSWRL
FT                   GVKRVRGEAGAPDGEVSNHIYENVFEGDLVRVSIPAGELVLDRSDRPLVLVSAGIGCTP
FT                   IMGMLHALAAERSERSTTVLHADRALSTHAYRAELADLVGQLPNGRLWTWYQSLDGSRR
FT                   GALSGLMDFDAVDVAPDAVAYVCGPTPFLGYAVSALTAKGLSEADVRYEVFGPLAALVA
FT                   A"
FT   gene            461437..462645
FT                   /locus_tag="Srot_0479"
FT   CDS_pept        461437..462645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0479"
FT                   /product="lipid-transfer protein"
FT                   /note="KEGG: mva:Mvan_2338 lipid-transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96966"
FT                   /db_xref="GOA:D6ZBY9"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBY9"
FT                   /inference="similar to AA sequence:KEGG:Mvan_2338"
FT                   /protein_id="ADG96966.1"
FT                   /translation="MAARKGKRVFVIGVGMTKFEKPGRREDWDYPDMARESGANALADA
FT                   GIPYADVEAASVGYVYGESTSGQRAVYELGMTGVPVVNVNNNCSTGSTALCLAAQQIRG
FT                   GLNDCVLALGFEKMQPGSLGATYDDREQPMERHIMALAEISEVLFPPAPWMFGAAGREH
FT                   MKLYGTTAEHFAKIGEKNHRHSVNNPNSQFRDEHTLDDILAARMIYDPLTKLQCSPTSD
FT                   GSAAAILASEDFVDQHGLADRAVEIVGQAMTTDFQSTFDGTAKNIVGFDMSRQAAREVY
FT                   EQSGLGPEDFQVIELHDCFSTNELLTYEALGLCPEGEGGKLVDSGETTYGGKWVVNPSG
FT                   GLISKGHPLGATGLAQCAELTWQLRGEADKRQVSGVAAALQHNIGLGGAAVVTAYQRAT
FT                   GPR"
FT   gene            462715..463149
FT                   /locus_tag="Srot_0480"
FT   CDS_pept        462715..463149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0480"
FT                   /product="Polyketide cyclase/dehydrase"
FT                   /note="PFAM: Polyketide cyclase/dehydrase; KEGG:
FT                   mab:MAB_2950c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96967"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBZ0"
FT                   /inference="protein motif:PFAM:PF10604"
FT                   /protein_id="ADG96967.1"
FT                   /translation="MGHVEATANVPFPPEKVWSAITNLEDYGKWMSIHTKWKGDIPAKL
FT                   EKGTQYSEVITMMGMANVITWTVEQFEENKTWVSSGSGMAGVTTTTSIHLTPDGDGTKI
FT                   SIGSEFSGNIIKGPLAKAIEKAAVKDLEKSVQSLTELLNA"
FT   gene            463163..464047
FT                   /locus_tag="Srot_0481"
FT   CDS_pept        463163..464047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0481"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   mab:MAB_2949c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96968"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBZ1"
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /protein_id="ADG96968.1"
FT                   /translation="MTQAQELRFDVEGLDRWSEESTYEVTREAIVAYAEATNDPIPAHR
FT                   AGEIAPPVFAIVPVFENMMEPVFAVVPLELFGLVLHGEQDFRFHRPIYPGDVLVSRSKM
FT                   IGFDGLENGSRGAALIETRLQSGELVNEQYLTFFIRKFTNPEAAGALSPEHKFPEELRA
FT                   QAPVARVVAHVDTDQTYRYSEASGDPMPIHLDEEVALDAGLPGVIAHGLCVLAFTSWAA
FT                   LTSLADGRTERLARLAVRFAKPVLPGQDIETTLWRSAASGGSTQYVYETKVGDDVVIKD
FT                   GLVEIADRIVGNH"
FT   gene            464066..464935
FT                   /locus_tag="Srot_0482"
FT   CDS_pept        464066..464935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0482"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   rha:RHA1_ro05061 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96969"
FT                   /db_xref="GOA:D6ZBZ2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBZ2"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADG96969.1"
FT                   /translation="MGALDGRVAVVTGAGRGIGREHALLFAKEGAKVVVNDLGGANDGT
FT                   GADAGPAAEVVQEILALGGEASANTNNIADWDGAKDLVDQAVRDFGRLDVVVNNAGILR
FT                   DGFIAGMTEAQWDAVVAVHLKGHFNVLRHASAYWKEESKAGRQPNASVINTASDSGLTV
FT                   PNDGQGNYGAAKAAIAALTQVAASELERYGVRANAIAPMARTRLTLATPGMGAIFAEEV
FT                   EEGEFDGFSPANISPLVAYLATADCTITGKVFRVGGGYIAELGGWHEVNSYETDGPWSV
FT                   ELVAKQLA"
FT   gene            464945..466207
FT                   /locus_tag="Srot_0483"
FT   CDS_pept        464945..466207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0483"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   nfa:nfa9280 putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96970"
FT                   /db_xref="GOA:D6ZBZ3"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBZ3"
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /protein_id="ADG96970.1"
FT                   /translation="MFEWSEMDLLVRGALREFIDKEIKPVRDQLESGEIKPYPIIRKLF
FT                   EQFGIAAMATERLEKALAREEAHEAARAKGEKPEKSDSGALGGLGSGDQASLMFMLNKE
FT                   LAGVSLGLVVSFGVSLGLGAGTIMAKGTLAQKKRWLPGLVTAEKIAAWAITEPDSGSDA
FT                   FGGMKTTVRRDGEDYILNGQKTFITNGPDADVIVVYAKLDDGSALSRRDRKVLAFVLDK
FT                   GMAGLVQEKPFQKMGMNSSPTGELFFTDVRLAPDRLLGESEDHSSGDGRDSARSNFVVE
FT                   RVGVAALSLGIIEECLRLCADYAKTRTLWGQEIGAFQLIQLKLAQMEVARLNVENMVFR
FT                   AIELSRAGKQPTLAEASAMKLYSSQAATEVAMEAVQLFGGNGYMREYRVEQLARDAKSL
FT                   MIYAGSNEIQVTHIAKGLLSP"
FT   gene            466275..467186
FT                   /locus_tag="Srot_0484"
FT   CDS_pept        466275..467186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0484"
FT                   /product="aquaporin"
FT                   /note="KEGG: rsa:RSal33209_1492 aquaporin"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96971"
FT                   /db_xref="GOA:D6ZBZ4"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR034294"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBZ4"
FT                   /inference="similar to AA sequence:KEGG:RSal33209_1492"
FT                   /protein_id="ADG96971.1"
FT                   /translation="MTDHEIEAHEALVPELEEVEEFDDEGPELADGGIVRRILAEFLGA
FT                   FFLALVIATASGPTAPVLVGLTAAVLFFLFGPVSGGHFTPVVTAALGLLGRIRAELAWV
FT                   YVFVQFAAGFAAFALVWALRPPLDDAARGALRASVDTLVGAVGGQVPWFPAHWPLLLLL
FT                   SVLLVAVVLAARSAFGQGSQAAAWIGGVVGATFWLGNAIYPAASVPAVVFNGYASAFRA
FT                   LPVLVLFPLIGAYVGALVYREIVVAHPAEAEEDFVDETDFVDEAEPVAADEAELVDTPA
FT                   EQGEDGHGTADEDEDSQPHESS"
FT   gene            467224..469092
FT                   /locus_tag="Srot_0485"
FT   CDS_pept        467224..469092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0485"
FT                   /product="GTP-binding protein LepA"
FT                   /note="KEGG: mmi:MMAR_3724 GTP-binding protein LepA;
FT                   TIGRFAM: GTP-binding protein LepA; small GTP- binding
FT                   protein; PFAM: GTP-binding protein LepA domain protein;
FT                   protein synthesis factor GTP-binding; elongation factor Tu
FT                   domain 2 protein; elongation factor G domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96972"
FT                   /db_xref="GOA:D6ZBZ5"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBZ5"
FT                   /inference="protein motif:TFAM:TIGR01393"
FT                   /protein_id="ADG96972.1"
FT                   /translation="MLRPRSTAIPNFADTTFTDPERIRNFCVIAHIDHGKSTLADRMLQ
FT                   LTGVVDDRSMRAQYLDRMDIERERGITIKAQNVRLPWQTDGADYVLHLIDTPGHVDFTY
FT                   EVSRALAACEGAILLVDSTQGIQAQTLANLYLAMERDLTIIPVLGKIDLPASDPETHAS
FT                   EIAHITGCDPADILRVSGKTGEGVKELLDEVVRLVPPPKGDADAPARAMIFDSVFDTYR
FT                   GVVTYVRVIDGKITPRERIQMMSTKAQHELLEVGIVSPEPKACAGLGVGEVGYLITGVK
FT                   DVRQSKVGDTVTSLRHGATQALPGYREAKPMVFSGLYPIDGSDYPNLREAIEKLQLNDA
FT                   ALTFEPETSVALGFGFRCGFLGLLHMDITKERLLREFGLDLIATAPAVVYRVLLDSGDE
FT                   VVVTNPAEWPTGKVRSVFEPMVRCTVIAPNEFTGPIMELCTSRRGQMKSMDYLSQTRLE
FT                   IVYHMPLGEIIFDFFDELKSRTKGYASLDYEPSGEQESELVKVDILLQGEAVDAFSAIV
FT                   HKDAAQAYGGKMTTRLRELIPRQQFEVPIQAAVGSKIIARENIRAIRKDVLAKCYGGDI
FT                   TRKRKLLEKQKEGKKRMKTIGRVEVPQEAFIAALTIGDEGNNKKKD"
FT   gene            complement(469093..469500)
FT                   /locus_tag="Srot_0486"
FT   CDS_pept        complement(469093..469500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0486"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mdi:METDI3948 thiamin-monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96973"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBZ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96973.1"
FT                   /translation="MPSRARAFFLAAACLVASGCAPQPPTSEPDIVYAVTAAGSSEVWV
FT                   RYLKDIEPGGGAGKRRGVEAQENARTPFTRTARLGQGWTHAWIEATTEPVDRTVKLHCA
FT                   LQHNGTTVTEGNGLGFVSCGSPADGNAAPPA"
FT   gene            complement(469506..469916)
FT                   /locus_tag="Srot_0487"
FT   CDS_pept        complement(469506..469916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0487"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fjo:Fjoh_0561 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96974"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBZ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96974.1"
FT                   /translation="MRRPVLIALLSLCLVVSGCGKHERGNGSHNVTYEITGVGVSGKIK
FT                   ISYLSHMGRPKAGKKIPSRRSSDYAAVPYTKEVTLGDFWDHANIHANDPGTNDNTASLT
FT                   CTIKHDGAVIATKTGTRSVTCEAPKSATAESN"
FT   gene            complement(469976..470617)
FT                   /locus_tag="Srot_0488"
FT   CDS_pept        complement(469976..470617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0488"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG: afo:Afer_1435
FT                   ThiJ/PfpI domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96975"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBZ8"
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /protein_id="ADG96975.1"
FT                   /translation="MKTQRCYSCPMARRSVSILLFDGFELLDVFGPAELLSALPDDFAL
FT                   SFLGPSRAPVASAQGVSVNPDRTYEPAAASDILLLPGGAGTRPLVSDEKFLDILREHAS
FT                   RAGIVASVCTGSLVLAAAGLLDGYRATSNKSLFSFVSQHGQNVTWEPRARWVEDRDRWT
FT                   SSGVAAGMDMTIALIRSLCGDAAAKTAADDSEIEPQLDPSHDPFADLYGL"
FT   gene            471087..471662
FT                   /locus_tag="Srot_0489"
FT   CDS_pept        471087..471662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0489"
FT                   /product="chorismate mutase"
FT                   /note="KEGG: mkm:Mkms_2781 chorismate mutase; TIGRFAM:
FT                   chorismate mutase; PFAM: Chorismate mutase, type II"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96976"
FT                   /db_xref="GOA:D6ZBZ9"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR008240"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZBZ9"
FT                   /inference="protein motif:TFAM:TIGR01806"
FT                   /protein_id="ADG96976.1"
FT                   /translation="MTMGALSKTVAAFLVAGAFACGPVPAAMANGVAAELVVQAAADRL
FT                   AVSSDVAASKWFSGGAIHDQARADDVLEDAAEQGSAAGLDQDRVRALFEDQIAAAEGEE
FT                   YARFAEWSFDPRSAPQAPTDLSSARARINEASSRLIQAYAQFAQKTAAKPACGAQVRAA
FT                   LAAEVSRRGWGAQWARGMRRAATHFCTG"
FT   gene            472236..472481
FT                   /locus_tag="Srot_0490"
FT   CDS_pept        472236..472481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0490"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96977"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC00"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96977.1"
FT                   /translation="MSVYDAAVADGLQDGRGEAHKLFAWRVERIRLQPHVGEAEIVPLL
FT                   RADESGVTVTGSLSTSLVAEFPFTMAMPEHSPRSEK"
FT   gene            complement(472744..473250)
FT                   /locus_tag="Srot_0491"
FT   CDS_pept        complement(472744..473250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0491"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Pc12g08860"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96978"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC01"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96978.1"
FT                   /translation="MTTEEEAAAAKARAENLLGATENQFAEAVALRKDLMQIIGKGQSP
FT                   DKLAQARCGADGVLVTFRFDRERAPKVDLAHLEKAVVQAAKAATHDARKQALEAMADFR
FT                   KHLGELPTPGEILAEVLPDANIEYDKLPVSPMRRVTKAMMHEPEYEEDDDPSYGRPNGW
FT                   GVQKK"
FT   gene            complement(473278..475233)
FT                   /locus_tag="Srot_0492"
FT   CDS_pept        complement(473278..475233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0492"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sen:SACE_1344 PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96979"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC02"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96979.1"
FT                   /translation="MTIHIPDGLKWVFEMAGGGQWPEGDEDAVREVAKGHEAYAKALEE
FT                   DLQKFNDAMSLAKDSVEGKIHDALADLEQKVADQLKQVADAHHNQAKALKDAANTIEYT
FT                   KGMMIAALVTLAAEIATAIAMMPFTCGASAAAEAAAIAAAKVLFNTLSREMILKLMRAA
FT                   TIAAVVGIEDVALKTVSSVVTQKVQVDKGTRDKIDGDLVRDAAKTSGIGAAAGLLGAPL
FT                   GAVAGGAVEKGLQAAGGAAAKAAGVEVGETTAGKLGEFASKQLGGAADAVTGSAVTGGI
FT                   TSAATGQKFDPATLAGAAAGKAAGSVVGKGVEKGSAAATKSIPESSGLKSAIEPATDLG
FT                   KSMASEVAKTAAEQGAIAGINHTPFDTDKLAGAPVKGGLESAKGGFGKAEKLQAEASKE
FT                   KPVAGPQPQGTVPPGTQGPQPEGALPHTARTPTENLQGPKEKPVAGPQPQGTVPPGTQG
FT                   PQPEGALPHTTRTPTENLQSSVPHADSSSAGSAHAQPPAPHSGSGGAQQAGQQASPPGQ
FT                   GISNTPAGHMGADLRGFGSGAPAAGTPLAATSPQGESPSVEPASGAVSPQAGSVGAPPQ
FT                   RAASAPPILERQFDQNVRPVQTAEPVVGDLTPGERDERDHVLAMYEAQSAAADDDVWEA
FT                   GRDMGSDAMDRSASAR"
FT   gene            complement(475230..475763)
FT                   /locus_tag="Srot_0493"
FT   CDS_pept        complement(475230..475763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0493"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sen:SACE_1345 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96980"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC03"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96980.1"
FT                   /translation="MADGKIEMDYDGFRSAGHHLQSLSESVRSSYQTFLSATEGRGEPW
FT                   GHDKFGKSFAEGKDKYKESMESLKKLAEGDGGDGYIEALDEFGKNILNAADQIESKDND
FT                   EGRNIQQVDKQTDAATPRYTLQGAGADSGDAGADGERMRLPHADFGRFGRIGVVTSAAE
FT                   DGVEPPGQADGGVA"
FT   gene            476122..476439
FT                   /pseudo
FT                   /locus_tag="Srot_0494"
FT   gene            476762..477046
FT                   /locus_tag="Srot_0495"
FT   CDS_pept        476762..477046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0495"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: psa:PST_0888 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96981"
FT                   /db_xref="GOA:D6ZC04"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC04"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96981.1"
FT                   /translation="MATAFAVAAHSIAVWGLGGVDPTSYAYASYENSALAKGANQVKAD
FT                   LLWTSGALFVLGLFLLWAGQTKRKAAPFVLEIMTGLAAAVAVVAICVCA"
FT   gene            complement(477084..477455)
FT                   /locus_tag="Srot_0496"
FT   CDS_pept        complement(477084..477455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0496"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain N"
FT                   /note="KEGG: rsk:RSKD131_0844 proton-translocating NADH-
FT                   quinone oxidoreductase, chain N"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96982"
FT                   /db_xref="GOA:D6ZC05"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC05"
FT                   /inference="similar to AA sequence:KEGG:RSKD131_0844"
FT                   /protein_id="ADG96982.1"
FT                   /translation="MIGAAAALTVLSILLFALFYGLHVYSEELLKQAVAEFDKPDWNKA
FT                   TRKYAAASDFSDLSVVGSAVTALAAGVLAFAGRLRTSNAGWRSGAIVVLVAAGLAFLVS
FT                   GGLVGWWVLHVFVGIATHL"
FT   gene            477767..477943
FT                   /pseudo
FT                   /locus_tag="Srot_0497"
FT   gene            479082..479561
FT                   /locus_tag="Srot_0498"
FT   CDS_pept        479082..479561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0498"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96983"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC06"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96983.1"
FT                   /translation="MSIRLTFLFATCVLGLAGCAFSGDKDGATGGKAEPAQHKHPSSTA
FT                   EICSFFKKAHTKLSAQYAEFESKTLDSHWTWSDDSVSQLGSALAPLLRREAEDIQQSVS
FT                   ESATGPVAAQVKDLAEQDVHLAEKIEGRTFQGSIETSERLVDATVKSVKSICAIH"
FT   gene            479602..480015
FT                   /locus_tag="Srot_0499"
FT   CDS_pept        479602..480015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0499"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbe:Cbei_1923 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96984"
FT                   /db_xref="GOA:D6ZC07"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC07"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96984.1"
FT                   /translation="MVTEIDEEPFSDSATYGKPPWTLAGSSMRIRTCGISAVSMLFAVL
FT                   LFGSGAKVLCTTGFVGFILVVPAVFFIMLAVRNFSQYKFLRKLQDSAPAGEEPYICSYI
FT                   GFKWALMDVGLFAGALASAALLNWCFAKIGLVK"
FT   gene            complement(480027..480539)
FT                   /locus_tag="Srot_0500"
FT   CDS_pept        complement(480027..480539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0500"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: svi:Svir_18580 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96985"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC08"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96985.1"
FT                   /translation="MSTPEPDPVLDIARGDPAVSKALSSSLKILRNKSDDPAFKTMVDE
FT                   ILAGKKSLREAASSQAFNQGIADKAQAGFEWYRNLSEEERERGAEQGRSQLARLREELL
FT                   YQPKEQPHSQEDGADDDDESSFDYSDPLRRNAKDEDFPTHSSLRHLEEADDEDEGFDPS
FT                   DPLGRRR"
FT   gene            complement(480542..480874)
FT                   /locus_tag="Srot_0501"
FT   CDS_pept        complement(480542..480874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0501"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bfa:Bfae_08040 predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96986"
FT                   /db_xref="GOA:D6ZC09"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC09"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96986.1"
FT                   /translation="MDIFAQAVASLVSALNSLLEFLLDKLIIMGISLAAGAITAETGVG
FT                   ALVGGLFALSQAFEAEAKWKDILKAIDSGWALVNGFIGTSVSACADLTGLTSQMAPGGT
FT                   YEHPEA"
FT   gene            complement(480875..481618)
FT                   /locus_tag="Srot_0502"
FT   CDS_pept        complement(480875..481618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0502"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcv:Bcav_2541 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96987"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC10"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96987.1"
FT                   /translation="MAVTVNPAALYAFKEHQIKITEEIDAAKKYSDTNLQDMSWTSAGI
FT                   AGQFLWSTAISGIKNIHQGVDTNLTLLHSLTTVSANEVGKAGDMYAHTDQYHAQQIDNK
FT                   YNGTPEWTGHGLHRFSAEDPASKLQPPKAEEIIPGGVDKALGAGSWLSLSHWVLEAIDQ
FT                   VCGVNPGKWVLEKFTGDWEAFGKVADSLRKIGEFYNSYGQNISEDMVFMLDSWTGKAAG
FT                   SAKGYFEKFASSVQHQQDSLEKVAH"
FT   gene            complement(482815..483081)
FT                   /locus_tag="Srot_0503"
FT   CDS_pept        complement(482815..483081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0503"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mab:MAB_3347 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96988"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC11"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96988.1"
FT                   /translation="MNVRTYRASTGLRCGALTGSSTSMEKVIDHFPYDHGDSGGPVRID
FT                   TPTGAWVVGILTAVPNSDQSSSIVVPIEDPVTTYQVKVTVHRA"
FT   gene            483085..483693
FT                   /pseudo
FT                   /locus_tag="Srot_0504"
FT   gene            complement(483712..483787)
FT                   /locus_tag="Srot_R0012"
FT                   /note="tRNA-Ala3"
FT   tRNA            complement(483712..483787)
FT                   /locus_tag="Srot_R0012"
FT                   /product="tRNA-Ala"
FT   gene            complement(483862..484824)
FT                   /locus_tag="Srot_0505"
FT   CDS_pept        complement(483862..484824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0505"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa49500 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96989"
FT                   /db_xref="GOA:D6ZC12"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC12"
FT                   /inference="similar to AA sequence:KEGG:nfa49500"
FT                   /protein_id="ADG96989.1"
FT                   /translation="MSVPNSILSVLLVVVWLFVLVPMVVNRRPKVMTVSQAALNTRVLF
FT                   RGGLDKLKHRVRPGLAAESFEEEEDEEGGGARRPVAEVFADADDAESAESAESPQDNDD
FT                   YEVADEAEFIEDDVPPRRQREDEPVDDAEVVAVRDRRHAAHDDEDAQAREEAELQQLAH
FT                   RLGRGGYNPNADASARAHRYAVRQRFVLGLIVSLVAATVLAFAMSPLVWYAVAVIAATL
FT                   VGYLAYLRRQVRIEEQIRARRMARFARSRGPEHAERAAPRPRAERRGSQRGETAPGESA
FT                   RRAARKARGPRVVAIDEDDPDFVDLPSPHDGVLRRASGQ"
FT   gene            complement(484868..485533)
FT                   /locus_tag="Srot_0506"
FT   CDS_pept        complement(484868..485533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0506"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   nfa:nfa49510 putative ribosomal-protein- alanine
FT                   N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96990"
FT                   /db_xref="GOA:D6ZC13"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC13"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADG96990.1"
FT                   /translation="MAKTVANPVLGPVTTPGGEVRLRPIRLTDARSWSQARIADQQHLE
FT                   PWEPGPGRGWEERHKAQHWLSLWSQLRAHTKKGVVYPLVIEVDRTYAGQLTIGGVQRGA
FT                   LQSAWIGYWVASRVCGGGVATAAAALAVDWCFQTLKLHRVEATTRRENFASKTVLERIG
FT                   FREEGLIKDYLVVQGMWRDHVLFGLTAPETRGGVVNRLVREGKILGAAPPAGGRARLL"
FT   gene            complement(485535..486788)
FT                   /locus_tag="Srot_0507"
FT   CDS_pept        complement(485535..486788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0507"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="KEGG: rer:RER_43880 molybdopterin biosynthesis
FT                   protein MoeA; TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; PFAM: MoeA domain protein domain I and II;
FT                   molybdopterin binding domain; MoeA domain protein domain
FT                   IV"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96991"
FT                   /db_xref="GOA:D6ZC14"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC14"
FT                   /inference="protein motif:TFAM:TIGR00177"
FT                   /protein_id="ADG96991.1"
FT                   /translation="MRSVAEQLRRVLAAAVAPSPIRVAISEAQGLQCAEDVISGRSFPG
FT                   FDQAAVDGYAVRGVDVALPEPMDDDPHPDPLFLPVVGDIEAGNKQPARLQPHQAVLLQT
FT                   GAPLPSLADAVLPIAFTDGGIERIRVDLGVRSGDFVRKAGDDLKAGDVVVRSGTIIGPA
FT                   QVGLLAAVGRDRVLVHPKPRVSVLSVGAELIDVDRTPGSGQVYDVNSYALAAAARDAGA
FT                   EAHRVGIVPHDERQIKDIVEGQLGRAEVVIISGPVGGDVGRNVNQALSELGQWEVSRVA
FT                   MSPGSVQGFGALGEEGVPTFFIPSNPVSALVVFEVIIRPLIRSALGRLSPRRRVLKAVA
FT                   TETLTSVIGRTSYIRGKLMRDDETGEYLVEPLGGVLASNPHLLSQLGEANCLINISEDA
FT                   SGVREGDPVDVIFLGQRG"
FT   gene            complement(486798..487781)
FT                   /locus_tag="Srot_0508"
FT   CDS_pept        complement(486798..487781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0508"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase; KEGG: mpa:MAP0924
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96992"
FT                   /db_xref="GOA:D6ZC15"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC15"
FT                   /inference="protein motif:PFAM:PF00483"
FT                   /protein_id="ADG96992.1"
FT                   /translation="MAENENSLSTLPRPGMPHTAVVPAAGMGTRFLPVTKSVPKELLPV
FT                   VDTPGIELVAAEAAQAGAQRLVIVTSEGKDSVVAHFVEDLVLESALEAKGKSAMLEKVR
FT                   RAPKLIKVESVIQHQPLGLGHAIAQVEPLLHPDDDAIAVLLPDDLVLKSPQQVAQERER
FT                   DICDQIEIREKVGALNLMAQVRAEHGGSVICAFPVPREEISAYGVFDVVEQEGPVRRVR
FT                   GLVEKPPAEKAPSNLAVAGRYILERAIFDALREVAPGAGGEIQLTDAIALLIDRGRPVH
FT                   LVVWDGYRHDLGNPGGYLKASIDFALDREEYGPGLRAWLISRLGLS"
FT   gene            488006..488560
FT                   /locus_tag="Srot_0509"
FT   CDS_pept        488006..488560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0509"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /note="KEGG: svi:Svir_32680 5,10-methenyltetrahydrofolate
FT                   synthetase; TIGRFAM: 5-formyltetrahydrofolate cyclo-ligase;
FT                   PFAM: 5-formyltetrahydrofolate cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96993"
FT                   /db_xref="GOA:D6ZC16"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC16"
FT                   /inference="protein motif:TFAM:TIGR02727"
FT                   /protein_id="ADG96993.1"
FT                   /translation="MGPQSSAQRKAALRAQTRSARRALSDAQRAARDRAVDAQAARIAE
FT                   RFGPGDVVSSYVPTSLEPGSDRMLAAFADRGASVLVPVVVGVDAALAWRHWPEEGQDAP
FT                   PGALAEAAVVLVPALAVDRRGVRLGQGGGHYDRSLAEAGPGAMLVAVVDDRELVDELPC
FT                   EPHDELLGWALTPKGLWRLGG"
FT   gene            complement(488582..489472)
FT                   /locus_tag="Srot_0510"
FT   CDS_pept        complement(488582..489472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0510"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mgi:Mflv_3443 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96994"
FT                   /db_xref="InterPro:IPR026954"
FT                   /db_xref="InterPro:IPR038232"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC17"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG96994.1"
FT                   /translation="MQFRVCAGGLCHYTERMFPRSRPRAAPVPARAATGLASRPQRGGA
FT                   DLLALAERASERADTLAKPLEQARLPSFPLLKITRALGVAVTITALASCGDPKEPGARR
FT                   AQSSQRVAPIAAEAIQSLFEPGHFNASGNIESMYSSASPPECRALVLEVDSPLLMRGQV
FT                   ASASAIAPKPGDKEHAQIVEIAAVYREGFSATDVIAEAAAMREHCEGTPITGSTQGGGN
FT                   STFQLIGQPSSGSPNILLWTLSALGKAWFCNNALIAAHNAAVEITSCYPSPAPKMRELA
FT                   QSALSRIERQARSSR"
FT   gene            489658..490287
FT                   /locus_tag="Srot_0511"
FT   CDS_pept        489658..490287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0511"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /note="KEGG: rha:RHA1_ro05695 50S ribosomal protein
FT                   L25/general stress protein Ctc; TIGRFAM: ribosomal 5S rRNA
FT                   E-loop binding protein Ctc/L25/TL5; PFAM: Ribosomal protein
FT                   L25-like"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96995"
FT                   /db_xref="GOA:D6ZC18"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC18"
FT                   /inference="protein motif:TFAM:TIGR00731"
FT                   /protein_id="ADG96995.1"
FT                   /translation="MAETARVEATVRDEFGKGASRRARRDGHVPAVLYGHGIDPKHFNI
FT                   PAKEFARVLRANGVNAIVSLHAGGEEHLALTKTVVVHPTKSYLQHVDLQVIRRGERIAV
FT                   DVPVVLTGSAASGSVVQHETTTLSVEAEAMHIPEQIEVSIEGLEIGSKIIASELELPEA
FT                   VSLTGDPEQMIVQINEARAAQVEQDSAEGSDEAEADSSAEDGGEES"
FT   gene            490320..490880
FT                   /locus_tag="Srot_0512"
FT   CDS_pept        490320..490880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0512"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="TIGRFAM: peptidyl-tRNA hydrolase; KEGG:
FT                   mab:MAB_1142c peptidyl-tRNA hydrolase (PTH); PFAM:
FT                   peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96996"
FT                   /db_xref="GOA:D6ZC19"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC19"
FT                   /inference="protein motif:TFAM:TIGR00447"
FT                   /protein_id="ADG96996.1"
FT                   /translation="MIAGLGNPGPKYEKTRHNVGHMVVDLLLARAGGSLRAHKTSGMLA
FT                   ARLSFHGRGVILGKPTAYMNVCGPQIAKLAKYFSVPAADVVAVHDELDIGFGLVRLKRG
FT                   GGEAGHNGLRSLSSSLGTKEYCRVRVGVGRPPVGTQTADFVLAGFRADERKELPGLLER
FT                   SADAVEALVREGLEAAQNRVHSA"
FT   gene            complement(490897..491274)
FT                   /locus_tag="Srot_0513"
FT   CDS_pept        complement(490897..491274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0513"
FT                   /product="Rhodanese domain protein"
FT                   /note="SMART: Rhodanese domain protein; KEGG: mjl:Mjls_4389
FT                   rhodanese domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96997"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC20"
FT                   /inference="protein motif:SMART:SM00450"
FT                   /protein_id="ADG96997.1"
FT                   /translation="MKRTIDEVLGEARSRLARLEPHELPAALRRGAILVDIRPAAQRAR
FT                   EGELPEALVIERNVLEWRCDPASDARLPQAVDHDVEWVLLCSEGYTSSLAAASLQDLGL
FT                   WRATDVVGGYQAVAADRGARQ"
FT   gene            complement(491304..491876)
FT                   /locus_tag="Srot_0514"
FT   CDS_pept        complement(491304..491876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0514"
FT                   /product="cysteine dioxygenase type I"
FT                   /note="PFAM: cysteine dioxygenase type I; KEGG:
FT                   mul:MUL_0216 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96998"
FT                   /db_xref="GOA:D6ZC21"
FT                   /db_xref="InterPro:IPR010300"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC21"
FT                   /inference="protein motif:PFAM:PF05995"
FT                   /protein_id="ADG96998.1"
FT                   /translation="MSTPSLLTRQRPLPTRLSTADLLRTTADVAEQIKDGAWAHLLPPA
FT                   GGWPTDDRWCRQLFADDELDVWAISWVPDRTTELHDHGGSLGALTVVDGALAEWRWTGS
FT                   RLRERRLGAGAQAAFALGWVHDVTWAQPGVSPLVKGAAAPGSTAPALSVHAYSPPLTVM
FT                   SYYEVTEQQSLRRVRAELTDVPERPKR"
FT   gene            492039..492887
FT                   /locus_tag="Srot_0515"
FT   CDS_pept        492039..492887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0515"
FT                   /product="iron permease FTR1"
FT                   /note="PFAM: iron permease FTR1; KEGG: rop:ROP_58390
FT                   hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADG96999"
FT                   /db_xref="GOA:D6ZC22"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC22"
FT                   /inference="protein motif:PFAM:PF03239"
FT                   /protein_id="ADG96999.1"
FT                   /translation="MLFANALIGLREGLEASIIVTILCAFLVKSGLKSHVKWVWTGVAV
FT                   ALGITVTVFLVITYGSSTLSSLGQEFVGGVASLVAVAIVTTMVLWMRTAAASLSGDLKA
FT                   ALAKAVSLGPAAVVLMSGLAVGREGIETALLVFDTTQSNPSSLYGLLVGVAVAVALAIA
FT                   MYFGALRINLSAFFKVTGVLLVFVAAGVLRYGVNDLQEAGALPGSERLAFDVSGTIDPN
FT                   TWPAKLVEGMFNIVPNPTLLSAIAWLVYVVVVLAVFLRPVRPQSAAPPAAQAQRGVSAD
FT                   S"
FT   gene            493097..494251
FT                   /locus_tag="Srot_0516"
FT   CDS_pept        493097..494251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0516"
FT                   /product="Peptidase M75, Imelysin"
FT                   /note="PFAM: Peptidase M75, Imelysin; KEGG: mva:Mvan_4774
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97000"
FT                   /db_xref="InterPro:IPR018976"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="InterPro:IPR034981"
FT                   /db_xref="InterPro:IPR038352"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC23"
FT                   /inference="protein motif:PFAM:PF09375"
FT                   /protein_id="ADG97000.1"
FT                   /translation="MSNRSALSIILAPMGAALLVSGCEAKVKPGQASGDIAVTATDDSC
FT                   QLTANSANTGNVVFKVTNKGTKVTEFYVYGVGDRVIGEVENIGPGVTRTLIAPLSEPGS
FT                   YQTSCRPGMIGNGVRKPFTVTGPSVAQADPKGLLANAASEYKRYVVSQIDALKQATAEF
FT                   ADKIKAGDVAGAKAVYPVARLYYERIEPIAESFQDPKNNLDLKIDMRIDDAKSGIVFTG
FT                   FHRLEQDLWEGVKPDTNQIADQLVADVGELDAKVKDPGFTFTGLDIAHGAQQLLDEVAA
FT                   TKITGEEDRYSHTDLWDFQANIEGSQHAIAALRQVIDERKPGLGPQIDAAFAKVQQELD
FT                   ALRQGDGFVFYTDQTVSPQKRKAFSDSIDALSKQVSQVEAVVAG"
FT   gene            494264..495538
FT                   /locus_tag="Srot_0517"
FT   CDS_pept        494264..495538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0517"
FT                   /product="Dyp-type peroxidase family"
FT                   /note="KEGG: rop:ROP_58370 putative peroxidase; TIGRFAM:
FT                   Dyp-type peroxidase family; PFAM: Dyp-type peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97001"
FT                   /db_xref="GOA:D6ZC24"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006313"
FT                   /db_xref="InterPro:IPR006314"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC24"
FT                   /inference="protein motif:TFAM:TIGR01413"
FT                   /protein_id="ADG97001.1"
FT                   /translation="MNNSLEPRYSRRQLLAVGGASAVVAAGAGAAAGRAHIPERAAAGS
FT                   DRDGVVPFRAAHQAGIVTAQQDQLHFAALDVMTESREELVALIKQWTVMAERMTKGQEA
FT                   TPGGAMGGNPLAPPQDTGEAFDLAPAQLTITVGFGPGIFEKDGKDRFGLAKHRPEPLTP
FT                   LPGFPGDALEPARCGGDVVIQACANDPQVAVHAVRNLVRTGFGVVSVRWSQLGFGRTSS
FT                   TSTRQVTPRNLFGFKDGTNNIKAEETNELDKHIWVAKDDGPDWLVGGTYLVARRIRMNI
FT                   ERWDRDFLKDQEQTIGRTKESGAPLSGGGEFEPLDLDAKLGVEPAIPWNAHVRLASHQN
FT                   LGGIRILRRGYNFTDGSDGVGHLDAGLFFLAFCRDPQKQFVPMQQTLAKSDALNEYIKH
FT                   TGSALFVCPPGLGDGEYWGQKLFEG"
FT   gene            495538..495927
FT                   /locus_tag="Srot_0518"
FT   CDS_pept        495538..495927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0518"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   mjl:Mjls_2434 GCN5-related N- acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97002"
FT                   /db_xref="GOA:D6ZC25"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC25"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADG97002.1"
FT                   /translation="MGQTGYGVQVVQRLLPDQWRILRRLRLAGLVEVIGEDHEYYAKEE
FT                   AFDEVAWQSMIATHPQFVASSHSVPVGLASLLLEPEREAEVSFLWVEPQHRGSGVAEAL
FT                   MAAVADWVSRGGYRAGETLKRNRRL"
FT   gene            complement(495943..497733)
FT                   /locus_tag="Srot_0519"
FT   CDS_pept        complement(495943..497733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0519"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding
FT                   protein"
FT                   /note="PFAM: Carbamoyl-phosphate synthase L chain ATP-
FT                   binding; Carbamoyl-phosphate synthetase large chain domain
FT                   protein; biotin carboxylase domain protein; biotin/lipoyl
FT                   attachment domain-containing protein; KEGG: mgi:Mflv_4784
FT                   carbamoyl-phosphate synthase L chain, ATP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97003"
FT                   /db_xref="GOA:D6ZC26"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC26"
FT                   /inference="protein motif:PFAM:PF02786"
FT                   /protein_id="ADG97003.1"
FT                   /translation="MPNITTAFDSVLVANRGEIAIRVIRAAQDAGLRSIAVYAEPDANA
FT                   PFARLADEAFALGGKTPLESYLVIDKIIAVAERSGAKAIHPGYGFLSENADFAQAVIDA
FT                   GLVWIGPPPQAIRDLGDKVTARRIALKVGAPLVPGTDKPVSSSDEVLAFAQEHGLPVAI
FT                   KAAFGGGGRGMKVARTMEEIPELFDSATREATAAFGRGECFVERYLDRPRHVEAQIVAD
FT                   THGNVVVVGTRDCTLQRRFQKLVEEAPAPFLTDEQRESIHSSAKAIARETGYHGAGTVE
FT                   YLVGEDGLVSFLEVNTRLQVEHPVTEETAGIDLVLEQFRIAAGATLSISEDPEPRGHSF
FT                   EFRINSEDAGTGFLPNTGKITTYRQPNGPGVRLDSGVEAGTVVGGQFDSMLAKLIVTGR
FT                   DRNEALARARRALDEFALEGLATTIPFHRLVVRDPAFIGDGQKFNVHTRWIETEWNNTV
FT                   APFADPAEHDDEQNLGTRGVVVEVGGRRLEVLLPEELFTAANNTGVIRRKPKPRHKVAG
FT                   ASAQGGNSVTAPMRGTVVKVAVELGQTVESGELIAVLEAMKMENPISAHKSGVITKLHV
FT                   ETGATVSPGAVLAELADAAS"
FT   gene            complement(497843..498727)
FT                   /locus_tag="Srot_0520"
FT   CDS_pept        complement(497843..498727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0520"
FT                   /product="Rhodanese domain protein"
FT                   /note="KEGG: rer:RER_21240 thiosulfate sulfurtransferase;
FT                   PFAM: Rhodanese domain protein; SMART: Rhodanese domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97004"
FT                   /db_xref="GOA:D6ZC27"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZC27"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ADG97004.1"
FT                   /translation="MHVDPASVAAGYAVPERVVSTEWLSANLGHRQLRLLEANEDSLVY
FT                   DAGHIPTAAKVDWRTELASPNSHDVLDPSRFASLLNSKGIDRNHTVVVYGDKQNRWAAH
FT                   LVWILTLFGHTDVRLLDGGRAAWLAEGRETTLDFPRLAQADYPLVKRDDETNRVFRDQL
FT                   ARSLGSCTVLDVRSPEEYAGPRRPVPEYPVERSARAGHIPSAKNIPWASAIHPSGHFLS
FT                   AAELTQVFDGLAEGKRSKVVTYCQIGERSAHTWFVLKFLLGVSSARNYDGGWSEWGNTV
FT                   AAPFATGEEPGAP"
FT   gene            complement(498904..499635)
FT                   /locus_tag="Srot_0521"
FT   CDS_pept        complement(498904..499635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0521"
FT                   /product="maf protein"
FT                   /note="KEGG: nfa:nfa9920 Maf-like protein; TIGRFAM: maf
FT                   protein; PFAM: Maf family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97005"
FT                   /db_xref="GOA:D6ZCG3"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCG3"
FT                   /inference="protein motif:TFAM:TIGR00172"
FT                   /protein_id="ADG97005.1"
FT                   /translation="MADSPTSLRVVLASGSPSRRALLRGAGVEPEILVSDVDEEAIAAG
FT                   LGPQADPGDVVAALAEAKAEAVAARLIEAASMGGPPSSGAQILVIAADSAFLSGGELHG
FT                   KPHLPDVAWSRWQKMSGQVGTLLTGHCLLRIADGRIVARAQEVARGDIQFGDLTGDEAR
FT                   AYLATGEPLEVAGAFTLEGRGSWFIDRVEGAPSTVIGLGLPVLRRLLAEVGLDVAALWR
FT                   AAGTAERLSAPDGELPVTTPR"
FT   gene            complement(499660..499932)
FT                   /locus_tag="Srot_0522"
FT   CDS_pept        complement(499660..499932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0522"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: car:cauri_0561 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97006"
FT                   /db_xref="InterPro:IPR032716"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCG4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG97006.1"
FT                   /translation="MTASTVVPHATEETSRGPIDFTVVKGNPTDEEVAALSAVLAELWA
FT                   QRLWERDTRRHPRDLWRAGDQQLSYIPGGLPQSFLQEPSPPWRGA"
FT   gene            complement(499985..500167)
FT                   /locus_tag="Srot_0523"
FT   CDS_pept        complement(499985..500167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97007"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCG5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG97007.1"
FT                   /translation="MCSHAFEHAEESSGPPKHRIMRDTHHAFTVRRAAAPRPDIMEDLR
FT                   FQHAATESWGFVKIS"
FT   gene            500223..500963
FT                   /locus_tag="Srot_0524"
FT   CDS_pept        500223..500963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0524"
FT                   /product="transmembrane protein"
FT                   /note="KEGG: mmi:MMAR_2455 transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97008"
FT                   /db_xref="GOA:D6ZCG6"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCG6"
FT                   /inference="similar to AA sequence:KEGG:MMAR_2455"
FT                   /protein_id="ADG97008.1"
FT                   /translation="MTSLAQAAPLRWAARFPVTLCYVLGLAAVAFFQRGLSDARGQQLV
FT                   SQTSTNLRNLAEGRWLTLLESAFVTQEDPSRIWVWLPGFACLLALGEWIWRSRRLAGAI
FT                   VLSHVGGTALVALGLVVALRLGWAESSVVDDDDVGVSYASMGAFGALIGAVPRALRLPW
FT                   AAWWLAAAALALWRDRDFTSAGHLVSLCLGLMAGAWFARGGERTRWTPLMLCLAAVAFV
FT                   FSFDVLVDVRAFGFDPQAPAASPP"
FT   gene            complement(500960..501484)
FT                   /locus_tag="Srot_0525"
FT   CDS_pept        complement(500960..501484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0525"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   fra:Francci3_0826 phenylacetic acid degradation-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97009"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCG7"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ADG97009.1"
FT                   /translation="MTMPPEPRTPDSWGPARSKTVQWHDPAPNAAAGRRMSGAEYLAAM
FT                   RDGRLPGPPISGLLGMELVSFGEGEVVFRCVPDDSAHNPIGVVHGGLVCALLDSVCGCA
FT                   AHTMLPAGVGYTSIELKVSYVRPVRSGDELTAKGWLVKPGSRVSFAEGEVRNQDGKVVE
FT                   TASSSLLIMKP"
FT   gene            complement(501574..502152)
FT                   /locus_tag="Srot_0526"
FT   CDS_pept        complement(501574..502152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0526"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: swi:Swit_3968 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s)"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97010"
FT                   /db_xref="GOA:D6ZCG8"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCG8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG97010.1"
FT                   /translation="MAVTAFFDGTACGPAGAIRYDLRMIRLNLFFALLSLVLALAGPRG
FT                   YGLWGWWGLVAYLVGAVGSVGPWALGLIARIGVLERYDRLEPQFSKAAEALSVASVFIP
FT                   FLRAVNAMLAGVAFGAWLLNKRWLAQAAVLVATGLIALGGPLVQLAVGHRPIASANWAI
FT                   AAAPLAVMALWLLGRRFLRRQPAVRRPVR"
FT   gene            complement(502170..503123)
FT                   /locus_tag="Srot_0527"
FT   CDS_pept        complement(502170..503123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0527"
FT                   /product="proline iminopeptidase"
FT                   /EC_number="3.4.11.5"
FT                   /note="TIGRFAM: proline iminopeptidase; KEGG: gbr:Gbro_3091
FT                   proline iminopeptidase; PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97011"
FT                   /db_xref="GOA:D6ZCG9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005944"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCG9"
FT                   /inference="protein motif:TFAM:TIGR01249"
FT                   /protein_id="ADG97011.1"
FT                   /translation="MRSLYPEIEPRATGHLDVGDGQRIFWEQVGNPEGKPAVFLHGGPG
FT                   GGINPKQRRFFDPKRYNVLLFDQRGCGRSTPHAGENPDLSLNTTWNLVSDIEKLREQMG
FT                   VERWLVFGGSWGSTLALAYAQTHPERVSELVLRGVFLCRESELDWFYNPGGASQIFPDL
FT                   WEEYLAPIPPAARGGNLIEEHAKLLWGRDQSAAEASAFAWTGWEDRTIGLTVDPHDREK
FT                   DPRTALAFARIENWYFQNKAFLRENQLLEDVDKIRHIPAAIVHGRYDVICPVASAWELH
FT                   RRWPESKLTITAQSGHTAFEAENTHHLVEATDAFAQ"
FT   gene            complement(503218..504045)
FT                   /locus_tag="Srot_0528"
FT   CDS_pept        complement(503218..504045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0528"
FT                   /product="3-methyl-2-oxobutanoatehydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="TIGRFAM: 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase; KEGG: mva:Mvan_3602
FT                   3-methyl-2-oxobutanoate hydroxymethyltransferase; PFAM:
FT                   Ketopantoate hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97012"
FT                   /db_xref="GOA:D6ZCH0"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCH0"
FT                   /inference="protein motif:TFAM:TIGR00222"
FT                   /protein_id="ADG97012.1"
FT                   /translation="MSVSAAPYATQTRPRVRISHLHEMKREGRKWAMLTAYDYTTAALL
FT                   DAADIPVLLVGDSAANVVYGHDTTVSVEADELLPLVRGVARGAQRALVVADLPFGSYEA
FT                   SPAQAFETAARFARAGAHAVKLEGGEDYAEHISSLSRAGIPVMAHIGFTPQRVNSLSGF
FT                   RVQGRGDEAETLVHDAIAVAEAGAFAVVMEMVPAELAAQITAKLTIPTVGIGAGPDCDA
FT                   QVLVWQDMAGLTAGRTAKFVRRFAELGAALGEAAREYARDVESGAFPAPEHSY"
FT   gene            504230..505825
FT                   /locus_tag="Srot_0529"
FT   CDS_pept        504230..505825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0529"
FT                   /product="TAP domain protein"
FT                   /note="PFAM: TAP domain protein; alpha/beta hydrolase fold;
FT                   KEGG: rha:RHA1_ro01168 proteinase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97013"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCH1"
FT                   /inference="protein motif:PFAM:PF08386"
FT                   /protein_id="ADG97013.1"
FT                   /translation="MKEVFSVAAWGGAFLGKSGPRRARALAIVSATAAAAGVALVACPR
FT                   SASAPDMPEALKPFYDQQVVWGSCQGYVADFKPSPRTECAMVKVPVDYQNPKGESAQIA
FT                   VYRIKAAGQKIGSLLFNPGGPGGSGVGFVSGSASALVKLDIAQRFDLVGFDPRGIGHST
FT                   PSVHCLSDKEQDALRALNDNDYTPAGIARQETRNKDYAQKCAQRTGANFLAHVNSMDVA
FT                   RDMDVLRQALGDEKLNYVGYSYGTRIGTDYAELFPTHVRAMVLDGALDPNESPVDKLVN
FT                   QAKGFEDAFRIFAADCATQDHCPLGNDPAQADEKFRALVLPLIEHPVNTRDGRGLGYSD
FT                   AVLGTIQALYSKQLWVALREGLTEVKAGSGNILQLLSDLYMDRDSKSGHYSNEQDANIA
FT                   VRCVDDAPTTDRSVVDQMDVQGRKVAPFEDDERGTGHGALDPCAFWPVKPTIAPTISSP
FT                   PVGLPKIVVVSTTNDPATPYQAGVELAKQLGASLITYNGTQHTVSLQDQSQCVDNAVQQ
FT                   YLIDLKSPADGLTC"
FT   gene            506073..507095
FT                   /locus_tag="Srot_0530"
FT   CDS_pept        506073..507095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0530"
FT                   /product="Polyprenyl synthetase"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: cai:Caci_6665
FT                   polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97014"
FT                   /db_xref="GOA:D6ZCH2"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCH2"
FT                   /inference="protein motif:PFAM:PF00348"
FT                   /protein_id="ADG97014.1"
FT                   /translation="MTNLAASIGTKAFCRSVEDRVRQQVDSLPPAIRGPACHHFGIREA
FT                   GGKSPGMGKIARSRLCAELASMVDGPHVTIPRERAITAATAIEMIHNFGLIHDDIMDQD
FT                   EERRGRKAVWVAYGTGMAILLGDILLATAVKIAASVGNTRIADIFNQAIGKLIEGQLLD
FT                   MGSNIGTTLEELWGIAEKKTASLFELAAMSIAELACVTQRQGEAMESFSRHYGVAFQYM
FT                   NDAASFFAGNSHDPRALSDIKNRRATLPAVLLVQNALPGSDALIAHFSDDQPLTGGAAY
FT                   EIMRALRSDAVRDMARQAVLQELEMAQNALSAEFEPCSVLALASEMLDSKILGGLMSPC
FT                   "
FT   gene            507089..507973
FT                   /locus_tag="Srot_0531"
FT   CDS_pept        507089..507973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0531"
FT                   /product="UbiA prenyltransferase"
FT                   /note="PFAM: UbiA prenyltransferase; KEGG: cai:Caci_4968
FT                   UbiA prenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97015"
FT                   /db_xref="GOA:D6ZCH3"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCH3"
FT                   /inference="protein motif:PFAM:PF01040"
FT                   /protein_id="ADG97015.1"
FT                   /translation="MLKERVRREISITLRLNINNIWVAMFPAVVFAAAGWVSNGSSSAT
FT                   EALKFLAALVWSYFFSYVFDAANQAVGCEEDVLNKPHRPIPHGLVDSRGLWARYRWASA
FT                   LFVAVSLVGNATTLAASLGWVLVTLFAHTQLKPRHYYLWKPVTTWLGVVAQLAGGWSFM
FT                   DDLASESIMWIVVVATMFIVAQPIEDVRDIAGDTRMGKVSLAYLFGAKKVCVAFCLIIA
FT                   AWPFLAYALFLHSSTLSPWEWGALLLLGALCGIAFHHAYQWNSLHHQRRAYIVYCFAYI
FT                   ALTLVPLSCLVSR"
FT   gene            507992..508561
FT                   /locus_tag="Srot_0532"
FT   CDS_pept        507992..508561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0532"
FT                   /product="isopentenyl-diphosphate delta-isomerase, type 1"
FT                   /EC_number="5.3.3.2"
FT                   /note="TIGRFAM: isopentenyl-diphosphate delta-isomerase,
FT                   type 1; KEGG: nfa:nfa19790 isopentenyl-diphosphate delta-
FT                   isomerase; PFAM: NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97016"
FT                   /db_xref="GOA:D6ZCH4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR011876"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCH4"
FT                   /inference="protein motif:TFAM:TIGR02150"
FT                   /protein_id="ADG97016.1"
FT                   /translation="MESAFTKEESRWLMEFARGNVGTVDLVDAQGRSTGVRPVADAHRA
FT                   PGVLHRAFSVLLLRDGNEMLLQRRSVAKERWPGFWSNSCCGHPRSADTLVDDAKRRVFE
FT                   ELGIRVDALEHAGSFVYRATLREWTEHEYDHVLIGNMAGEDSLLRPDPKEIGELLWLPV
FT                   QDSLEALRQVTPWLPLVLEQVRARLA"
FT   gene            508644..509984
FT                   /locus_tag="Srot_0533"
FT   CDS_pept        508644..509984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0533"
FT                   /product="glutamine synthetase, type I"
FT                   /note="KEGG: rop:ROP_08930 glutamine synthetase I; TIGRFAM:
FT                   glutamine synthetase, type I; PFAM: glutamine synthetase
FT                   catalytic region; glutamine synthetase beta-Grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97017"
FT                   /db_xref="GOA:D6ZCH5"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCH5"
FT                   /inference="protein motif:TFAM:TIGR00653"
FT                   /protein_id="ADG97017.1"
FT                   /translation="MNRQEEFVLRALEERDIRFVRLWFTDVLGYLKSVAIAPAELEGAF
FT                   AEGIGFDGSSIEGFSRVYEADMVAKPDPSTFQVLPWTTSSGKHHSARMFCDIAMPDGSS
FT                   SWADSRYVLRRQLNRALELGFSCYVHPEIEFFLLKDSPSKLAPPVPADDGGYFDQAVHD
FT                   SAPDFRRHVVHALEFMGISVEFSHHENAPGQQEIDLRYADALSMADNVMTLRYLVKEVA
FT                   IQEGVRATFMPKPFTQHAGSAMHTHMSLFEGEANAFHSPDDPLQLSPIGKSFIAGILEH
FT                   ANEISAVTNQWVNSYKRLVQGGEAPTAACWGASNRSALVRVPMYTPNKASSRRIEVRSP
FT                   DSSCNPYLTFAVLLAAGLRGVEKGYDLPAQAEDDVWSLSSAERKAMGYRPLPESLSEAL
FT                   TAMEGSELVAQALGEHVFDYFLRNKRHEWSEYSRQVTPFELHNYLAL"
FT   gene            complement(510030..511040)
FT                   /locus_tag="Srot_0534"
FT   CDS_pept        complement(510030..511040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0534"
FT                   /product="malate dehydrogenase"
FT                   /EC_number="1.1.1.37"
FT                   /note="TIGRFAM: malate dehydrogenase; KEGG: rop:ROP_63030
FT                   malate dehydrogenase; PFAM: Lactate/malate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97018"
FT                   /db_xref="GOA:D6ZCH6"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001252"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010945"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCH6"
FT                   /inference="protein motif:TFAM:TIGR01759"
FT                   /protein_id="ADG97018.1"
FT                   /translation="MPHDLPGKDQPVVVAVTGAAGNIGYSAVFQIASGAMLGPGRRIVL
FT                   RLLETPAAARAAEGVAMELMDCAFGLLDSVEVHDDPAAAFAGANVALLVGAKPRARGME
FT                   RSDLLRANGGIFGPQGRALNEGAADDIRVIVVGNPANTNALIALSHAPDIPPERFTALT
FT                   RLDHNRALAQLAVKAGVRVGEVSRVSIWGNHSSTQYPDVFHARAGQLSGAQLAEDRSWL
FT                   ADEFIPTVAQRGAAIIEARGVSSAGSAATAAIDHIRDWALGREWGGDWTSVALPSPGVY
FT                   GVPEGLVSSFPARSVNGEWLIVEGLHVGEFSRARIDASVAELVSERDAVRALGLL"
FT   gene            complement(511084..512133)
FT                   /locus_tag="Srot_0535"
FT   CDS_pept        complement(511084..512133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0535"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mab:MAB_0706c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97019"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCH7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG97019.1"
FT                   /translation="MRRIRPSANDAARRRPFRVAAMMLCAVVLTAGAGGCSADRSAEAR
FT                   AIGNAVRALPGVAAADVAYRSGASFRLDVTLAETASQTQAAAVGSTFVDRMRAGDFGGF
FT                   DVILNVAYPANSSRATKTSDSHASFQYHFRSAPENAASNPNPSSAEVASSLALWLQTAQ
FT                   SPATVGATVHQEALPGTNSRRSIVVSISSSVDDEAIAELIDAHPELRDATWKSSVPPGA
FT                   ARREFRVYRIHGQFPDRERRELWQQILERLGPDDDGDAVTDPAGAQASGALTNVKIDLW
FT                   AKPNTNERVEGITRAVVPLLPGLGSPVRVNIFSYTESVELILGGCSQPSPNHRPSALEA
FT                   ELRRQYERC"
FT   gene            512353..512853
FT                   /locus_tag="Srot_0536"
FT   CDS_pept        512353..512853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0536"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: rop:ROP_57200
FT                   hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97020"
FT                   /db_xref="GOA:D6ZCH8"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCH8"
FT                   /inference="protein motif:PFAM:PF07681"
FT                   /protein_id="ADG97020.1"
FT                   /translation="MPVWVRDFALLVLRLGCAFCLIPHGWNKVTNWGFSGTAAGFAQMG
FT                   VPYPELSAAVAIAAELVGAVLLALGLLTPLASSAVIVAMLGGLLTAPNHVFTGGGMTGG
FT                   LLPWHTAGKALDRGVGFLDEKWLGVSAFQFCLLGLAVLITGPGGISLDWVLFKHSRWLA
FT                   PRS"
FT   gene            512975..514189
FT                   /locus_tag="Srot_0537"
FT   CDS_pept        512975..514189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0537"
FT                   /product="monooxygenase FAD-binding protein"
FT                   /note="PFAM: monooxygenase FAD-binding; fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; KEGG: mab:MAB_3330 putative salicylate
FT                   hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97021"
FT                   /db_xref="GOA:D6ZCH9"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCH9"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ADG97021.1"
FT                   /translation="MQRLRAAVIGGGIGGLAAAIALRENGLSAVVFEKAQELREIGAGV
FT                   VVRANGMRALASIGARSAVGEVALPVRCRPPQMWHGDSLSPDADPHGNGTLESPVVYPA
FT                   HRGELQRVLKEQLPSEAVRLGHTLERVAEDEDGVEVFFANGEHERFDLVIGADGIHSVV
FT                   QGCIGEPVLPEGQGIMAYRGLVPAERLVGKAETARLCQWLGQDRYFITYPVCRGRLLNV
FT                   VASVPNTLPEGSWSAPGDIADFAREYEDWHPEVRRVIDAMDHTFRWGIYDRPPLSRWTS
FT                   GRVALIGDAAHAMLPYLGQGVNTAMEDAVTLGVLLAGADTGELAGRLRMYEDVSRDRIH
FT                   RIQQSSRRMGRIYRDARLGADDRRERMAAELQGGSWLAGHDAERTARSALAQLVRAGRS
FT                   LENSR"
FT   gene            complement(514326..514413)
FT                   /locus_tag="Srot_R0013"
FT                   /note="tRNA-Ser4"
FT   tRNA            complement(514326..514413)
FT                   /locus_tag="Srot_R0013"
FT                   /product="tRNA-Ser"
FT   gene            complement(514805..515347)
FT                   /locus_tag="Srot_0538"
FT   CDS_pept        complement(514805..515347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0538"
FT                   /product="CMP/dCMP deaminase zinc-binding protein"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   mjl:Mjls_5341 tRNA-adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97022"
FT                   /db_xref="GOA:D6ZCI0"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCI0"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ADG97022.1"
FT                   /translation="MSTDRQNPATEDFDAGDPDAALMREALAAAGAAGELDVPVGAVVF
FT                   GPDGKELARAANAREAFGDPTAHAEILALRQAAAILGDGWRLIGCTLAVTLEPCTMCAG
FT                   AAVNARIARIVFGAREPKTGAVGSLWDVVTDPRLNHRPQVRSGVLEAECAELTRSFFRK
FT                   LRARQTPKTAIAENGNR"
FT   gene            complement(515477..515986)
FT                   /locus_tag="Srot_0539"
FT   CDS_pept        complement(515477..515986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0539"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rer:RER_03290 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97023"
FT                   /db_xref="InterPro:IPR023869"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCI1"
FT                   /inference="similar to AA sequence:KEGG:RER_03290"
FT                   /protein_id="ADG97023.1"
FT                   /translation="MSSQHAKGPVGLAVAVVREEGRWRVLGLSPKVLTSLEQAERELRE
FT                   LRSTSAVFGLINVDDEFFVIVRPGPGSSRLLLSDATAALDYDLAADVLDELHVEIPDPD
FT                   ELDDDEEPWAEGDFGILEDLGLPESVLGLIVSESDELYADEQLAALARQLGFEEELEKA
FT                   DQRPRG"
FT   gene            516106..517059
FT                   /locus_tag="Srot_0540"
FT   CDS_pept        516106..517059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0540"
FT                   /product="Prephenate dehydrogenase"
FT                   /note="PFAM: Prephenate dehydrogenase; KEGG: rer:RER_03280
FT                   prephenate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97024"
FT                   /db_xref="GOA:D6ZCI2"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCI2"
FT                   /inference="protein motif:PFAM:PF02153"
FT                   /protein_id="ADG97024.1"
FT                   /translation="MAIRDSSPVCVIGLGQIGGSVVKAAAEAGREVFGYVRSARTFDAA
FT                   RAAGFTVFGELESALKHAELRRAVIVVAVPLPATGGVFARIAAFGGSCVVTDVGSVKAP
FT                   ILAAAEEHGLGGRFVGGHPMAGSANSGWAAADAALFHGAAWVVSVDEAVTAAGFAEVAR
FT                   LALGLGAVVVPALAAEHDRAVARISHLPHLLAAVLANTGAAGGELALGLAAGSFRDGTR
FT                   VAGSDPALAEAMCANNTAAVIEALDEALDALNAARTKLGLTGLPGPVVRSGRESRAAYD
FT                   RIAAQRPVIAGVDLEEPDWRERLAEAGRRGAILRRL"
FT   gene            517178..518713
FT                   /locus_tag="Srot_0541"
FT   CDS_pept        517178..518713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0541"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; KEGG: msm:MSMEG_1517 SPFH
FT                   domain-containing protein/band 7 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97025"
FT                   /db_xref="GOA:D6ZCI3"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR027705"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCI3"
FT                   /inference="protein motif:PFAM:PF01145"
FT                   /protein_id="ADG97025.1"
FT                   /translation="MRPVKTERNSLLMTIAIAVVVAVAWLVILLPLLYVKVPPNKVGVF
FT                   TGRGGKPKVIRGGGRLRLPGFERVDYLTLEPLSVRIKLDGALSGSGVPVNLEAVGMVSV
FT                   GASDEAVELAIRRFLGVDRLELRSQLNEILSGSLSEILARTTMEELNADREQLTRKLID
FT                   EASADLSRIGYTVDIVKIAALSDENGFLGSLGRRRIAEAKRDAFVGTAEAERDSNVQSA
FT                   QAKQAGAVAKAESDIAIAQAAQRRDVELAKLRAQVDTENALADQAGTLAETQARKDISI
FT                   AQEQAEAARIEASIAVQELRAEHAQAMLQADVIAFAEAEGQAAIKRAEGQHQAAVLQAE
FT                   SQAMATRKVGEAIADARRSAAQALLAEREAEASGLLALMQAEAEGLRVKLAAEAEGKKQ
FT                   VAEALNRYNSVGARLLALPDVLNALVAATEAASRPIAALDRVAANGNAAASLTALSSVS
FT                   PTVLANVLESFKASGVDLSEMIEDSAADAGASSAAEEESGLDIDLGLYQGAQS"
FT   gene            complement(518727..519632)
FT                   /locus_tag="Srot_0542"
FT   CDS_pept        complement(518727..519632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0542"
FT                   /product="putative F420-dependent oxidoreductase"
FT                   /note="KEGG: mab:MAB_0968c luciferase-like hypothetical
FT                   protein; TIGRFAM: putative F420-dependent oxidoreductase;
FT                   PFAM: Luciferase-like, subgroup"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97026"
FT                   /db_xref="GOA:D6ZCI4"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCI4"
FT                   /inference="protein motif:TFAM:TIGR03560"
FT                   /protein_id="ADG97026.1"
FT                   /translation="MRFSLWASASQSWPDLLDVARLADSGGWHALYLADHFMPRAATAA
FT                   DPGGPMLEATAALSALAAATHRVRLAHLVLSMTYRHPAVLANWAATTDQIANGRLTLGI
FT                   GAGWQENEHRAYGLALGTPKERVDRFAEGLRAIRGLLGQTATTLSGEYYQLDGAVSEPK
FT                   PVQEHMPVLIGASGPRMLSLVAQHGDEWNTWTKPGEFRTAAEPLDAACERHGRDPKSVR
FT                   RSTQAGILVTDEPERARAFEADTRMPSAIAGTAQQIAEKAALWKDEGVDEIIIRDESLG
FT                   RGQRRADACAALWEALSQLR"
FT   gene            complement(519676..521220)
FT                   /locus_tag="Srot_0543"
FT   CDS_pept        complement(519676..521220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0543"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; TAP domain protein;
FT                   KEGG: stp:Strop_1545 TAP domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97027"
FT                   /db_xref="GOA:D6ZCI5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR013595"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCI5"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADG97027.1"
FT                   /translation="MKPMRRFLPSLLAALLIAGCAHTDESGPSGKSAPSSPARPALAWE
FT                   PCPWEGDFLRAIGTERAAQFQHGFELGCASVTVPQDHDKADGQTMRVALSRTRSKDAGG
FT                   KNRPPLLVNFGGPGQPGVREAAAMALRAENDLAAHFDVIGFDPRGVGESEPVVCGPDPA
FT                   QEAKQQVLDPRDPAQLAKLRARVAAVAQDCEAKYGSKLAAINTYQTAQDIDSIRVALGA
FT                   QRIDYLGYSYGTFLGAAYAHLHPRQIRAAVFDSPVDLRRDPVKTEEEAVQAKEKAFDSF
FT                   FDWTKTQPSYADLASARGFLGQGLLDPGAGQLLAGISTLLSSPAKWPDLAEGLRSVMST
FT                   GDSAALRKADPGFSMANWTVLCDDLPQDRRPDDAAVRSLASQWAQKYPTFGLYELGYGN
FT                   GLVTGCAGWPAPAHPVTSDFIDRAAPPAGGAPGPKPLVVSGETDPTTPLAWAAPFTEAV
FT                   GGVLLVTAEPGHGHYLRGGARRAPENGAAEKNCVDAAVDDYLVTGTLPPESSRCPV"
FT   gene            521397..521771
FT                   /locus_tag="Srot_0544"
FT   CDS_pept        521397..521771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0544"
FT                   /product="ribosomal protein S12"
FT                   /note="KEGG: mjl:Mjls_1012 30S ribosomal protein S12;
FT                   TIGRFAM: ribosomal protein S12; PFAM: ribosomal protein
FT                   S12/S23"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97028"
FT                   /db_xref="GOA:D6ZCI6"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCI6"
FT                   /inference="protein motif:TFAM:TIGR00981"
FT                   /protein_id="ADG97028.1"
FT                   /translation="MPTINQLVRKGRQPKGNRVKTAALKGSPQRRGVCTRVYTTTPKKP
FT                   NSALRKVARVKLTSQVEVTAYIPGEKHNLQEHSMVLVRGGRVRDLPGVRYKIIRGALDT
FT                   QGVKNRKQARSRYGAKREKS"
FT   gene            521771..522241
FT                   /locus_tag="Srot_0545"
FT   CDS_pept        521771..522241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0545"
FT                   /product="ribosomal protein S7"
FT                   /note="KEGG: gbr:Gbro_3805 ribosomal protein S7; TIGRFAM:
FT                   ribosomal protein S7; PFAM: ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97029"
FT                   /db_xref="GOA:D6ZCI7"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCI7"
FT                   /inference="protein motif:TFAM:TIGR01029"
FT                   /protein_id="ADG97029.1"
FT                   /translation="MSRKGPAPRRAVVNDPVYGSPVVTQLVNKILLDGKKSVAERIVYS
FT                   ALERARDKTGTDPVVTLKRALENVKPTMEVRSRRVGGATYQVPGPVAPGRSNTLALRWL
FT                   VKFSRARREKTMEERLANELLDASNGLGASVKRREDTHKMAEANRAFAHYRW"
FT   gene            522324..524432
FT                   /locus_tag="Srot_0546"
FT   CDS_pept        522324..524432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0546"
FT                   /product="translation elongation factor G"
FT                   /note="KEGG: mva:Mvan_1281 elongation factor G; TIGRFAM:
FT                   translation elongation factor G; small GTP- binding
FT                   protein; PFAM: protein synthesis factor GTP-binding;
FT                   elongation factor Tu domain 2 protein; elongation factor G
FT                   domain IV; elongation factor G domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97030"
FT                   /db_xref="GOA:D6ZCI8"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCI8"
FT                   /inference="protein motif:TFAM:TIGR00484"
FT                   /protein_id="ADG97030.1"
FT                   /translation="MAGAQSVLTDLNRVRNFGIMAHIDAGKTTTTERILYYTGVNYKIG
FT                   EVHEGAATMDWMEQEQERGITITSAATTCYWNDHQLNLIDTPGHVDFTVEVERNLRVLD
FT                   GAVAVFDGKEGVEPQTEQVWRQADKYSVPRICFVNKMDKLGADFFYTIKTMVDRIGVKP
FT                   LPIQLPIGAENDFEGVIDLVGNRALVWSADTKLGEKYDVVEIPAHLKEQAAEYRQQLLE
FT                   AVAETDEVLLEKFFGGEELTIEEIKGGLRKIVLTSERFLVLCGSAFKNKGVQPLLDAVI
FT                   DFLPSPLDIPATLGHRPNDEEAVVERHPDSNEPFAALAFKIAAHPFFGKLTYIRVYSGK
FT                   IDGGSAVVNSTKGKKERIGKLFQMHANKENPVESAQAGHIYAVMGLKDTTTGDTLSDVN
FT                   DQIVLESMTFPDPVISVAIEPKTKSDQEKMGIAINRLAEEDPTFKVKLDHETGQTVISG
FT                   MGELHLDILVDRMKREFKVEANVGKPQVAYRETIRRTVDKHEYTHKKQTGGRGQFARVI
FT                   IKLEPSVAEDGSGYEFANAVTGGRIPTNFIPSVDAGVKDALQGGVLAGYPLTDVKVTLL
FT                   DGAYHEVDSDELSFKTAGNQALREAARKADPVILEPIMKVEVITPDDYVGDVIGDLNSR
FT                   RGQIQEMSQRGTSRVVSALVPLSEMFGYVGDLRSKTQGRANYSMLFDSYAEVPGGVAKE
FT                   IIAKANGE"
FT   gene            524517..525710
FT                   /locus_tag="Srot_0547"
FT   CDS_pept        524517..525710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0547"
FT                   /product="translation elongation factor Tu"
FT                   /note="KEGG: mab:MAB_3848c elongation factor Tu; TIGRFAM:
FT                   translation elongation factor Tu; small GTP-binding
FT                   protein; PFAM: protein synthesis factor GTP-binding;
FT                   elongation factor Tu domain 2 protein; elongation factor Tu
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97031"
FT                   /db_xref="GOA:D6ZCI9"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCI9"
FT                   /inference="protein motif:TFAM:TIGR00485"
FT                   /protein_id="ADG97031.1"
FT                   /translation="MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITKVLHDKYPDLNE
FT                   ARDFAQIDNAPEERARGITINISHVEYQTEKRHYAHVDAPGHADYIKNMITGAAQMDGA
FT                   ILVVAATDGPMPQTREHVLLARQVGVPYILVALNKSDMVDDEEILELVELEVRELLSSN
FT                   EFDGDNAPVVRVSGLKALEGDQKWVDSVAELMQAVDENVPDPVRETDKPFLMAIEDVFT
FT                   ITGRGTVVTGRIERGVINVNEEVEIIGIKPTATKTTVTGVEMFRKLLDQGQAGDNVGLL
FT                   VRGIKREDVERGQVVIKPGTTTPHTEFEGTAYILNKEEGGRHTPFFNNYRPQFYFRTTD
FT                   VTGEVTLPEGKDMVMPGDNTDISVKLIQPVAMEEGQRFAIREGGRTVGAGRVTKINK"
FT   gene            525999..526934
FT                   /locus_tag="Srot_0548"
FT   CDS_pept        525999..526934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0548"
FT                   /product="Cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /note="KEGG: mbt:JTY_0479 putative mycolic acid synthase;
FT                   PFAM: Cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97032"
FT                   /db_xref="GOA:D6ZCJ0"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCJ0"
FT                   /inference="protein motif:PRIAM:2.1.1.79"
FT                   /protein_id="ADG97032.1"
FT                   /translation="MTKLRPFYEDIEAHYDVENSIEFFSLWLDETLGYTCGYWPRPNMT
FT                   SAEAQIAKFDLALGKLGLEPGMTLLDIGCGWGAGLIRAYEKYDVNVIGLTISPSQYEYT
FT                   KKKLAALDGKRKAEVVLQGWEEYEGKVDRIVSVGAFEHFRVERHGAFFEKAYSMLPEDG
FT                   KMLLHCIVGYSRAALEQMGLWQVDRNLIRYTHLIRNYIFPGAELVDPQSIVSEAAKAKF
FT                   RCDMIQPLGLHYGKTLDVWLENFMAKKDEIIALSSPELYQIYINYLAGSAHYFRTGHIN
FT                   IAQFTLTKKPLPWLETPPNTPPFVFKSWNS"
FT   gene            527297..527749
FT                   /pseudo
FT                   /locus_tag="Srot_0549"
FT   gene            527751..528410
FT                   /pseudo
FT                   /locus_tag="Srot_0550"
FT   gene            complement(528431..529162)
FT                   /locus_tag="Srot_0551"
FT   CDS_pept        complement(528431..529162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0551"
FT                   /product="Isochorismatase"
FT                   /EC_number="3.3.2.1"
FT                   /note="KEGG: mab:MAB_4406 isochorismatase/phenazine
FT                   biosynthesis protein PhzD; PFAM: isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97033"
FT                   /db_xref="GOA:D6ZCJ1"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR016291"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCJ1"
FT                   /inference="protein motif:PRIAM:3.3.2.1"
FT                   /protein_id="ADG97033.1"
FT                   /translation="MSGFRRRELLVAGSALAASSLAGVFGGSEAGADVRPTGSISYPLD
FT                   GLSIPKSLAPWGLDRSRAVLLVHDMQHYFVKPYRLGSDPMKTVLANAKSLLDTARASGI
FT                   PVLYSGQPGGMTPEQRGLFLDLYGTGMPDDDAERAIVPPLERTSADVFITKSKISAFFH
FT                   TDLLDTLRSLGRDQLVIVGVYTFSGVAATSMDALQNDIETFIAADATADYTLDEHRQAL
FT                   AWCAARTARVVTAQSIATALR"
FT   gene            complement(529307..530575)
FT                   /locus_tag="Srot_0552"
FT   CDS_pept        complement(529307..530575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0552"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mmi:MMAR_2797 sialic acid-transport integral membrane
FT                   protein NanT"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97034"
FT                   /db_xref="GOA:D6ZCJ2"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCJ2"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG97034.1"
FT                   /translation="MRKPSPWADLDRDQRSAFLASWLGWAMDAFDFFILTLVLNEIGQE
FT                   FHVSKRQLTFLITVTLVMRPLGAYLFGIWADKAGRRVPLMVNVCFYSTVGFLGAFAPNF
FT                   AVLVVLRLLYGIGMGGEWGIGAALTMEKVPPGKRGFFSGILQAGYASGFLFASVAHLFL
FT                   HSCLGLSWRWLFGLSILPALISLIVRAFVKESEVWVSTQEKMRAHGSSVRAVFFDPAVL
FT                   RRFGYLILLMTAFTSLSHGTQDLYPTFLKETEHAGRALSSAVADWVMIVANAGAIIGGV
FT                   FFGSLSDRIGRRGVIVLGSLTTLPLLPLFTVPHNPWLLGLGMFLVQATTQGAWAAVPAH
FT                   LSELSPNAIRGFYPGVTYQLGNLCTSCNATLQTGMAAAWGYPVSFWVLVGAACVSLAAL
FT                   TWFGPHADGVDFTAQDEKETAFD"
FT   gene            complement(530647..531831)
FT                   /locus_tag="Srot_0553"
FT   CDS_pept        complement(530647..531831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0553"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: art:Arth_0592 proteinase inhibitor I4, serpin"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97035"
FT                   /db_xref="InterPro:IPR023796"
FT                   /db_xref="InterPro:IPR036186"
FT                   /db_xref="InterPro:IPR042178"
FT                   /db_xref="InterPro:IPR042185"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCJ3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG97035.1"
FT                   /translation="MRRAVAFAAAAVLAGCASGAAKEEPHLEALSSRVKFAEIGVDAHQ
FT                   EAVTALARRSAQLALDELDALAPDHDTVFSPWALVRRERIIADANGAGEDPAIAAMIGQ
FT                   LEKWQGDPDSVPNAGADGTPVLRSRTALIADRSLAVAPEFLDLLAENFDMGLYLARGGD
FT                   PKLAEAVNGWALGTVNARFSGPMPGLGAQHGVYFADLTELLAGWRFPFRPEWTSPAPFT
FT                   TAGGASAQPPTMRGVVLARTAAGTGWRAAELPLADGVEMRLVIPVDPRASLSGILPAAR
FT                   TALASAPPAPLGFALPRWSALADLTGAAEATAQAALPRLAPEARASGWSSQAAVAFGEQ
FT                   GVSMAPPPPVSGPGGATAPAPAISFAADHAFCFEIFDPGTGLVLLAGRAAHPGS"
FT   gene            complement(531855..532967)
FT                   /locus_tag="Srot_0554"
FT   CDS_pept        complement(531855..532967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0554"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   mjl:Mjls_2593 alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97036"
FT                   /db_xref="GOA:D6ZCJ4"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCJ4"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ADG97036.1"
FT                   /translation="MTQLSETVLEEPVAKTMQAVVCHGPQDYRVEEMPVPVPGPGEALI
FT                   RVEAVGICGSDLKCFQGAAKFWGDEGRAPWAHTGVIPGHEFVGRVVRIDEDASLRWGVK
FT                   LGDRVSAEQIVPCWECRFCRKGNYHMCVPHDIYGFRRGYNGAMATYMLFPAKSLVHKIS
FT                   GELAPEHAAFCEPLACSLHAVQRAHIRFDDVVVVAGCGPIGLGMIAGAKARNPQHIVAL
FT                   DMKPEKLELAARCGADTTVDISQNDPNGVVLELTEGLGADVYLEGTGHASAVPQGLKLL
FT                   RKQGKYIEYGVFRDAVAVDWTIISDDKELDVLGAHLGPNCWPTAIRMLESQSLPLDDIC
FT                   THQFPLTDFEKGFELVGDGSRSVKVSLIPS"
FT   gene            complement(532951..534465)
FT                   /locus_tag="Srot_0555"
FT   CDS_pept        complement(532951..534465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0555"
FT                   /product="Carbohydrate kinase, FGGY-like protein"
FT                   /note="PFAM: Carbohydrate kinase, FGGY-like; KEGG:
FT                   mjl:Mjls_2566 carbohydrate kinase, FGGY"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97037"
FT                   /db_xref="GOA:D6ZCJ5"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCJ5"
FT                   /inference="protein motif:PFAM:PF00370"
FT                   /protein_id="ADG97037.1"
FT                   /translation="MDLVIGVDIGTGSSKGILAACDGKVLSTALSPHRMSLPRPGWAEM
FT                   DAERDWWDGVCAITRELVEAAPPGSRIAGVCVSGIGPCLLLCDEQVRPLRPAILYGVDA
FT                   RATAEIQELAERFGPEAIAQKCGSALSSQAVGPKLAWARRHEPDVWARTRRWYSSNSYI
FT                   VAKLTGEYIADHHTASQCDPLYLTREFAWNTEWADELLDHVPLPQLAWPSEVVGHVRQE
FT                   ASEATALPVGTPVLAGTVDAYAEAHSVGVRHPGDLMVMYGSTMFFVEVIDSFCHHPALW
FT                   TTAGVQTGSLALAAGTSTAGSLISWLQSVTGGPDFDVLTREAESVPAGADGLLALPYLA
FT                   GERTPIFDYDARGVFAGLTMNHTRGHLFRAAYEGIAFGVRDVLEAFGEAEAPVRRIVAI
FT                   GGGVKSPVWTQAVSDITGQPQAITEQTAGASYGDALLAAVGVGLVTPETDWSHVVCKVI
FT                   PREERRERYDRLHETWRELYRSSKSAVHQLAGEGNDHRRRSSDATV"
FT   gene            complement(534509..535597)
FT                   /locus_tag="Srot_0556"
FT   CDS_pept        complement(534509..535597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0556"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   gbr:Gbro_4483 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97038"
FT                   /db_xref="GOA:D6ZCJ6"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCJ6"
FT                   /inference="protein motif:PFAM:PF03706"
FT                   /protein_id="ADG97038.1"
FT                   /translation="MATQSPEGSAAPGRNPAQMLRRAALVVVVVILAIELWYVAPEVRR
FT                   YWQETKNVRWLWVGACVLAAAASMESFSQVQRTLFASAGVRVSTLRSAAEIYAANSISC
FT                   SLPAGQVLATAFAYRQTRRWGATALVASWQIVMSGLLKGAGLALIGFGGAFLAGVKTTP
FT                   FSLIFMVGGFLAFLFLAQFIASRPEDMSALSSKIFALVNRLRKRPPDEGLLRWQQLLEQ
FT                   AQAVRLSRLDGLKAFSWSMTNWLADIACLACACYATDAHPSLPGLLTAYALGKTAAVAV
FT                   PLLPGGLGVVELVLVPTLTGSGVPSGAAFSAVVIYRLVSFLLVTAVGWVVFFLVFRKSD
FT                   PIHTKQPDEFDQERLETNTPNT"
FT   gene            535652..536809
FT                   /locus_tag="Srot_0557"
FT   CDS_pept        535652..536809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0557"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   rop:ROP_52190 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97039"
FT                   /db_xref="GOA:D6ZCJ7"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCJ7"
FT                   /inference="protein motif:PFAM:PF01594"
FT                   /protein_id="ADG97039.1"
FT                   /translation="MSTQVSDSGQRVQVVLPQDGHIHITLRKLSDWTWRLLVVLLGLVV
FT                   LGKLFLFLEVVLVPVALALLLAAFMSPLVDSLVSRRVPRSLAVGVVLVLVLGVLTGIFA
FT                   FIIQQAIDGWPALQEQVLQSFEQLRVWAEHAGLHFSADQLEKARDTTVHFVQQHRSDIT
FT                   QGVFSTASALVEGVTGFFLALFTLIFFLSDGKSIWEYLTKLVPGESRERVRAAGSSGYK
FT                   TLIGYVRGTVFVAAADAIGIGVGLAVLRVPLALPLASLVFLGAFVPVVGSVLAGSVAVL
FT                   VALVTQGPLVALLTLILLVAVMQLESHVLQPLVLGRAVRIHPLAVILAIAVGVVLAGVV
FT                   GALLAVPLVAVLNTFIGQLVRGQGPESQETLKSEVEQVGEPASLH"
FT   gene            536809..538017
FT                   /locus_tag="Srot_0558"
FT   CDS_pept        536809..538017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0558"
FT                   /product="Uroporphyrinogen III synthase HEM4"
FT                   /note="PFAM: Uroporphyrinogen III synthase HEM4;
FT                   transcriptional regulator domain protein; KEGG:
FT                   nfa:nfa45590 bifunctional uroporphyrinogen- III
FT                   synthetase/response regulator domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97040"
FT                   /db_xref="GOA:D6ZCJ8"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCJ8"
FT                   /inference="protein motif:PFAM:PF02602"
FT                   /protein_id="ADG97040.1"
FT                   /translation="MGMDTTSPESDRVLPERVPPERTLSGYTVGVTAARRADEFAALLT
FT                   RRGAVVLHAPAIVIIPLADDAELERVSREIIQNPPDVAVATTGIGFRGWLEAAEGWGVA
FT                   EELRNALQGSRLVARGPKATGAIRAAGLREAWSPSSESSSEVLERLLEEGVQGLRVAVQ
FT                   LHGATTEFEPLPDFSEALQAAGAQVLAVPVYRWEPPHDQSAMDALIAAVAQGTVDGVSF
FT                   TSAPAVASMLGRAKETGMFEQLLDGFRAQVAALCVGPVTAAPLEALGVPTSAPARSRLG
FT                   ALARHIEEELPRRAKVFRAHGHTIAVLARAVVVDGEVRHLAPSMLTLLRALARQPGRVV
FT                   TREALLASLPGHSADAHAVEAAIGRLRTGLGDPKIVQTVVKRGYRLAADWGVDDFGASA
FT                   DKY"
FT   gene            complement(538079..538474)
FT                   /locus_tag="Srot_0559"
FT   CDS_pept        complement(538079..538474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0559"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: ppu:PP_1062 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97041"
FT                   /db_xref="GOA:D6ZCJ9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCJ9"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADG97041.1"
FT                   /translation="MDIIRVVAAVIIDAQGRFLVARKRGTAVFMQAGGKVEPDEAPLDA
FT                   LVRELDEELGVQIGPEHAQRLGVFEAPAAHEPAATVLAEVYRVACAQEPHAHAEIEEIA
FT                   WITPGADDQRAFAPLTELLLDQFRASA"
FT   gene            538554..539252
FT                   /locus_tag="Srot_0560"
FT   CDS_pept        538554..539252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0560"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiX
FT                   protein"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiX
FT                   protein; KEGG: nfa:nfa45580 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97042"
FT                   /db_xref="GOA:D6ZCK0"
FT                   /db_xref="InterPro:IPR002762"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCK0"
FT                   /inference="protein motif:PFAM:PF01903"
FT                   /protein_id="ADG97042.1"
FT                   /translation="MPPDQASLLLVAHGTRCAEGVAMFEDLRDKVAQLLPDAQVRLAYV
FT                   DVIGPTPEDALRELPGPVVIVPAFLASGYHVRIDLPEQVRRSGRSDTVTAPALGPDVAL
FT                   AEVMAERLTQAGWAGEGQVVLAVAGSNDPAAQAENQTTLRQLEAVLGASVLLGTIGQGS
FT                   PRIAQVVPSLPGPVFIAQYLLADGLFSRKLIDLAPQAKGRAGPLGTHPKVVQLVVRRYR
FT                   EGLAEPRPNV"
FT   gene            complement(539276..540640)
FT                   /locus_tag="Srot_0561"
FT   CDS_pept        complement(539276..540640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0561"
FT                   /product="condensation domain protein"
FT                   /note="PFAM: condensation domain protein; KEGG:
FT                   rop:ROP_63500 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97043"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCK1"
FT                   /inference="protein motif:PFAM:PF00668"
FT                   /protein_id="ADG97043.1"
FT                   /translation="MLVTTIDLVRLDPGGYLQWHSPPQPLGPVSDIPPSANQGFHLNAV
FT                   LLGREGAKNGSDGWLAVTFDVPGRIRPDSLTESFAALMRRHESLRCSFEAVDGNIIRRV
FT                   HPASAVALVAPDAALPMASADELSATLRQKLRSVCDPTRFPAALFAAVDRPETSTVICG
FT                   FDHSAVDALSLAIIAREVRADYLARVAGEPAPTLPEVGSFLDYCAYETGQPPLPQDHPG
FT                   LTIWRQFLTSQKGLFPSFPLDLGVRPGEIEPQRTVVRELLDENGAERFETFCHSHEGSL
FT                   YSGELTALAGAVRDLGGPERIATLTPMRILLRPEWEEAVGWFVTNIPLVFRCGTDFADG
FT                   VRQNRLAFREALPAAQVPMGQVLSGRAGAFELVRRDVSMVSHIDYRKVFAASAADTERR
FT                   TTHISNTTVADDAQFWFSRTSQGLWLRIRHPDTAVARETVGRLCQRLEAILREQC"
FT   gene            complement(540660..542204)
FT                   /locus_tag="Srot_0562"
FT   CDS_pept        complement(540660..542204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0562"
FT                   /product="condensation domain protein"
FT                   /note="PFAM: condensation domain protein; KEGG:
FT                   rha:RHA1_ro06288 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97044"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCK2"
FT                   /inference="protein motif:PFAM:PF00668"
FT                   /protein_id="ADG97044.1"
FT                   /translation="MNQPAKGVHDGADTAVSRARPTEQHGIQTPVNLWQPPAGKIWEWR
FT                   VSAPAASSGPGAPVSAVPASYIQERHIRRAAANAQLPTPPPAVWEAVSVDFEAPLDREA
FT                   LGEVWQQFLKRHDSLRSWFEVQEVAAIGNAGQAISKVVRHEVDPATLTWELVEGPTFET
FT                   SAQVRDHLVSRFDANTSPLRWPALVFAAVEHAGGFHAVYAEDHSFCDGYSNLIAIVEIK
FT                   SLYASIAEDEPLMLPDPGSQLEAAREERERLASLTIESPETQRWIEYYHTLGGQLQKFP
FT                   LPLGGEADQPGGKVLAFELLTEAEAEVLHQYCKQRGGSFTAGLYAAFAATNYELGGIDQ
FT                   FNMLRAVATRDDERYTYTHGWFINTIPVVFDLRGADDFADLVPRAREAMTATKDLTSVP
FT                   IQRVIDLVAEATGAADSTGIPFQPPPMISFIDVRLFPKWLATKETSYHKIVQPVPPTTT
FT                   VFNWLNRYHDVLELIVYFPGNPIAEASIRKYVEHLRGVFLDVVRTGGHAIAQLSHA"
FT   gene            complement(542395..543852)
FT                   /locus_tag="Srot_0563"
FT   CDS_pept        complement(542395..543852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0563"
FT                   /product="condensation domain protein"
FT                   /note="PFAM: condensation domain protein; KEGG:
FT                   rer:RER_21220 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97045"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCK3"
FT                   /inference="protein motif:PFAM:PF00668"
FT                   /protein_id="ADG97045.1"
FT                   /translation="MEFVELFDYPITPGRVTHWMAHAETVMRDWPVDPRPASFVHEAHL
FT                   RAYTLAKCETRESWIGTALEFEGELDHAAFARTLRLWADRHEVLRSQVELVDLSHPQTS
FT                   PLIRRTLPEGAADFVPIDVGDLHSATAVHRELSQQFDTIASPSRWPGYVFSTLERDDGT
FT                   FTVLFVADHSLLDGYSIYLLGNELVQLYRQVLVEAPDFTPEPAGDKDSYVDFSAEERVA
FT                   AQAVGPEHPAVRAWDAVLKDGGAVTFPLPLEDMRSHRGKVAQRGYMSWLLDSQLSEDFS
FT                   EACKAAGGNYQAGIIAALALSTKLTSDREQFSAVMPFHTRNHPRWAESLGWFVGVAPMT
FT                   VDLRMSDSFSSALPLAQQTQQTGRLIASVPYARVRELLGPTRDNSFLVSFINGFAIPGI
FT                   DQWQEWRLRGLRSKNYSDDEVALFFNRSPSGLVLCGRYPNTETASRNVHKYLSTFRRIV
FT                   VSVAETGEFALSGQKLAARAERLRQPA"
FT   gene            544072..547149
FT                   /locus_tag="Srot_0564"
FT   CDS_pept        544072..547149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0564"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: rer:RER_22180
FT                   ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97046"
FT                   /db_xref="GOA:D6ZCK4"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCK4"
FT                   /inference="protein motif:PFAM:PF00580"
FT                   /protein_id="ADG97046.1"
FT                   /translation="MDRMSPRQLFEEPARLFQDLASGRRGPFMVRGGPGSGKTRLVVDL
FT                   ACHWAPQPGTVTVVLTSNRAAADRLRAQIHGRLLRASPQLALAKPLVRTTHSYAFALLE
FT                   ARARASGNPPPRLIPAAEQDATLRELAIDQAARWPEPLRAALGSMEFTAQLRSVFQRAA
FT                   QHGHGPEGLIALGTARARPEWVAAGRTWREYEQVMTLRGAVGMADPAASPGALDAAELL
FT                   GAALDAVAEDPDLLLHPLGKPGSRFVVFVDDAQHFDPQAARLSSLAARRADLAVCTVDP
FT                   DQSVFWFQGAQTGPGLWREAEQLRLGPSQRLSSSVAQLVAAVAPRSAPQVATCRESAGE
FT                   AQTRLYPTVAAQAEGVVEALCRAHARDQVPWSRMAVLVRSVPVLEPSLARAAALADVPL
FT                   RLAAMSGPLAANTAVSALLSLLKALARKALEPATALELLVSPIAGASVAQARSLRRLLR
FT                   AQEPDRPSLDLLAELVLGAREHDVPEPVLRLRRVWRAACEALGAPAPTVETVLWAAWSA
FT                   SGLEERLPEGDFAAVRALFAAARAQRAADAADAAAELARFAERVERERLPVSATLGDGG
FT                   GSDAVTLLSAHAAAGQEWDVVVVCGVQEGLWPGFSESSSLLGVDELAAALAGTPAEAKL
FT                   DARKQVLAQERRLLYLACSRAREQLLVTAVEGEGDLVPSRFLAPLAPLALRTQEHGPAE
FT                   RAAAAPPPAPATPWSSAGVVAELRALACGADQHRAQRAAAALAALAQAGVIGAHPKSWH
FT                   GLAEVSTSEPLAKDGSLTLSPSRVQQLLDCPLRWLFERAMPAAPGEAAAIGTAVHLLAS
FT                   VADRFPEDELQAALDAAARAADERSARPPWAAQRRREQLARLFAAFMAWRNASRGELTQ
FT                   VGVEIPVEMSVSGVTLRGRIDRLERTARGELVIVDLKTAATPRSAASVREDPQLACYQL
FT                   VVRMARDEPVAGGKLVYLGALRQETGAAEREQPALTEEEAAQWNSTIREAAAAAAGPQF
FT                   RARPNQHCGSCPGRRCCPALQSAPGAPLAGAAGGAR"
FT   gene            547146..550334
FT                   /locus_tag="Srot_0565"
FT   CDS_pept        547146..550334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0565"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: rop:ROP_64380
FT                   putative ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97047"
FT                   /db_xref="GOA:D6ZCK5"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCK5"
FT                   /inference="protein motif:PFAM:PF00580"
FT                   /protein_id="ADG97047.1"
FT                   /translation="MIGPRLLAQAIGAPVPSEEQEQVIGAPLASSAVLAGAGSGKTETV
FT                   AARVVWLIANGLVEPEHVLGLTFTRSAARGMLARVRARLAGFAASPLLERVDPTGRLGE
FT                   LLENSEPQVMTYDAYAGELVSRWGLLLGASATEAAAGGRVVLSEAGMWQLAYETVANWE
FT                   SLLSVDRGVAGVAEAVTALGRRMAEQLAAPDRVLAAAEELARLVRTLPKGPRQRAEPSL
FT                   ELREAVAVQQARAELLGVVARMQDRLRSSGAVDFATQTARAAELAQRFPQVRAEECAAH
FT                   RVVLLDEYQDTGHAQRILLRALFGPPRIGGAARGGGANGAAVTAVGDPHQAIYAWRGAS
FT                   SGNLAAFQADFGAPEALTLMTSWRNPASVLDLANLTAAPLRRAGIAVPELAARPDAPAG
FT                   EVRVALFDDAAAERAWIAERLRHAAQTSPTRPSMAVLVRRNADAVPVAEALTAAGLEAQ
FT                   VIGLGGLLATPQVAELVAMLELIADPGASAAALQVLTSPRWRIGARDLAALAQRAQELG
FT                   PGRARPLAPRDPAELVEQLTAVLADDGSERAGLGDALADLGDQGRYSAAGYARLALLAG
FT                   ELDRLRGQLARPLPEFVTLVERVTGLAVEADAQAKERLSAFASVVAEHAKAAELLGGSA
FT                   SLAGLVGYVRLAETVERGLPVGEVAPDPRKVQVLTVHAAKGLEWDVVAVAHLCAGVFPT
FT                   GRARSTWIGALAELPPEDLGPLTSSQDRAELQEMLRAEREAAKELAGEEERRLAYVAVT
FT                   RAKQTLLLSGHWLAEGAERALGPSAFLVEWRDALVAAGGSPDMWAESPALDHMRPASGE
FT                   SEGALWPPDPLLGRRAQTQRGAERVRAALADAVPLPRPEGPDAELYEAAAALVAERAAA
FT                   AEARSVERAGLTVSDVVGIAVDPAGFERERARRGPRPPAPEAQAGIGFHEWVRRWYLSE
FT                   ELVGLDELPGAADDDDAVASEKLRQKFLESPWAARSPVAVETPFELNLDGVLVRGRIDA
FT                   VFAEPGGGYVVVDWKTGRADLRRAKAQLSVYRLAWQRLTGAAQVAGAVHEVATGVTRTF
FT                   DDLYTAEELAALLR"
FT   gene            complement(550377..551165)
FT                   /locus_tag="Srot_0566"
FT   CDS_pept        complement(550377..551165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0566"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: bfa:Bfae_06260 predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97048"
FT                   /db_xref="GOA:D6ZCK6"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCK6"
FT                   /inference="protein motif:COG:COG4270"
FT                   /protein_id="ADG97048.1"
FT                   /translation="MSISPSLERSERKKLPAAVGKAVHDLDLDRRVADFGDSVAELADR
FT                   LPAPLASFVAPALPPKRSFLAKLLAPFGLDGVLPRSWRFAGKALSLPSRTRKGEIAPAL
FT                   AELRHEFEGLAQLAVDLLPAPLAELTPLRTPAGAAEPAGSWNLVAITAPLLVAGPLHFL
FT                   IPKQFDRIVPPSLPGSARLWTYLSGVAEIGVGALLVIPRTRKLGGLAAAALFAAVYPAN
FT                   VQMAKDFTGKGVLPEAIAFGRLPLQFPLLYGALKIAVTGK"
FT   gene            551204..551605
FT                   /locus_tag="Srot_0567"
FT   CDS_pept        551204..551605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0567"
FT                   /product="putative F420-dependent enzyme"
FT                   /note="KEGG: gbr:Gbro_4095 PPOX class putative F420-
FT                   dependent enzyme; TIGRFAM: putative F420-dependent enzyme;
FT                   PFAM: pyridoxamine 5'-phosphate oxidase-related FMN-
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97049"
FT                   /db_xref="GOA:D6ZCK7"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019965"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCK7"
FT                   /inference="protein motif:TFAM:TIGR03666"
FT                   /protein_id="ADG97049.1"
FT                   /translation="MTALFDQIAAEKYVLLTTYRKDGTPKPLPIWAVRDGDELLIWTVA
FT                   DSWKVKRIRNNPRVTLRACDRTGKNPFGPTVEGTAAILDAAGTERAKQAVKEKYGLFGR
FT                   AMVAASDLRGKARTVGLSITEAPAQAPLP"
FT   gene            complement(551571..552830)
FT                   /locus_tag="Srot_0568"
FT   CDS_pept        complement(551571..552830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0568"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mmi:MMAR_0577 integral membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97050"
FT                   /db_xref="GOA:D6ZCK8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCK8"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG97050.1"
FT                   /translation="MATDQPAPIGQKDQQPFPLGKLVLLSLCMLVVITVEVGPVGVLPH
FT                   IAADLRVPQSRAALLVSCYAITVVLASVPAIRLLDRFDRRQVLMLSMSAFAVSTAALAV
FT                   TRSLPLAVAARVIGGFGHAIFFGVGIDITHRLSPAKRMVPAVAIFFSGNVLALALAVPA
FT                   VAAAGGSGWRGTFLALAGSAGACVVAARLLLPALPSGKADAPPLAGGARRPFFPWPDRP
FT                   AATVCLFGLVWLTGHFLAFTLLRAELTAAGFPDRLAPALLMAYGIGTLAGTGLAGAVAT
FT                   HRLRGAIAVGFLLLCGAQLCLWSLLPSMWPSFAAAALWGIGFGAIPTLNSSAILHYSRV
FT                   SPDMTASMLSSACNIGISLGSFASGLVYQNLGHDSAFLLAAGIFVVGALATRSLHKDGP
FT                   REGLGLTRGARAEGPAQGPR"
FT   gene            552968..554233
FT                   /locus_tag="Srot_0569"
FT   CDS_pept        552968..554233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0569"
FT                   /product="UDP-galactopyranose mutase"
FT                   /EC_number="5.4.99.9"
FT                   /note="TIGRFAM: UDP-galactopyranose mutase; KEGG:
FT                   rha:RHA1_ro04053 UDP-galactopyranose mutase; PFAM:
FT                   UDP-galactopyranose mutase-like; FAD dependent
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97051"
FT                   /db_xref="GOA:D6ZCK9"
FT                   /db_xref="InterPro:IPR004379"
FT                   /db_xref="InterPro:IPR015899"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCK9"
FT                   /inference="protein motif:TFAM:TIGR00031"
FT                   /protein_id="ADG97051.1"
FT                   /translation="MTKPICLMILIPWSAVAPLSSYDLVVVGSGFFGLTVAERAASELG
FT                   KRVLVLERRAHLGGNAWSEPEPETGIEVHKYGAHLFHTSNTAVWDYVRRFTEFTDYQHR
FT                   VFTKHAGQIYPLPFGLALFCQFFGRAFTPAEAKAFVAAQAAEAVGDPDENLENRAVSLI
FT                   GRPLYEAFVRDYTAKQWQTDPKELPAEIITRLPVRLTFDTRYFNDRFEGLPKDGYAAWL
FT                   TKMAEHPLIDVRADVDYFDVAERIREENPQAPVVYTGPLDRYFHWSAGALSWRTLDFET
FT                   EVLDVGDFQGAAVMNYADLDVPYTRIHEFRHFHPERDYPKGKTVVMREFSRFAARADEP
FT                   YYPVNSPADRAKLAVYRELAKREGAERRVLFGGRLGTYQYLDMHMAIASAMRMFENELR
FT                   PYFATGAWPGARSTAATQRGAV"
FT   gene            554230..556203
FT                   /locus_tag="Srot_0570"
FT   CDS_pept        554230..556203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0570"
FT                   /product="galactofuranosyltransferase"
FT                   /note="KEGG: rer:RER_02120 galactofuranosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97052"
FT                   /db_xref="GOA:D6ZCL0"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR040492"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCL0"
FT                   /inference="similar to AA sequence:KEGG:RER_02120"
FT                   /protein_id="ADG97052.1"
FT                   /translation="MSQPEAAQQAAQTPPVGVGAPPTSSASGVRDETLLQRLVLPRAGE
FT                   SAGVRRLYVEHPNSATPRAHAIDRSRLRMRPDTEVSFATYFNAFPAAYWRRWTTLRSVV
FT                   LQVELSGRAGVQVYRSKSDAAPVLLESAVTSGGDQAQTLRFELPLTAFEDGGWMWFDVT
FT                   AEEEPVVLERASWHSPSEPPGGCGPEQSKVAIGIPTFNRPADAVQALLALTSDPVLDAR
FT                   VGAVVMVDQGTKKAKDEPGFAEAASRLGDRLTVHHQGNLGGSGGYARVMHEALTTTKAE
FT                   RFVVMDDDVDVEPESILRLIAFGRWAQTPTIVGGQMLNLQERSHLHSMGEVLDRVRLIW
FT                   EKAPNTRYDHDFARTPLLQTKQLHRRVDVEFNGWWLCLIPRKVLEDVGLPMPFFIKWDD
FT                   VELALRARKAGYPTVGLPGAAIWHMAWADKDDRIDWQSYFHLRNRLIVAALHHDGSRLG
FT                   LYFHLAKATLFHALTMEYSTLALQLKAVRDFKAGPEGLHGLLPKALGEAQSLRKNYPDA
FT                   HVIASATELPLPSGRDMGGTRKPLGRVGKVVRMATAVAHQLSKENPEHHERPQANVSSL
FT                   DAWWWMLSKVDGVTVTVGGGSGVVYRKRSRAEAVRLAKEFAREFVGLARDYSSLAKRYR
FT                   AAAPELTSEKTWLKTFGVKDGA"
FT   gene            556200..557123
FT                   /locus_tag="Srot_0571"
FT   CDS_pept        556200..557123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0571"
FT                   /product="UbiA prenyltransferase"
FT                   /note="PFAM: UbiA prenyltransferase; KEGG: rha:RHA1_ro04056
FT                   phosphoribose diphosphate:decaprenyl-phosphate
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97053"
FT                   /db_xref="GOA:D6ZCL1"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCL1"
FT                   /inference="protein motif:PFAM:PF01040"
FT                   /protein_id="ADG97053.1"
FT                   /translation="MTDIEQGSSVVPSRSNPAVGLIKAMRPKQWVKNVLVLAAPLAALG
FT                   SKTGVSFTDILGPILIAFAAFCLAASGVYLVNDIKDVEADRAHPVKRNRPIAAGVVPPA
FT                   LAAAAAAVLMAASIAISFLANWHLAVVMAIYLCLQLAYCFGLKHQPVLEICVVSSGFLL
FT                   RAIGGGSAANIELSQWFLLVMTFGSLYMAAGKRYAELKVAEETGAKIRKSLEGYTSTYV
FT                   RFVWTLAATSALLSYGLWAFNGHPADAGVWYAVSMVPVVIATLRYAVHVDGGDAGEPEE
FT                   IAFSDRVLQLSALAWIGVMVVAILVV"
FT   gene            557101..558969
FT                   /locus_tag="Srot_0572"
FT   CDS_pept        557101..558969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0572"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa1800 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97054"
FT                   /db_xref="GOA:D6ZCL2"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCL2"
FT                   /inference="similar to AA sequence:KEGG:nfa1800"
FT                   /protein_id="ADG97054.1"
FT                   /translation="MSRFSWSDRFSRPRPTAAATGSRAKDRTFWLASALTTALFMFGAW
FT                   EHRWIADDGLIVLRTVRNLLAGNGPVFNMGERVEANTSTAWTYLVFALAWLTGLRLEYL
FT                   VLGLALVLAAAGLLFATAGSRRLWRRSPGVLLPAGALIYIATDPARDFATSGLENSLSL
FT                   FWLGLLWWSLMRLSEIWERGDKPPRPVLALIAFFAGLAPLVRPELALVGGAVLLLMALA
FT                   PVGWPNRLLVTAAAGAVPVGYQIFRMGYYGVLVPTPAIAKDANGSKWLQGWHYLVDFAG
FT                   PYWLWLPVALIVAMLVAVLRAGLGGDRVGQAHGSAQAHWATRATVIAGVLSAFGVLEMV
FT                   YWMREGGDFMHGRVLLAPLFCALLPLMAMPVALPKSLSRRSVAQAVPALLWTGVAGWAL
FT                   FAAFGAHRGDPTAVNEYGIVDERRFYSANTGHAHPLLAEDYLDYPRMHGLLEAVAENPS
FT                   GGVLLPGWDADWVVDPLPDPPLRGQPYRTTVYFLNLGMSSMNLPLSVRVLDQMGLAYPL
FT                   ASHTERIPNGRLGHDKLLFPDWVIADAGGADDHPYLPAQFDTQWVREAREALTCPETAQ
FT                   LLDSYRAPLTWARFKQNLKHALRLTGYRIDRVPKYELQRCALPPVE"
FT   gene            558978..559053
FT                   /locus_tag="Srot_R0014"
FT                   /note="tRNA-Leu2"
FT   tRNA            558978..559053
FT                   /locus_tag="Srot_R0014"
FT                   /product="tRNA-Leu"
FT   gene            559528..559899
FT                   /locus_tag="Srot_0573"
FT   CDS_pept        559528..559899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0573"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vei:Veis_2776 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97055"
FT                   /db_xref="GOA:D6ZCL3"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCL3"
FT                   /inference="similar to AA sequence:KEGG:Veis_2776"
FT                   /protein_id="ADG97055.1"
FT                   /translation="MPSERFAASWWTLGFGGAMILQGVFRKQFAEHTFWGYNGGWQREI
FT                   AVWNLGTVVTALSLAKEPEAPARAQVRGYAVLSALFAVNHLAAAARSPRSWGHWAAAGA
FT                   NAAGLAVGLPALLRARKAS"
FT   gene            complement(559940..560296)
FT                   /locus_tag="Srot_0574"
FT   CDS_pept        complement(559940..560296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0574"
FT                   /product="MazG nucleotide pyrophosphohydrolase"
FT                   /note="PFAM: MazG nucleotide pyrophosphohydrolase; KEGG:
FT                   ppw:PputW619_0679 MazG nucleotide pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97056"
FT                   /db_xref="GOA:D6ZCL4"
FT                   /db_xref="InterPro:IPR025984"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCL4"
FT                   /inference="protein motif:PFAM:PF03819"
FT                   /protein_id="ADG97056.1"
FT                   /translation="MSGLEQYAGALAEFVAARDWHLYDSPKNLALALGGEVGELMAVMQ
FT                   WLSDEEIRQKTTDDEDFRRALSFEMADVLNYLLRLARHVGVDLIEAAEEKLAVNEIRYP
FT                   VARAKGNATKHNAL"
FT   gene            complement(560293..561381)
FT                   /locus_tag="Srot_0575"
FT   CDS_pept        complement(560293..561381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0575"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   dba:Dbac_1649 GCN5-related N- acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97057"
FT                   /db_xref="GOA:D6ZCL5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCL5"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADG97057.1"
FT                   /translation="MVSASAKPSSIAAQGAFLRPAVESDRGFLREIFTTALSDYYGGDH
FT                   VAHADRVLAAHLRGGEDRHGHFSQAQDTQILATPGADQLGVLNCALKRQGTVKISPLIV
FT                   SPRAKSGAGLGRTLLLHAQQFALRRRARQIYCTVAETNAKALGFFRRHGFVVAGSAQDQ
FT                   YKDGVRELVLYKDLRPQHGRRSWIIRECEENDLPAVVGMVCEFYAPILADQSKQVALSL
FT                   VDGFRRRSRRDLNEKFKDINLGLDENGSLLALAAAGPKKGAAVKVAPLCGRDMEVLSEL
FT                   VALVPDLFPSQRSRYYTHQIAEPDITKVMHKNGWRVDCLLPGAYRSDQCVVQWSLTLGC
FT                   SPDESRPQDLRRAAPDEKAELA"
FT   gene            complement(561755..562183)
FT                   /locus_tag="Srot_0576"
FT   CDS_pept        complement(561755..562183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0576"
FT                   /product="Transglycosylase domain protein"
FT                   /note="PFAM: Transglycosylase domain protein; KEGG:
FT                   mbt:JTY_2397 putative resuscitation-promoting factor"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97058"
FT                   /db_xref="InterPro:IPR010618"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCL6"
FT                   /inference="protein motif:PFAM:PF06737"
FT                   /protein_id="ADG97058.1"
FT                   /translation="MKPHQNPMKPMGRRMRVVLLLAAVALGASSSAALSSPVDWDAIAQ
FT                   CESGGNWAADTGNGFYGGLQISASTWRANGGVGSPAAASPQEQIAVADRIMAAQGPSAW
FT                   PKCAMSTGNAAVGSIPNILTQLEKALPVRPCWIPLRCY"
FT   gene            complement(562180..562743)
FT                   /locus_tag="Srot_0577"
FT   CDS_pept        complement(562180..562743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0577"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mav:MAV_0098 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97059"
FT                   /db_xref="GOA:D6ZCL7"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCL7"
FT                   /inference="similar to AA sequence:KEGG:MAV_0098"
FT                   /protein_id="ADG97059.1"
FT                   /translation="MENAAPPPDAIDTGAEQAGQPPHALRERWHQRHVRVRLIWLFVAG
FT                   AAIAAGWLGWQAFESYQREVAGAQAVRAAKSYVLVLSNINAETVDNNFSELYKNSTKEF
FT                   NDAHSAQAAELRKQLIEKKVSASGSIEEVALISSDVDKATIELLVNESVRNSDSPEPRQ
FT                   DRVRLSLDLEKTGGQWLTSGIRIL"
FT   gene            562921..563232
FT                   /locus_tag="Srot_0578"
FT   CDS_pept        562921..563232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0578"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa10720 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97060"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCL8"
FT                   /inference="similar to AA sequence:KEGG:nfa10720"
FT                   /protein_id="ADG97060.1"
FT                   /translation="MPRRKPNAEPRKGRAPAPRPGPPSFRFATSEAGPDGEEEYVVVAV
FT                   PGAKAVKAYRCPGCDHEIGVGEPHVVAWPAFDASAGERRHWHRSCWQARGRRAPSRRR"
FT   gene            563341..564534
FT                   /locus_tag="Srot_0579"
FT   CDS_pept        563341..564534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0579"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; KEGG:
FT                   rer:RER_38940 acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97061"
FT                   /db_xref="GOA:D6ZCL9"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCL9"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ADG97061.1"
FT                   /translation="MAGSVIVGGARTPFARLLGNLKALTAPQLGAAAIAGALERGGVPA
FT                   DAVELVIMGQVLTAGSGQLPARQAAVAAGLPWSTSAISTNKVCLSGLDAIATADVLIRA
FT                   GENEVVVAGGQESMTQAPHLLPGSRAGFKFGDVALVDHMQYDGLHDVFTEQAMGALTDQ
FT                   VNTAPPSGRWQPVSREDQDAFAAASHQRAAKAWKDGVFANEVVPITVPGRKESLTICED
FT                   EGIRPDATTDSLGALRPAFDKAGAITAGNSSPLSDGAAAVVVTSEAKAQSLGLTPIAKI
FT                   LAHASVAGPDSTLQLQPSDAIAKACAKAGLSPADLDLVEINEAFAAVGVASSRALGLDP
FT                   ERVNVNGGAIALGHPLGASGTRILLHLALELRRRGGGVGAAALCGGGGQGIAVLIQA"
FT   gene            complement(564553..564840)
FT                   /locus_tag="Srot_0580"
FT   CDS_pept        complement(564553..564840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0580"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97062"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCM0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG97062.1"
FT                   /translation="MTHQEDPALYQVIVHHDETGFWIALYDTQRGLRENRTALEADLLL
FT                   DSEDAAPDQVQAVLLEQFGLVPLDAWELVTSRYGQGWQAPFGSAMRAIAA"
FT   gene            565003..565749
FT                   /locus_tag="Srot_0581"
FT   CDS_pept        565003..565749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0581"
FT                   /product="bifunctional HisA/TrpF protein"
FT                   /EC_number="5.3.1.24"
FT                   /note="TIGRFAM: bifunctional HisA/TrpF protein; KEGG:
FT                   nfa:nfa18500 1-(5-phosphoribosyl)-5-[(5-
FT                   phosphoribosylamino)methylideneamino] imidazole-4-
FT                   carboxamide isomerase; PFAM: histidine biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97063"
FT                   /db_xref="GOA:D6ZCM1"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR010188"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCM1"
FT                   /inference="protein motif:TFAM:TIGR01919"
FT                   /protein_id="ADG97063.1"
FT                   /translation="MHASSPLILLPAVDVVDGQAVRLTRGEAGSETGYGAPLEAALAWQ
FT                   EAGAEWVHLVDLDAAFGRGSNRELLAEIIGKLDVKVELSGGLRDDESLRAALATGCARV
FT                   NLGTAAVENPQWTARALAEHGEKIAIALDVLHGQNGWRLRGRGWVSDSGDLWEALERLD
FT                   QQGCARYVVTDVSKDGTLAGPNLRLLGEVADATSAKVIASGGVSSVDDLVAIAGLIPRG
FT                   VEGAIVGKALYAGNFTLQEALAAVAS"
FT   gene            565817..566620
FT                   /locus_tag="Srot_0582"
FT   CDS_pept        565817..566620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0582"
FT                   /product="imidazoleglycerol phosphate synthase, cyclase
FT                   subunit"
FT                   /note="KEGG: rer:RER_34430 imidazole glycerol phosphate
FT                   synthase subunit HisF; TIGRFAM: imidazoleglycerol phosphate
FT                   synthase, cyclase subunit; PFAM: histidine biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97064"
FT                   /db_xref="GOA:D6ZCM2"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCM2"
FT                   /inference="protein motif:TFAM:TIGR00735"
FT                   /protein_id="ADG97064.1"
FT                   /translation="MTLATRVIPCLDVDKGRVVKGVNFVDLRDAGDPVELAKAYDTVGA
FT                   DELCFLDITASSDERATTLDMVTRTAEQVFIPLTVGGGVRDVASADALLRAGADKVAVN
FT                   SAAVARPRLLSELAERWGAQCVVIAIDARRARPPEARSDRPGAAAGPSWSGFEVATHGG
FT                   RRGTGIDAVRWAREAVEFGAGEILLTSMDRDGTKSGFDLELIGAVRAVAPVPVIASGGA
FT                   GTAGHFAPAIHAGADAVLAASVFHFGEIAICEVKAAMAAEGIVVR"
FT   gene            566617..566994
FT                   /locus_tag="Srot_0583"
FT   CDS_pept        566617..566994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0583"
FT                   /product="Phosphoribosyl-AMP cyclohydrolase"
FT                   /EC_number="3.5.4.19"
FT                   /note="KEGG: sen:SACE_5755 phosphoribosyl-AMP
FT                   cyclohydrolase; PFAM: phosphoribosyl-AMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97065"
FT                   /db_xref="GOA:D6ZCM3"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCM3"
FT                   /inference="protein motif:PRIAM:3.5.4.19"
FT                   /protein_id="ADG97065.1"
FT                   /translation="MSESPAPGPAPALDPAVAARLKRNADGLVAAVVQRRGTGEVLMMA
FT                   WMDDEALARTLTSRRGTYFSRSRGRLWVKGETSGNTQEVVEVRLDCDGDTVLVVVDQTG
FT                   PSCHTGTSTCFDSDVLLRPKV"
FT   gene            567038..567568
FT                   /locus_tag="Srot_0584"
FT   CDS_pept        567038..567568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0584"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sru:SRU_1782 aldehyde dehydrogenase (NAD)
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97066"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCM4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG97066.1"
FT                   /translation="MSKTVLRTLALLFGAVLPLNVAPLALADDDDDDGEGASAPPYWNN
FT                   AGPVDPDDPVVVYSDQPTAEVDYEVTGTSRSADLFFGTPGGTLRHQGYVLPFRQKEVAW
FT                   PPVQFMPMFATIPAINDWIALPNGNSRRPGDHSLTGGTATCRIWVSGKLVQERSASGVN
FT                   HTAKCAVTVRFFQ"
FT   gene            567602..568309
FT                   /locus_tag="Srot_0585"
FT   CDS_pept        567602..568309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0585"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_2996 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97067"
FT                   /db_xref="InterPro:IPR038468"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCM5"
FT                   /inference="similar to AA sequence:KEGG:Mmcs_2996"
FT                   /protein_id="ADG97067.1"
FT                   /translation="MLKNARRAQILGALVVAGACGVGLCLGQGDASLVREALAAPTSPT
FT                   VPPPPPGGGGTMPSTYVAPTTGIIDTVVPSSAVVSYQVISDSPEVVTANVKYTEDGAIT
FT                   GFAPVALPWTKPVAVAPPLSIVTVYATLPQSPAVADPEGGGTQADLADATIRCRVLVNG
FT                   AVVKEDSAKGPNATATCSVSVNVDSSLPAAPAPSGAPGAPAPSAAPAVPPAPAVPGEPR
FT                   VTTLAPPAPAPGR"
FT   gene            568431..569333
FT                   /locus_tag="Srot_0586"
FT   CDS_pept        568431..569333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0586"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: nfa:nfa14310 putative transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97068"
FT                   /db_xref="GOA:D6ZCM6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCM6"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADG97068.1"
FT                   /translation="MLNEDLDWFITLAETEHMTEAARLHSMSQPALSRALDRLERRLGT
FT                   RLFDRHGKRLALNQRGRVLYTHARRAVAEVEAAIREIGDMVAAPGVVRLGFLHSFGMWL
FT                   VPKLVSGYREEHPSVNFELTQDAADKVCRRIIDEELDLGIVAPRPNDPKLAWQPLLRQK
FT                   LCLAVPAGHRLSRQDSVRLAEACDEPFILMSQGHGMRRLVEELAAAAGFQPKVAFESTE
FT                   LWTIRGLVASGLGVALIPFEGEEAGGPQGGNVVVLPLEDAGAEREVGLVFKSGMALSAL
FT                   VQDFKQFALQWAFEQRARG"
FT   gene            569479..570405
FT                   /locus_tag="Srot_0587"
FT   CDS_pept        569479..570405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0587"
FT                   /product="methyltransferase"
FT                   /note="KEGG: mab:MAB_4584c hypothetical protein; TIGRFAM:
FT                   methyltransferase; PFAM: O-methyltransferase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97069"
FT                   /db_xref="GOA:D6ZCM7"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCM7"
FT                   /inference="protein motif:TFAM:TIGR00027"
FT                   /protein_id="ADG97069.1"
FT                   /translation="MTTPDAAWARSEGDSWDIVSSVGLTALGVAAMRALETKRDDRLVE
FT                   DPYAEHFVRAAGEENLLALLEQPELAEQSVFDPHRHMGVRSKFFDQFFLSAASAGSRQG
FT                   VVLAAGLDVRAHRLDWPDGQVVFEIDQPQVLAFKREVLAELGASAKSDRREVAVDLRED
FT                   WPAALKAAGFDPSAPTAWSAEGLLPYLPGAAQDLLFQRVVELSAPGSQIAVESFRGRFN
FT                   PTRFQDVQRKYTQDQGNPFAKIDISKLFYNDERADPEQWLRERGWAVRAANILELCDEY
FT                   GVPPMELPEEIRDIVRHMVYFSAVLPR"
FT   gene            570512..571222
FT                   /locus_tag="Srot_0588"
FT   CDS_pept        570512..571222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0588"
FT                   /product="Domain of unknown function DUF1906"
FT                   /note="PFAM: Domain of unknown function DUF1906; KEGG:
FT                   mav:MAV_1648 secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97070"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015020"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCM8"
FT                   /inference="protein motif:PFAM:PF08924"
FT                   /protein_id="ADG97070.1"
FT                   /translation="MTLDRRAVLRGAATLGVASALGLSAPRAHAAGGVLLDFAGAAPSP
FT                   AAIRGAGAIGTIRYVSDERNGPGKRSSKPVTRDQVQVSKAAGLVIVSCYQYGKNETADW
FT                   KGGQQAGLTHARRGVQLHLAAGGPAGAPIYACIDDDPSDAELQGPIRGYLLGWQQIVGP
FT                   NAVGVYGNPRTIDFCLRSGVGKWFWQHDYGNPGYRTHPAAHLHQRAASMQPQPVVGGTL
FT                   CDINDIIKPSFGAW"
FT   gene            complement(571284..571535)
FT                   /locus_tag="Srot_0589"
FT   CDS_pept        complement(571284..571535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0589"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mjl:Mjls_4759 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97071"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCM9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG97071.1"
FT                   /translation="MIRTKAFAFGNAALLTGVCAGLLAVAQAQPAAADAELCGDTPHFS
FT                   GCLSDDGSTRGCIHTRHGHIRLCNDDGGRWRDRDRWDD"
FT   gene            complement(571628..572197)
FT                   /locus_tag="Srot_0590"
FT   CDS_pept        complement(571628..572197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0590"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbt:JTY_3961 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97072"
FT                   /db_xref="InterPro:IPR028953"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCN0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG97072.1"
FT                   /translation="MTDAQSLALSDRFLAWLARAGWAASRWNDDGSFDEQGDCSIWEED
FT                   QGGRVLTAYLLHRRESDGWVEVAKGSAERLVFAASGLAAVERYFWGLLADAVRERLGLR
FT                   ELQARTDIASGYRIEDGLRDAAGRLVAKGEQQSLVALSRSLAPTLDQLETSLLDPEGKP
FT                   LFAVRDATARAETAAILPAPGQPRGA"
FT   gene            572247..573026
FT                   /locus_tag="Srot_0591"
FT   CDS_pept        572247..573026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0591"
FT                   /product="Domain of unknown function DUF1906"
FT                   /note="PFAM: Domain of unknown function DUF1906; KEGG:
FT                   mpa:MAP2334c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97073"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015020"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCN1"
FT                   /inference="protein motif:PFAM:PF08924"
FT                   /protein_id="ADG97073.1"
FT                   /translation="MTLSRRNVLRGMGGAALAAGLVHAAPAWADPDDDADDPEDDAPRP
FT                   KRPGPVNWGLGKMLDYSAGVPAPEAIKAAGYLGSFCYVSDQAKGEEWMKAKPLTRPVAD
FT                   AMRASGLIIASVWQWGGQTTADWRRGHDAGVKAARRAITLHQAAGGPDHAAIYACVDDD
FT                   PTPDLWEDSIADYLRGFEEVIGHERLGVFCNPKTIDWCLDAGLGTYFWQHDWNNDTLAL
FT                   HPAAHLHQLPGRKPWVVQVDNVECDQTAVLNMAFGQW"
FT   gene            573150..573971
FT                   /locus_tag="Srot_0592"
FT   CDS_pept        573150..573971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0592"
FT                   /product="Domain of unknown function DUF1906"
FT                   /note="PFAM: Domain of unknown function DUF1906; KEGG:
FT                   mbt:JTY_2540 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97074"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015020"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCN2"
FT                   /inference="protein motif:PFAM:PF08924"
FT                   /protein_id="ADG97074.1"
FT                   /translation="MVITMALSRRDVLRGLSAAPVLGLGAIAAPARADQESDNADGGLW
FT                   GLGTLVDFSARVPDPAAIKEAGHLGAVRYVSERRPTEPWMLAKPVTSDEVAGMREHGLA
FT                   VASVYQWGKNLTADWRGGYDGGVDAARRGVELHLAASGPADGVIYAALDDDPDRDAFDT
FT                   LIAPYLTAWRDVIGNERLGVYCNPKTIDWCLGAGLGTYFWQHDWGNPSGAEHAAANLHQ
FT                   LPNSKGNLRVIDGVPCDVSVILKPDYGQWGQANAALAASAEQAANDDPVSS"
FT   gene            574021..574488
FT                   /locus_tag="Srot_0593"
FT   CDS_pept        574021..574488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0593"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: ckp:ckrop_0509
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97075"
FT                   /db_xref="GOA:D6ZCN3"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCN3"
FT                   /inference="protein motif:PFAM:PF07681"
FT                   /protein_id="ADG97075.1"
FT                   /translation="MARGIRDVGLLLARLGFAFALLPHGWEKLHDIGFSGTADGFAKMG
FT                   VPFPEVAAGVSIAGEFASSILLALGLLTPIAGLVAVVAMLGAVFTAPKHFFTAGAAHMD
FT                   QGVVNLLDTHWAGSEAFVFAVAALALTVAGPGRFSVDKSLFGRPEWFAPRE"
FT   gene            574970..575410
FT                   /locus_tag="Srot_0594"
FT   CDS_pept        574970..575410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0594"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: acp:A2cp1_1230 translation initiation factor
FT                   IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97076"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCN4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG97076.1"
FT                   /translation="MTYGGRSHGYEDVGPRVKQFGHFESADEEQIDPRILQEKARKAEA
FT                   VLKEYERRGPQSFATMRWSPEKGVSAAPLRARPSVSAQDGSGADTGFPAPPPVEPGRGA
FT                   VPVEPPRAPQGPSPYGPPSPYGPPPIPPRPSGLSRGGSSYGR"
FT   gene            575400..575744
FT                   /locus_tag="Srot_0595"
FT   CDS_pept        575400..575744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0595"
FT                   /product="putative aminotransferase"
FT                   /note="KEGG: mbt:JTY_2304 putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97077"
FT                   /db_xref="GOA:D6ZCN5"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCN5"
FT                   /inference="similar to AA sequence:KEGG:JTY_2304"
FT                   /protein_id="ADG97077.1"
FT                   /translation="MAGDPLSTNIERLRLFGQNVSDGSEQAESAGAGGLYGSVSLPGAE
FT                   TAQAAVDAAQAHRAVVGRLRGEYAYAGEETASDAARFQGHEEDHAARFRQTYDEIDQSA
FT                   TGLGAQSAEA"
FT   gene            575747..577588
FT                   /locus_tag="Srot_0596"
FT   CDS_pept        575747..577588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0596"
FT                   /product="protein of unknown function DUF1023"
FT                   /note="PFAM: protein of unknown function DUF1023; KEGG:
FT                   mav:MAV_1467 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97078"
FT                   /db_xref="InterPro:IPR010427"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCN6"
FT                   /inference="protein motif:PFAM:PF06259"
FT                   /protein_id="ADG97078.1"
FT                   /translation="MGEFTMSQIASWRPETLIAGADEAKAHNTRLLGILDGIKDATNRM
FT                   AGESSGAGETARFDFIDRTTKFGYSKHELMVQHQQLVEEAGYDLKAKADRVLTEAQAAR
FT                   KAGLVVWDDGQVSGEVPRQREELEKYTASIGEAKHALEQADREHARKIRELNDKIKEGT
FT                   EGGYREADYFQKFGNLKDEPLDPDKAAKERAGRIADGKEPLPTDPKELNEVFKHLHGGK
FT                   DGPDGDKSILAELYRRYPEIGNKPGFPFENRDYCNRLHLNDLKQLVRDEIQRLQNEHPD
FT                   WKTDQIPGYKENPHMPPGFNEEQKQAQQLNNPEWNEWKTRIAEMQHRLDGYNNLQATLD
FT                   KTTLPKALGGDGLPRFLSFLDDKGHTAVTIGDADHATKVATFVPGTGQDMTKMTGSDDY
FT                   SARLYTEALNQGKEHGIQPTDISVTTWMCYDRPMDIFDPTKGSWAGDPKFALDGAQALD
FT                   DWQSGLRFSHDDANLGRAYQTVIGHSYGSVEVGAAASNGHHLDADAMVGVGSPGMIGNS
FT                   AHDMNINQGGEVYIATADNDMIRVATTLAPIGDNPLGNDPSTWGDATQFQTDPGKKGDG
FT                   WLTGDLSGDAHGSYFQPNSTGLKNMGRIIVGREPEHK"
FT   gene            577585..578262
FT                   /locus_tag="Srot_0597"
FT   CDS_pept        577585..578262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0597"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mav:MAV_1466 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97079"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCN7"
FT                   /inference="similar to AA sequence:KEGG:MAV_1466"
FT                   /protein_id="ADG97079.1"
FT                   /translation="MNAAMKNSDIRVKGTTALLFSALVVAILAGCGGHEHTQSSAATPP
FT                   HHNDVTTLDMKPEPMTVSPNITSQRQAQETLYGYMQKTLQGLPDNIFLDNKRYGGYGGG
FT                   HTAACDSERVDRENSPVDFGDYRDMHTPPGSDYNALIAKVGDIWKSWGWRVEERDDDKP
FT                   NRYGHSPDGYTLSIQSAGAYEPTMVGGTPCFPASLRDDTVPQPRVISKDKLLYDEPSAA
FT                   PTR"
FT   gene            578582..579643
FT                   /locus_tag="Srot_0598"
FT   CDS_pept        578582..579643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0598"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: AMP dependent CoA ligase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97080"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCN8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG97080.1"
FT                   /translation="MKSGLHRRRDGANAAPHKSTRVSKLLTSFLAVSGLIVCLGGCDYP
FT                   DRRSEANSVGATVRALPGVASADVRYDTSFDGGAHFDLDVKLADNASAAQAAAMGRVFV
FT                   DRMRASELDQFDVTLNVQYRFTSSTANEPARGSSATLKFNERANPPNGPSGAETSDSLA
FT                   LWLTVAQSPFFFGVGMTQPTFEGPDSSRDMFIELPFDTDDATISDFIHEHPGLDTATWV
FT                   TTIPDWEAGLRPAAYKLRGEFPDKHRRELWKKLLKQLGASDKIDLEIDAIKAPAGRAPV
FT                   YLEIIDHSSKEKVPQVARSVAAAALGFGDIVDLRFGSEYGRIELVEGVCEQPQPSKLLA
FT                   DLENELRQQYKHC"
FT   gene            579683..579838
FT                   /locus_tag="Srot_0599"
FT   CDS_pept        579683..579838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0599"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97081"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCN9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG97081.1"
FT                   /translation="MTDDGKAWEPVAYDAVGLRGRTARITADIPRDSSIVPSDLAEGVK
FT                   RGRHRP"
FT   gene            complement(579932..581107)
FT                   /locus_tag="Srot_0600"
FT   CDS_pept        complement(579932..581107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0600"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   rha:RHA1_ro02011 O-succinylbenzoic acid--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97082"
FT                   /db_xref="GOA:D6ZCP0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCP0"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADG97082.1"
FT                   /translation="MPERTLKALPVPDGARALELLPLIRAALDGENPHAFLPVPEQQEH
FT                   HAAMLRTALRAGEPIEDGPAFVLATSGSTAAPKGALLSPAALAASAAATHARLNGPDQE
FT                   QGEKPAQWLLALPAWHIAGLMVLVRAVLEGAEPAVIDVSGGFDPAALPAAVAALGAGRR
FT                   YTSLVPNQLVKALGVPAAREALAALDAVLVGGGALAPQIRAEAHAAGVRVVTTYGMSET
FT                   CGGCVYDQVPLDGVRVEIDAHQRIHLAGPMLASGYRGMPEHPAFARPGWFATSDAGQRE
FT                   AGRLRVLGRLDGGISTGGLTIAPKVVEEALLRHPGVRECAVVGVPDHRLGEAVAAVVVP
FT                   EGSPPALDELREHVTRLLDALAAPRALRLVGELPRTGLGKTDRQALVRLFA"
FT   gene            complement(581100..581411)
FT                   /locus_tag="Srot_0601"
FT   CDS_pept        complement(581100..581411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0601"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rer:RER_16880 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97083"
FT                   /db_xref="InterPro:IPR021784"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCP1"
FT                   /inference="similar to AA sequence:KEGG:RER_16880"
FT                   /protein_id="ADG97083.1"
FT                   /translation="MSLPPTLRAIVQWLRAAYPQGIPEQDYVPLFALMPRKLSEGEIRQ
FT                   LAETLNENGRGAASSIDIGVLITKITNELPRAEDVDRIRQRLGDLVWEDEDGSGKTGA"
FT   gene            complement(581481..581768)
FT                   /locus_tag="Srot_0602"
FT   CDS_pept        complement(581481..581768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0602"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: krh:KRH_23050 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97084"
FT                   /db_xref="GOA:D6ZCP2"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCP2"
FT                   /inference="similar to AA sequence:KEGG:KRH_23050"
FT                   /protein_id="ADG97084.1"
FT                   /translation="MNQFNADYFLGVGKAVITVLIVGVIFGAGLPALFAAGLTSLYGGE
FT                   PETAGTVAATKNPARVALAWLAFAAVLALIAFGIAVIVFGKPLLHAVGLV"
FT   gene            complement(581765..583033)
FT                   /locus_tag="Srot_0603"
FT   CDS_pept        complement(581765..583033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0603"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: rer:RER_36310
FT                   inorganic phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97085"
FT                   /db_xref="GOA:D6ZCP3"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCP3"
FT                   /inference="protein motif:PFAM:PF01384"
FT                   /protein_id="ADG97085.1"
FT                   /translation="MHGVNTELIVLALVIVTALGFDFTNGFHDTGNAMATSIATGALKP
FT                   KVAVGLSAVLNLVGAFLSTEVALSVATKIVKIYDGKTGQAAQGVQPSVLLTIVFAGLIG
FT                   AILWNVLTWLLGLPSSSSHALFGGLIGATIAGLGVSKVLWSGVLKSVVIPAVVSPIVAA
FT                   VVAATGTWLVYKITSRVTGSARERGFRIGQIGSASLVSLAHGTGDAQKTMGVITLALVA
FT                   ANHATTDAQGSPVVPLWVEAACAIAIALGTYSGGWRVIRTLGKGLVEIESPQGMSAEAS
FT                   AAAIILSSSYGGMALSTTHVATGSILGTGIGKKGAEVRWNVAGRMAAAWLVTLPAAAVV
FT                   GWTCFQIARLVPGLGGPLTIFVLLLGACFWMWLRARKHNISPDNVNAEWADETPPAATT
FT                   TATETSPAPPRATVGVGVKGSAE"
FT   gene            complement(583159..583557)
FT                   /locus_tag="Srot_0604"
FT   CDS_pept        complement(583159..583557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0604"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: rer:RER_16970 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97086"
FT                   /db_xref="GOA:D6ZCP4"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCP4"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADG97086.1"
FT                   /translation="MDVLASKFILYPSDYEGSLRFYRDVLGLAVFREYPGGTVFFAGGG
FT                   LIELAGHGESAPPEPGKASAVYLQVRDVYAAERELRAAGAEIEREAKQEPWGLHELRVR
FT                   DPQGTLLILAHVPEDHPQRRAGKPPAQP"
FT   gene            complement(583574..584845)
FT                   /locus_tag="Srot_0605"
FT   CDS_pept        complement(583574..584845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0605"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="TIGRFAM: seryl-tRNA synthetase; KEGG: sma:SAV_2294
FT                   seryl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); Seryl- tRNA synthetase, class IIa-like"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97087"
FT                   /db_xref="GOA:D6ZCP5"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCP5"
FT                   /inference="protein motif:TFAM:TIGR00414"
FT                   /protein_id="ADG97087.1"
FT                   /translation="MHDLDVLLTPEAAAKLARRGYQLDIARLESLREQRKALRRQADEL
FT                   RAQVRALGKAGKDAVDKQAHAEHARAVKEQVRETEAALDELEAALRAELLTIPNLPSDA
FT                   APEGLRESDYQIVRVVGEQQTFDPAEYPDGPKDHVALGEQLGILDLGRAVKLSGPRFSF
FT                   LKGQGARLERALASFFLDLHTREHGYEEFSVPLIVGAQTLTGSGQLPKFGEDLFKIATG
FT                   EPQYLIPTAEVPLVNYYAGEFLGADALPIAATAHSSCFRSEAGSYGRDTKGILRQHQFS
FT                   KVELVRVVLPEHAQAQQELMLGHAERCLRELGLHYRVIDLPAGDLGFTAERTFDIEAWL
FT                   PSQNAYREISSVSSCADFQSRRNGLRVKGKDGERIWPATLNGSALPIGRTVIAILEQFQ
FT                   QPDGSVLVPEALRGFMGADALRPV"
FT   gene            584921..586579
FT                   /locus_tag="Srot_0606"
FT   CDS_pept        584921..586579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0606"
FT                   /product="2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid
FT                   synthase"
FT                   /note="KEGG: gbr:Gbro_1092 2-succinyl-5-enolpyruvyl-6-
FT                   hydroxy-3-cyclohexene -1-carboxylic-acidsynthase; PFAM:
FT                   thiamine pyrophosphate protein TPP binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97088"
FT                   /db_xref="GOA:D6ZCP6"
FT                   /db_xref="InterPro:IPR004433"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCP6"
FT                   /inference="protein motif:PRIAM:2.2.1.9"
FT                   /protein_id="ADG97088.1"
FT                   /translation="MNPSTLQARVLVDEFLRGGVREAVLCPGSRNAPLSFALHAAERAG
FT                   RVRLHVRIDERSAGFLAVGLAAASGAPVIVVMTSGTAVANLGPAVCEANYARVPLIVLS
FT                   ANRPYEVLGSGVNQVIEQLGLFGSQVREAVSAGLAEQAATSGSQWRARVVRALSAATGT
FT                   RTGNAGPVQFDVPFREPLVPQAPEDDLESHCGGAFAGRPGGGPWTQIPQGGFEIPTPID
FT                   LSVPTVVVSGHGAGSHPELAALPTVAEPTAPVPANPLHPFAVPHVGAEQAVICGRPTLH
FT                   RQVASLLADPAVRVYALTTGPRWPDVAGNVAGTGTRAVPVGSPDPAWLQRCARAHAAAL
FT                   GSVGRGLDAEAATTGLHVARAVLAALRPGDQLVLGASNPVRDVALAGGVPAGVAVRSNR
FT                   GVSGIDGVLSSAVGSALAHEGRTIALLGDLTFLHDVSGLVIGPHEPKPRSLAIVVANDD
FT                   GGGIFELLEQGGPEYRAEAYGDAYERLFGTPHGKDFSALCAGLGVAHVRAALDELPAAL
FT                   GAEAEGLRVVEVRTDRGALRDLHRAMREFDLGEAR"
FT   gene            586576..587016
FT                   /locus_tag="Srot_0607"
FT   CDS_pept        586576..587016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0607"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ami:Amir_6693 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97089"
FT                   /db_xref="GOA:D6ZCP7"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCP7"
FT                   /inference="similar to AA sequence:KEGG:Amir_6693"
FT                   /protein_id="ADG97089.1"
FT                   /translation="MNPAAATWTWRGLAAVGCLVTVMCGLLLAGTWRDDRKIDADMSTT
FT                   RAEVVSTVSNKVVVRYAVTAAPSLRTNGLLSPGGVFGLFTTDVPQPGEGVMVEYSRANP
FT                   DLVRVADRGFEWAAFRVAAFLAVVWAALGGLRLLLWRLVRRG"
FT   gene            complement(587099..589027)
FT                   /locus_tag="Srot_0608"
FT   CDS_pept        complement(587099..589027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0608"
FT                   /product="Gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /note="KEGG: mab:MAB_2788 gamma-glutamyltranspeptidase
FT                   (GgtB); PFAM: gamma-glutamyltranspeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97090"
FT                   /db_xref="GOA:D6ZCP8"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCP8"
FT                   /inference="protein motif:PRIAM:2.3.2.2"
FT                   /protein_id="ADG97090.1"
FT                   /translation="MRFLLAAVLLGGGLVACGTGRPPSSASSDCADASPGTGVAKTAVP
FT                   TTHGPQDIAKRPEHANGYRTGMRAVTTRSFMVVTANPLASRAACGVLRAGGTAADALVA
FT                   AQTVLGLVEPQSSGLGGGAFLLYYDAATRALDAYDGRETAPAAANGDSLRWISNADRGE
FT                   PKPDTRASGRSIGVPGVLRLLELVHNEHGSQPWRSLFDPAVSLADDGFAISPRLAAALA
FT                   PEAARLRLDPQASAYFLNPDGSPKPAGTRVRNPAYAKTLGAIAGEGPDAFYTGAIAHDV
FT                   VDAVANTAGGRTPGLMTLADLAGYQAKKRAPICFAYRRKQVCGMPGPSSGGTAVAQVLG
FT                   MLGHFDLGALRPASPGEDGGRPDPLAAHLIAEAERLAYADRDKYLADPDFVTAPPGLLD
FT                   PGYLAGRAALIDRARSMGTARAGDFGPVDFAVAPGHEHGTSQITVVDSRGNAASMTTSV
FT                   ESAFGSYHMVDGFFLNNQLTDFSARPTDAEGRPVANCAQPGKRPRSSMSPTLVFGANGP
FT                   AGGSVEDVLGSPGGGTIIQYVVKTLVALVDWGLDPQQAVGMVDFGAENSPVTNLGGEHP
FT                   LVDAADNGASDPLAQALRQRGHTVDVTPQDSGLSAVRRAGPGWEGGADPRREGVVMGDA
FT                   ERTSPAS"
FT   gene            589045..590205
FT                   /locus_tag="Srot_0609"
FT   CDS_pept        589045..590205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0609"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="KEGG: btr:Btr_2082 hypothetical protein; PFAM:
FT                   isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97091"
FT                   /db_xref="GOA:D6ZCP9"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCP9"
FT                   /inference="protein motif:PRIAM:1.1.1.85"
FT                   /protein_id="ADG97091.1"
FT                   /translation="MAESENAAPRPEVAAPRPKAAMRRPKVAVLPGDGVGPEVLDAALP
FT                   VVEALGLDWELLFGEIGWTCWQRDGEPVPADTWRLIEDSDAGLLGAVTSKPEQEAQAEL
FT                   APRLRGAGRVYRSPVVQLRQRLDLYANLRPVVDYRAQPAQFDYVIVRENTEGLYAGFDV
FT                   AEVRGELWDLVRSHPNAARSGPDGVRVALRLQTDFGTDRILRFAFGLARAQGRSGVVVA
FT                   DKPNILRSSGGRLRERVERVAAEYPELRAEICNVDAVAMRLVTDPAGFGVIVAENVFGD
FT                   ILSDVAAGVAGSIGVAPSGNVGERWSYFEPVHGSAPDIAGRGIANPFGMILAVADLADH
FT                   LGAQAEAGAARRAVRAVMTRGEQVTADLGGSATTRQSARAVLACLV"
FT   gene            590245..591150
FT                   /locus_tag="Srot_0610"
FT   CDS_pept        590245..591150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0610"
FT                   /product="methyltransferase"
FT                   /note="KEGG: mab:MAB_0027c hypothetical protein; TIGRFAM:
FT                   methyltransferase; PFAM: O-methyltransferase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97092"
FT                   /db_xref="GOA:D6ZCQ0"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCQ0"
FT                   /inference="protein motif:TFAM:TIGR00027"
FT                   /protein_id="ADG97092.1"
FT                   /translation="MAVNNPSDRTEHDSWDIVSSVGFTALGVAAARALQNRRAQPLAVD
FT                   PFAEAFVTAAGHPETQALLENAPEEAQWDEQTALWTDFFGARTRYFDEYFAGAGTPQVV
FT                   ILAAGLDSRAYRLPWQTGSVLFEVDQPEVLRFKADVIGKLGAQPLVDRREVAFDLRDEW
FT                   AAALTAAGFDPEKPTAWLAEGLLIYLPGPAQDALFAQMHALSAPGSRMGVENGFRPGDV
FT                   ERVREAAAKGVVLRSGGSDFDPTTLWYDDPRADPQQWLAERGWTVAPVGRAQVAASYGR
FT                   PFPEQFAALWSSTGYFTAER"
FT   gene            591197..593149
FT                   /locus_tag="Srot_0611"
FT   CDS_pept        591197..593149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0611"
FT                   /product="excinuclease ABC, C subunit"
FT                   /note="TIGRFAM: excinuclease ABC, C subunit; PFAM:
FT                   excinuclease ABC C subunit domain protein; Excinuclease ABC
FT                   C subunit domain protein; UvrB/UvrC protein; KEGG:
FT                   msm:MSMEG_3078 excinuclease ABC subunit C; SMART:
FT                   Excinuclease ABC C subunit domain protein;
FT                   Helix-hairpin-helix DNA-binding class 1"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97093"
FT                   /db_xref="GOA:D6ZCQ1"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCQ1"
FT                   /inference="protein motif:TFAM:TIGR00194"
FT                   /protein_id="ADG97093.1"
FT                   /translation="MSYRPAAGAIPTEPGVYRFRDPSGQVIYVGKAKNLRARLSNYFQD
FT                   LYALAPRTRLMVTTASAVEWTVVATEVEALQLEFSWIKEFDPRFNVRYRDDKSYPMLAV
FT                   SLNEEYPRLFVYRGARRKGVRYFGPYSHVWAIRNTVDLLTKVFPARTCSNGVFKRHGQI
FT                   GRPCLLGYIDKCSAPCVGAVSAAEHRRIVQSFCEFLAGGADNLVRETRKRMLAAAEALD
FT                   FEAAARLRDELAALDKALEHQTVVLADGSDADVVAFDYDELEVAVQVFQVREGRVRGQR
FT                   GWVVDNAYSPGPHGDRTRDGRGWEAASRREMVEEFLLQFYGDLAELESVADRFGQSDRM
FT                   SAVPKEVLVPELPDDVEGFATWLSTLRGTPVALRVPRRGDKRKLMETVARNAHETLAQH
FT                   KLRRSGDFTERSAALQEIYEAFDLPAPPIRIECVDVSHVQGTDVVASLVVFDDGLPKKA
FT                   DYRHYTIKGAMGADGAPQNDDTRSVAEVIARRFAKRGDRPDPGLLVIDGGQPQVRAAHK
FT                   ALVELGAADIPVVGLAKRLEELWLPDDDDPVILPRRSPGLFLLQRVRDEAHRFAIAHHR
FT                   KKRSKRMTVSALDEVKGLGERRRAQLVKHFGSVRKLADASADEIAALPGFGPVLAESVV
FT                   TALAACQTPPQEASA"
FT   gene            593146..594111
FT                   /locus_tag="Srot_0612"
FT   CDS_pept        593146..594111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0612"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   mmi:MMAR_2228 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97094"
FT                   /db_xref="GOA:D6ZCQ2"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCQ2"
FT                   /inference="protein motif:PFAM:PF03668"
FT                   /protein_id="ADG97094.1"
FT                   /translation="MTEPETPQSGSEPQEATGDVAPPGGVGQPGTGRAAIEVLFLTGLS
FT                   GAGLGTAAKILEDVGWYVADNLPPQLVTRMVEIGLDPQTQIPRLAVVVDSRTRDFTGDI
FT                   HALLAELRAQGLDPKVLFLQASDEVLIRRFEQVRRRHPLQGQDTLAEGIKRERDLLAPL
FT                   LAEADSVLDTSVSSVKELRDVVEQEWGGSASRSKTSVTVQSFGFKYGLPLDANMVADVR
FT                   FLPNPHWVRHLRDKTGLTPEVSEYVLSAPGAKEYLRVYHELLRLMLTSYRKEAKRYMTI
FT                   AVGCTGGKHRSVAMAVALGALIGQDQQLTVRVIHRDLGLE"
FT   gene            594111..595100
FT                   /locus_tag="Srot_0613"
FT   CDS_pept        594111..595100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0613"
FT                   /product="protein of unknown function UPF0052 and CofD"
FT                   /note="PFAM: protein of unknown function UPF0052 and CofD;
FT                   KEGG: rer:RER_30270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97095"
FT                   /db_xref="GOA:D6ZCQ3"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCQ3"
FT                   /inference="protein motif:PFAM:PF01933"
FT                   /protein_id="ADG97095.1"
FT                   /translation="MARRAAGRFAVAALGGGHGLFATLSAVRRLTPDVTAVVTVADDGG
FT                   SSGRLRQELDVIPPGDLRMALVALTPDDGDAGMWAQVLQHRFGGVGALAGHPVGNLLLA
FT                   GLAEVLGDPVAALDAMVRTFGAQGRVLPMSAVPLEIEAEVSGIEDDPRLIRRIRGQVAV
FT                   ATTPGKVRRVRLLPTEPPACAAAVGAIMRADLVVLGPGSWFSSVIPHVLVPEQLQALTA
FT                   TDARKVLVLNLAPEPGETAGFSTERHLHVLSQHAPGLRVDHIVVDAASVPDGADREQLV
FT                   RAADRFGASPTFARVAIPGTHQHDPEALAGVLKDLVGQDVPGQEDGGR"
FT   gene            595097..596089
FT                   /locus_tag="Srot_0614"
FT   CDS_pept        595097..596089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0614"
FT                   /product="protein of unknown function DUF199"
FT                   /note="PFAM: protein of unknown function DUF199;
FT                   Sporulation regulator WhiA-like; KEGG: gbr:Gbro_2362
FT                   protein of unknown function DUF199"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97096"
FT                   /db_xref="GOA:D6ZCQ4"
FT                   /db_xref="InterPro:IPR003802"
FT                   /db_xref="InterPro:IPR018478"
FT                   /db_xref="InterPro:IPR023054"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039518"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCQ4"
FT                   /inference="protein motif:PFAM:PF02650"
FT                   /protein_id="ADG97096.1"
FT                   /translation="MTNGMTTEMKDELCLVPPGALSARKAEVAAVLRFGGGLQILSGRI
FT                   VVGAELDHAGAAKRLRVGLHELHGSTSGVHVLPPGGSHKYHRYVVRVTRGGEMLARQTG
FT                   MIDGQGRPVVGLPAAVVNGSLEDVEGAWRGAFLASGMLAAPSRTAALEVVAPSPLAALA
FT                   LVGAARRLGVPAKSRELRGQDRVVVRDAEAIGELLTRMGAKNSWKVWEEHRQQRQVRAA
FT                   PQRLANFDDANLRRSARAALASAARVGRAIEILGDEVPEHLLVAGRLRMAHKEVSLEQL
FT                   GSLADPPMTKDAIAGRIRRLLSMADKVAALRGVPDTESAVSSDLLDDDE"
FT   gene            596086..597288
FT                   /locus_tag="Srot_0615"
FT   CDS_pept        596086..597288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0615"
FT                   /product="Inosine/uridine-preferring nucleoside hydrolase"
FT                   /note="PFAM: Inosine/uridine-preferring nucleoside
FT                   hydrolase; KEGG: bpy:Bphyt_4926 inosine/uridine-preferring
FT                   nucleoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97097"
FT                   /db_xref="GOA:D6ZCQ5"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCQ5"
FT                   /inference="protein motif:PFAM:PF01156"
FT                   /protein_id="ADG97097.1"
FT                   /translation="MRVRSACAAILCAALLLAGLPSAAARAALVDSEPQKIIIIDTDFA
FT                   TMLDDGQVVSMAAQLHAEGQIDLLGVTVVTGDEWRDQEVAEAVRATERLGVGDPGPCRR
FT                   VPADFAVGVYPGADYPLDHGPAAVKADAAALATGDGFTGAWGTKKPVSRADLVAPPDGF
FT                   ATCARPRAQRAVDFMADQLRAFPHEITIVAIGPLTDLALLAKEHPDAVGLVKRIVIMGG
FT                   AFDVPGNSTAKAELNWWFDPKAADEVLKLPVEEVVTPLDLSNTVPLDDALYRRIAFPPS
FT                   PTPVTGLYRDIVGAGLDGKGGFDRDPDYTQPLWDELAFAYAVDPGFATESRVVWPTVRA
FT                   QLGENDGSVSYAPAPKPGRRPVTVITKFDNPRFDDWYVDLMTRPVPVRRQGASRLAQGN
FT                   H"
FT   gene            597336..598352
FT                   /locus_tag="Srot_0616"
FT   CDS_pept        597336..598352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0616"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /EC_number="1.2.1.12"
FT                   /note="TIGRFAM: glyceraldehyde-3-phosphate dehydrogenase,
FT                   type I; KEGG: nfa:nfa35890 glyceraldehyde-3-phosphate
FT                   dehydrogenase; PFAM: Glyceraldehyde 3-phosphate
FT                   dehydrogenase, NAD(P) binding domain; Glyceraldehyde
FT                   3-phosphate dehydrogenase, catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97098"
FT                   /db_xref="GOA:D6ZCQ6"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCQ6"
FT                   /inference="protein motif:TFAM:TIGR01534"
FT                   /protein_id="ADG97098.1"
FT                   /translation="MAIRVGVNGFGRIGRNFFRAAHAAKAAGRADFEIVAVNDLSDPAN
FT                   LAHLLKYDSILRRFPEEVSVDGQDILVGSQKIRALAVKEGPAALPWGDLGVDVVVESTG
FT                   IFTDAAKAKGHLDAGAKKVVISAPATGEDLTVVLGANEDKYDGSQKIISNASCTTNSIA
FT                   PVLKVIDEAFGIVRGGLTTVHAYTQDQNLQDGPHKDLRRARAAALNIVPTSTGAAKAIG
FT                   LVLPQLVGKLDGYALRVPTPTGSISDLTLDVEKEATADAVNAAVKAAAEGPLQGILKYS
FT                   TDPIVSGDIIGDPHSSIFDAPLTKVISGQIKVAAWYDNEWGYSSRLVDLITLIGKSL"
FT   gene            598370..599596
FT                   /locus_tag="Srot_0617"
FT   CDS_pept        598370..599596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0617"
FT                   /product="Phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="KEGG: mgi:Mflv_3709 phosphoglycerate kinase; PFAM:
FT                   phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97099"
FT                   /db_xref="GOA:D6ZCQ7"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCQ7"
FT                   /inference="protein motif:PRIAM:2.7.2.3"
FT                   /protein_id="ADG97099.1"
FT                   /translation="MAISTLDDLLAAGVSGRGVLVRSDLNVPLDGSKITDPGRIAASVP
FT                   TLKKLAEAGAKVVVAAHLGRPDGAPDPKYSLGPVAAELAERLGRHVQLAGDVVGQDALA
FT                   RSEGLTSGDVLLLENVRFDPRETSKDDSARQSLARDLVELVGEDGAFVSDGFGVVHRKQ
FT                   ASVYDVATLLPAYAGDLVAAEAAVLRRLTESPERPYAVVLGGSKVSDKLAVIEHLAPRV
FT                   DTLVIGGGMAFTFLLAQGHSVGGSLVQEDQVENAKSLLQRYGSVLKLPLDVVVADTFAA
FT                   DAQTQTVAADAIPDGWMGLDVGPASHRHFRQALSDAKTIFWNGPLGVFEFPAFAWGTRA
FT                   LAEAIVEETAKGAFSVVGGGDSAAAVRTLKLGEDDFSHISTGGGASLEFLEGKTLPGIA
FT                   VLDRSGQER"
FT   gene            599593..600387
FT                   /locus_tag="Srot_0618"
FT   CDS_pept        599593..600387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0618"
FT                   /product="triosephosphate isomerase"
FT                   /note="KEGG: mav:MAV_3339 triosephosphate isomerase;
FT                   TIGRFAM: triosephosphate isomerase; PFAM: triosephosphate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97100"
FT                   /db_xref="GOA:D6ZCQ8"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCQ8"
FT                   /inference="protein motif:TFAM:TIGR00419"
FT                   /protein_id="ADG97100.1"
FT                   /translation="MTSPSRQPLIAGNWKMNLNHFEAIALVQKLCHALKAEHFETVQTS
FT                   VLVPFTDIRSVQAVVESDGLPVEYGAQDLSKHDAGAYTGEVSGAFLAKLGCTQVVVGHS
FT                   ERRAYHHETDELVAAKAKAALKHGLTPIVCVGEGEDVREAGRHIAHCDSQLRASLAGLS
FT                   EDELAKVVIAYEPVWAIGTGRVASPKDAQEVCGAMRKALAEIGGDHVARAARVLYGGSV
FT                   NKGNAAELLAEPDVDGALVGGASLKVEEFAAIVAFAALAAKS"
FT   gene            complement(600401..601261)
FT                   /locus_tag="Srot_0619"
FT   CDS_pept        complement(600401..601261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0619"
FT                   /product="protein tyrosine/serine phosphatase"
FT                   /note="KEGG: rha:RHA1_ro01881 tyrosine protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97101"
FT                   /db_xref="GOA:D6ZCQ9"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR026893"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCQ9"
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro01881"
FT                   /protein_id="ADG97101.1"
FT                   /translation="MGEPLERGDTRPQYSSAIVTDMTVEASDRSAPSGLDIPSVVNFRD
FT                   AAGHPRPLLGHGGTPLRARQFFRSGTLDPDDTDGARLAELPVSLVVDLRTPWEAQNRPD
FT                   RVPPGARYEHISVLGAGTQAEQAVYGHIPDPDEARESLRRLNRGFVADPEQRDQFRAVF
FT                   HSFAKAEGPVIFHCSYGKDRSGWTAAMLLAIAGVRESDIVADYLLSNAFLAEINHRRWE
FT                   QTQEKEGMAAANARAPIFEVRSDYFGAGLAQIERDYGTVDDYLRRGLGLDEQVLAALRA
FT                   KLLTA"
FT   gene            601331..601765
FT                   /locus_tag="Srot_0620"
FT   CDS_pept        601331..601765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0620"
FT                   /product="preprotein translocase, SecG subunit"
FT                   /note="KEGG: rha:RHA1_ro07180 preprotein translocase
FT                   subunit SecG; TIGRFAM: preprotein translocase, SecG
FT                   subunit; PFAM: Preprotein translocase SecG subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97102"
FT                   /db_xref="GOA:D6ZCR0"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCR0"
FT                   /inference="protein motif:TFAM:TIGR00810"
FT                   /protein_id="ADG97102.1"
FT                   /translation="MRLTLEITIIVTSLLLVLLVLLHRGKGGGLSSLFGGGVQSSLAGS
FT                   TQAERNLNRITVFVSLVWLIAIVGIGYQIKLKTEQDERRANDSSFSDMGGGLGGPGGGA
FT                   PNVPPVIPAPASQAPAPASPAPAAPASQAPAPATPAPATR"
FT   gene            601811..604603
FT                   /locus_tag="Srot_0621"
FT   CDS_pept        601811..604603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0621"
FT                   /product="Phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /note="KEGG: rer:RER_30340 phosphoenolpyruvate carboxylase;
FT                   PFAM: phosphoenolpyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97103"
FT                   /db_xref="GOA:D6ZCR1"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCR1"
FT                   /inference="protein motif:PRIAM:4.1.1.31"
FT                   /protein_id="ADG97103.1"
FT                   /translation="MTDAVSLFDPNDPERVATEPLREDIRLLGRVLGEIICEQSGQHVF
FT                   DLVEHARTESFRVRRSEIDRAELADFFADVGVDEAIPVVRAFCQFLLLANLAEDIHTER
FT                   RRRVHVQSGEAAPDSTLAATWRKLDESRPDPDRVAAALADALVAPVITAHPTETRRRSV
FT                   FEAQGRITELMRYLDRTALDETERDEVVEELRRHVTALWQTAITRLSRVRIQDEIEMGL
FT                   RYYQASLLEMIPKLNLEVDRQLRERWPEARPASAPPVVRPGSWIGGDRDGNPNVDASVV
FT                   ERASRRASAVVLEHYLAELALLQNELSMSRRLVEVDDAVRQLAAQAGPSAEWRADEPYR
FT                   QALSWLRARLSSTAAAVAPGLVEGASDPEGAPAYPKPEAFLADLDVIDSSLRAHHGAAL
FT                   AEGRLAAVRAAVSSFGFHLQSLDLRQNSEVHEQVVAELLAWAGACREYTSLAEDEKVRL
FT                   LTAELSTRRPLVGPRAAFSEVTARELGINAVAAKIIAELGPAAIPNYIISMCTSVSDML
FT                   EVLLLLKEAGVYDPGAGAEPPSCPINVIPLFETIEDLRQSAATLVATLSVPLYRDLVAG
FT                   KGMAQEVMLGYSDSNKDGGYLAANWALYRAELDLVEAAKQTGVRLRLFHGRGGTVGRGG
FT                   GPSYSAILAQPPGAVAGSLRLTEQGEIIAAKYAEPRRAYRNLEILVAATLEASLLDTEG
FT                   LGEQAEEVYALFDDLAERARVAYSALVHETPGFVEYFLASTPVSEIGALNIGSRPASRK
FT                   PTASIRDLRAIPWVLAWSQSRVMLPGWYGVGTAFEQWAGDDPAKLAVLRDLNERWPFFR
FT                   AVLSNLAQVLAKSDLGLASRYAELVPDARVREQVFGAICAEHARTLKMHAAITGTDDLL
FT                   ADNAALKRSVYNRFPYLEPLNHLQVEFLRRYRAGDQSDRVRLGIHLTMNGLATALRNSG
FT                   "
FT   gene            604731..605198
FT                   /locus_tag="Srot_0622"
FT   CDS_pept        604731..605198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0622"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sen:SACE_5984 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97104"
FT                   /db_xref="GOA:D6ZCR2"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCR2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG97104.1"
FT                   /translation="MQPLENYSDPESWLADLKTELSNLQEQGQRANEALQQAQGTGTAA
FT                   NGDVTVVVGQSGQVQSLKLNDKALHLGPTKLSEAILTALRKAQNNAIDAARDAVAGLIG
FT                   EEKAHEFLDRYRLPDDEEDLSPPDARLAAGDDLEDRPSASWVRKDDGHKRW"
FT   gene            605192..605527
FT                   /locus_tag="Srot_0623"
FT   CDS_pept        605192..605527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0623"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sen:SACE_5896 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97105"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCR3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG97105.1"
FT                   /translation="MVTHCPCVAEERENMGFDINPDGIRGNADSLRGICEQFGSIGESG
FT                   KNTELGWDVFGLLGRPFAWGLGYATKAAGSGIEAYGQIIGHTAEQLDHAADHIAARDQE
FT                   ASDYLAQ"
FT   gene            605558..606283
FT                   /locus_tag="Srot_0624"
FT   CDS_pept        605558..606283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0624"
FT                   /product="protein of unknown function DUF164"
FT                   /note="PFAM: protein of unknown function DUF164; KEGG:
FT                   mav:MAV_2210 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97106"
FT                   /db_xref="InterPro:IPR003743"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCR4"
FT                   /inference="protein motif:PFAM:PF02591"
FT                   /protein_id="ADG97106.1"
FT                   /translation="MKADPQAQRGLLELAALDTQVRQLTHRLRALPEAERLAAATSAAR
FT                   TAADEASVIAMRIEDVEREIAKREGDVDAVRQREERDEQLLKSGALDSRVQNDVQHELG
FT                   SLRKRQAAFEDELLGFMEQREQELAVLARAQERRAEAQAAAQAARAALSEAESQVKEQL
FT                   QAAESSREARAAQIPGELLALYERLRARGTAAGRLDGRKCGACRLELTVSQMAEMSAAA
FT                   PDEVLRCPECDAILIRVGA"
FT   gene            606336..607472
FT                   /locus_tag="Srot_0625"
FT   CDS_pept        606336..607472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0625"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; ribonuclease H; KEGG:
FT                   nfa:nfa16400 bifunctional RNase H/acid phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97107"
FT                   /db_xref="GOA:D6ZCR5"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR014636"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCR5"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ADG97107.1"
FT                   /translation="MRVVIEADGGSRGNPGPAAFGAVVLDGDRVLAQRAEQIGHATNNV
FT                   AEYRGLIAGLEAAKELGASEVLVRMDSKLVVEQMSGRWKVKHEGMRELASRAAALSRAF
FT                   DAVRYTWVPREQNKRADALLNAVLDGKEINTGGAAPVAAPEPAPETAPAVAPGAQLSWA
FT                   PPKPVSTRLLLVRHGETEASREFRQCGRSDLPLTKEGLAQARAAARRLGARGAITQVYS
FT                   SPLSRATQTATAVADALGVRVRTDDRLVEMDFGEWEGLTGQQIQDRDPRLREQWLAEPA
FT                   TPAPGGESFAQAAARVEAFIADVVKEHPGEEIVLVSHVTPIKLVLKAALGSGWELLTRL
FT                   FLDVASLSVVEFAPGGRSSVRLVNDISHWDTSRWDLSR"
FT   gene            607550..607955
FT                   /gene="rnpB"
FT                   /locus_tag="Srot_R0015"
FT   ncRNA           607550..607955
FT                   /gene="rnpB"
FT                   /locus_tag="Srot_R0015"
FT                   /product="RNA component of RNaseP"
FT                   /note="manually curated; Bacterial RNase P class A as
FT                   predicted by Rfam (RF00010), score 218.44"
FT                   /ncRNA_class="RNase_P_RNA"
FT   gene            complement(608012..608764)
FT                   /locus_tag="Srot_0626"
FT   CDS_pept        complement(608012..608764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0626"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa56340 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97108"
FT                   /db_xref="GOA:D6ZCR6"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="InterPro:IPR033116"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCR6"
FT                   /inference="similar to AA sequence:KEGG:nfa56340"
FT                   /protein_id="ADG97108.1"
FT                   /translation="MPHRLAAWLPAAVLAAAAALPAPTASAEPDAIVLAPGAPLAIVAA
FT                   PLAPGEQTTAEACTLTAIGYDNEQRLVGLTAGHCARVGKIVYSEDSSGVGMIGKIVKIN
FT                   HDMSHPAVADEAHPWVEDLDYAVIEFNEEKVIPSSQVRVGDRTIDVADVGGEPEVGDKV
FT                   CKVGRTTGLTCGEVTEVKDWAHAATFCTKEGDSGGPVFLGDRIVGLVTTSVTIVGSNAC
FT                   GTETGSNIDTVLGAIGPGVGDGFQQFTE"
FT   gene            609130..609408
FT                   /locus_tag="Srot_0627"
FT   CDS_pept        609130..609408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0627"
FT                   /product="transcription factor WhiB"
FT                   /note="PFAM: transcription factor WhiB; KEGG: nca:Noca_1411
FT                   transcription factor WhiB"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97109"
FT                   /db_xref="GOA:D6ZCR7"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCR7"
FT                   /inference="protein motif:PFAM:PF02467"
FT                   /protein_id="ADG97109.1"
FT                   /translation="MKDSLDITQQIFLAIAEEEGAGQWQENALCAQTDPEVFFPEKGGS
FT                   TREAKRICLNCEVKNDCLEFALQNDERFGIWGGLSERERRRLRRRLA"
FT   gene            complement(609418..609990)
FT                   /locus_tag="Srot_0628"
FT   CDS_pept        complement(609418..609990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0628"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mkm:Mkms_1343 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97110"
FT                   /db_xref="InterPro:IPR010428"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCR8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG97110.1"
FT                   /translation="MTARPSHSPQASNTQRRKHARQTGPGQPVQSTGLAGRATRRANRR
FT                   GRDLRGDLVPQQLPAWRSKREKFDSLVLEALSPIDQRWHDHLVGLDIAVDEVPRMHPLH
FT                   QQFVQWPPEVTADGPVPLARLIPAGVDVSGRHTRARVVLFRRPLEDRAEDPDELVDLLH
FT                   HVLVRQIATYLGLTEEAIDPEGTTYDY"
FT   gene            610102..610488
FT                   /locus_tag="Srot_0629"
FT   CDS_pept        610102..610488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0629"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rer:RER_21560 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97111"
FT                   /db_xref="InterPro:IPR021888"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCR9"
FT                   /inference="similar to AA sequence:KEGG:RER_21560"
FT                   /protein_id="ADG97111.1"
FT                   /translation="MRIPRRCSRPGCKMPAVATLTYVYAESTAVVGPLATNAEPHAWDL
FT                   CEIHAQRITAPKGWAMMRCEGSFTPVHAEDDDLTALAEAVREAGRGERKGARLPAVAGA
FT                   GATGRRGHLRVVPDLADPSPAGDK"
FT   gene            610485..611882
FT                   /locus_tag="Srot_0630"
FT   CDS_pept        610485..611882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0630"
FT                   /product="Phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /note="KEGG: nfa:nfa46250
FT                   phosphomannomutase/phosphoglucomutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; phosphoglucomutase/phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97112"
FT                   /db_xref="GOA:D6ZCS0"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCS0"
FT                   /inference="protein motif:PRIAM:5.4.2.8"
FT                   /protein_id="ADG97112.1"
FT                   /translation="MTGAGRGGARSPEAIAVVVKAYDVRGVVGEQIDEGLIADLGAAFA
FT                   QLMRSEGATSLVIGHDMRDSSGPLSDAFARGALAQGLDVTSIGLASTDELYFASGVLDR
FT                   PGAMFTASHNPAKYNGVKLCRAGAKPVGKETGLGEISQALISGVRDTEGAAPGERSAKD
FT                   VLEDYAQYLRDLVGLARIRPLTVVVDAGNGMAGHTAPAVLGPIEGLTVIPMFFELDGNF
FT                   PNHEANPLDPKNIVDLQAKVRATGADLGLAFDGDADRCFVVDERGDAISPSAITALVAE
FT                   RSLEKSPGSVIIHNAIVSRAVPELVRERGGVPERTKVGHSFIKQRMAETGAVFGGEHSA
FT                   HYYFRDFWGADSGMLAALHVLAALGASDRTASELMDGYERYAASGEINSTVSDAKAAIG
FT                   RVLDGFAERATSVDELDGVTVDLGDGAWFNLRASNTEPLLRLNAEAADRANVDAITEEV
FT                   LTLIRGE"
FT   gene            612084..613157
FT                   /locus_tag="Srot_0631"
FT   CDS_pept        612084..613157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0631"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rop:ROP_63790 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97113"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCS1"
FT                   /inference="similar to AA sequence:KEGG:ROP_63790"
FT                   /protein_id="ADG97113.1"
FT                   /translation="MVDLTNAPAAERAAMVLFEVAAHGGAQARAVAAAVAGGALDALES
FT                   IQPRALLSVAGSAEAAHGADVFALVAGDEWDVPVVRSARLPSWAGPLDVLLVVGSDPGD
FT                   PLLVEAVSTALRRGVTTVVSAPLEGPLQAAASGRALDLAPRLAGGDSFGFVQSLAAHIA
FT                   VARAVRSARGASLVDVAALADQIDQEIFSAHPSRPVFENPARALAERMRGRRVVLAGDG
FT                   PAAVAVARYGADALLRVAGEPAQATDLVTTLFAGERLGVGGLSADAALFHDPEFDGPLP
FT                   AAPRVFALSAERGRWEVEAQIRRLPDAESVVVDPIQPEPEIRRFPRQEEFADLPQLAVL
FT                   AQRLALASVYLRLGEEH"
FT   gene            613157..614332
FT                   /locus_tag="Srot_0632"
FT   CDS_pept        613157..614332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0632"
FT                   /product="mannose-6-phosphate isomerase, class I"
FT                   /EC_number="5.3.1.8"
FT                   /note="TIGRFAM: mannose-6-phosphate isomerase, class I;
FT                   KEGG: mab:MAB_3601c mannose-6-phosphate isomerase ManA;
FT                   PFAM: mannose-6-phosphate isomerase type I"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97114"
FT                   /db_xref="GOA:D6ZCS2"
FT                   /db_xref="InterPro:IPR001250"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016305"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCS2"
FT                   /inference="protein motif:TFAM:TIGR00218"
FT                   /protein_id="ADG97114.1"
FT                   /translation="MRKLHGQMRHYPWGSRTHLAELTGRLSPSAQPEAEIWYGAHPAEP
FT                   CALGDAGDDGERTLAATIAADPGLQLGGNVVRRFGAELPFLVKLLAAGEPLSLQAHPSA
FT                   AQAQAGFARENALGVALDDPKRNYKDPRHKPELLVALTRFEALAGFRDARQTLGQLERA
FT                   GLLAQLPEAVLLRDHDLRGLVERWLLMPVDEVARRVAAVRAAGHPVGADLAQRYPHDPG
FT                   VLVALLLHHIVLEPGEGLFVPAGVLHAYLGGLGVEVMANSDNVLRGGLTSKHVDVDELL
FT                   AVMDFAPIPQRQLVVRSEDSPASSQYPGLATEFRLRVTRLANGEAQRAPSGPALEPGPE
FT                   ILLCVSGEAEIETGGRRERITPGEAVWRPAHERDVDITARADATVVFRASV"
FT   gene            614403..615335
FT                   /locus_tag="Srot_0633"
FT   CDS_pept        614403..615335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0633"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="KEGG: mab:MAB_3600c putative cation transporter;
FT                   TIGRFAM: cation diffusion facilitator family transporter;
FT                   PFAM: cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97115"
FT                   /db_xref="GOA:D6ZCS3"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="InterPro:IPR040177"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCS3"
FT                   /inference="protein motif:TFAM:TIGR01297"
FT                   /protein_id="ADG97115.1"
FT                   /translation="MDENPHGNSQKAIIAALAANLGIAVAKFVGFALTGSSAMLAEGVH
FT                   SVADTSNQALLLRGQAAAKRSADQQHPFGYGRSRYFYAFIVALVILLLGAVFAIVEGVE
FT                   KVRAPHALENPWIGVAILGFAVLLEGYSFLTAFGESRKSMGGQSLWQFIRHTRNPELPV
FT                   VLLEDFGALIGLVLALSGVGLTLVTGNPVWDGIATLCIGVLLAVIALVLIVEMGSLLIG
FT                   EGATPDQQRQILRALCEGPEIERVIHCRTLYLGPEELLVAAKVAVSGTADLATVARAVD
FT                   AAEARLRGLVPEIDLIYIEPDVDRRPCSG"
FT   gene            615465..615908
FT                   /locus_tag="Srot_0634"
FT   CDS_pept        615465..615908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Srot_0634"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cai:Caci_8255 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Srot_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ADG97116"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZCS4"
FT                   /inference="similar to AA sequence:KEGG:Caci_8255"
FT                   /protein_id="ADG97116.1"
FT                   /translation="MGIPSLTPCVLVIGLDPYRAPGCLDPKPVVDSLNKGLARFTEQGV
FT                   GFETCLFGLDGSDDVEAILSNALRSRSWECVVVGGGVRKPEDQVELFEQVVNLIRRYAP
FT                   SAAIAFNNAPENTFDAAARWVDTSRPDQPVGADDAESSSEKPH"
FT   gene            616037..616573
FT                   /locus_tag="Srot_0635"
FT   CDS_