(data stored in ACNUC7421 zone)

EMBL: CP001959

ID   CP001959; SV 1; circular; genomic DNA; STD; PRO; 3241804 BP.
XX
AC   CP001959; ABTG01000000-ABTG01000007;
XX
PR   Project:PRJNA29543;
XX
DT   19-MAY-2010 (Rel. 104, Created)
DT   01-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Brachyspira murdochii DSM 12563, complete genome.
XX
KW   GSC:MIGS:2.1.
XX
OS   Brachyspira murdochii DSM 12563
OC   Bacteria; Spirochaetes; Brachyspirales; Brachyspiraceae; Brachyspira.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-3241804
RX   PUBMED; 21304710.
RA   Pati A., Sikorski J., Gronow S., Munk C., Lapidus A., Copeland A.,
RA   Glavina Del Tio T., Nolan M., Lucas S., Chen F., Tice H., Cheng J.F.,
RA   Han C., Detter J.C., Bruce D., Tapia R., Goodwin L., Pitluck S.,
RA   Liolios K., Ivanova N., Mavromatis K., Mikhailova N., Chen A.,
RA   Palaniappan K., Land M., Hauser L., Chang Y.J., Jeffries C.D., Spring S.,
RA   Rohde M., Goker M., Bristow J., Eisen J.A., Markowitz V., Hugenholtz P.,
RA   Kyrpides N.C., Klenk H.P.;
RT   "Complete genome sequence of Brachyspira murdochii type strain (56-150)";
RL   Stand Genomic Sci 2(3):260-269(2010).
XX
RN   [2]
RP   1-3241804
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Ovchinnikova G., Munk A.C., Detter J.C., Han C., Tapia R., Larimer F.,
RA   Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T.,
RA   Wu D., Gronow S., Spring S., Wellnitz S., Schneider S., Klenk H.-P.,
RA   Eisen J.A.;
RT   "The complete genome of Brachyspira murdochii DSM 12563";
RL   Unpublished.
XX
RN   [3]
RP   1-3241804
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Ovchinnikova G., Munk A.C., Detter J.C., Han C., Tapia R., Larimer F.,
RA   Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T.,
RA   Wu D., Gronow S., Spring S., Wellnitz S., Schneider S., Klenk H.-P.,
RA   Eisen J.A.;
RT   ;
RL   Submitted (24-FEB-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 01bf37183bd9bbcbbbffef3ca67e7b3d.
DR   BioSample; SAMN00001910.
DR   CABRI; DSM 12563.
DR   EnsemblGenomes-Gn; Bmur_R0001.
DR   EnsemblGenomes-Gn; Bmur_R0002.
DR   EnsemblGenomes-Gn; Bmur_R0003.
DR   EnsemblGenomes-Gn; Bmur_R0004.
DR   EnsemblGenomes-Gn; Bmur_R0005.
DR   EnsemblGenomes-Gn; Bmur_R0006.
DR   EnsemblGenomes-Gn; Bmur_R0007.
DR   EnsemblGenomes-Gn; Bmur_R0008.
DR   EnsemblGenomes-Gn; Bmur_R0009.
DR   EnsemblGenomes-Gn; Bmur_R0010.
DR   EnsemblGenomes-Gn; Bmur_R0011.
DR   EnsemblGenomes-Gn; Bmur_R0012.
DR   EnsemblGenomes-Gn; Bmur_R0013.
DR   EnsemblGenomes-Gn; Bmur_R0014.
DR   EnsemblGenomes-Gn; Bmur_R0015.
DR   EnsemblGenomes-Gn; Bmur_R0016.
DR   EnsemblGenomes-Gn; Bmur_R0017.
DR   EnsemblGenomes-Gn; Bmur_R0018.
DR   EnsemblGenomes-Gn; Bmur_R0019.
DR   EnsemblGenomes-Gn; Bmur_R0020.
DR   EnsemblGenomes-Gn; Bmur_R0021.
DR   EnsemblGenomes-Gn; Bmur_R0022.
DR   EnsemblGenomes-Gn; Bmur_R0023.
DR   EnsemblGenomes-Gn; Bmur_R0024.
DR   EnsemblGenomes-Gn; Bmur_R0025.
DR   EnsemblGenomes-Gn; Bmur_R0026.
DR   EnsemblGenomes-Gn; Bmur_R0027.
DR   EnsemblGenomes-Gn; Bmur_R0028.
DR   EnsemblGenomes-Gn; Bmur_R0029.
DR   EnsemblGenomes-Gn; Bmur_R0030.
DR   EnsemblGenomes-Gn; Bmur_R0031.
DR   EnsemblGenomes-Gn; Bmur_R0032.
DR   EnsemblGenomes-Gn; Bmur_R0033.
DR   EnsemblGenomes-Gn; Bmur_R0034.
DR   EnsemblGenomes-Gn; Bmur_R0035.
DR   EnsemblGenomes-Gn; Bmur_R0036.
DR   EnsemblGenomes-Gn; Bmur_R0037.
DR   EnsemblGenomes-Gn; Bmur_R0038.
DR   EnsemblGenomes-Gn; Bmur_R0039.
DR   EnsemblGenomes-Gn; Bmur_R0040.
DR   EnsemblGenomes-Gn; Bmur_R0041.
DR   EnsemblGenomes-Gn; EBG00001208565.
DR   EnsemblGenomes-Gn; EBG00001208566.
DR   EnsemblGenomes-Gn; EBG00001208567.
DR   EnsemblGenomes-Gn; EBG00001208568.
DR   EnsemblGenomes-Gn; EBG00001208569.
DR   EnsemblGenomes-Gn; EBG00001208570.
DR   EnsemblGenomes-Gn; EBG00001208571.
DR   EnsemblGenomes-Gn; EBG00001208572.
DR   EnsemblGenomes-Gn; EBG00001208573.
DR   EnsemblGenomes-Gn; EBG00001208574.
DR   EnsemblGenomes-Gn; EBG00001208575.
DR   EnsemblGenomes-Gn; EBG00001208576.
DR   EnsemblGenomes-Gn; EBG00001208577.
DR   EnsemblGenomes-Gn; EBG00001208578.
DR   EnsemblGenomes-Gn; EBG00001208579.
DR   EnsemblGenomes-Gn; EBG00001208580.
DR   EnsemblGenomes-Gn; EBG00001208581.
DR   EnsemblGenomes-Gn; EBG00001208582.
DR   EnsemblGenomes-Gn; EBG00001208583.
DR   EnsemblGenomes-Gn; EBG00001208584.
DR   EnsemblGenomes-Gn; EBG00001208585.
DR   EnsemblGenomes-Gn; EBG00001208586.
DR   EnsemblGenomes-Gn; EBG00001208587.
DR   EnsemblGenomes-Gn; EBG00001208588.
DR   EnsemblGenomes-Gn; EBG00001208589.
DR   EnsemblGenomes-Gn; EBG00001208590.
DR   EnsemblGenomes-Gn; EBG00001208591.
DR   EnsemblGenomes-Gn; EBG00001208592.
DR   EnsemblGenomes-Gn; EBG00001208593.
DR   EnsemblGenomes-Gn; EBG00001208594.
DR   EnsemblGenomes-Gn; EBG00001208595.
DR   EnsemblGenomes-Gn; EBG00001208596.
DR   EnsemblGenomes-Gn; EBG00001208597.
DR   EnsemblGenomes-Gn; EBG00001208598.
DR   EnsemblGenomes-Gn; EBG00001208599.
DR   EnsemblGenomes-Gn; EBG00001208600.
DR   EnsemblGenomes-Gn; EBG00001208601.
DR   EnsemblGenomes-Gn; EBG00001208602.
DR   EnsemblGenomes-Gn; EBG00001208603.
DR   EnsemblGenomes-Gn; EBG00001208604.
DR   EnsemblGenomes-Gn; EBG00001208605.
DR   EnsemblGenomes-Gn; EBG00001208606.
DR   EnsemblGenomes-Gn; EBG00001208607.
DR   EnsemblGenomes-Tr; Bmur_R0001-1.
DR   EnsemblGenomes-Tr; Bmur_R0002-1.
DR   EnsemblGenomes-Tr; Bmur_R0003-1.
DR   EnsemblGenomes-Tr; Bmur_R0004-1.
DR   EnsemblGenomes-Tr; Bmur_R0005-1.
DR   EnsemblGenomes-Tr; Bmur_R0006-1.
DR   EnsemblGenomes-Tr; Bmur_R0007-1.
DR   EnsemblGenomes-Tr; Bmur_R0008-1.
DR   EnsemblGenomes-Tr; Bmur_R0009-1.
DR   EnsemblGenomes-Tr; Bmur_R0010-1.
DR   EnsemblGenomes-Tr; Bmur_R0011-1.
DR   EnsemblGenomes-Tr; Bmur_R0012-1.
DR   EnsemblGenomes-Tr; Bmur_R0013-1.
DR   EnsemblGenomes-Tr; Bmur_R0014-1.
DR   EnsemblGenomes-Tr; Bmur_R0015-1.
DR   EnsemblGenomes-Tr; Bmur_R0016-1.
DR   EnsemblGenomes-Tr; Bmur_R0017-1.
DR   EnsemblGenomes-Tr; Bmur_R0018-1.
DR   EnsemblGenomes-Tr; Bmur_R0019-1.
DR   EnsemblGenomes-Tr; Bmur_R0020-1.
DR   EnsemblGenomes-Tr; Bmur_R0021-1.
DR   EnsemblGenomes-Tr; Bmur_R0022-1.
DR   EnsemblGenomes-Tr; Bmur_R0023-1.
DR   EnsemblGenomes-Tr; Bmur_R0024-1.
DR   EnsemblGenomes-Tr; Bmur_R0025-1.
DR   EnsemblGenomes-Tr; Bmur_R0026-1.
DR   EnsemblGenomes-Tr; Bmur_R0027-1.
DR   EnsemblGenomes-Tr; Bmur_R0028-1.
DR   EnsemblGenomes-Tr; Bmur_R0029-1.
DR   EnsemblGenomes-Tr; Bmur_R0030-1.
DR   EnsemblGenomes-Tr; Bmur_R0031-1.
DR   EnsemblGenomes-Tr; Bmur_R0032-1.
DR   EnsemblGenomes-Tr; Bmur_R0033-1.
DR   EnsemblGenomes-Tr; Bmur_R0034-1.
DR   EnsemblGenomes-Tr; Bmur_R0035-1.
DR   EnsemblGenomes-Tr; Bmur_R0036-1.
DR   EnsemblGenomes-Tr; Bmur_R0037-1.
DR   EnsemblGenomes-Tr; Bmur_R0038-1.
DR   EnsemblGenomes-Tr; Bmur_R0039-1.
DR   EnsemblGenomes-Tr; Bmur_R0040-1.
DR   EnsemblGenomes-Tr; Bmur_R0041-1.
DR   EnsemblGenomes-Tr; EBT00001777592.
DR   EnsemblGenomes-Tr; EBT00001777593.
DR   EnsemblGenomes-Tr; EBT00001777594.
DR   EnsemblGenomes-Tr; EBT00001777595.
DR   EnsemblGenomes-Tr; EBT00001777596.
DR   EnsemblGenomes-Tr; EBT00001777597.
DR   EnsemblGenomes-Tr; EBT00001777598.
DR   EnsemblGenomes-Tr; EBT00001777599.
DR   EnsemblGenomes-Tr; EBT00001777600.
DR   EnsemblGenomes-Tr; EBT00001777601.
DR   EnsemblGenomes-Tr; EBT00001777602.
DR   EnsemblGenomes-Tr; EBT00001777603.
DR   EnsemblGenomes-Tr; EBT00001777604.
DR   EnsemblGenomes-Tr; EBT00001777605.
DR   EnsemblGenomes-Tr; EBT00001777607.
DR   EnsemblGenomes-Tr; EBT00001777610.
DR   EnsemblGenomes-Tr; EBT00001777612.
DR   EnsemblGenomes-Tr; EBT00001777614.
DR   EnsemblGenomes-Tr; EBT00001777617.
DR   EnsemblGenomes-Tr; EBT00001777624.
DR   EnsemblGenomes-Tr; EBT00001777626.
DR   EnsemblGenomes-Tr; EBT00001777628.
DR   EnsemblGenomes-Tr; EBT00001777630.
DR   EnsemblGenomes-Tr; EBT00001777631.
DR   EnsemblGenomes-Tr; EBT00001777633.
DR   EnsemblGenomes-Tr; EBT00001777635.
DR   EnsemblGenomes-Tr; EBT00001777637.
DR   EnsemblGenomes-Tr; EBT00001777639.
DR   EnsemblGenomes-Tr; EBT00001777643.
DR   EnsemblGenomes-Tr; EBT00001777646.
DR   EnsemblGenomes-Tr; EBT00001777649.
DR   EnsemblGenomes-Tr; EBT00001777653.
DR   EnsemblGenomes-Tr; EBT00001777656.
DR   EnsemblGenomes-Tr; EBT00001777658.
DR   EnsemblGenomes-Tr; EBT00001777660.
DR   EnsemblGenomes-Tr; EBT00001777662.
DR   EnsemblGenomes-Tr; EBT00001777668.
DR   EnsemblGenomes-Tr; EBT00001777671.
DR   EnsemblGenomes-Tr; EBT00001777672.
DR   EnsemblGenomes-Tr; EBT00001777674.
DR   EnsemblGenomes-Tr; EBT00001777676.
DR   EnsemblGenomes-Tr; EBT00001777678.
DR   EnsemblGenomes-Tr; EBT00001777681.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01990; SECIS_4.
DR   SILVA-LSU; CP001959.
DR   SILVA-SSU; CP001959.
DR   StrainInfo; 115432; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4083292
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             Tanja Woyke (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##MIGS-Data-START##
CC   investigation_type  :: bacteria_archaea
CC   project_name        :: Brachyspira murdochii 56-150, DSM 12563
CC   collection_date     :: 1992
CC   lat_lon             :: 52.939 -73.549
CC   depth               :: Missing
CC   alt_elev            :: Missing
CC   country             :: Canada
CC   environment         :: Host, Intestinal microflora
CC   num_replicons       :: 1
CC   ref_biomaterial     :: DSM 12563, ATCC 51284, CIP 105832
CC   biotic_relationship :: Free living
CC   trophic_level       :: Chemoorganotroph
CC   rel_to_oxygen       :: Anaerobe
CC   isol_growth_condt   :: Missing
CC   sequencing_meth     :: WGS
CC   assembly            :: Newbler v. 2.3 (pre-release)
CC   finishing_strategy  :: Finished
CC   sequencing depth    :: 19.7x Sanger, 48.9x pyrosequence
CC   GOLD Stamp ID       :: Gc01276
CC   Type Strain         :: Yes
CC   Greengenes ID       :: 88867
CC   Funding Program     :: DOE-GEBA 2007
CC   Number of Reads     :: 79829 Sanger, 861386 pyrosequencing
CC   Gene Calling Method :: Prodigal, GenePRIMP
CC   Isolation Site      :: intestinal contents of healthy swine
CC   Host Name           :: Swine
CC   Host Health         :: Healthy
CC   Body Sample Site    :: Gastrointestinal tract
CC   Body Sample Subsite :: Intestinal tract
CC   Cell Shape          :: Spiral-shaped
CC   Motility            :: Motile
CC   Sporulation         :: Nonsporulating
CC   Temperature Range   :: Mesophile
CC   Temperature Optimum :: 39C
CC   Gram Staining       :: gram-
CC   Diseases            :: None
CC   ##MIGS-Data-END##
CC   ##Genome-Assembly-Data-START##
CC   Finishing Goal           :: Finished
CC   Current Finishing Status :: Finished
CC   Assembly Method          :: Newbler v. 2.3
CC   Genome Coverage          :: 19.7x Sanger, 48.9x pyrosequence
CC   Sequencing Technology    :: Sanger/454/Illumina
CC   ##Genome-Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3241804
FT                   /organism="Brachyspira murdochii DSM 12563"
FT                   /host="swine"
FT                   /strain="DSM 12563"
FT                   /mol_type="genomic DNA"
FT                   /country="Canada"
FT                   /isolation_source="intestinal contents of healthy swine"
FT                   /note="type strain of Brachyspira murdochii"
FT                   /db_xref="taxon:526224"
FT   gene            132..1511
FT                   /locus_tag="Bmur_0001"
FT   CDS_pept        132..1511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; KEGG:
FT                   bhy:BHWA1_00217 chromosomal replication initiation protein;
FT                   SMART: Chromosomal replication initiator DnaA domain; AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70112"
FT                   /db_xref="GOA:D5U3U5"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3U5"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ADG70112.1"
FT                   /translation="MEDIKQYWNEFLNIISEDDEFTAVALLKGSVFVAEEDNKAAIVCS
FT                   GDFAATHIKKDFLGRIKKFFNDKCSNNIDIDVRVDADFVNEHLMPEEEYHEKSEKTDNN
FT                   AEVSNTVKKEVSNNKSNLNDYFRFDNFIQGNNNRYVFEAAKYVSSNPGKEYNPFYVYGS
FT                   VGIGKTHLLQAIGNSYLEANPNAKVLYIDGSGFRDEYVSCLQNKKPEVFKRKYKSLDML
FT                   LLDDLQLLESAQETSKELFEIFQALDSAAKQMVFVSDKPPKELRNIESRLKNRFEKSLI
FT                   LSIEPPQYETRLAIIERKLFDLHTSIDEEVMKYMAENITTDVRKIEGAIRAYLSVRDLM
FT                   KITPDVEQCEKMGIFKDYFTNKPKLKNATVKEIKKMVADYYGIEMSSFESKDRTKFIAK
FT                   ARHVAIYLSCEYSKKSVTEIGLEFNRDHASIIHGRDKVKDELRSGSHLFSEINEIISNI
FT                   S"
FT   gene            2051..2671
FT                   /locus_tag="Bmur_0002"
FT   CDS_pept        2051..2671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0002"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein; KEGG: bhy:BHWA1_00218 protein
FT                   GrpE (HSP-70 cofactor)"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70113"
FT                   /db_xref="GOA:D5U3U6"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3U6"
FT                   /inference="protein motif:PFAM:PF01025"
FT                   /protein_id="ADG70113.1"
FT                   /translation="MEEEIKETNESGDKEDINKENNEELENNNEENKESSNEEAANDEV
FT                   SELKKKVEELQQEASDMKNKYMYAMAEAENIRKRTAKEKTDAIKRANKGLLLSLLTFMD
FT                   NFERALKAGEKDENIQGTEYYKGIELIHKQFIDFMHDNGVSEIESLGEEFDPNIHEALT
FT                   MIEVPDLDKEKVVEVYAKGYKLNDELLRTAKVVVGKPPAAPKE"
FT   gene            2693..2902
FT                   /locus_tag="Bmur_0003"
FT   CDS_pept        2693..2902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0003"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70114"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3U7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG70114.1"
FT                   /translation="MAHIQLFRAYYEPKADKKESIQHINRVLQDLTDAINNHIKDKEVI
FT                   NVDLTTSHLGNGHTEYVVSVLTKD"
FT   gene            2992..4908
FT                   /locus_tag="Bmur_0004"
FT   CDS_pept        2992..4908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0004"
FT                   /product="chaperone protein DnaK"
FT                   /note="KEGG: bhy:BHWA1_00219 molecular chaperone DnaK;
FT                   TIGRFAM: chaperone protein DnaK; PFAM: Heat shock protein
FT                   70"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70115"
FT                   /db_xref="GOA:D5U3U8"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3U8"
FT                   /inference="protein motif:TFAM:TIGR02350"
FT                   /protein_id="ADG70115.1"
FT                   /translation="MSKIIGIDLGTTNSCVSVMEGGKPVVITNSEGNRTTPSIVAFTNK
FT                   GEVLVGQPAKNQMVTNPENTIFSIKRFMGNTYAEVSEERSRMPYTVIEDGGKVKIKTLE
FT                   GNFTPQEISARILQKMKQTAEEYLGETVTDAIITVPAYFNDSQRQSTKDAGRIAGLNVL
FT                   RIINEPTAAALAYGMEKKKDEKIAVYDLGGGTFDISILELADGVFEVKSTNGDTHLGGD
FT                   DFDQAIINWLIDEFKKDTGVDLNNDKMALQRLKEAGEKAKKELSSSLQTDINLPYLTAD
FT                   ASGPKHLNVSLTRAKFEDLIRDLVEKTRIPCEKALKDAGLSIGDIDEVILVGGSTRIPM
FT                   VQETVKNIFNKEPNKSVNPDEAVAMGAAVQGGIIKGDVKDVLLLDVTPLSLGIETEGSV
FT                   MTVLINRNTTIPTNKKQVFSTAADNQSSVTIRVLQGERKMANDNRELGRFDLVGIPPAP
FT                   RGVPQIEVSFDIDANGIVHVTAKDLGTGKEQKIRIESSSGLSEDEINRMVQDAEKHAEE
FT                   DKKKKEEVEAKNNADHMIYQTEKLLKENGDKLPASDKSEIESKMNALKSAVESNNTDNI
FT                   KRATDDLQAAWSKASEALYKQAGAQQGQADGGQQAQQNNSQDSGRKDDGVVDADYEIVD
FT                   DNK"
FT   gene            5123..5455
FT                   /locus_tag="Bmur_0005"
FT   CDS_pept        5123..5455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0005"
FT                   /product="Ankyrin"
FT                   /note="PFAM: Ankyrin; KEGG: ankyrin repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70116"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3U9"
FT                   /inference="protein motif:PFAM:PF00023"
FT                   /protein_id="ADG70116.1"
FT                   /translation="MLALENGHLEVVKYLLENGANVNLKNITDVSALILASMDNHLEIV
FT                   KYLLDKGADINAKDNYGKTALMYASEKGHSEVAKFLKSKGAKKYIYNFCSLTIYHNTSI
FT                   INIQSF"
FT   gene            5465..6406
FT                   /locus_tag="Bmur_0006"
FT   CDS_pept        5465..6406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0006"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00853 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70117"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3V0"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00853"
FT                   /protein_id="ADG70117.1"
FT                   /translation="MEYSEYLEKLKKEIITVDNMNRINDCYIRYLFSEKGNERIILSFI
FT                   NSVMKNMHFRTFVKAEILNPFNLSKYLESKESVMDIRCTTDSGEVVIIEIQSQGNIEFI
FT                   YRSLFYWANGYAVMLNKGDNYNNLCPVISINILNFNLMYDIKDIHTCYVLKEIKHNRIL
FT                   TNHCQLHYIELPKFNFNSSYDEAEKKFLSWLKFFKGDKMENLLKEDTIFEEVKLKSESF
FT                   VHTNPLIDSYRRKEADEYFNKRMLDYELAEAERKGISKGIEKGIEKGIEKGIEKGIEKE
FT                   KYVLAKNMKNENLDINLISKITGLSTEEILKL"
FT   gene            6556..7248
FT                   /locus_tag="Bmur_0007"
FT   CDS_pept        6556..7248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0007"
FT                   /product="protein of unknown function DUF1275"
FT                   /note="PFAM: protein of unknown function DUF1275; KEGG:
FT                   bhy:BHWA1_00222 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70118"
FT                   /db_xref="GOA:D5U3V1"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3V1"
FT                   /inference="protein motif:PFAM:PF06912"
FT                   /protein_id="ADG70118.1"
FT                   /translation="MKNSFIAFIKRKNESIHTTETIYIASILTLVGGFVDAYTYITRDG
FT                   VFAYAQTGNMIFFAMHLAKKEFAITMHYLIPILVFIIGIWTALYIKKVLNKKKLMELEY
FT                   VIILMAAVILFIVGFLHKGISNIIVVSVISFMSAALMITFNKVEGLAYVTNMCTGNLKS
FT                   ASDNLFRFLFNRDRVGLKNGLIYLTILFSFTLGAFLGSFFTNMFGIKSIWIASGLLFIV
FT                   ESLMFFDN"
FT   gene            7274..7564
FT                   /locus_tag="Bmur_0008"
FT   CDS_pept        7274..7564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0008"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="KEGG: bhy:BHWA1_00223 putative chaperone protein
FT                   DnaJ; PFAM: heat shock protein DnaJ domain protein; SMART:
FT                   heat shock protein DnaJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70119"
FT                   /db_xref="GOA:D5U3V2"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3V2"
FT                   /inference="protein motif:PFAM:PF00226"
FT                   /protein_id="ADG70119.1"
FT                   /translation="MDKDYYAILNVNMFSSNEKIKKSYRELAMKYHPDRNAGDEKANRM
FT                   FIDITEAYEVLSDKEKRMQYNILYVGSNKYVVGALAAAGFGLGLILSRRKK"
FT   gene            7604..8734
FT                   /locus_tag="Bmur_0009"
FT   CDS_pept        7604..8734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0009"
FT                   /product="chaperone protein DnaJ"
FT                   /note="TIGRFAM: chaperone protein DnaJ; PFAM: chaperone
FT                   DnaJ domain protein; DnaJ central domain protein; heat
FT                   shock protein DnaJ domain protein; KEGG: bhy:BHWA1_00224
FT                   chaperone protein DnaJ; SMART: heat shock protein DnaJ
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70120"
FT                   /db_xref="GOA:D5U3V3"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3V3"
FT                   /inference="protein motif:TFAM:TIGR02349"
FT                   /protein_id="ADG70120.1"
FT                   /translation="MAEKRDYYEVLGVAKTATNDEIKKAYRKLAMQYHPDRNPGNKEAE
FT                   DKFKEATEAYEILSDEKKRAQYDQFGFQGVHSDFADAYGRGGFDFSQMFGGSGGFGDLD
FT                   DIFSSFFGGGFSGRSSRSQRRGNDLRHDITLSLEDAVFGKKMEIKLDKNDICDVCHGTG
FT                   AEPGTKTQTCPTCGGSGEVRMAQGFFSVRRTCSKCNGSGSIVTTPCKKCRGTGTVKKNK
FT                   TISVNIPKGIEDNTQLRVSGEGEAIGGGVAGDLYLYIHVAPHQYFVRDGIDLITEVGIN
FT                   IVQAALGADIYIQTLDKKKVKIKIPAGTNSGQVFKLKGSGAAHINRSGRGDLFVIVNID
FT                   VSSKLSSEEKRLFNELKKVMPNNDEPVLRKPSRNNW"
FT   gene            8859..9899
FT                   /locus_tag="Bmur_0010"
FT   CDS_pept        8859..9899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0010"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   bhy:BHWA1_00598 ankyrin repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70121"
FT                   /db_xref="GOA:D5U3V4"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3V4"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ADG70121.1"
FT                   /translation="MKGLVYLGNKKIDLKKIENPKILDSKDAVVKVTLSSICTSDLHII
FT                   NGAVPRAKENIVLGHEFVGEVIEVGKDVKKIEIGDRVSCNCITFCGECYYCKNGFINNC
FT                   EIGGWEIGCRIDGCQAQYVRVPFADTALNTIPENVTYDRALFVGDILASGYFGAELSEV
FT                   KNNDTAAVIGAGPVGLCSMICARIFGAKNIIAIDIDENRLNIAKEKGLADFFINPNKTE
FT                   NIEEFIKDINKGRLADNVIEAAGGDNTFELAWKIARPNSSVALVAMYEKPQILPLNIMY
FT                   GKNLIFKTGGVDAVHSDEILNLISEDKINTDFIITHRIKLDNIIKGYDIFKSKKDNCMK
FT                   IAVEYD"
FT   gene            complement(10288..12345)
FT                   /locus_tag="Bmur_0011"
FT   CDS_pept        complement(10288..12345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0011"
FT                   /product="excinuclease ABC, B subunit"
FT                   /note="TIGRFAM: excinuclease ABC, B subunit; PFAM: helicase
FT                   domain protein; UvrB/UvrC protein; KEGG: bhy:BHWA1_00365
FT                   excinuclease ABC, B subunit; SMART: DEAD-like helicase ;
FT                   helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70122"
FT                   /db_xref="GOA:D5U3V5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3V5"
FT                   /inference="protein motif:TFAM:TIGR00631"
FT                   /protein_id="ADG70122.1"
FT                   /translation="MFCMNFKLESNFKPSGDQVTAIESLVKGLENKNKYQTLLGVTASG
FT                   KTFTIANVIEKANRPTLVMSHNKTLAAQLYRELKDFFPNNAVEYFVSYYDYYQPEAYVP
FT                   AKDLYIDKDASVNDEIDRLRLKATTSLLERRDVIIVASVSCIYGLGSPEDYRKLYISIE
FT                   KDGEYDRDEIIEKLVSIQYERVKDVLERARFRVIGDTLEIMSAYSDEVIRIEFFGDTVE
FT                   RIIKINPVTRKKLSEQDRVVIYPAKHFVTGGDKLAAGIKLIEEELEEQYNKFKSEGKLV
FT                   EAERIYGRTKYDLEMLREVGYCAGIENYSRPLSGRKEGDRPACLIDYFPKDFLTIIDES
FT                   HVSVPQIRGMFFGDRSRKETLVKYGFRLPSALDNRPLFFEEFEKLTNDTIYISATPAEY
FT                   ELKKSSKVVEQIIRPTGLLDPIIEVYPIDGQIDRILEEIKKTISNNERIFITTLTKKMA
FT                   EDLTKYLNENGVRTRYLHSDIQTVERVEIIRDLRLGAFDVLVGINLLREGLDVPEVSLI
FT                   LILDADKTGFLRNTTTLIQTIGRAARNANGRVIMFADSISDAMKVAIDETERRRKIQME
FT                   YNKEHNITPKTIIKKIQDIIEREEKVETSYELHFDFRRFNERVKIDPKQQSDEYIKELE
FT                   KEMKRASDSLEFEKAIEIREKINQLKQLKPSKKTAHKNVTSKNPNGKTKR"
FT   gene            complement(12373..13278)
FT                   /locus_tag="Bmur_0012"
FT   CDS_pept        complement(12373..13278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0012"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00366 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70123"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3V6"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00366"
FT                   /protein_id="ADG70123.1"
FT                   /translation="MNIVIIHTGFAKYLVYALKKIKETNKNSNIFLISDRKYKEYSKYS
FT                   IFVDINKVTKDEAILFKNKYIHLGKSNPNYEMFCMQRWIILKDFMKIYNINECLHIDSD
FT                   VLLFSNMEDALNPFNQYSISLANNLALTMYIRDIKILEEFSKYLLFKYTDEKEINKLKD
FT                   MYYNTYRVNNGVAGSISDMDISREFFSDFHLPVGNLSEIKNNSIFDFAIVYGAPNFEML
FT                   KKDKYEMKKIFFENNIPFCNYNDGTVNSKIRFHTLHFVVWSKLYIKKLYQNKDLNFNPY
FT                   YINIYREFNVFKNKIKKIFR"
FT   gene            complement(13510..14364)
FT                   /locus_tag="Bmur_0013"
FT   CDS_pept        complement(13510..14364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0013"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; KEGG: bhy:BHWA1_00367
FT                   peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70124"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3V7"
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /protein_id="ADG70124.1"
FT                   /translation="MKKYILILFIISSLLFARVPIDDNRIRITSTFGEFRTDHFHNGVD
FT                   FGGNRMEIYPVKDGEIVYYLDEDEDPTRPLYGVGNVVMIEHPDNLRSYYYHIEPGTIEK
FT                   SYAKVTEKDVIALTGNSGRSGGAHLHLTIENMKEGLVVDPLEYLNIDKGSSQPPLIHGI
FT                   YLRTENRLIQIKDKMPMSYKGEIKLFVKAYDLLGSIPMGLKRVKIYMNDELVRDYDFTY
FT                   FIKRDNVYYISPNYRFEEVYGVDSHFYRGGVFTPKRGKYTFKAEVTDFDNKTVVLTRTV
FT                   NFY"
FT   sig_peptide     complement(14311..14364)
FT                   /locus_tag="Bmur_0013"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.642) with cleavage site probability 0.642 at
FT                   residue 18"
FT   gene            complement(14361..15536)
FT                   /locus_tag="Bmur_0014"
FT   CDS_pept        complement(14361..15536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0014"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00368 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70125"
FT                   /db_xref="GOA:D5U3V8"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3V8"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00368"
FT                   /protein_id="ADG70125.1"
FT                   /translation="MQIKEKSIIELENIHKIEPFFIRYLTIISSVVLIISFIFFFGTNR
FT                   LNEEYNTVNVWNKETQSIEPPSHDDNFNIDGIFKQNFFTKPEGIVHYFDFNGDTIYSTN
FT                   LSRGELATANNQNFIIYKRYGNYIDAYNNMGIIIWRTNTSIYPEIAPYAERIIYHSSDN
FT                   SKIQMFDFNNNPLSRHVQYGEIITDGAFALNTGDYIAGFSSGDIAYINRNGNLSFAIST
FT                   ILSEINIVKSVAISEYGSFAMSVSGIRPEYITLYDANGSTMWYLETGLNRRRHVSSYVS
FT                   EKSMTAFMLADRDIVLYTLNKGKEIDRINLEKYNMMNAVNMKLNSETNSTIMSVSKDAK
FT                   SVVLIYDNNAKEIVFEKYLDGWVYNLDISSLENEYMIVSDKMIYTYKRVKL"
FT   gene            complement(15593..16780)
FT                   /locus_tag="Bmur_0015"
FT   CDS_pept        complement(15593..16780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0015"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; KEGG: bhy:BHWA1_00369
FT                   peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70126"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3V9"
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /protein_id="ADG70126.1"
FT                   /translation="MKYIITIILSFYIFSFSLYSQYKAEYLGNNISIVRDGQTINKMPE
FT                   LKDNDILETKKDSFAQININGKYYYIAPNSKVQITSSNAKIINGALYTRDKNFDSLDDF
FT                   KDYDKDIKIYADPFPFYAGKVSTIFITSKDEIKIENSKLLGSARPIVKFFEVKDADRNL
FT                   KVYKSIFGIYVGAQDEKYQFVSNIELKDKTTLSVAIDIKLDFTPPPPKPKQIPGVTSTM
FT                   KNIISNPQKSREERELLNGNIYISYTPTNYADKVYIMPSQGRYSSGFGAFRGYTKDYAR
FT                   YHQGFDIANTNGTPIIAANNGVVRVSRELFVRGNCVVIDHGEGVYSSYFHMSKLIAKEG
FT                   QYVKKGEVIGLIGSTGMSTGPHCHWEMRAGNMTFDPLSILEKPVSFNTKVLTQIK"
FT   gene            complement(16832..17521)
FT                   /locus_tag="Bmur_0016"
FT   CDS_pept        complement(16832..17521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0016"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; KEGG:
FT                   bhy:BHWA1_00370 TPR domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70127"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3W0"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ADG70127.1"
FT                   /translation="MSIGSSRSKLEDGIKFFRNENYKEAIDSLEKIFSEKNDVESGYHL
FT                   ALAYAQIQDYDNTLQVFDKIMRRLDNPLRLMQAHIIVGYIYAVKEMYDLAEFELMDALS
FT                   SGVENTQIHAALGYVYYKKGNIRKAIEHLKKAVNLDPKSANARNSLGFILADTETNIDE
FT                   GIEEIKKAVSIDPSNPAYLDSLGWAFLKKNDLPHAKEYLTKAFELAPTNRDIKEHLLKL
FT                   DQLSYKK"
FT   gene            17792..17862
FT                   /locus_tag="Bmur_R0001"
FT                   /note="tRNA-Cys1"
FT   tRNA            17792..17862
FT                   /locus_tag="Bmur_R0001"
FT                   /product="tRNA-Cys"
FT   gene            17875..19782
FT                   /locus_tag="Bmur_0017"
FT   CDS_pept        17875..19782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0017"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="KEGG: bhy:BHWA1_00744 penicillin-binding protein 3;
FT                   PFAM: penicillin-binding protein transpeptidase;
FT                   Penicillin-binding protein dimerisation domain; PASTA
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70128"
FT                   /db_xref="GOA:D5U3W1"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3W1"
FT                   /inference="protein motif:PRIAM:2.4.1.129"
FT                   /protein_id="ADG70128.1"
FT                   /translation="MNEARIKKLYLFLVCFAIVTIAIFFRLFNLTIKNRKSITSLDGLD
FT                   KPRGTIYDSKMRPLTINIPAYTIYLDTESVSLDGNENTDINEAYSQIFSIIGITKEKFS
FT                   DLISAKRRTIRLAQNINLDSYKKIKEIKDKYTVKSIYGIESYKRFYPYEDVFAHVIGYM
FT                   NKTETEGYAGLEATYESILSSENDNPKDIVLTLDIDVQTIVRNEVLKTVAEISPQSATV
FT                   IVSDVNTGAVIANYSYPSFDPNNPFIYVNNERMDRSIMSTIYPGSTMKIFAELAAIEQG
FT                   VVNSDEIFHCKGYYDYSRQTRIHCDYPHGDVAFNDILKYSCNYAIVTIAERIDKQFFYD
FT                   YLKRFGFGEPTGVGPYKNEWSGIYHPLNKWHRFSRGYLAIGYDLSVTPMQIAASYLPLL
FT                   NGGWKVPMHVVDAIYDGIEKISVTNRLKKTRIIDEQYSQIARVLLRKGVESGSTGYRAN
FT                   LLNIDVVGKTGTAITEVYRDNESEKPEKYYQSIFIGGFPLEDPKISILVLLDDPQGKGT
FT                   QSAGRVAAPLFAKIANQIIPYLGLVDGDIYTINTNDFLSLVPPSNSYYSATNNIMPNIM
FT                   GLSLRDALNNISYIVSNNNAKIAIQGEGYVYDYSPQAGSEITNNSIVRLLLKAPIDNKE
FT                   "
FT   gene            19804..20706
FT                   /locus_tag="Bmur_0018"
FT   CDS_pept        19804..20706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0018"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: bhy:BHWA1_00743
FT                   carbohydrate kinase, PfkB family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70129"
FT                   /db_xref="GOA:D5U3W2"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3W2"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ADG70129.1"
FT                   /translation="MNNILSFGELLYDVYDNVSVIGGAPFNYSIQLSRLMGHDDRLRFI
FT                   TALGDDDYSKDALSFINNENIDKSLIQILDNYETGKATVFLNEKKVPDYIIHENAAWDN
FT                   IEYNKDIENALNENYDLFYFNILSQRNDKSYTTLKKIFKNIKSKYKVCDVTFRKNYYTK
FT                   EKIKESLEFVNILKINDDELAVIKGLFYPSLENDNKTLLKAINKDFNIDYIFLTLGSKG
FT                   ASVFYNNEYIFKPSNKVNVIDTVGAGDSFCAALSYAILRNLDIKNVLEFASDVSEEMIQ
FT                   VKGGTAKYDIKKVKSKFNL"
FT   gene            complement(20711..21265)
FT                   /locus_tag="Bmur_0019"
FT   CDS_pept        complement(20711..21265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0019"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00742 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70130"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3W3"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00742"
FT                   /protein_id="ADG70130.1"
FT                   /translation="MKIYFTLLIITAYFSFLYPQNSFDYNLNVKFRVIEKFDKLLSSDN
FT                   KEYVFYIDANYIFTEEGKSIYSNNIYNIQTTLNDLEKKLDKAKTQEEKMQLNQNIRIYE
FT                   GLLAYNTPPKKFITLLINRQIYEYIAKYPSSYIDNMMQNNLQQFYDDIRNNIILNEKYT
FT                   GRFTSLLFITKEKFKYYTGRT"
FT   gene            complement(21293..22465)
FT                   /locus_tag="Bmur_0020"
FT   CDS_pept        complement(21293..22465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0020"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein; KEGG:
FT                   bhy:BHWA1_00741 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70131"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3W4"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ADG70131.1"
FT                   /translation="MKYYIKTILLFLILTYSVIYAKPSDKIRFDSDELTELEYDFFTKI
FT                   DNGETNDLELHYDGFIIASGITDEEEFKFYRGKLDEIRNLAKKDLSQYTEEGAYAFGKR
FT                   LLNWLYSSGVLKKYFETSTLFQDLIYKGEYNCLSSSILYSLLYSEFGFKVTGVLTSSHA
FT                   FCTVYTEQGKIDVETTISRGFNPGQKEIRNTGNSTIVTFVPQGNYRDRNEVDIFTLIAT
FT                   LYPNSISLKKIEKDLEKQLVMAKKAYYLSPNTEIYNKNLINAYNRLALDYLKKNDYEAA
FT                   YKTLEEAYVFDPSSSMTKNNRIHYYNTIGTSYLSQKDYPNAIQIYKIGISDIGDDASVL
FT                   KRNLKVSYYNYAVTEYNERRYNNANTISEEALKLFPNDRDFIRLLSSIPK"
FT   gene            complement(22492..23142)
FT                   /locus_tag="Bmur_0021"
FT   CDS_pept        complement(22492..23142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0021"
FT                   /product="protein of unknown function DUF151"
FT                   /note="PFAM: protein of unknown function DUF151; UvrB/UvrC
FT                   protein; KEGG: bhy:BHWA1_00740 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70132"
FT                   /db_xref="GOA:D5U3W5"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003729"
FT                   /db_xref="InterPro:IPR036104"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3W5"
FT                   /inference="protein motif:PFAM:PF02577"
FT                   /protein_id="ADG70132.1"
FT                   /translation="MVEAKILNLAITDKGFVVILKPEKSDKVVPISIAYLEAQSIMASL
FT                   IGYKIERPLTHDIVSSIFQNCGIRLINIIIDNVHIDTFFSKLVIEHNGKNIFIDSRPSD
FT                   AIALSLKSKAPIFIEEHVVDKAGIVLEDNDSLMKVKDSIPFTYQRFDREDLKETSSENI
FT                   FTKKEPEEYNNNTNTKDYKKNKEELQRLLDQAVKEERYEDAAKYRDELDNLSE"
FT   gene            23339..25096
FT                   /locus_tag="Bmur_0022"
FT   CDS_pept        23339..25096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0022"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00739 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70133"
FT                   /db_xref="InterPro:IPR008763"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3W6"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00739"
FT                   /protein_id="ADG70133.1"
FT                   /translation="MEAMEKRIFFIFALLFVFAFNLFTQTEDLPKTPPENPEVIPISEI
FT                   YEGMEGVGYTVIHGTNVEPFKVKVLSILKKRWHNSDAILIQCEGLNLDHSGTVAGMSGS
FT                   PIYFNGKIAGALAFGWNYAKDPIAGVTPIEEMYKLYEDTNAKSPLLGFADNNSLQTPLI
FT                   FSGISSKAFDEYSSSFKKSGFYPMQTGGSISDTNQATKFLFGDSVAIVLADGDVSMAGI
FT                   GTVSHTDNEKFLLFGHSMWSKGRLRAPVSRAYINHIVASVDSSFKLGAAYSNYLGYTVY
FT                   DGVFGVSGVYGEVPENTMVPVKLEIEDQTFLTRDYNFRVLNDPTYFSDILSMAIYSAIS
FT                   STAGGEEEGVFSISYEIETDYFEEPYKVNDRILAYSSTDAFKSAIEQLISPIDFFIYNN
FT                   FNRVGIKSVKLSIKRNNLEYAFLNDITLVEPRAVAGETIHLRVGLTPYGKEKQYIDIPV
FT                   KLPVNLKTDVYSIYAANEYIYNYAEQLFMPNKYEIRSLDDVMRIYGKSYDDSSLRVWLY
FT                   SSSRGVQIGKDLYPTLPPSKYGIMAKNATSDKAAVITAVDGKYEMPCSTLGLIKLDIII
FT                   EGARKYENR"
FT   gene            25083..27134
FT                   /locus_tag="Bmur_0023"
FT   CDS_pept        25083..27134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0023"
FT                   /product="putative YD repeat protein"
FT                   /note="KEGG: bhy:BHWA1_00738 putative YD repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70134"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3W7"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00738"
FT                   /protein_id="ADG70134.1"
FT                   /translation="MKIAKIIFILQFILILTSANVFAVVTRTLSSTKRGFFDNGVYDGV
FT                   MLTEQGSLTLAPVIEQDGAISGKDIWKIYPVSDGGMFAAISGSGAELYKRDAESTNFTS
FT                   FASESNESAFTAVISDSQGNVYAAVGPYAKIIKYDSSGKELWRKTLDDTYIWDMKFDNN
FT                   GNLFAAAGGNNARVIKISSDGEIKEILKTEEQHAMSLYFDSKNNKMYVGTAGRGLVLCI
FT                   DLSTNLENPSYSVVYDTAENEVYAITMDNIGNLYFGTATRQPAYLILPSIIDGDKRPDE
FT                   ADKEFRNSLYRADTNGTVQRLFFLNQTLVLALSSDKNNNIYFVTGDTADIYKINGDDGL
FT                   LSYIGGLKNKILSTFAVSEDGLYFAISKTGEIYRIKHGYPNYGSFTSDTLDLKLLSKLG
FT                   SFNAMSTVPQGGNISVEVRTGNAARVDKSWSDFMPIDANGKVNVPEGRFMQFKVTMETS
FT                   DTEITPVLNSMDFTYVENNLAPEVLNGGLTTRYRQQNDSSETAKSPQLEENEAMVYWKG
FT                   SDPNGDKLSYDLEYRLKGEKNYRKLASNLETSYYKFNSYLMPSGIYDFRITASDKYDNP
FT                   VGEIKTKTLEVFNVKYDNDPPELFDFNVTGEGSGRVVTFRVEDKLSFIKTVRYSTITGE
FT                   WRYIVPNDGLLDSMNEAFTINIDDAEAGSVTIEVMDTEGNTKYYSFII"
FT   gene            complement(27314..29854)
FT                   /locus_tag="Bmur_0024"
FT   CDS_pept        complement(27314..29854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0024"
FT                   /product="helicase c2"
FT                   /note="SMART: helicase c2; DEAD-like helicase; KEGG:
FT                   bhy:BHWA1_00600 helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70135"
FT                   /db_xref="GOA:D5U3W8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3W8"
FT                   /inference="protein motif:SMART:SM00491"
FT                   /protein_id="ADG70135.1"
FT                   /translation="MSNNYDREIDSVFSTNAISYMRKAIADAYGNEVYFGINFNAYGIL
FT                   DYIEVMARGNKDSVPAIISLSLEFDAVIHNHPSGQLTPSRPDLAIASELGNNAGVGFYI
FT                   VNNDVDDYYEVVKPIKAENIKTIDVPDALYMFTENGTLSKLLKKYEYRQEQTELVEATI
FT                   ESFNNNKHLISEAGTGIGKSFAYLVPALLWLKENKTRIVISTNTINLQEQIISKDIPSI
FT                   IGGIAPNVKYALVKGRNNYVCIKKVKDALNDTDRLDFEEQIRFFEDINNWLSITKDGSI
FT                   TDLGYRPQGELWEMVACDTDTCTHRKCEYLEDCYFYKMRKQLNAAQLLIVNHHILCADL
FT                   SLYAETAGRYSLLPRYTKVLIDEAHNFENSASSYFGDEGSKNGISKALFYISRMKKNKR
FT                   LGIIESINNMLNDKKSLIEKHEYDEILDLINKAHDLTSRVRNVTEDKTKEFMNYCHKNI
FT                   QTKEGLGYKFRISPELVNTNHWKNDGLKPLREMVLSMTSLVNICDKLYKKFFDIAIEKD
FT                   FDYEEIAQMANAYLERLKRQLVSLNAVIDYKKDEYIRWIETRLTKKGSLILNWHLTPVT
FT                   VAKNLNDFLYSRFDTVAMYSATLTVSKSFNFFSNRLGFDYIEKNKKIEIYLESPFNYED
FT                   NARLYIAADMPDVASDTFNDFTSKVLLDVCDITGGRAFILFTSFSSLMSVYENTVKKLK
FT                   SKNINALAQTASVHRHTLLDMFKSSSNNVLYGVDSFWEGVDVAGKNLEVVIIPKLPFAV
FT                   PTDPISEGRYRYIEENGGNAFLDYALPFAVIKFKQGFGRLIRSKDDRGVVFVLDKRLYT
FT                   KNYGVQFIQSLPNAKVIKASMKEIFNDMNNFFEY"
FT   gene            30283..31614
FT                   /locus_tag="Bmur_0025"
FT   CDS_pept        30283..31614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0025"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="KEGG: ppd:Ppro_0172 ATPase central domain-
FT                   containing protein; PFAM: AAA ATPase central domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70136"
FT                   /db_xref="GOA:D5U3W9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3W9"
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /protein_id="ADG70136.1"
FT                   /translation="MKKIVELDKPKFDDKLKAEYSEFFDFLNKKIDAFDMVNTNIKSLF
FT                   VYLVFDSVLYNITRPESVICRFSKQVEISKEGDIKISLLRFQLDTLINDYKYNNLKIIL
FT                   FFNIPEDEILSKYLIPKNSKNNTVSNTDDPVLNVVPIKPIYSLKQMVLNPATYDEINKI
FT                   IIMIKNIDKIYNEWGFSEIDSVPKCIVNFFGPPGTGKTMAAHAIANELGVNILALNYAD
FT                   IESKFVGDAPKNLVSAFKIAEKEKSMMFFDEADSFLGKRITNVSSSSDQAVNSLRSQML
FT                   ILLESFNGTVIFATNLHKNYDSAFESRILKHIKFELPDLDMRAKIIRKMIPSKAPIDCS
FT                   LFTDEYLLELSNILDGFSPREIKNTILDLFISFLYSGNTEIDKEFINNVFKNAKEKFDE
FT                   VKNKTNLSSEAKKKLESSIKDNLENNNYVVEKIKENTEEENNIN"
FT   gene            31657..32154
FT                   /locus_tag="Bmur_0026"
FT   CDS_pept        31657..32154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0026"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: viral A-type inclusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70137"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3X0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG70137.1"
FT                   /translation="MNYNKDDILRVARDYMKKIEISNKDTIDSILDKLKKLPEDGVAKI
FT                   TDYLKNLNQAVSNHEEGVLGIIKEAWNLHEEKREVLSLEDCISMIKGNINPKEHSAACI
FT                   FLKSTGKNSKHYANYEIHVFYMDHNNNPMINGNSPHWIIYTNELSKDLSEEFGNGDMIV
FT                   LK"
FT   gene            32171..32500
FT                   /locus_tag="Bmur_0027"
FT   CDS_pept        32171..32500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0027"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbh:CLC_1106 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70138"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3X1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG70138.1"
FT                   /translation="MNFWKDLLKKLWGKIKKIFAKVLNFMKNILDFFKDPSRLAKLKAN
FT                   NDLLAISIKEKLESGNYRTVNCLFNNSTKEVEDYSEENALGIESESIDAQTSNTFSDKD
FT                   MIVLK"
FT   gene            32513..32899
FT                   /locus_tag="Bmur_0028"
FT   CDS_pept        32513..32899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0028"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70139"
FT                   /db_xref="GOA:D5U3X2"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3X2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG70139.1"
FT                   /translation="MEGKDMLYALIGAIVVVGGGFIIYKLSKVAANNLVNKAVYKDIVT
FT                   MEELIRFYKNDDVIQHLKENKDLLAVAIKKQLDDGNIHILATIFNNNTKEAEYIEKYML
FT                   NYKTAKLDEDLKNAFKDKDMIVLK"
FT   gene            32902..33447
FT                   /locus_tag="Bmur_0029"
FT   CDS_pept        32902..33447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0029"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbt:CLH_2831 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70140"
FT                   /db_xref="GOA:D5U3X3"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3X3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG70140.1"
FT                   /translation="MGALIFIIFYFILTRIALKIKSNISNRIIYYITDIIFFILIMFLL
FT                   YDYFLFENGFINNRIVNIIPFHIGFLSILDKFFIYSYNIINSLIGFLINLNENKQLILM
FT                   NDEYKKMLIVELAVIVFSILILFRARMIRKKIKNYYSDTSPALSIIESEIRKNLILNNM
FT                   LKISKFVIFIITICCIKL"
FT   gene            33457..33870
FT                   /locus_tag="Bmur_0030"
FT   CDS_pept        33457..33870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0030"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kinase domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70141"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3X4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG70141.1"
FT                   /translation="MGEIIDAIIDIIRTFINIIRRIIVKIINFAKHIARFFKDKIKQFK
FT                   KDISKIFISLKLDKDEFSKKIAENMESGNYNEVSMLDLSPETEKTVINVVYDRDTNSIT
FT                   DYEENAELIEAESGIDQVTLKKFKGKNMIVHKS"
FT   gene            33890..34120
FT                   /locus_tag="Bmur_0031"
FT   CDS_pept        33890..34120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0031"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to cytochrome C-type biogenesis
FT                   protein CCMF"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70142"
FT                   /db_xref="GOA:D5U3X5"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3X5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG70142.1"
FT                   /translation="MEKIYYDFMLLSSIIIFFIIRKTYKSLKAAAFVSKQYGEYTIEIK
FT                   LYKLLYLLLFLSSFAFLIYSFLEFISFIVKD"
FT   gene            complement(34156..35343)
FT                   /locus_tag="Bmur_0032"
FT   CDS_pept        complement(34156..35343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0032"
FT                   /product="Capsule synthesis protein, CapA"
FT                   /note="KEGG: bhy:BHWA1_00588 enzyme of poly-gamma-
FT                   glutamate biosynthesis (capsule formation)-like protein;
FT                   PFAM: Capsule synthesis protein, CapA; SMART: Capsule
FT                   synthesis protein, CapA"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70143"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3X6"
FT                   /inference="protein motif:PFAM:PF09587"
FT                   /protein_id="ADG70143.1"
FT                   /translation="MIKTIIITILLIFSLLSCSDKKDSTEKEQKIPEPPKSIQLVFTGD
FT                   IMTHPTIVNAFQSNDVLIDLKEYFQGDIVFANLEFVVNTNKPPMPYPEFNGSLDYLKYF
FT                   FNYFNTFSIANNHAYDQGAQAEAETVAELHRNNKLTLGGSTNSPNIAPIITNINNIPLF
FT                   ISAYTMLDNGLSHKTNKNDYFYFMNFYPKQEDLIEKVKSDLALATNNEIKIISLHFGLE
FT                   YTTAPEEATIKTARALIENGVDIIVGHHPHVPRPAEIYEGTNHSGIIIYSLGNFIANHK
FT                   GRYPYLDIGTVVSLNINENREISFSYVPTYYAFFRQNGFEVVMKPIKEDPNISMPTLSS
FT                   NYVYSAYDTNAIKKGYELIHNFYSPLTNEKVKTMFTFDVTNYNDAVSNESLAYYN"
FT   gene            complement(35394..36797)
FT                   /locus_tag="Bmur_0033"
FT   CDS_pept        complement(35394..36797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0033"
FT                   /product="protein of unknown function DUF21"
FT                   /note="KEGG: bhy:BHWA1_00587 hemolysin protein; PFAM:
FT                   protein of unknown function DUF21; CBS domain containing
FT                   protein; transporter-associated region; SMART: CBS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70144"
FT                   /db_xref="GOA:D5U3X7"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3X7"
FT                   /inference="protein motif:PFAM:PF01595"
FT                   /protein_id="ADG70144.1"
FT                   /translation="MEMLLVYLFEILTIIILIMLSALFSGSETAYTSIDDVTLMRLVRE
FT                   KKIKEEDKKYWEKSSSMIPTLLVGNNIVNITASSIITVFAIRLAEALPHISTNLMVTIS
FT                   TATITVLIIIFGEILPKVLMRVNAEKMMPYLLYFMKFCHFIFKPITFLMDKITTFIMNY
FT                   FVPKKLRNTEKRSALSSMDDITTIIHLGHKEGIIKEYTHELLTGVIDFRNKTVEEIMTP
FT                   RVDMVCIEAETDVDEIIRLTVETGLSRFPVYEETVDHIIGIFHTRALFKEYVKGSSKKS
FT                   KLKKKAIDYIMLPYFVPETKTISSLFTDMQKKKLQMVITIDEYGGTAGLVTMEDIIEEI
FT                   MGDIEDESDKKEADVIRFKGKRIIINGNASIEDVNKTLKLELEHEEYQTIAGYVLDMLD
FT                   HIPETNERFILKGYRGRIMKVEDRRIVEIEFTPLKYTARNSDANDNNENNEIQDVHDIE
FT                   KNDLEIVNE"
FT   gene            complement(36816..37502)
FT                   /locus_tag="Bmur_0034"
FT   CDS_pept        complement(36816..37502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0034"
FT                   /product="N-acetylmuramyl-L-alanine amidase, negative
FT                   regulator of AmpC, AmpD"
FT                   /note="PFAM: N-acetylmuramoyl-L-alanine amidase family 2;
FT                   KEGG: bhy:BHWA1_00586 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70145"
FT                   /db_xref="GOA:D5U3X8"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3X8"
FT                   /inference="protein motif:PFAM:PF01510"
FT                   /protein_id="ADG70145.1"
FT                   /translation="MLKNIIGIFIIICILSCNNTIKSSVKYTNDYNVQTNTQELIINND
FT                   YKITPNSLRLKLLSEYTKVHYGQPLIYLENPQIIVVHSAETPNLKVTANIFQRDVLHGR
FT                   PDIEAGGEVNVGTHFMVDFDGTIYANTPTEYIARHTVGFNYTAISIENIGYADKLTKEQ
FT                   LEANVKLIKYLQNKYKSIKYVIAHYEYKDKTLPHYSLYKELNTKYINPNKIDPGTNFMQ
FT                   ELRKRI"
FT   gene            complement(37514..37990)
FT                   /locus_tag="Bmur_0035"
FT   CDS_pept        complement(37514..37990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0035"
FT                   /product="CheC domain protein"
FT                   /note="PFAM: CheC domain protein; KEGG: bhy:BHWA1_00585
FT                   chemotaxis protein CheX"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70146"
FT                   /db_xref="InterPro:IPR028051"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR038756"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3X9"
FT                   /inference="protein motif:PFAM:PF04509"
FT                   /protein_id="ADG70146.1"
FT                   /translation="MDVRFINPFIVSLVSIFKEMAGLTMEKGTLVKGQGRKLFSGYGVA
FT                   IGIVGDVNGQVLYEFPENFSQLLTENLTDKKRGEYDSEDDFEDMMRSVINEMGNTISGL
FT                   AITKLAEEGISCDITPPILYFGKEIQIIPKNLQTIIIPFQSSLGFVSVNIAMDA"
FT   gene            38394..42116
FT                   /locus_tag="Bmur_0036"
FT   CDS_pept        38394..42116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0036"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /note="TIGRFAM: DNA polymerase III, alpha subunit; PFAM:
FT                   DNA polymerase III alpha subunit; PHP domain protein; KEGG:
FT                   bhy:BHWA1_00584 DNA polymerase III, alpha subunit; SMART:
FT                   phosphoesterase PHP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70147"
FT                   /db_xref="GOA:D5U3Y0"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3Y0"
FT                   /inference="protein motif:TFAM:TIGR00594"
FT                   /protein_id="ADG70147.1"
FT                   /translation="MSFVHLHVHTQYSILDGASRIKSLYSKKDKKKRLIPGLIDRAVEL
FT                   EMPAIAITDHGNMFGVMEFFSEAKDKGIIPVIGCELYVAPKTRFDKKIENSEEKSAMHL
FT                   ILLAKDKEGYDNLCKLVTFGYTEGFYYRPRVDHELIEKYNKGLICLSACMGGEIPIAIR
FT                   KKDYKQASKLAEYYKSIFGNDFYIELQDHNIPEEKSLNSALYKLANHHSIEMVVTNDVH
FT                   YVLKEDAKAHEILLAIQTKATLDSPRRYKFPSNEFHLKSKEEMMKSFAKLPKAFENTVK
FT                   IAEQCRDLNIMTKTYYMPNYELPNGETETTALRNMCMEGLNKHYNNNIPKEAMERLEME
FT                   LGVISKMGFEGYFLVVQDFINYARNHDVAVGPGRGSAAGSIVAFATGITKVNPLDYNLL
FT                   FERFLNPERKSMPDIDVDFQDDKREVIIDYVKEKYGKDNVAQIATFGALGGRSVIRDVC
FT                   RVMGIDLATADRLAKGIPNDVSRVVDIYDHPDCAEFRKEVESSRELKNMYEISTRLDGL
FT                   VRNVGLHAAGVIISSHPIMDLAPVYQDSKTGTRACQYEMTYVESAGLIKMDFLGIKNLR
FT                   LIKDAVKDIKERYGTEIDIDKIPLDDEAVYDIFRKADTGGVFQFESPGMRQMLINIQPT
FT                   GFDDLVSSVALYRPGPLNSGMDKDYADRKNKRKEIVYKHPDLEPILKESQGVLIYQEQI
FT                   MAISRVIGGFTAAEADDLRKAMGKKIVEKMNSMEEKFINGGLERGYDKELLTYLFDTMK
FT                   GFAEYGFNKSHSVCYALIAYQEAYIKAHYPMEYYVALLNTVIADTDKISLYLNEVKQKN
FT                   IDIVTASVFESNALFSQKNGKIVYALHAVKGVGLHAALAIEEEREKNGQFKNLEDFVKR
FT                   VDVHLVNRKVYETLIKCGAFSEFGHTESALLASLDAILAHASNYQKETLSGQTMLFDSM
FT                   SEDDSGSASLVIEKQVEYASNILMENEKEVLGFSLRYHPFARYISKIDYKYFNNTLDID
FT                   NLKDKDEFSLPCVVMSVTESTTKKNTPMLTLKVIDLFTEYVFYITAKNQIDKYKDMISE
FT                   QAGILIKGRREKNRFSDKIYNNISDIKLLDSYLNDKNLKLKEVKRDNIKRDSVSEVISD
FT                   SRNDNKAVQINKNDSPFKNTSNKENDIKRSDNVVSNAAFTSRPNNSIAVKHTNSGKKQL
FT                   ALYVNKNIFDDMDLLCLQNAISSNPGDYTIFLKLKSESGTEVFKIGENYKVDPNQRFLN
FT                   EAKSALRSLIEIEYA"
FT   gene            complement(42485..43477)
FT                   /locus_tag="Bmur_0037"
FT   CDS_pept        complement(42485..43477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0037"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="TIGRFAM: tryptophanyl-tRNA synthetase; KEGG:
FT                   bhy:BHWA1_00449 tryptophanyl-tRNA synthetase; PFAM:
FT                   aminoacyl-tRNA synthetase class Ib"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70148"
FT                   /db_xref="GOA:D5U3Y1"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3Y1"
FT                   /inference="protein motif:TFAM:TIGR00233"
FT                   /protein_id="ADG70148.1"
FT                   /translation="MKVMLSGIQPTGSLHIGNYLGALKNWVNILDEYYGFFCIVDYHAI
FT                   TIEYDVAQMQKRIMDAAVQYLACGLDPKKCSIFVQSDVRAHTELAWIFNSIIPVAELER
FT                   MTQYKDKSRKNAENINAALLTYPSLMAADILLYHPDIVPVGEDQEQHVELTRMIVRKFN
FT                   NRYGEYFKEPDTYHGKVLRILGLDGQNKMSKSLNNHIALSLTEEETEKLIMQKAMTDTN
FT                   RKLKTDAGNPDICNVYSYHKIFSTEEEQKEVCEGCKNASIGCVQCKKMLAKNINKELAP
FT                   IRENINKYSNDKDYVYDVLKEGAKKASEVAEKTLYDVRKLMGLVDDKRK"
FT   gene            complement(43554..44540)
FT                   /locus_tag="Bmur_0038"
FT   CDS_pept        complement(43554..44540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0038"
FT                   /product="PSP1 domain protein"
FT                   /note="PFAM: PSP1 domain protein; KEGG: bhy:BHWA1_00448
FT                   PSP1"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70149"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3Y2"
FT                   /inference="protein motif:PFAM:PF04468"
FT                   /protein_id="ADG70149.1"
FT                   /translation="MIKNIAHIKFRGSNIGKFEHLHIENIKVKDTCVIETDEGIEIGHV
FT                   LNFEDIDVDSLENDNNENTVNNETHDDESSHDDNISTDEELSDELKDIVAAEENHNVKP
FT                   KNNKNKIFNILRIADEKDLEQHKINTEDAAEAFKICREKVNNHNLDLKLISSYYFLDRA
FT                   KLLFEFIAEERIDFRELVKDLAAHFKTRIELRQIGVRDEARSIGGCGICGRELCCKVIR
FT                   GKFETITIKMAKEQGMLLNTMKISGQCGRLMCCLGHEYQAYCSLKKDLPKVGTKLVFNS
FT                   VPAVIKDLNPLNKKLLIETEDKRLLYINVSDLKTNEEGFLIANIKAE"
FT   gene            44709..45326
FT                   /locus_tag="Bmur_0039"
FT   CDS_pept        44709..45326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0039"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00447 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70150"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3Y3"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00447"
FT                   /protein_id="ADG70150.1"
FT                   /translation="MRLFLSFTLLFLMISCASTPEIYLKTNNAYYWKELIKNKVASDDY
FT                   QNIYRFDEKANMTLTVYGYKSKIKYTLFLMKEHNQAFYYKNFTLKNYIVESLPSFNLYE
FT                   DAVTKNDYSILYLDYSYYFSKNFPDRSIYLPIGLMIEDNNLYITKSYDDGYMDRLSHWL
FT                   RKNGYGRGKEWIPAVNADWESYPVPTEHEIDWEKIELVGVLF"
FT   sig_peptide     44709..44762
FT                   /locus_tag="Bmur_0039"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.763) with cleavage site probability 0.668 at
FT                   residue 18"
FT   gene            complement(45323..48019)
FT                   /locus_tag="Bmur_0040"
FT   CDS_pept        complement(45323..48019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0040"
FT                   /product="lipoprotein"
FT                   /note="KEGG: bhy:BHWA1_00756 hypothetical protein; TIGRFAM:
FT                   lipoprotein; PFAM: protein of unknown function DUF285
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70151"
FT                   /db_xref="InterPro:IPR005046"
FT                   /db_xref="InterPro:IPR011889"
FT                   /db_xref="InterPro:IPR025406"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3Y4"
FT                   /inference="protein motif:TFAM:TIGR02167"
FT                   /protein_id="ADG70151.1"
FT                   /translation="MSKYKPETKDELQKLVQDENIYLGDIDTSLITDMSGLFSFEGRKD
FT                   FSGIENWNTSNVTNMRGMFYNCYSFNEDIEKWNISNVKDMGHLFYNCINFNQNISEWNV
FT                   SNVTDMRGMFKGCTNFNHPLNKWDTSKVKDMSLMFRGCVDFNQPLDNWDTSNVISAAGM
FT                   FMNCRNFNQNINNWNVSKLEYANNMFEECWNFNQPLDKWDTSNVISTASMFKHCINFNQ
FT                   NINNWNVSKLEYANSMFEDCYSFNQPLDKWDTSNLKYISNMFKFCYEFNQPLNTWNTSQ
FT                   IIEMDYVFDKAKKFNQPLYKWDTSNVVSMQCLFYDAESFNQTLGTWKVNKVENMIGMLF
FT                   RSGFQYYDSLENWNIESLEYLGDWSDVISKNIDKLSLKWILYLYAFDNENKIIIKKIED
FT                   NIKEIHKIASEIKNKKVQSAKRKLENFYFNDLKEFLNYQLFDTIEQYEENIKLSKKDEK
FT                   KVSYIENCNVLIKDKSRDVDIKVIKYIYLKYLELKRDIYYLLEIDSIINLLDRESFLTF
FT                   AKNIYIETHKEAAAVVYSLYGGDEALREIYKKEKDSNFFLIILSSVKRTEYSIKLLYDI
FT                   YSKTKKSELRENAFNLINKISKEIGLDIDDLELKFSSNFGFDSKGEKVINDDYKLILNS
FT                   DYSVNVFDIKNNNVLKAAPKNFDDNTKEEIKYIKNEIPKVIKKLSLKLTKSLMYEKKYN
FT                   YSFFKEVFIDNPLMNKFSSSLIWNLYDKDNLFLTNFRYSNDGSYSNCEDEEINIDENSF
FT                   ISLASPIEMNEETINKWRKQLEDYELIQPIQQLSIIKLDKNNLENEINKLQNIEISYGT
FT                   FKAFGARYSMTPSYLEYGAVESYNLKLDNNDYFEIKINANNDIDYKDKIKINIQFSNEN
FT                   NTKVSERFIYTLLILMICDFRLTELFD"
FT   gene            complement(48182..49216)
FT                   /locus_tag="Bmur_0041"
FT   CDS_pept        complement(48182..49216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0041"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00044 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70152"
FT                   /db_xref="InterPro:IPR021440"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3Y5"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00044"
FT                   /protein_id="ADG70152.1"
FT                   /translation="MIKIKLSIISLITILILACSQNNNENVKANNNYYLENIDYSDSNN
FT                   WLNLPNNNNGNIDIFYLYPTTWASDDSNFMICPIDYTPMRATVTNKVIMHTSMFEEYGN
FT                   VYAPFYRQANALYLLNQTNNISKEELNSYLFSTPKDDAIAAFDYFIKNYNNNRPIILMG
FT                   HSQGAMMIKEILKDYFKDNEYLQKRLIAAYIIGYSVTKEDIEENPHLKFASGEYDTGVI
FT                   ISYNTESPDFNGYNPTLLENSITINPITWTLEETLAAKELSLGANITNENTLINQITNF
FT                   SDAKVDKVRGVIKCSTADTNIFFTDRAGVFSKGIFHAWDIELYYFDLKANAKKRVEAFM
FT                   KQNY"
FT   sig_peptide     complement(49145..49216)
FT                   /locus_tag="Bmur_0041"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.646) with cleavage site probability 0.217 at
FT                   residue 24"
FT   gene            49737..50429
FT                   /locus_tag="Bmur_0042"
FT   CDS_pept        49737..50429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0042"
FT                   /product="channel protein, hemolysin III family"
FT                   /note="KEGG: bhy:BHWA1_00446 hemolysin III putative;
FT                   TIGRFAM: channel protein, hemolysin III family; PFAM:
FT                   Hly-III family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70153"
FT                   /db_xref="GOA:D5U3Y6"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="InterPro:IPR005744"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3Y6"
FT                   /inference="protein motif:TFAM:TIGR01065"
FT                   /protein_id="ADG70153.1"
FT                   /translation="MANTSAFQLINRLNSDKLKIDKKNKKIGELYSAVSHGVGALLAIA
FT                   GLVLMLIKVHGNPMPVIIYGAGIIFLYTFSSLYHFFPDGKVKKLFRKFDHIGIYIFIAA
FT                   TYTPLCIFSLPKNIGILILSVIWGCALIGVLSNTVFKYKNIYLRLILYILMGWIIIFAF
FT                   KPLLNSFDVLHLNWLIFGGIFYTIGAFLYALGKKFNDKSKQFTHDIFHIFVLAGSFAHY
FT                   WFLYSYVI"
FT   gene            50511..51551
FT                   /locus_tag="Bmur_0043"
FT   CDS_pept        50511..51551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0043"
FT                   /product="tRNA 2-selenouridine synthase"
FT                   /note="KEGG: bhy:BHWA1_00445 rhodanese-like domain protein;
FT                   TIGRFAM: tRNA 2-selenouridine synthase; SMART: Rhodanese
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70154"
FT                   /db_xref="GOA:D5U3Y7"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR017582"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3Y7"
FT                   /inference="protein motif:TFAM:TIGR03167"
FT                   /protein_id="ADG70154.1"
FT                   /translation="MVKRINIDDFLRMQREENLPIIDVRSPIEYSHAHIPNAYNVYLFN
FT                   DEERKNVGTIYKQVGRKEAVLKGLEYVSVRITDILKSIDNIAKNYNNTNKILMHCFRGG
FT                   MRSESVAWLCSSYGYDVYVLEGGYKKYRNYVLSSFEKKYRIYLLTGRTGSGKTLILKIL
FT                   KDKGFNVIDLEKIAKHKGSAFGWIDEGEQPSQEQFENLLSYELSKYDINSILWFEDESL
FT                   LIGRRAVPKSLFNNMRDAEKIIYLDIPLECRAMYIVNTYGKYSIDDLRESILKIEKRLG
FT                   GERLKESLELLDNGKMYECVLNMLYYYDKAYKLSITDDEKRLVSIECKNQNFDEIVDLI
FT                   LARVKC"
FT   gene            51576..53417
FT                   /locus_tag="Bmur_0044"
FT   CDS_pept        51576..53417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0044"
FT                   /product="excinuclease ABC, C subunit"
FT                   /note="TIGRFAM: excinuclease ABC, C subunit; PFAM:
FT                   excinuclease ABC C subunit domain protein; Excinuclease ABC
FT                   C subunit domain protein; UvrB/UvrC protein; KEGG:
FT                   bhy:BHWA1_00124 excinuclease ABC, C subunit; SMART:
FT                   Excinuclease ABC C subunit domain protein;
FT                   Helix-hairpin-helix DNA-binding class 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70155"
FT                   /db_xref="GOA:D5U3Y8"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3Y8"
FT                   /inference="protein motif:TFAM:TIGR00194"
FT                   /protein_id="ADG70155.1"
FT                   /translation="MNQEIKSYIHEKLKRIPDKSGVYFMKDNKETIIYIGKAKSLKKRV
FT                   SSYFNNSNKDAKTTALVEHIRDIDYILTENEVEALILEAEMIRKHKPHYNILLKDQKSF
FT                   PFIAVTNEHFPRVIKARNVIDKENAKKYKKYYGPYVAAEKADNIVKFVVENFKLRRCKY
FT                   DFPLKKPIRPCLYYHIGKCTAPCADLINEEDYDKTIDDAIMVLEGNVDELSVRLRQEMF
FT                   QHAEKLEFEAAKDLRDKIDLLKYITVEQSIYIPESDDIDIIGAYGENGNYIIVILSVKG
FT                   GKLADRKTFSMQSPNNDEYYAEKGVSKYSEILSAFFTQYYTHANLIPASISVDFPIIDI
FT                   DIIKDYLKQISGREVDIRLDKSRKGLMAIANENAKHIFKEKALIREVPLGITRLQEIFK
FT                   LKKAPSIIESFDIAHIQGSYTMAGMVRFVNGVSDNKNYRIFNMKTVTGIDDFASIKEAV
FT                   YRRYKRLRDENLTFPDLILIDGGKGQLNSAIEALKELDIKGQPIMALAKKFEEIYLPNR
FT                   NEPVRLNDNEPARLFLQKVRDETHRWVNTSHGKKRSREMVKSELEGINGLGKKGIEKLY
FT                   AHFINIDNIKNASFESIRNIPGISYKVANNIYDHFHK"
FT   gene            complement(53433..54557)
FT                   /locus_tag="Bmur_0045"
FT   CDS_pept        complement(53433..54557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0045"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   bhy:BHWA1_00125 arylsulfatase regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70156"
FT                   /db_xref="GOA:D5U3Y9"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR034485"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3Y9"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADG70156.1"
FT                   /translation="MNNVSVLIKPSSSLCNIKCKYCFYIDEAKNRKIENNGIMTEKVMT
FT                   AIIDKVLQNADKNVLFSFQGGEPTTAGIEYFNSFIDYVNNRNKKNINVKYSIQTNGILI
FT                   DDKWGELFKKNNFLVGLSFDMIKDIHDKYRTDKIGNATYNKVLETKKLFDAFNIEYNIL
FT                   TVLTSKLSKYPKDVYKKIKKLNLKYTQFIPCLSDINSNDNNTYSITPKEFSNFYKEIFS
FT                   LWKEDFFNNIYYSIQFFDNIIPLFGGGYAPMTCGINGICTNQMIIESNGDVFPCDFYCL
FT                   DNYKLGNIADEDFDNIFYNQKAKDFINEKTDIINNDDYKLCRSCRYFKICKLGCKRMLE
FT                   NMYIDNKDKTFCGYKDFLDYSINDIIKIWKIVSR"
FT   gene            54735..55670
FT                   /locus_tag="Bmur_0046"
FT   CDS_pept        54735..55670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0046"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00127 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70157"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3Z0"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00127"
FT                   /protein_id="ADG70157.1"
FT                   /translation="MNNKNYYTIILSSVRYDKRLKSLSKLIYGEILALTNDKGYCWANN
FT                   NYFADIYSVSKDTISRSIKQLEKYNYIKCVYDKTKQNNEKRKIYIKKFNLVPAKNTIQY
FT                   SENCDDGIDKKAEDNNKYNNLNNKDSELKNTNQLNKTDTNKIDNKQYSPSPDFDLFINE
FT                   LIDTFNFLTGNKASKLYHLHSFKTKGKQEEIKSIFEDRKYDWKGCINLAKEKVKDKDNL
FT                   SGIWLDFLSYLKIYLIKGDRENSIKRHYSKEELIKREKILKERELIKIQREKEEQLKML
FT                   EEEKRLGFNNMTEDEIIEFTKKSLMHLKRA"
FT   gene            55955..57307
FT                   /locus_tag="Bmur_0047"
FT   CDS_pept        55955..57307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0047"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   bhy:BHWA1_00129 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70158"
FT                   /db_xref="GOA:D5U3Z1"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3Z1"
FT                   /inference="protein motif:PFAM:PF07670"
FT                   /protein_id="ADG70158.1"
FT                   /translation="MNNISNSENVLSNNELVRSKYSKSSYLKFIVFSFIGVFVLFVPIQ
FT                   IGNVKSIPMDHLVNLIRKIPFADPYYGILITMFGSIYPFISKSWNKNKTEIFFSFVKLF
FT                   SIPFIIMAYFGLGPADFHKPNMLLFSYNLLTQIALINSIGFIFLSFLVDYGLMSFAGIF
FT                   MRCIMKPIWKTSGRSSLDAIASFVGSYSIALLMTSKVYKKGYYSKKEACIIATGFSTVS
FT                   TTFMIVVAKMFGVMDKWNIYFFGTMIITFLVTAITVRLYPLRSKPNNGYMDKEVKEEPV
FT                   YKGGNIFKLALNEAADTASHADNFFSSVIKNLKEGLMVSISVMPNFMSITFIGLLIVNY
FT                   TPIFDVISYIFLPVTKLLGLGDEAYIVAKACSVTLVEMSCSSSIVMYASQFAKSVVAVV
FT                   CVAEILYFAAPIPVMLAVGIPISIKDMMIIWVERIVLALLFAVPFAYFFLS"
FT   gene            57332..58126
FT                   /locus_tag="Bmur_0048"
FT   CDS_pept        57332..58126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0048"
FT                   /product="phenazine biosynthesis protein PhzF family"
FT                   /note="KEGG: bhy:BHWA1_00130 phenazine biosynthesis protein
FT                   PhzF family; TIGRFAM: phenazine biosynthesis protein PhzF
FT                   family; PFAM: Phenazine biosynthesis PhzC/PhzF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70159"
FT                   /db_xref="GOA:D5U3Z2"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3Z2"
FT                   /inference="protein motif:TFAM:TIGR00654"
FT                   /protein_id="ADG70159.1"
FT                   /translation="MKCYIIDAFADRVFMGNPTAVCILDKEIPHELMQNIASENNISET
FT                   VFTIKNKDNNYDVYWFTPECEIDFCGHAVLAVGYAILNFNERYSNFVNLDTKEGILTIK
FT                   KNGDLYEMDTPKYNLKPIDITNDIIEAIGGIKPTEAYIGRDIVCVLEDENQVINAKVNL
FT                   EKIKQLDGLLFHITSIVKDKSNINYDCVTRTFGPKLDVDEVDVCGSGHCHIIPLLSSKL
FT                   NKYYFEAFQYSKRTGVLYCNIKDNKLTISGKACLYCISELFV"
FT   gene            58200..58994
FT                   /locus_tag="Bmur_0049"
FT   CDS_pept        58200..58994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0049"
FT                   /product="Hydroxyethylthiazole kinase"
FT                   /EC_number="2.7.1.50"
FT                   /note="KEGG: bhy:BHWA1_00131 hydroxyethylthiazole kinase;
FT                   PFAM: hydroxyethylthiazole kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70160"
FT                   /db_xref="GOA:D5U3Z3"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3Z3"
FT                   /inference="protein motif:PRIAM:2.7.1.50"
FT                   /protein_id="ADG70160.1"
FT                   /translation="MSTLKEEIFKAITDMKAKSPLVHNITNYVVMQITANALLAVGASP
FT                   VMTFEKEEFEDMLSIASSLVINIGTLTKSSIEAMHSACSIANKKNVPFVLDPVGAGATK
FT                   LRTQTAIDIIKNYNPKVIRGNASEIMVLAGESIKTKGVDSTANVNMALEAGRHLAKEYN
FT                   TVVSISGETDIITDGNRVLYVSGGSPLMPLNTGMGCTSTAITAAMLAVSNPLIAASSAM
FT                   CIMAEAGEEASKRTDAPASFAVSFIDELYKLNISNASNRVKE"
FT   gene            complement(59123..60061)
FT                   /locus_tag="Bmur_0050"
FT   CDS_pept        complement(59123..60061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0050"
FT                   /product="Bile acid:sodium symporter"
FT                   /note="PFAM: Bile acid:sodium symporter; KEGG:
FT                   bhy:BHWA1_00132 transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70161"
FT                   /db_xref="GOA:D5U3Z4"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3Z4"
FT                   /inference="protein motif:PFAM:PF01758"
FT                   /protein_id="ADG70161.1"
FT                   /translation="MKTLKQISNFFGKYMAVIVLIVAAVSLFFPKTVSFIKTSYVNYLL
FT                   MIVMFGMGLTLKLEDFKVVFTRPKDIIIGAIAQFTIMPLLAYLLSIVFKLPPELAVGVI
FT                   LVGTCPGGTSSNVMTYLANGDVALSVGMTSVSTILAPIATPLLTLLYAGQKVDVNAVSM
FT                   FISIVQVVILPIALGFLINKFFYKFTSSIKEILPLISVLAIVAIVAAVVSANSQRLMQV
FT                   GYLVIIVVILHNCLGYLLGYLLGKLFRLSNSKCKAVSIEVGMQNSGLATSLAATHFASM
FT                   ALATVPGAIFSVWHNISGSIAANIMASKIKD"
FT   gene            complement(60091..61176)
FT                   /locus_tag="Bmur_0051"
FT   CDS_pept        complement(60091..61176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0051"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   bhy:BHWA1_00133 glycerol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70162"
FT                   /db_xref="GOA:D5U3Z5"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="UniProtKB/TrEMBL:D5U3Z5"
FT                   /inference="protein motif:PFAM:PF00465"
FT                   /protein_id="ADG70162.1"
FT                   /translation="MTTENLFLPNFSIGKDAYKYIYDICSNYGNKAVIISGKKSLQASI
FT                   ELILHNIKDINITGMLHYGGNSTFENIDLLKEKKAVMEADMIFAVGGGRALDTSKVLAN
FT                   MMNKPIFTFPTLASNCAAVTCSSVIYYNDGSFREMFNLKRPPLHTFINTDVILKSPENY
FT                   FIAGISDALSKQYEALLCTRDENLNYKNFLGIEVIKNCSNDILKYYLEAVDDFRNKKVT
FT                   DALNRVILHIIYTVGLTSIMIKDNYHMSLHNGLKKLKAVGEKLLHGELVSYAILLLLTM
FT                   DKQYDARDDIFKFNKFMSLPTCLKDIGINNLSLEDEDFNTALDGTLALDELNISSYKAD
FT                   KETILKAIIDLEHYNNSQYIK"
FT   gene            complement(61499..63181)
FT                   /locus_tag="Bmur_0052"
FT   CDS_pept        complement(61499..63181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0052"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="TIGRFAM: dihydroxy-acid dehydratase; KEGG:
FT                   bhy:BHWA1_00134 dihydroxy-acid dehydratase; PFAM:
FT                   dihydroxy-acid and 6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70163"
FT                   /db_xref="GOA:D5U4B8"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4B8"
FT                   /inference="protein motif:TFAM:TIGR00110"
FT                   /protein_id="ADG70163.1"
FT                   /translation="MSFRENSSLRSDRVLKGDERAPNRSLFYSMGYTDEELKRPLIGII
FT                   SAYSEIVPGHIHLDKLSQAVKAGVLIGGGTPILIPSIGVCDGIAMGHLGMKYSLPSREL
FT                   IADSVESMVIAHGLDGVVLVPNCDKIVPGMIMGLLRMNIPGIVISGGAMLPGDHGDEKI
FT                   SLSNIFEAVGAKKANLINDKELEEYAQNTCPSCGSCAGMYTANSMNCLSEALGIALPGN
FT                   GTIPAVYSARTLLAKKAGMQVMELLKNNIKPLDIITPESFKNALAVDMALGCSTNSVLH
FT                   LLAIANEAGIPIDLKTINEVSDRTPNLCHLAPAGHNYIEDLYKAGGIPAVMKELDKGGF
FT                   INTSLLTATGKTIAENIKDAVNKNNNVLRNIENPYSKTGGIAILWGNIAKDGCVVKRSA
FT                   VADEMLVHKGPARVFDSEEEAISAIYAGKINKGDVVVIRYEGPKGGPGMREMLNPTSAL
FT                   AGMKLDKDVALITDGRFSGASRGASIGHVSPEAASGGEIAFIKENDIISIDIPNHKINL
FT                   EISDEEMEKRRKEIPIKPLEEIRGWLGRYRKLVQSANTGAILK"
FT   gene            63483..65420
FT                   /locus_tag="Bmur_0053"
FT   CDS_pept        63483..65420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0053"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: bhy:BHWA1_00135 methyl-accepting chemotaxis
FT                   protein McpB; PFAM: chemotaxis sensory transducer; SMART:
FT                   chemotaxis sensory transducer; histidine kinase HAMP region
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70164"
FT                   /db_xref="GOA:D5U4B9"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4B9"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADG70164.1"
FT                   /translation="MFKKVGLQFQITISILIPIILIIILANGFITIYSGNISKSLSYRI
FT                   LEETSLKEANIIKNTINNNLYNVMGLKINIENIYNRGIRDRETYKQLTSVFFNSLPDDI
FT                   NGLSIAFEPNALDNDADYTNSEYRNANGRFNYYISRNGEAYLSIDTFNVDYYTEPKRTG
FT                   DIYVSGVYNSTVNVGTVLFTLCIPIKPNNKFIGVIYVDIFADSVTSLLKDIAPFEGTLI
FT                   MLYDQNGALVYDTLSKNDISKNIYEVYPHYKKYNIFENIQSGKFSIIEAYGESAKKHFT
FT                   YAFTPIEISKGVYWGLELAAPRDIILKDSIIMRNSLIVILAVVIIIFAVLIPFIIKKKV
FT                   SDIINSFARNILDMSNGDLTVSMPKDFNKRKDEWGDIARGWDKAMNNFNKVINTVKNSA
FT                   EQVSTAANEVLAGNNDLSERTESQASSLEETAASMNQMASAIKESAENVASSTSMVSEA
FT                   KDHLNKAGEIVEESVSKMDDVYEASNKIMDITKLIENIAFQTNILALNASVEAARAGEQ
FT                   GRGFAVVASEVRNLAQNTQESVKNITSLITDSNEKIHLAAESVKESKDIFMEISEKMDN
FT                   ASSLMDRINTAAQEQEKGIEQINIAINNMDAALQKNASLVTEAASASESLLNEANELIK
FT                   SIEYFRLKNN"
FT   gene            complement(65487..67364)
FT                   /locus_tag="Bmur_0054"
FT   CDS_pept        complement(65487..67364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0054"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bhy:BHWA1_00552 long-chain acyl-CoA synthetases
FT                   (AMP-forming)"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70165"
FT                   /db_xref="GOA:D5U4C0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4C0"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADG70165.1"
FT                   /translation="MRNYTSIPSAFFETVQNMPQSPAYRYRNNNDEKVTITYKKLYDKV
FT                   NAIAKAFEVKGLAQKHVAIFSENRIEWFVSDMALLALGSADVPRGIDSTSDELNYIIEH
FT                   SEAQAVLVENKYVFEKIKKHHKDLSLIVLLDSSMHDPENNIYAFDKFEELGEEHLKGDE
FT                   EFAVKKAAKLTNESIATIIYTSGTTGKPKGVILTHGNILHNVRVLPDIIKLKAGEKLLT
FT                   ILPIWHIYERTISYVTAIIGCFTAITNKRYLKNDFTEEKPDIFISVPAIWVNIYNTVMK
FT                   NIDRKNAFLKKFIKFIIKRSISYIRSVRYQNDLVYLIGDEKREDKKAEYSIGMFDPLFH
FT                   KMAKKMVYSKIMELTGGKIRLTISGGGALPMYIEDFVEAVGINLVVGWGITETSPVVTL
FT                   RSPYKNYRGTCGAPIPEVKIEIRDKDGNSCKDGVMGVCWIKGPNIFKEYYKDPELTAQA
FT                   KIDGFFNSGDLGTYTQEGEIVLTGRAKETIVLLTGENVEPQPIENKAMESSYISQIMLV
FT                   GQDKASTGAIVVINKENIKYYFDKEKIAYDEKNLASSKEVYKLIREELDRLINYKNGFR
FT                   PYEAIAKIIITDEEFTIENGLLTQSLKIKRANVTEAYKDKIEALYEKKL"
FT   gene            complement(67439..68569)
FT                   /locus_tag="Bmur_0055"
FT   CDS_pept        complement(67439..68569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0055"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   bhy:BHWA1_00551 mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70166"
FT                   /db_xref="GOA:D5U4C1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4C1"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADG70166.1"
FT                   /translation="MNNYNIKKIAVLHPTFGYNGGAENVILSSTEYWHSIGIETVIYTY
FT                   RLRDNAPDYIKQIKTDITLNPFIFNKTSKFLASELKNYDAVLIHNFPATIFFGLAYDYA
FT                   KKNNIKLPKSFWYCHEPSVRLYGYDDKSYKKLQKTLDIIARYTMHLDRLGVSKIDYIIS
FT                   NSIRTKEGIKRVYNREAEVIYPCITSNIDFLPIKESEHFLYIGRIEKPKNIENALSAFK
FT                   ILLENIDNKELKFIIAGKGRYEKYLKNFVKKNNLEKNIIFKGFVSEEEKKELLNKSYAL
FT                   VMPAINEPFGLTVIEALYCSCISIISNKSGVYEAVKDYSISCNTRNIEEIYKAMLLSYK
FT                   DKDIKEKFLQLSKSSIHNFTVSSYSENIIKYIVKYL"
FT   gene            68688..69641
FT                   /locus_tag="Bmur_0056"
FT   CDS_pept        68688..69641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0056"
FT                   /product="putative esterase"
FT                   /note="KEGG: cpy:Cphy_3193 putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70167"
FT                   /db_xref="GOA:D5U4C2"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4C2"
FT                   /inference="similar to AA sequence:KEGG:Cphy_3193"
FT                   /protein_id="ADG70167.1"
FT                   /translation="MKNIFILMIIVFSIISCNNANSNKENDMNNFTMYTNEDKSITVEQ
FT                   KNITYNIDYKPNVVYASKDNTDLTLQILVPRLLETDTNARYPLIVYIQGSAWRKQNVYR
FT                   NLIALGDFARRGYVISIVEYRPSDDAVFPAQIEDTRDAISFMINNADKYNADTNNIFVW
FT                   GDSSGGHTALFSSIPLSENDNTIPNINAIIAYYPPTDLLDMRNDPLGSTTGDADSPEGI
FT                   LIGRKNVYDFPEEAKRISPYYEISKVTNMPPIFLAHGMSDSLVPFNQSKILADKLKEEN
FT                   RVYEFYALKDADHGDWQFWAKDMFDLVEKFINKYKK"
FT   sig_peptide     68688..68756
FT                   /locus_tag="Bmur_0056"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.681) with cleavage site probability 0.500 at
FT                   residue 23"
FT   gene            70115..71041
FT                   /locus_tag="Bmur_0057"
FT   CDS_pept        70115..71041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0057"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: efe:EFER_2124 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70168"
FT                   /db_xref="GOA:D5U4C3"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4C3"
FT                   /inference="similar to AA sequence:KEGG:EFER_2124"
FT                   /protein_id="ADG70168.1"
FT                   /translation="MYLAPVGLVVYNRIEHTKRVIEALKKNTLASDTDLYIFSDAPSKK
FT                   EDEEAVYELREYLKTIKDGFKNVYIYEAQKNLGIKYSTVNAVNTIFEHHEYFIGLEDDI
FT                   ETNKHFLEFMNNALNYYKDDEDVIAITAFSHKHATKNHKHDVIFTYAFHSWGWGTWKSK
FT                   WNNINWDTCDTSWYNKSIKHKILGGVFSWFHLLAIKKSVKDNLYVQNNLWDIYYSFTMY
FT                   KNKKLCVWPSKKSFTNNFGFDGTGYHKFDFHHGYFEKNLDDDNMNIEFSSDKKMNFFEY
FT                   LIISIKIGIFSWANGFISMFFSKFLKR"
FT   gene            complement(71046..71657)
FT                   /locus_tag="Bmur_0058"
FT   CDS_pept        complement(71046..71657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0058"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="KEGG: bhy:BHWA1_00374 hydrolase; TIGRFAM:
FT                   HAD-superfamily hydrolase, subfamily IA, variant 3; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70169"
FT                   /db_xref="GOA:D5U4C4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4C4"
FT                   /inference="protein motif:TFAM:TIGR01509"
FT                   /protein_id="ADG70169.1"
FT                   /translation="MISSDNIKLLIFDMDGTLIDSANLHYYSYSNVFKEYGIELDKDYY
FT                   YNKCFGLHYRTFTNNILKLNNKLTNDENKNNELIEKIHNRKENIYLQNLNMVNIHPLML
FT                   EILIESKKKSKYTALATTSSPKGVYAILKEFNLERLFDLVLTGNDIQNKKPHPEIFLKC
FT                   INHFNVKEEESIIFEDSEVGLEAANQTNTWVIKVEKWAKI"
FT   gene            72127..73713
FT                   /locus_tag="Bmur_0059"
FT   CDS_pept        72127..73713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0059"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_5"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_5; KEGG: bhy:BHWA1_00375 pyrrolo-quinoline
FT                   quinone"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70170"
FT                   /db_xref="GOA:D5U4C5"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041538"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4C5"
FT                   /inference="protein motif:PFAM:PF07728"
FT                   /protein_id="ADG70170.1"
FT                   /translation="MKNTKLRIEKIISLLSEGLYEREEIVALTFLSAVAGKPIFLYGPP
FT                   GTAKSFIAKRVSSAFKESKYFGYLMQRFSTPEDIFGPISLEELKNDRYIRKIEGYLPDC
FT                   DFAFLDEIWKSTPAILNTLLTIINERVFKNGYKEIKVPLKALISASNETPPEGQGLEAL
FT                   YDRFIMRLMVRPMKNKDNFEKILQNTQINSYAEIDEEIKISSDEWVKIREEVNDIKLSK
FT                   IVIDIIHRVKLSIEKFNEDNRNIAIYVSDRRWQHISYLLKTAAYLNDKDEADIYEAFLI
FT                   ENCLWSLEEHIEAVDSIVENAVRESYSFNNEHINEWRESFKSVQENIDNEFYELEKTYD
FT                   TENIDDKPYIAKILNINIDEYGNKGETIIYIPIKQLGKKGYFYPLDLSRNQTKKFRCSF
FT                   NGTDKCTVEINSATSVNGFVSNKLSKNYEFLEEFEPDFYMKKIGYKKQEKEKKSSYIKL
FT                   LNSLISSIENIIINLKNDYNANRENTKSIFISEEKFNIFDDIFNSYIDSLESEKLDAQR
FT                   IKSEIENHETI"
FT   gene            73700..75136
FT                   /locus_tag="Bmur_0060"
FT   CDS_pept        73700..75136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0060"
FT                   /product="von Willebrand factor type A"
FT                   /note="SMART: von Willebrand factor type A; KEGG:
FT                   bhy:BHWA1_00376 von Willebrand factor type A (vWA) domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70171"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4C6"
FT                   /inference="protein motif:SMART:SM00327"
FT                   /protein_id="ADG70171.1"
FT                   /translation="MKQFDNNSYRNEIKKTESMARGVFYGSFENINEKRLEEELEVKIT
FT                   KWKKDLNTFTNENNPYDENKTELEISLKKLKVLKNKNIKTTKEDIINDLNSFSILSDDS
FT                   SVEFWKDKLHNSDSLNINLNIIKNNILSSWQKTYNKKNNEWLVSTVKERRDKFISDIES
FT                   WISLIKKLRYMSNILRIKTGVLWDFRVGELEENDISLLNRWVEFINKYKKEIETICDSI
FT                   GKRVDIEKALKNIEFKNTYSYTNKKISSKEEIVGIYFAKDIENVVPEELSLLCDEDSEK
FT                   LFKLKYIENRLMCFDKSAYVFNENDFDIVKAGYKEGKGDMIICIDTSGSMKGTSEYIAK
FT                   AIMFKMVMQALSENRNAYLINFSTEIYTCRFTKNNGIEDLIKFLKLSYHGGSDIYKALY
FT                   EANRVMNTSSFKNADVLVLSDFIMEDMPDNLVKICSNQRNNGNKFFAVSIGKFPFGYSY
FT                   KKVFNRHWIFDIDSGIKEIC"
FT   gene            complement(75141..75968)
FT                   /locus_tag="Bmur_0061"
FT   CDS_pept        complement(75141..75968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0061"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="TIGRFAM: glutamate racemase; KEGG: bhy:BHWA1_00378
FT                   glutamate racemase; PFAM: Asp/Glu/hydantoin racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70172"
FT                   /db_xref="GOA:D5U4C7"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4C7"
FT                   /inference="protein motif:TFAM:TIGR00067"
FT                   /protein_id="ADG70172.1"
FT                   /translation="MNINSSISSMPIAVFDSGFGGLTVLKQLLQLLPNENYIYLGDNIN
FT                   IPYGDKSEEEIINLTSKMVEFLISKKCKIIIIACNTISACAYNILKQKYDIPIIEVISN
FT                   GVADALNKTKNNNISVMATEFTVHSNVYKNKINKHNKESKITQISCKELCPMIENDWYS
FT                   YDNRLDVLKNYLKNIDDKSDTLILACTHYPHIIDDIKKTLEYNVKNSIKNIIDPAYHTS
FT                   MSVKEYLEKNNLINTDKTNDITIYTTASVEKEEKIINIFMPKDRKYKLEQIKL"
FT   gene            76145..76393
FT                   /locus_tag="Bmur_0062"
FT   CDS_pept        76145..76393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0062"
FT                   /product="sodium pump decarboxylase, gamma subunit"
FT                   /note="KEGG: bhy:BHWA1_00379 hypothetical protein; TIGRFAM:
FT                   sodium pump decarboxylase, gamma subunit; PFAM: sodium pump
FT                   decarboxylase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70173"
FT                   /db_xref="GOA:D5U4C8"
FT                   /db_xref="InterPro:IPR005899"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4C8"
FT                   /inference="protein motif:TFAM:TIGR01195"
FT                   /protein_id="ADG70173.1"
FT                   /translation="MNSSIMEALQIMVIGMGVVVLFLIILVFVMKFVSAVVAQVDKLMP
FT                   PPQEDSSSSPAPVQTVNNDKMVAIAIALAHVHSNKSK"
FT   gene            76421..78232
FT                   /locus_tag="Bmur_0063"
FT   CDS_pept        76421..78232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0063"
FT                   /product="Pyruvate carboxylase"
FT                   /EC_number="6.4.1.1"
FT                   /note="KEGG: bhy:BHWA1_00380 biotin/lipoyl attachment
FT                   domain-containing protein; PFAM: biotin/lipoyl attachment
FT                   domain-containing protein; pyruvate carboxyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70174"
FT                   /db_xref="GOA:D5U4C9"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4C9"
FT                   /inference="protein motif:PRIAM:6.4.1.1"
FT                   /protein_id="ADG70174.1"
FT                   /translation="MAKKEVKFMLTAFRDGFQSVYGARVLSKDFMPAVEAFVKAGVTYF
FT                   ESGGGATFQSAFFYNQENAFDVMDTFRKTVGPDVNLQTLARGVNVVGLESQPREMIKMH
FT                   AQLFKKHGVTTIRNFDALNDVNNLIFSGKCIKEAGLKHQVCVSMMALPPGCEGAHDAAF
FT                   YAKVLKQIKDNVEFDSVCFKDASGTTTPQVVYDTVKEARKLLGSDMHIQVHSHETAGIG
FT                   AVQYRAALDAGCDCIDLSAAPVSGGTCQTDLIVMWHALRGTEYELNIDIDKIREAEEVF
FT                   KDCMKDYFLPPESRTVEPMIPFAPMPGGALTANTQMMRDINVMNRFPEVIKAMTEVVKK
FT                   GGFGTSVTPVSQFYFQQAFNNVMQGNWKKIADGYGKMVLGYFGKTPSTPDPEIVKIASE
FT                   QLGLQPTTELAMDIDDKNPKKGRKAAEQALKDAGITDLSDENVFIAAACKEKGIQFLKG
FT                   EAKLGIRKNAPNASSSAGASQAASNEVTVTVGGSSYGIKIENGKAIVDGVSYDYTIKDG
FT                   IVAGASQAAASASSGSATPVTAGLPGTVVKIVAPVGTQVQDGSTVLIVEAMKMEVEIKS
FT                   SANGVVKEVKVKPGDAVVAGQELAIVG"
FT   gene            78264..79640
FT                   /locus_tag="Bmur_0064"
FT   CDS_pept        78264..79640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0064"
FT                   /product="sodium ion-translocating decarboxylase, beta
FT                   subunit"
FT                   /EC_number="4.1.1.3"
FT                   /note="TIGRFAM: sodium ion-translocating decarboxylase,
FT                   beta subunit; KEGG: bhy:BHWA1_00381 Na+-transporting
FT                   methylmalonyl-CoA/oxaloacetate decarboxylase, beta subunit;
FT                   PFAM: Na+transporting methylmalonyl- CoA/oxaloacetate
FT                   decarboxylase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70175"
FT                   /db_xref="GOA:D5U4D0"
FT                   /db_xref="InterPro:IPR005661"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4D0"
FT                   /inference="protein motif:TFAM:TIGR01109"
FT                   /protein_id="ADG70175.1"
FT                   /translation="MRKIFLVFALVFMTASMVLAQESTQKPLNIKDSLISLARNTAFGG
FT                   LFPRSEQEIAEAQAKAESSKQEKYQTKLNDIKVKSVPLWQNLIMICVGLVLVYLAIAKG
FT                   FEPLLLIPIGMGGILANIPIANIAALPVVEVMNGIPVTLSSGGFLGQIYTFGIESGLFP
FT                   LFIFIGVGAMTDFGPLIANPKTALLGAAAQIGIFGTLLGAMILSAYVPVISFTLKDAAS
FT                   IGIIGGADGPTAIFTASRLSPSLLGAIAVAAYSYMALVPIIQPPIMKWLTTEKERKIEM
FT                   KQLRPVSKREKIIFPLSVIILVALLLPDAAPLIGAVMFGNLLKESGVTDRLSKTAQNEL
FT                   INIVTIMLGLSVGSKLAADKFLRFETLGILVLGLVAFSMGTAGGVLLAKLMNLFSKDKI
FT                   NPLIGAAGVSAVPMAARVANKVGQEANPHNFLLMHAMGPNVSGVIGSAVAAGVLLAILG
FT                   "
FT   sig_peptide     78264..78326
FT                   /locus_tag="Bmur_0064"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 21"
FT   gene            79933..80871
FT                   /locus_tag="Bmur_0065"
FT   CDS_pept        79933..80871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0065"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   pdi:BDI_1651 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70176"
FT                   /db_xref="GOA:D5U4D1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4D1"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADG70176.1"
FT                   /translation="MKISVIVPCYNEELVIEILYNRLINVLSNYNDYEIIFINDGSYDN
FT                   TEYIINKYRKENNNIKLFSFSRNFGHQAAVSCGILNSSGDIAIIIDADLQDPPELIPSM
FT                   IEEHINSKANVIYACRTSREGESFIKKITANLFYRLVNLLSDVKFPLDTGDFRLIDRNV
FT                   INAYKQFKEKPKYIRGLISWMGFKQKPFLYNRKPREAGKTKYTYKKMFNLALTAVISFS
FT                   TKPLRISLILGILSMVLGIILSLYVFIKYFFFNSDIIKGWSSIMITVIFMGGVQLLSLS
FT                   VISEYLAKIYEQIKNRPEFIIKNNEDENYEK"
FT   gene            80861..82399
FT                   /locus_tag="Bmur_0066"
FT   CDS_pept        80861..82399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0066"
FT                   /product="glycosyl transferase family 39"
FT                   /note="PFAM: glycosyl transferase family 39; KEGG:
FT                   tye:THEYE_A0589 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70177"
FT                   /db_xref="GOA:D5U4D2"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4D2"
FT                   /inference="protein motif:PFAM:PF02366"
FT                   /protein_id="ADG70177.1"
FT                   /translation="MKNSIKRFINIIIKNKIFLISFIFIILSYILRTILLTFTTLIDDE
FT                   AHYALWTKHLPFGFFDHGGGIAFFMKLSMIIFGNTGFGVRFGSILFSILVSVFIYIFVS
FT                   KEKDENAAVISVILFNTIPFFAGLSLIVTIDTPMFYFLLFSIMAYYKAIYSNKNYFYLA
FT                   GFLFGFSLLSKEGAIFVGSSICFFILISNRRKEIFLYKEFYLSFIAATLVYLPFIIYNF
FT                   QTDFTFIKYALDRQLQKPGSINRTLDFWGAQIGLYSPLFFILFCYLIIKTTLQFFNKKE
FT                   TENNFYFAFISLIPFIYIVQKSFKNKLEANWALFMYAGGLFLVSYYISKNWNKKYIRNL
FT                   FLSNILLCNIAIFIIILQYFVPIIPIKGDPTDRYYKYNAIRYDLKEYYNLNMDKNIRMF
FT                   ALNYQIPSMINFYINPENEAVCLNWNTYHPTVFDFWYDDNNFIGDDLYYITTSPDTNLA
FT                   SKYFDSIEYITNFQSYRKQINGDKRYLDNYYIYLCRNYNGKKTDYIYKSEKIKF"
FT   gene            complement(82452..83408)
FT                   /locus_tag="Bmur_0067"
FT   CDS_pept        complement(82452..83408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0067"
FT                   /product="Uncharacterized conserved protein UCP018688"
FT                   /note="PFAM: Uncharacterised conserved protein UCP018688;
FT                   KEGG: bhy:BHWA1_00382 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70178"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR016732"
FT                   /db_xref="InterPro:IPR024320"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4D3"
FT                   /inference="protein motif:PFAM:PF09924"
FT                   /protein_id="ADG70178.1"
FT                   /translation="MLNFEPISLDKQELYHKYFSITPEQSADYTFMNLLGLKDIYMLEW
FT                   AFTEKLVWIRQKSPYITYWAPVGDWFNTDFCNDMGPCEISGEAVIRIPKELALFWDKTT
FT                   KIKVKESRDEWEYLYDFNELITLPGKKFHNKKNLYNQFIKNDFEYKPIDKTIVKDILDF
FT                   EAKWEEEEKKNNDASQHNAEECEAFDSNKLLSHEVRAEADTIMIRTLLDNWDIISNIAG
FT                   GAIYIDKKVVAYTIADLSMRDTIVVHSERGDRNYKGTYQAINRMFLENLKNYVIDYERF
FT                   KFVNREQDVGDLGLRKAKLSYNPVCYVEKYKGFCAEF"
FT   gene            complement(83477..84028)
FT                   /pseudo
FT                   /locus_tag="Bmur_0068"
FT   gene            84149..84481
FT                   /locus_tag="Bmur_0069"
FT   CDS_pept        84149..84481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0069"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   bhy:BHWA1_00384 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70179"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4D4"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ADG70179.1"
FT                   /translation="MKKESLKEKYMEDTGFAYTMSLISGKYKMIILYILSELKVVRYNE
FT                   LKRIISAISHKTLSLTLKELEKDDLVIRKEYPQIPPKVEYSLSKRGKSLIPILDAICVW
FT                   GEKNRK"
FT   gene            complement(84482..85015)
FT                   /locus_tag="Bmur_0070"
FT   CDS_pept        complement(84482..85015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0070"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00385 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70180"
FT                   /db_xref="GOA:D5U4D5"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4D5"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00385"
FT                   /protein_id="ADG70180.1"
FT                   /translation="MLLYLIPIFIILPLILMAIMIFLPTVIGKRIPPSFSKEKTQVFDI
FT                   PRNELYHLLIDYENYPAWLKYISIVRVEKLEGNKLKIMQTYSNRRTYQELIEVRRIENS
FT                   EISIVKTENEFTALWTYILEDAENGGTRMTIKETLYVYHPYLRFMLKYVLIDENGKNDF
FT                   FRRVRNFINKNKNS"
FT   gene            complement(85015..86322)
FT                   /locus_tag="Bmur_0071"
FT   CDS_pept        complement(85015..86322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0071"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   bhy:BHWA1_00386 PerM, predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70181"
FT                   /db_xref="GOA:D5U4D6"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4D6"
FT                   /inference="protein motif:PFAM:PF01594"
FT                   /protein_id="ADG70181.1"
FT                   /translation="MNNDFFDKDKNNNSLTHNKILVKGGEILLVLIISSAFFYFCYLIR
FT                   EIINPIILFIILIAALIPFWRYIWAKTSIVLILALFTLWVIKEAGYLVAPFIWGIFIAY
FT                   MFDPLITKMQTKIPRIAAVLFIFIPLIIIAVIFFVFILPRTIEEMEVISKSLPEYVDKI
FT                   YNSISLLLISVSDKLNGSIGKSFDIDMAIDAASIKDFLFGSDGIFTLIYKKMIDFRFQN
FT                   ISSLTTIFSVIFSYFVILPFVTFYLMLDFQNIKSKIIKIIPMRWQTSISEIVKKSNSII
FT                   NGYVRGMTILALSFFIISYILLSVTNTRYAFILALLRGILNYIPFIGPFAAFVTALLVG
FT                   IITENIWWHGALKICIIFGFVQILDSGLMAPKILGKSVKIHPIAVMFSTIIGGVLFGFL
FT                   GILFSVPFCGIVLLVVQNFFNKYYHSKFYTLTKRGK"
FT   gene            86476..86549
FT                   /locus_tag="Bmur_R0002"
FT                   /note="tRNA-Ile1"
FT   tRNA            86476..86549
FT                   /locus_tag="Bmur_R0002"
FT                   /product="tRNA-Ile"
FT   gene            86579..86652
FT                   /locus_tag="Bmur_R0003"
FT                   /note="tRNA-Ala1"
FT   tRNA            86579..86652
FT                   /locus_tag="Bmur_R0003"
FT                   /product="tRNA-Ala"
FT   gene            86751..87104
FT                   /locus_tag="Bmur_0072"
FT   CDS_pept        86751..87104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0072"
FT                   /product="Ankyrin"
FT                   /note="PFAM: Ankyrin; KEGG: bhy:BHWA1_00390 ankyrin
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70182"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4D7"
FT                   /inference="protein motif:PFAM:PF00023"
FT                   /protein_id="ADG70182.1"
FT                   /translation="MKNIILIPLIIISILLIPYNKLYSLTQDEETFLDAAIFGDEDVIE
FT                   KIIAKNINVNIQDDVGNTALILACMEGHVKVVELLIKANADKSIVNKHGNDALFYAKQK
FT                   NYTDIIKLMGQNI"
FT   gene            complement(87107..88867)
FT                   /locus_tag="Bmur_0073"
FT   CDS_pept        complement(87107..88867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0073"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00391 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70183"
FT                   /db_xref="GOA:D5U4D8"
FT                   /db_xref="InterPro:IPR010420"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4D8"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00391"
FT                   /protein_id="ADG70183.1"
FT                   /translation="MLKDIPKYIKYRIDRMLNKGLFYQLLLLVFAIIILLLIVSIFIIV
FT                   FFNYPPKDAFWDSLMQFIDTGNISSVDGSIGIVLTFLMVTFIGVCGWGSLIAMINKALQ
FT                   DRINNLSKGNAFIMEKNHAIILGYGEEALTIVEEFIMAKVKTIIILSEHNVDIIRKRIS
FT                   FIKGSKQTNIIIREGSASRIENIKLLNIAKSSSISIINNDDTESLNILLALKKIVEEEE
FT                   LDKKINICVLVHEEDTIEIIKSIEEKNFVIHVIYKYEILYKLIAQSIIYTGLSNVYEDL
FT                   FSNDGNVFYIETDHDFNDCKFEDAALKYLERGMILLGITKEDRSQLLIPNYDYLLKKEN
FT                   RLVILSRNNNDDNIKEYPDIKPSIVKYKNNILLICEENRYDEIIKEISEYMENHNTSMI
FT                   SYNSIKSQKNKYKFMREKLKEENTTKIVLISEDNVTDVKSINILLIIRQIIRKENLNIA
FT                   ILSLLNSIQKRNLIYSDDVRDFIVSGKLIGMLMAQASISSNILYIFYGLLSKNGKDIIM
FT                   SPYSDYFNESKSFKDVYLYLLRKKVIIIGVKRYNDVIINPNNDCMLDNKDEIIIITNYV
FT                   LEEENEELIF"
FT   gene            complement(89287..92457)
FT                   /locus_tag="Bmur_0074"
FT   CDS_pept        complement(89287..92457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0074"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   bhy:BHWA1_00506 acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70184"
FT                   /db_xref="GOA:D5U4D9"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4D9"
FT                   /inference="protein motif:PFAM:PF00873"
FT                   /protein_id="ADG70184.1"
FT                   /translation="MNRIIELFAKNRLLVNVIILITLAVGIYSYLNIKKEAFPSTNFDV
FT                   MIVQVIYPGASPEDVEQYAMIPIEDELQTIAGIDEFYSIIIENAGILTIRIDMNLKDSR
FT                   PVKDEIFRRLQNAPNVSKDVSEIKIFEANANRMPIYNLGIRFKEGQEGSEKELYDISKR
FT                   FEKELKYVDGVANIEVYGRTDPEIQILADPYKLREYYTSLTEIIQALSLRNIRSTSGSM
FT                   KPSESDNLEDKNKLLVTTGQFQDPLSITNVIVRSIFNGQPVRIGDIARVEELFVDKSVY
FT                   MRVNSKHGYSINIIKKEDADILKTIDNVNQYFEKNKSTIPSNIEIVPMADNSRTITDLL
FT                   NAVSSNIITGFIIIFIILIIFLDFKSAIFTSLGMLIVISVSLIYMTYSGITFNIISLGG
FT                   IITVLGMIVDNSIVVSENIFNYHQKGIRGLEATKNAVGEVFMPMLVSTLTTVASFAPII
FT                   FVTGTMGRLINQYPRVVIVALVVSIFQAVLLLPNNLITKEELTGEHKRKRFNFKNPLDF
FT                   DKDKLFDKLKIPFIKFLRFTLKFRYIVLIFFIVTLLITLLIAKSIFSKFTLIYDTSADV
FT                   IVVNIDTGVGSSIYKTEKYLQKVENIIYETINTNDIVAVYSLLGKQLDKNTVEISEEMD
FT                   NIAGTMIYLVPANNREKIAYDIADDLNAAIEKSSIKDELELITVNTKLPINPGKAVDIK
FT                   IIGNDTAMVKEVKDKMKEHLLSLDGVVNYDDDDKIGQEELRVIFDYDRMSELGVNVAYA
FT                   ARELRAAYSGIVATSIQEFENKLDFRVRLDKKYTYDTNVLNNLLIPNTYYRLIQLKDIA
FT                   DIYITNNQSSIRHYNGKKSITMTADIEQGKNTAIQVTYEMQDYFNSIAKDYPNISVEFA
FT                   GEVKETRGSIIGIAWGYLIAIIAIYVILLLQFNKFVQPFMILGIIPFGIIGVILGFAAH
FT                   RMPMSFVGAVGIVGLAGVVVNNGIIMVELINRILEKGNIRNKQDVLNAIVEGTGDRFRA
FT                   IFLTTVTTIFGLLPTVYGIGGRADLIVPMVMSMAYGLLFAALLTLILLPSLFMISADLK
FT                   LIKINYEK"
FT   gene            complement(92531..94036)
FT                   /locus_tag="Bmur_0075"
FT   CDS_pept        complement(92531..94036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0075"
FT                   /product="putative outer membrane component of multidrug
FT                   efflux"
FT                   /note="KEGG: bhy:BHWA1_00505 putative outer membrane
FT                   component of multidrug efflux"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70185"
FT                   /db_xref="GOA:D5U4E0"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4E0"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00505"
FT                   /protein_id="ADG70185.1"
FT                   /translation="MLRKLIYIIIFNSVFFNFFIFAQTNNNIVLPYAQYMERIKILIPE
FT                   MKLTASQESNAYNNLTKAKSSGDVKFDLQAGAIGKQAHFDEYSFIPTSDFYYNGFRIGA
FT                   GFSGLIPYSGTRWSVEIKHDSFFGDFKTGDITLPVDTPFGTVNGKLPNMGTNDFKYYYP
FT                   SIKIQIAQPILRDFFGKLDRYPIKDAEYQLTIAKLKRIIDDNSVLTSYQKIYYQWIMAR
FT                   KLIALYDAMIREARSFENQVYKRYSSGVIDNDSYQNARRQTLKYIEAKDKSELMLKKII
FT                   RNIKFFIPEENIIPNEDDWTQTLETSINAKVDIVPFLESAQGQMAYQLKLRSEYALSIM
FT                   KNNALPDLSIVGSVSLSSLNDSGYFKSFSTMTNVDYFVGLMFSYPIGGRDAKAKMEDAY
FT                   AALNAVTADFDRVNRDFDVQIGTYYDEFEAYKKMLENKKLEVNAIVSRINTQNTKFRQG
FT                   RLPIDEIINARLDLAQARAELLNLEYMIISTVMDYNSLVLISN"
FT   gene            94259..94966
FT                   /locus_tag="Bmur_0076"
FT   CDS_pept        94259..94966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0076"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="TIGRFAM: trehalose operon repressor; PFAM: UbiC
FT                   transcription regulator-associated domain protein;
FT                   regulatory protein GntR HTH; KEGG: bhy:BHWA1_00504
FT                   trehalose operon repressor; SMART: UbiC transcription
FT                   regulator-associated domain protein; regulatory protein
FT                   GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70186"
FT                   /db_xref="GOA:D5U4E1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR012770"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4E1"
FT                   /inference="protein motif:TFAM:TIGR02404"
FT                   /protein_id="ADG70186.1"
FT                   /translation="MAAKYEYIYNSLLDKIKFGHFKEGDILPSEYDLMNEYKASRDTIR
FT                   KSLQLLSNNGCIQKHKGKGSIVINSNIYNFEFGGIFSFKEVSSKMYGKTKTIVNKCECI
FT                   KPNLLIKNALRLNDNDRVWSIERIRNIDGENIILDIDFINASIIPFIDENILKDSLYEY
FT                   IENNLKLKISYAEREISCEKVNGYDKKFLDLKDYDMIINVESKTFLSDTRVFQLTSARH
FT                   RPDKFKFRDFARR"
FT   gene            95160..97091
FT                   /locus_tag="Bmur_0077"
FT   CDS_pept        95160..97091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0077"
FT                   /product="PTS system, trehalose-specific IIBC subunit"
FT                   /note="KEGG: bhy:BHWA1_00503 trehalose PTS system, IIABC
FT                   component; TIGRFAM: PTS system, trehalose-specific IIBC
FT                   subunit; PTS system, glucose subfamily, IIA subunit; PTS
FT                   system, glucose-like IIB subunint; PFAM: sugar-specific
FT                   permease EIIA 1 domain; Phosphotransferase system
FT                   EIIB/cysteine, phosphorylation site; phosphotransferase
FT                   system EIIC"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70187"
FT                   /db_xref="GOA:D5U4E2"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR011296"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4E2"
FT                   /inference="protein motif:TFAM:TIGR01992"
FT                   /protein_id="ADG70187.1"
FT                   /translation="MGKFTEDAALLLKYVGGKENIKAITHCVTRMRFVLIDTKKADVKA
FT                   IENLKSTKGTFTQSGQFQVIIGNEVSEYYNEFVKISGIEGVSKDAVKESAKGNQTFLQR
FT                   LMSNIAEIFSPLIPAIICGGFILGFRSIISDIKFFEEGTKSLTQISQFWSGTNDFLWLI
FT                   GEAIFHFLPVGITWSITKKMGTTQILGIVLGITLVSPQLVNAYLVGTVDPKFYDFGFFK
FT                   MPMVGYQAQVIPAIMAGFVLVYLEKFWRKVVPEYISMVIIPFASLIPTVIIAHAVVGPI
FT                   GWKIGESVSYVVYTGLTSKFGVLFAGVFGFFYAPLVITGLHHMSNAIDLQLMSQFGGTM
FT                   LWPMIALSNIAQGSAVVAMAILQKKNNKAKQINIPAFISCYLGVTEPALFGVNLKYGFP
FT                   FICALIGSCIAAVISVGSKVMATSIGIGGIPGILSIQPKHMLMFAVAMIFAIAVPLILT
FT                   LIVGKKKLKAEDLIDNIDNNIETNKNLNTLDNLTTLDDDNFVSPMSGKVYKLSNISDEA
FT                   FSSGAMGEGFAVELYDGKVTSPCDGEITAAFTTKHAYGIETADGREILIHIGMDTVELK
FT                   GEGFESFVKAGDKVKKGDIIAKVDLEYVKNHGKSLVSPVVFTDGSKINLLKENAIIKNG
FT                   EGRIIEIK"
FT   gene            97208..98878
FT                   /locus_tag="Bmur_0078"
FT   CDS_pept        97208..98878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0078"
FT                   /product="alpha,alpha-phosphotrehalase"
FT                   /note="TIGRFAM: alpha,alpha-phosphotrehalase; PFAM: alpha
FT                   amylase catalytic region; KEGG: bhy:BHWA1_00502
FT                   trehalose-6-phosphate hydrolase; SMART: alpha amylase
FT                   catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70188"
FT                   /db_xref="GOA:D5U4E3"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012769"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4E3"
FT                   /inference="protein motif:TFAM:TIGR02403"
FT                   /protein_id="ADG70188.1"
FT                   /translation="MNFKNKVVYQIYPKSFMDSNNDGLGDIRGIISKLDYLSDLGIDII
FT                   WTTPFFVSPQKDNGYDVADYYNVDPSYGTMEDAEELIREAKKRNIDIMFDMVFNHTSTE
FT                   HEWFKKAINGIEKYKNYYIFKKGRIINGKKEPPTNWISKFGGSAWQYIEKFDEYYLHLF
FT                   DVSQADLNWDNEEVRKEIFDIVNFWISKGVYGFRFDVINLISKPKVFEDDFESDGRRFY
FT                   TDGINIHKYLKELNKNTFGKYDNAVTVGEMSSTTIENCIKYSGEKENELSMVFSFHHLK
FT                   VDYKNKDKWQLMDFDFQELKNILFSWQEGMQSNNAWSALFWCNHDQPRIVSRFGDDRKY
FT                   YKESAKMLASVMHCLRGTPYIYQGEEIGMTNAYFDNINQYKDVESLNYFNILKNNGVEE
FT                   KEIYKILQSRSRDNARTPMQWNDKKNAGFSNADTWIEIIYNYKEINAENNLKDEDSILN
FT                   YYKKLIRLRKDYKVISEGKTIPILKEDKNVLSFIREYNNEKILVINNFYGNECTADLNG
FT                   INFNIKTSKILISNYNDDLILDNILKLKPYESVLLYSKN"
FT   gene            99052..99618
FT                   /locus_tag="Bmur_0079"
FT   CDS_pept        99052..99618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0079"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bhy:BHWA1_00501
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70189"
FT                   /db_xref="GOA:D5U4E4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039532"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4E4"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG70189.1"
FT                   /translation="MKNDKKDLRIIKTQKLLKESLLELLKSNSLKDISVTEICEHALVN
FT                   RVTFYDHFNNKEELLNSIINDIKEDIIKELRKDNSIYDFRKNYRKILEKVINYFDYNRQ
FT                   YFNVSLIDSNNTLLFVSSLYRIFSEYLDETMKSENAENTKIMSQFFSGALVSVILCWVK
FT                   DDDNKKIKKEDLLNNICILLEKSFK"
FT   gene            99722..100723
FT                   /locus_tag="Bmur_0080"
FT   CDS_pept        99722..100723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0080"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD(P)(+))"
FT                   /EC_number="1.1.1.94"
FT                   /note="KEGG: bhy:BHWA1_00500 glycerol-3-phosphate
FT                   dehydrogenase (D(P)(+)); PFAM: NAD-dependent
FT                   glycerol-3-phosphate dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70190"
FT                   /db_xref="GOA:D5U4E5"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4E5"
FT                   /inference="protein motif:PRIAM:1.1.1.94"
FT                   /protein_id="ADG70190.1"
FT                   /translation="MANVGIIGAGGWGLALANIFSEKHNIKVWVHSEESYKLLSTTHRN
FT                   DNYLENIELNKKINFTMDMGEAVNNNEIIIIVTPSFAFAEACTNIKPYISSDQILVSAT
FT                   KGLDRKTGKTMSEVARSIISGDLSILTLSGPSHAEEAAKGVPTAVVVGGEKGVSEYVRD
FT                   TLTVPPKFRIYNSTDQKGVEIGGALKNIIAIAGGIVDGLNLGDNTKAALITRGLHEIVR
FT                   FALSKGARIDTMYGLSGIGDLIVTCSSALSRNNRLGRELAKGKKYEDVISENHGQVAEG
FT                   VYAATAAYEYAKKNNIYMPITEAIYNILFNNADIQTTLTELMSKDAKSEGFF"
FT   gene            complement(100724..101131)
FT                   /locus_tag="Bmur_0081"
FT   CDS_pept        complement(100724..101131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0081"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00499 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70191"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4E6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG70191.1"
FT                   /translation="MKYILIIFIILTLISCKSTNTQMAAVSEEVHNKENTSIPKAITLK
FT                   DRAGYYKSKSPYFTFNIDLKENGYANVVLKGWMVYRGIVKVGDPNSDAKKFRLDIDNIT
FT                   HVIVEFKDLNNAEASVILKGVVQQSLDMIKI"
FT   gene            101250..102308
FT                   /locus_tag="Bmur_0082"
FT   CDS_pept        101250..102308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0082"
FT                   /product="protein of unknown function DUF1385"
FT                   /note="PFAM: protein of unknown function DUF1385; KEGG:
FT                   bhy:BHWA1_00498 predicted metal-dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70192"
FT                   /db_xref="GOA:D5U4E7"
FT                   /db_xref="InterPro:IPR010787"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4E7"
FT                   /inference="protein motif:PFAM:PF07136"
FT                   /protein_id="ADG70192.1"
FT                   /translation="MKKQLDENRIKEGVGGQAVIEGIMLRNKSHYVVAVRKPDKQIDFI
FT                   KASISENRNSLTKMPFIRGVVNFVDMMKLGYKTLVFSANTAGLEEDNNKKDANKSNNQK
FT                   NDGLAMTLSMLVSLAFAVGLFIALPYFITTLIGINEKEHFVIFNLARGAIKLAIFVLYL
FT                   LVISFFKDIKRVFEYHGAEHMVVNAYEHGLDPDTGNIRDYTTIHPRCGTTFMFLVLTVS
FT                   ILLYMFTSYFVYTYIYASYTPPKIIGNLTVLAINILLLPIVSGISYEILKLGFRFYNFP
FT                   LMRLAILPGLLLQKITTRRPQDDEIEVALFALSKLLDTSVGNRTEEEVQADMKASLENN
FT                   NTNNTTEEKLCI"
FT   gene            102299..103426
FT                   /locus_tag="Bmur_0083"
FT   CDS_pept        102299..103426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0083"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00497 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70193"
FT                   /db_xref="GOA:D5U4E8"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4E8"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00497"
FT                   /protein_id="ADG70193.1"
FT                   /translation="MHIKKRLIAKDDYYEYSSSYIRKYIVIIAIALFCVLFTVIFIQVN
FT                   YRSVPEKSYMRNDTPVLDVNNPIITNNNGIYYTGDFDSIPKSIQINEDMAENLYLYLFH
FT                   DNHIIFWKLYKYNLKRYFSYYAFNILDGDSQSFVIKEDEKDYLDFYDNFIRAQFRKSVG
FT                   ELSLEIPNFYNTKLNLKTSINNLIESEFSFKFTNFSASMVNWAANRALYVSFYYGLPSG
FT                   YLVVPGSENAITDTSSVLAINTVGRNPSRYTHNIIAALAYISYNTEPIPIFIYDSKPQS
FT                   QNSRMVKFLFKNKWHIYKNFDSHEYKDVIDYYSKEEGFSFVFTVTSDYLYNGLGGFQKI
FT                   DFETTKGVIDGYFTVENEQFKINGNAVKEFVHSVF"
FT   gene            103426..104454
FT                   /locus_tag="Bmur_0084"
FT   CDS_pept        103426..104454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0084"
FT                   /product="putative transcriptional regulator"
FT                   /note="KEGG: bhy:BHWA1_00496 putative transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70194"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4E9"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00496"
FT                   /protein_id="ADG70194.1"
FT                   /translation="MRGNMTENKKFVRLFEIYTSLILDGFILKNKFVDDNNMSKRTLLR
FT                   DIKEIEKYLRIELKSEKDKYVISSSDLKKIKKGFNFDDNIKKNVDILFSIFIKKVSSNL
FT                   SLIPRSTVSKLLPQNIDDEYYDVILIARNDINHISGDSENIDKLLSFVKDLNDISFDYY
FT                   MESAKSSFRVEAAAYLIYYFQGIWYLVANDNKKNRIKTYIINNISNINIIKKIKFTDKK
FT                   DKEEYDNQYKIRSEKRDKLIKHLESKRSIYWNEDKIVKTLVKFNSNVAHYFKNRNYGFN
FT                   QKIKMELEDGSVLINFDFSSFTELRIFLSPWLGAFKIISPEKFNKEFIEHLNNALSVMQ
FT                   SE"
FT   gene            complement(104532..106619)
FT                   /locus_tag="Bmur_0085"
FT   CDS_pept        complement(104532..106619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0085"
FT                   /product="glutamine synthetase catalytic region"
FT                   /note="PFAM: glutamine synthetase catalytic region; KEGG:
FT                   bhy:BHWA1_00495 glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70195"
FT                   /db_xref="GOA:D5U4F0"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022147"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR040577"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4F0"
FT                   /inference="protein motif:PFAM:PF00120"
FT                   /protein_id="ADG70195.1"
FT                   /translation="MKKIPEIFGSMVFNDNVMKDKLPKDIYKKLIKTIKNGERLNLEVA
FT                   NVVAHAMKEWAIEKGATHFTHWFQPMTGVTAEKHTSFIAQTDDGATRMEFTGKELVQSE
FT                   PDASSFPSGGLRATFEARGYTAWDPTSYAFIKDDTLCIPSAFCSYSGESLDKKTPLLRS
FT                   MQVIEKEAKRILKLFGHNNINRVFTTVGAEQEYFLIDRELYLQRPDLRYCKRTLFGACP
FT                   PKGQELEDHYFGAIKPRVLEFMKELDIELWKLGIVAKTEHNEVAPGQYELAPEFTITNM
FT                   ATDQNQITMELMKVIAEKHNLACILHEKPFSGVNGSGKHNNWSIATDTGMNLLDPTDNP
FT                   AKNKQFLLFLVAIIKAVDEYQDLLRVTTASASNDHRLGASEAPPAIISMFLGDELTEVL
FT                   ESMEHSKDYEGKAKVEMEMGVNSLARLTKDSTDRNRTSPLAFTGNKFEFRMVGSSLSVS
FT                   GPNIILNTIVAEALSQFADILEKSSNFEKDLDELIKDTIKKHKRIIYNGNNYSDEWVKE
FT                   AEKRGLFNLKTTPEALPHFISQKNIDVLTKHKVLTEAEIRSRYEIGMEEYVKEINIEAL
FT                   TLTDMVYKHILPSSIEYTGELANIADKKNNLKVNFDVESDLINKLNKLISDLYSKLGKL
FT                   EEYIAEGKKITDVSKAANFSRDKIFACLEDMRVTIDELERTVSKKYWKLPTYGDMLYSL
FT                   S"
FT   gene            complement(106753..107571)
FT                   /locus_tag="Bmur_0086"
FT   CDS_pept        complement(106753..107571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0086"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00494 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70196"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4F1"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00494"
FT                   /protein_id="ADG70196.1"
FT                   /translation="MKQNIDLYEYINKWVGNSTAYPYYKIDLKLDLISKLISPHKSFNN
FT                   ISILASGAKRNRTDINYMEYLNVYLILNETDNITDTRKFKLSILDLIKKNDTYQTKINE
FT                   ISYYLILEYENEKIMLLPSFKNVDENNIEGTMITNSNGTNEIFYPKLDNKNFDKKEQEC
FT                   GANFINLIKIFKYIFLTFSNEIKSMNELSLNIIEALIWNLPNEYFKFNDYDEAILKAID
FT                   YIYEKIASDDYMSLSEINDIKVLFSIRNNLHRKEILKALYKIKQIIHESM"
FT   gene            complement(107576..108709)
FT                   /locus_tag="Bmur_0087"
FT   CDS_pept        complement(107576..108709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0087"
FT                   /product="response regulator receiver modulated CheB
FT                   methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /note="PFAM: CheB methylesterase; response regulator
FT                   receiver; KEGG: bhy:BHWA1_00493 response regulator receiver
FT                   modulated CheB methylesterase; SMART: response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70197"
FT                   /db_xref="GOA:D5U4F2"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4F2"
FT                   /inference="protein motif:PRIAM:3.1.1.61"
FT                   /protein_id="ADG70197.1"
FT                   /translation="MATKIKVLAIDDSALIRQLLTKIVNSDPALEMVGTAANPILAENK
FT                   VKNLKPDIITLDIEMPEMDGITYLKKLMLNNPIPVIMFSSLLDKHRELALDALNIGAFD
FT                   YVIKPSANVRDGVEELATDLVEKIKNAYANRAKFYRKHGVNIPTETASPVERTPISLEA
FT                   PKTAGFKVYQKNTADIILPLTPSRETPMDKIILIGSSTGGTEALIECLKNVTPSAPPIV
FT                   ITQHMPEHFTTSFAKRLNSILKIDVAESEDCMSIGRGQAVLARGGKHTMIKVKGGKYFI
FT                   EVRDGEPVTRHKPSVDVLFRSGAVYAKNKAIGIILTGMGDDGANGMKEMKDAGAYNIAQ
FT                   NEETCTVFGMPREAIARGGVDEVLPLDKILAAALKRV"
FT   gene            complement(108737..109330)
FT                   /locus_tag="Bmur_0088"
FT   CDS_pept        complement(108737..109330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0088"
FT                   /product="CheD"
FT                   /note="PFAM: CheD family protein; KEGG: bhy:BHWA1_00492
FT                   chemotaxis protein CheD; stimulates methylation of MCP
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70198"
FT                   /db_xref="GOA:D5U4F3"
FT                   /db_xref="InterPro:IPR005659"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038592"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4F3"
FT                   /inference="protein motif:PFAM:PF03975"
FT                   /protein_id="ADG70198.1"
FT                   /translation="MIDFPAAANSNFKRITIYIGGYYASKEPAVIKTVLGSCISVCLFE
FT                   NKLKFGGMNHFMLPEMREWENPAEDYNNTRYGVFAMEVLINEIIKLGGKKENLTAKIFG
FT                   GGHVLSGMTSNILQVPDKNIQFAKKFLADEKIPIVSEDVGGSWPRKVFFFNTENRVLMK
FT                   KLEGKTKEFSAEQEIKYSKNLQHKLEEKSDITLF"
FT   gene            complement(109346..110197)
FT                   /locus_tag="Bmur_0089"
FT   CDS_pept        complement(109346..110197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0089"
FT                   /product="MCP methyltransferase, CheR-type"
FT                   /EC_number="2.1.1.80"
FT                   /note="PFAM: MCP methyltransferase CheR-type; KEGG:
FT                   bhy:BHWA1_00491 chemotaxis protein methyltransferase CheR;
FT                   SMART: MCP methyltransferase CheR-type"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70199"
FT                   /db_xref="GOA:D5U4F4"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4F4"
FT                   /inference="protein motif:PRIAM:2.1.1.80"
FT                   /protein_id="ADG70199.1"
FT                   /translation="MDDMNANMPALTDSEFNELVKIIYDKTRIQMTNHKRALVTSRLSK
FT                   RLRALHMDSFREYIDFVKNAKDEELTNFVNAVTTNKTDFFRENKHFEYMKTNFLPEWEK
FT                   NFKEGKVKNLRIWSAACSTGEEPYTIQMTLHEYFGANYDKYDIKVLASDIDTNVLAHGR
FT                   AGIYKEESVEPIQPNILRKYFLRGTGDKDGLYKVKDILKKNLFFRQLNFKDEDFDIHTQ
FT                   FDLIFCRNVIIYFDKEFQKELFNKFHRYLKEDGLVFIGHSETLFGVSDKFKYVSSNIYK
FT                   KI"
FT   gene            complement(110220..110750)
FT                   /locus_tag="Bmur_0090"
FT   CDS_pept        complement(110220..110750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0090"
FT                   /product="CheW protein"
FT                   /note="KEGG: bhy:BHWA1_00490 chemotaxis protein CheW; PFAM:
FT                   CheW domain protein; SMART: CheW domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70200"
FT                   /db_xref="GOA:D5U4F5"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4F5"
FT                   /inference="protein motif:PFAM:PF01584"
FT                   /protein_id="ADG70200.1"
FT                   /translation="MLDNQKINAANIPQVGGTALDHEENLSTEPSQQFLVFKIDNEEYA
FT                   LDVLSIDGIVGVTNITPVPGSPKYMRGLMNLRGNILHIVDIRIRFGLARRDDHSIEDDV
FT                   IIVIYTTNRKFGILADMVSDVITVYESQMTETPIDNMRGLQISNVIRLENKIIMVLPID
FT                   EIIKSNDSENKTV"
FT   gene            complement(110762..112870)
FT                   /locus_tag="Bmur_0091"
FT   CDS_pept        complement(110762..112870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0091"
FT                   /product="CheA signal transduction histidine kinase"
FT                   /note="KEGG: bhy:BHWA1_00489 chemotaxis histidine kinase
FT                   CheA; PFAM: ATP-binding region ATPase domain protein; CheW
FT                   domain protein; Hpt domain protein; Signal transducing
FT                   histidine kinase homodimeric; SMART: ATP-binding region
FT                   ATPase domain protein; CheW domain protein; Hpt domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70201"
FT                   /db_xref="GOA:D5U4F6"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4F6"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADG70201.1"
FT                   /translation="MFDSDEFISIFLSEAKEIVEGLENDLVLLEDNKSDEDLLNKIFRS
FT                   AHTLKSSAGTVGFTTMSELNHVAENLLEKVRSGKLDVTPQMITVLLEFLDTVKLMLQNI
FT                   VDGKSETDGVTNIDSLKAKIKAIADGNDPAAVATPKPEEKKEEAPKAEKEDTSSSSSGS
FT                   NSFHIDMGFKATIFDNGIDPLMFLNDLRAIGTISNLKIECNNLPTILNLEDPYVCYTQF
FT                   SLDFDTNAPDEQVQNIFLFVIDDNDINIVNTKADIKDDDEDKPAETAPVKEEETPKAEE
FT                   APKPAEPTNNAAAANTAQPHKAAKVQAPSTVRVDTRKLDSLMNLIGELVIAQSRIMQLT
FT                   QSLDIDNGLKEAVSSMDRTSRQIQEEVMNIRMMPIGPIFNQFHRYVRDLNLELHKEVKL
FT                   VLKGESTEIDKNMLEQLSDPLKHMIRNSMDHGIEKTKEERIARGKPEYGTITMSAAHQE
FT                   GHVVIEVADDGNGLNKEKIFKKAVEKGLLSKDGKYSDIEIFRTIFAPGVSTADKITDIS
FT                   GRGVGMDVVRANVEKMKGKIEIKSTEGKGSTFIVKLPLTLAIIEGITFALGKQIYIMPL
FT                   ISIIEQIKVKNEQVKPFEGKGEMIKIREEYLPLIRLHKVFEIDTQVENIEDGIVVVVEA
FT                   GYRKCAIFVDELLDQQQVVIKSLDSAFDKHAGIAGGTILGDGKIALIIDIQGLVNMSLQ
FT                   GKINNGVK"
FT   gene            complement(112930..113298)
FT                   /locus_tag="Bmur_0092"
FT   CDS_pept        complement(112930..113298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0092"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: bhy:BHWA1_00488 chemotaxis response regulator
FT                   CheY; PFAM: response regulator receiver; SMART: response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70202"
FT                   /db_xref="GOA:D5U4F7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4F7"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADG70202.1"
FT                   /translation="MAKTILIVDDSNTARASVEYTLKKGSYTVVSADDGTTGLEVLGKT
FT                   PNVDMIITDLNMPKMDGIEFIKHVRQVDQHKYTPILMLTTESQDEKKMEGKAAGASGWL
FT                   VKPFNPTQLLDVVKRFLN"
FT   gene            complement(113318..113581)
FT                   /locus_tag="Bmur_0093"
FT   CDS_pept        complement(113318..113581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0093"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="KEGG: bhy:BHWA1_00487 anti-sigma-factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70203"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4F8"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00487"
FT                   /protein_id="ADG70203.1"
FT                   /translation="MAVIEISDNLNIRTMSKYFKNVIKSANYNEDITVKFNCEGPAHVD
FT                   LAGLQILYAMKKELAKNQKNLIVEGMDNLFVEYLNIINDKNN"
FT   gene            complement(113606..115537)
FT                   /locus_tag="Bmur_0094"
FT   CDS_pept        complement(113606..115537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0094"
FT                   /product="putative methyl-accepting chemotaxis sensory
FT                   transducer"
FT                   /note="KEGG: bhy:BHWA1_00486 putative methyl-accepting
FT                   chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70204"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4F9"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00486"
FT                   /protein_id="ADG70204.1"
FT                   /translation="MGVSAIIDNNIRQDILDYSAILETTVKDIHSFLEEVGRVYSFIGE
FT                   KFPMIEQEMKNENEKANSLLSYFTNKEKGEKNFSNDLEENQDDFFLSFDRMQNFISQDN
FT                   ELSDSLVEDVGKTSNIMDSIEQIRMLADQIKVYSLNAIIISSKYGAGGKAFGEISKNII
FT                   KMSETSNEQADQMNRIGKELFVRFESFKTEILKTNELQRQNFTIMREQLDKEHNNMVNS
FT                   FAVFSNIISNIISRVDNTYDFIFEVMMVLPREDIVRQQTEHIVESINSIVYENRNFIDY
FT                   YGSQVESMDAEDLEKTENQTLEHKLLDLLTFDDVVLTLIIENFKSIHEEISLTNSDIYK
FT                   SLKGLKDALLDITSDRTTIVEYMIGGETGKSEFPFTVSESLFNEYMGFIKLYLENFKLF
FT                   LTNKYRISDSNIAIIDSIEELESMFLETKNIAKTFNSINFLAKIELEKNSDIFNNSQTF
FT                   SIESVESIATNITDTVDACLEQFHNIKAAIFSSINKFKSNINQQSTEHTFIESMTESVS
FT                   KRLDESKYIINNNIKRLDSYADELFGLIDKTLIDLSSLSTLLTKINEIIEIFNSMRNVI
FT                   RNKKNEYYKLLGIENWKIESDKYLDIVNSYTIKKERAIANSILSGEEAPNVDINIDVGA
FT                   DSGDFTMF"
FT   gene            complement(115850..117742)
FT                   /locus_tag="Bmur_0095"
FT   CDS_pept        complement(115850..117742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0095"
FT                   /product="NAD+ synthetase"
FT                   /note="KEGG: bhy:BHWA1_00485 D+ synthetase; TIGRFAM: NAD+
FT                   synthetase; PFAM: NAD synthase; Nitrilase/cyanide hydratase
FT                   and apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70205"
FT                   /db_xref="GOA:D5U4G0"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4G0"
FT                   /inference="protein motif:TFAM:TIGR00552"
FT                   /protein_id="ADG70205.1"
FT                   /translation="MKIAISQIEIIPSMPCDNTVRIISAISSAKKNNADIIVFPELCVS
FT                   GYMLGDMWESKGFINECEELGEEIIKSSNGIYVIFGNVASDKSKKNFDGRLRKYNALFA
FT                   AKDGKLIHNNTTPYPFIIKSLLPNYKEFEDPRHFFSLKDLAFENNADIKEYLKPLEIEC
FT                   NGEKIKLGLTICEDAWSSNYSFSPMDIININKDVDLFINISSSPYTLVKDTKRHKMYGE
FT                   IASKHNIPLVYVNNVGIQNNGKTVYTFDGGSSVYDNNGNLLLTANRYEDNVYYIEMDIK
FT                   NKSYPKPIEIQEDDEYKFIYDTVIYGIKKFTKSIGVKKIVIGVSGGIDSALSSAMYVSA
FT                   LGKDNVYLVNMPSKFNSSTTKDLAKTLADNLGCSYMVVPIQESVDYTVKQLESSPIIKD
FT                   GNENYLKLSSFVIENIQARDRSSRILSAIAASIGGVFTCNANKTETMVGYSTMYGDSAG
FT                   FFACLADLWKYQIYGLAKYVNEKVFGEEIIPEGTINIVPSAELSTAQAVDEGKGDPIKY
FT                   DYHDYLFKFLMESWNRIILEDVLELYINDKLEEAIGCQKGILNKYFTTAHDFVDDLEKW
FT                   WKQFMGMGITKRIQAPPILAVSRRSFGYGNREAQNRVYYTARYLYLKNKVLSLD"
FT   gene            117889..118476
FT                   /locus_tag="Bmur_0096"
FT   CDS_pept        117889..118476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0096"
FT                   /product="flavin-nucleotide-binding protein"
FT                   /note="KEGG: bhy:BHWA1_00484 predicted flavin-nucleotide-
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70206"
FT                   /db_xref="GOA:D5U4G1"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4G1"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00484"
FT                   /protein_id="ADG70206.1"
FT                   /translation="MRRKDFIFEDMYEIDKMLNSIEFGVMALPDIIPYAVPVSFCFKNN
FT                   QIYFHGAMSGRKYEILKNNPEVSFTASKLYSYIPSSFMNNNMIPTQFFFSIFAEGRFES
FT                   INDIEERRNILYELVKKYEPNNNNLSIDNKMFNYAQNNMLIGVINIKNITAKAKFGQNM
FT                   TDDEIKMIIKDLKTRAEKIDIDTIEMINKMRK"
FT   gene            118593..119582
FT                   /locus_tag="Bmur_0097"
FT   CDS_pept        118593..119582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0097"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /note="KEGG: bhy:BHWA1_00483 cAMP-binding protein; PFAM:
FT                   cyclic nucleotide-binding; TPR repeat- containing protein;
FT                   SMART: cyclic nucleotide-binding; Tetratricopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70207"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4G2"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ADG70207.1"
FT                   /translation="MQTRVYKAGSIVYFTGDTSDRVYILKQGQAQSIFLSEETGYETRE
FT                   LINIGEFFGVKSILGTYPQEDTVQCLTDCVVIIITYEEFESLIAKNKPIIIKMLKVFSN
FT                   QLRRINKRVRELVENDINDEAPDPLEGLYNIGEFYFKNKKYKNALYAYKRYLQYADEDS
FT                   TYYNTVKEKIEECKDELDITDDSDIAPPNSEVSSAEKTAAQAQTAVNDPVYNKAVELYN
FT                   SNNYVNSIKTFNTLLKSSNAAVAENSMFYMGKCYYNLNKYDNASTVLLSAIKKYPKSSN
FT                   VKEAILFLAKTCEAKGDKTKAKAYYQKVISMPPMDNFSKEANASVSRL"
FT   gene            119604..120239
FT                   /locus_tag="Bmur_0098"
FT   CDS_pept        119604..120239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0098"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /note="KEGG: bhy:BHWA1_00482 cAMP-dependent protein kinase
FT                   regulatory chain; PFAM: cyclic nucleotide-binding; SMART:
FT                   cyclic nucleotide-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70208"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4G3"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ADG70208.1"
FT                   /translation="MDNNLSSHTKKYNTDDVIFLEYEKGDKFYMVQSGSVKITKVIKDV
FT                   EKLLDIVYPGDFFGEMAILEDTTRSASAIANEPTVLLELRKENFQSILANNTAMALKLS
FT                   KMFAKRIFDAKRRLLILQLNETDLRVYDCLLLLAELQNIPRDHYYEPQELNATINDIAN
FT                   WCGVKVNDVQKVLNSLVKTGKIDIRTNTIYVKNLKEIQRQIDLKRKKS"
FT   gene            120390..121082
FT                   /locus_tag="Bmur_0099"
FT   CDS_pept        120390..121082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0099"
FT                   /product="Ankyrin"
FT                   /note="KEGG: bhy:BHWA1_00481 ankyrin repeat-containing
FT                   protein; PFAM: Ankyrin; SMART: Ankyrin"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70209"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4G4"
FT                   /inference="protein motif:PFAM:PF00023"
FT                   /protein_id="ADG70209.1"
FT                   /translation="MKKIVLMAVLYTLFSFNALYSGKAENAAQLLLYIASGDSEGVLEL
FT                   INDKKVDISGRIEDGLTPLMFSIIYKQDEISKMLIEKGANINVKDKSGFTALIHSIMYN
FT                   RTEISKILIEKKADVNIKTSLNENGVYMKNFTPLILNQDKEIAKLLINAGADINLKLSC
FT                   KNGDIKLENAAPLMWFIITDNTEVAELLIESGADINAKDKDGKTALDYAREKNNSKIEQ
FT                   LLIQKGAN"
FT   sig_peptide     120390..120461
FT                   /locus_tag="Bmur_0099"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.727) with cleavage site probability 0.348 at
FT                   residue 24"
FT   gene            121330..122003
FT                   /pseudo
FT                   /locus_tag="Bmur_0100"
FT   gene            complement(122051..123331)
FT                   /locus_tag="Bmur_0101"
FT   CDS_pept        complement(122051..123331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0101"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00478 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70210"
FT                   /db_xref="GOA:D5U4G5"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4G5"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00478"
FT                   /protein_id="ADG70210.1"
FT                   /translation="MNIIKTLYKKYSYYINYALLVFINGIASVLNYISSIYINRSLSIS
FT                   DFAHYNGIINIYSIIVLTVSSFSYYIMHHYKYDEDARTYWAYGYIIAIIISILYIVSIP
FT                   LIDILFNIKSYPSLLIMSVGIFVTILGIVSQSILKINNYIAYDYTASLIAIFISKILLL
FT                   AYFIITGLTLEKAIISVALFCVLYFIINIIELKKLNLPYFVPLNKIKMYFSKQNLYIFL
FT                   SYIIHIVIVNFIFNWISLSDVLMANRYLDKTSAGYYSTMSLIIKMFFYIGTPIASVMFS
FT                   YILIAKKDNNKNKESKILYYSILLLVFASLCLSVFLIVFAKQIILIQFTSRYEAIIPLV
FT                   PTAVIFGFSLAFTVLTFNYGLAYRLWYPFYGYLIIFVYVYFSLRNGLRTFENFIFVMKI
FT                   FFIALLIYNILIILIHRIILKTNEKLK"
FT   gene            complement(123376..125004)
FT                   /locus_tag="Bmur_0102"
FT   CDS_pept        complement(123376..125004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0102"
FT                   /product="ABC-type uncharacterized transport system"
FT                   /note="PFAM: ABC-type uncharacterised transport system;
FT                   KEGG: bhy:BHWA1_00477 ABC-type uncharacterized transport
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70211"
FT                   /db_xref="GOA:D5U4G6"
FT                   /db_xref="InterPro:IPR019196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4G6"
FT                   /inference="protein motif:PFAM:PF09822"
FT                   /protein_id="ADG70211.1"
FT                   /translation="MSNKKFNLRILTIASWVLLFFAWIFFYAVTQRPTTVFWIVLAVSA
FT                   VITIITIVVDRKYIISFLKMRFVHKAFFGILSLVIVLAILVGLYIISINFPIRFDMTQN
FT                   KSYTISQQTTDVLSRIDSPLSIVVLRSPSTDPTSPDWRADLLLEQYKRINKHISVEYIN
FT                   PIEKPSAKSKYQMTQVGEIVFTYGQSKQVRVYRKDLTTQSKVTSDPLFVGEEKFTQAIY
FT                   TLLDNESYVIYFTVGHGERQIQDRGGEGLSYVKTYLENENYKVRELNIILENIPTDAAL
FT                   IVIAAPVETFSDFEIEKLNNYVKTGGKLLVLYDSFMDRSRFNSNLGGFLSDWGFKTKND
FT                   YIIDTASSVVIPVNIVPQYTSHPITQTLKEGNVFACLVVARSILSGENKYNGSFENIIT
FT                   TTPQGYGKEEATFDLSRARFNPRTDIPGPVPLAISGTYEIEGRKEPARIVVFGDATFAL
FT                   NAYINPEQGQSVDIAFAGNKDLFMNSVAYLLEARQKITIRPKEASIKNLTLTTTQTNFI
FT                   RYVAQIGLPCLFGILGILIWFLRRR"
FT   gene            125290..126444
FT                   /locus_tag="Bmur_0103"
FT   CDS_pept        125290..126444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0103"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number="1.1.1.267"
FT                   /note="TIGRFAM: 1-deoxy-D-xylulose 5-phosphate
FT                   reductoisomerase; KEGG: bhy:BHWA1_00476
FT                   1-deoxy-D-xylulose-5- phosphate reductoisomerase; PFAM:
FT                   1-deoxy-D-xylulose 5-phosphate reductoisomerase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70212"
FT                   /db_xref="GOA:D5U4G7"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4G7"
FT                   /inference="protein motif:TFAM:TIGR00243"
FT                   /protein_id="ADG70212.1"
FT                   /translation="MKKRILLLGATGSIGTNTCNVVRNFSSDFEIVGMSANSKIDILRT
FT                   LCTEFNPKTVNISDKSAANIFKDYDCAESINIFDGSIADFVKHTDFDILVNALTGYAGF
FT                   LPTVEAIKKGKTVALANKETLVVGGDIINELLKQNNAKLIPIDSEHSAIFQILNHFGKD
FT                   ALSKVIITASGGPFFRTPKEELKNVTVEMALKHPTWSMGSKITIDSATMMNKGFEVIEA
FT                   HHLFNLDYDKIETIIHPQSLIHSMAEFVDGEIYAQIGKNDMCLPIQHALTYPEIRNTPF
FT                   EKLKLYEHTELNFYKMDFDKFVMLKLAYECGKKGGLYPCVLNAANEICVYSFLEKRIGF
FT                   TDIFDIVSKVCSRKINIPLTIDNIINMDSEIRKETRWIIDSMTK"
FT   gene            126528..128264
FT                   /locus_tag="Bmur_0104"
FT   CDS_pept        126528..128264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0104"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /note="TIGRFAM: prolyl-tRNA synthetase; KEGG:
FT                   bhy:BHWA1_00474 prolyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (G H P and S); YbaK/prolyl-tRNA
FT                   synthetase associated region; Anticodon- binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70213"
FT                   /db_xref="GOA:D5U4G8"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4G8"
FT                   /inference="protein motif:TFAM:TIGR00409"
FT                   /protein_id="ADG70213.1"
FT                   /translation="MRLSKLFMPTLKEAPSDAIIASNKLMIRAALARKISNGLYSYLPL
FT                   GVRVLSKISNIIREEMDAIGSNECIMPILVSKELLTPSGRWERFKKELFRLKDRNDVDM
FT                   AMGPTHEEAFTITAQNEIQSYKDLPLTLYQIHTKFRDEIRPRFGVIRSKEFTMKDAYSF
FT                   HITKECLDKTYNDMSRAYTKIFKRMGLDTVSVKADSGAMGGEGSEEFMVLSEVGEETII
FT                   FCSKCDYRANVEKANVKKDEEVKSYTDKPLEEVNTPDIKTINDLEKFFNTSSKNFIKSI
FT                   IYKTEEGEVILAAIRGDLEINETKLSNALGGLDIELADEDTVKEVTGARVGFASPIGLK
FT                   KKIRIFADNSIKSVADAIVGGNKDDTHIKNVNVQRDFNIDVWGDFRTAKEGDKCPECGE
FT                   TLYQKKGLELGHIFKLGDKYTQAFNFKVLDENNKEITPIMGCYGIGVNRALASVIEQNY
FT                   DDKGIIFPISVAPYEAIVVAIDKEGEESFKKAEEIYNALNALKVETMFDDRKERLGVKL
FT                   NDCDLIGIPMRIMVGKKSLQRGVVEFKLRSSSESIEVKADEIVEYVKAKKEELFNEINS
FT                   KL"
FT   gene            128337..128774
FT                   /locus_tag="Bmur_0105"
FT   CDS_pept        128337..128774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0105"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bhy:BHWA1_00473 ribosomal-protein-alanine
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70214"
FT                   /db_xref="GOA:D5U4G9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4G9"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADG70214.1"
FT                   /translation="MENIEVVNDIDNNIINSILFISSKSEYINLSENNLKQYIEDEYHN
FT                   VIIIKDDDEIKGFLIYFLLTPEIDIIFISVYPNSKGYGKKLLLYLFDDAKTNNVNSIKL
FT                   DLHENNIIAKNFYIKNGFKKIAVRKKYYNNKFDAIIMEKLI"
FT   gene            complement(128780..129850)
FT                   /locus_tag="Bmur_0106"
FT   CDS_pept        complement(128780..129850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0106"
FT                   /product="permease YjgP/YjgQ family protein"
FT                   /note="PFAM: permease YjgP/YjgQ family protein; KEGG:
FT                   bhy:BHWA1_00472 permease"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70215"
FT                   /db_xref="GOA:D5U4H0"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4H0"
FT                   /inference="protein motif:PFAM:PF03739"
FT                   /protein_id="ADG70215.1"
FT                   /translation="MKKLNAYLLKEFLSFFFGSLLLFVVLVTIADLSSRLSFYTEHPEL
FT                   INYFITYHLARAPHNTYYIFPVALMFASTYVLGTFVKNKEMLAIENSGISLFKFSMPMF
FT                   VIVIMLCLILVFFWQFVAAPLNKVSFAANDAMRGNKQASKSGPWQLFGGNNYLYFIDTY
FT                   FYQEQYMTNTILLKMNDDGGIKFRISSPYIQWNNDDKKWYVKNGILTTFSENKEIEVKE
FT                   INNYPLDVLERPEHFYGRPLLDSMSLTEEAHIIKLQKEVNMNTSRLETDLHYRISYCFS
FT                   GFIIVLLASLFSKFSTQSVLVVSLVMVIIVALLYYSILMIFRSMGEAGNMNPFIAAWMP
FT                   NIIFAILCILAFKKFH"
FT   gene            complement(129850..130731)
FT                   /locus_tag="Bmur_0107"
FT   CDS_pept        complement(129850..130731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0107"
FT                   /product="Protein of unknown function DUF2225"
FT                   /note="PFAM: Protein of unknown function DUF2225; KEGG:
FT                   bhy:BHWA1_00471 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70216"
FT                   /db_xref="GOA:D5U4H1"
FT                   /db_xref="InterPro:IPR018708"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4H1"
FT                   /inference="protein motif:PFAM:PF09986"
FT                   /protein_id="ADG70216.1"
FT                   /translation="MSDEQPRISFIEKNPRTCPVCNGEFYHEMLLTGGGRLIAGKLRDD
FT                   LRRTYEKSKKYGTVYPLIYVVVVCPNCLYAAFQEDFNLIDNKKKDEALETSKQREKYMK
FT                   EFFGDDVDFKRNRTLIEGAASYFLAIDGYHYHGKDTAPTLKKALCSLRLSWTLEDLANV
FT                   YPNENYDRLIPFFQYKASELYSSAIECMQNGKENFEKIKSFGPDIDNNFGYEGMLYMGA
FT                   LLGMDAAKFIPDPKVKAETLVQAKRKISKVFGSGKSSKSKPSALLEKIKELHVAITEEL
FT                   NELHEQYGIDVN"
FT   gene            complement(130801..131931)
FT                   /locus_tag="Bmur_0108"
FT   CDS_pept        complement(130801..131931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0108"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00470 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70217"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4H2"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00470"
FT                   /protein_id="ADG70217.1"
FT                   /translation="MVKNLKRSSILIAALLIFLYAVLSAQYQREIKKDAPPITGHYIRM
FT                   SSFESLSTWSIAALREEPYISELFADGYNNVHFAYYDNLLNTAVYVTGKEGNFSRTILD
FT                   NNRELGNLISIATNNSHIHVSYNKANKILYANDNSGTFNNYFMDLRQNRKILDLKLVMS
FT                   AFNYPTLFFVDNRGTLSVSRFYRDNFFSDFVYTNRIIDNVYPAAEKDGYALYMHEYDTG
FT                   NIFYGSRKTNTSFRFFDNRAIVTNASIYSVKHEEHNRFHIVYLSKDNNRNINYTRFYDG
FT                   TFTNFTIVSEDADIISLDCSLDYASQIMVLYTKEDGNKYLFIDGRIIDLSVLGTSSGNV
FT                   RLIAAQYPYYYLLYYNNIFDELRITKLNISDIEKLK"
FT   sig_peptide     complement(131854..131931)
FT                   /locus_tag="Bmur_0108"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.961) with cleavage site probability 0.524 at
FT                   residue 26"
FT   gene            complement(131906..133441)
FT                   /locus_tag="Bmur_0109"
FT   CDS_pept        complement(131906..133441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0109"
FT                   /product="Glucosamine-1-phosphate N-acetyltransferase"
FT                   /EC_number="2.3.1.157"
FT                   /note="KEGG: bhy:BHWA1_00469 N-acetylglucosamine-1-
FT                   phosphate uridyltransferase; PFAM: transferase hexapeptide
FT                   repeat containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70218"
FT                   /db_xref="GOA:D5U4H3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4H3"
FT                   /inference="protein motif:PRIAM:2.3.1.157"
FT                   /protein_id="ADG70218.1"
FT                   /translation="MEKNAVEIENALSSLSSKFSKNDTLVIILAAGHGKRIRSSTSKML
FT                   HTIWGVPSIERVRLAVRNGMPKSNITIVVGIKALDVANAVGKQTNTNFAYQEEQRGTGH
FT                   AVKVGLEKSDLKNIKYCYVIYADMGLIDSDTMKEFHEEFLKSKTDMIVMTAMYDGPKGS
FT                   NYYGRILRSRGLTYDGKKSKYRQGSQGNVIGVIEYKDVLAMKDDEKLYKIYKDEKFSYE
FT                   KDELLDNFNEYVAGIYGFKMKPLEELIQKLEANNAQNELYLTDLIEMFVNNNLSISTYM
FT                   PKDSRVVLGFNDKTVLKEMESIARSNVYNKLKNIITIYDGEDFFIDDTVVEQILERDKD
FT                   EKPLDIYIGKGAYIGKNVTLNYGVTISHGAKIEGNVHLGENAYIGDNALLSCLDNQRLI
FT                   LDDNVKIYSGNQIKGNVYIGKNTTLERGVNVTGSDNHPVNIGSNVLIKGVSYLYGSIVD
FT                   DNAYIEHCIFYYSHIKAVLDEKGNVIKCRFIRPKEEGVESVSKIEDGKKSKKK"
FT   gene            complement(133452..133991)
FT                   /locus_tag="Bmur_0110"
FT   CDS_pept        complement(133452..133991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0110"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00468 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70219"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4H4"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00468"
FT                   /protein_id="ADG70219.1"
FT                   /translation="MEIKDSTRSALVRKGNELFNQKDIEGAYRCYLTASYFGGIEKVAD
FT                   YYNFEKKNIIKAMQLYRLIIKEDSNLGGNVRAKQKLDKLCESVVKVLRKWLKEDESFNQ
FT                   DKNKDKLELDSKNTFLPNDYKKNSLEDIMKAKEQLDNKASIVNDKKISNPLPLNVKKPV
FT                   FEQIYTNKQKANDKKN"
FT   gene            complement(134096..135490)
FT                   /locus_tag="Bmur_0111"
FT   CDS_pept        complement(134096..135490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0111"
FT                   /product="MATE efflux family protein"
FT                   /note="KEGG: bhy:BHWA1_00467 NorM, Na+-driven multidrug
FT                   efflux pump; TIGRFAM: MATE efflux family protein; PFAM:
FT                   multi antimicrobial extrusion protein MatE"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70220"
FT                   /db_xref="GOA:D5U4H5"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4H5"
FT                   /inference="protein motif:TFAM:TIGR00797"
FT                   /protein_id="ADG70220.1"
FT                   /translation="MKSNDEHELKETERQNKKYKELTESNIETLVIKLGIPTIISMLTT
FT                   SFYNMADTFFVSKINTQSTAAVGIVFSMMAIIQAIGFFFGHGSGNYISIKLGAKETEEA
FT                   SKMAATGFLSAMIVGFIIFIIGTIFIKPLATILGSTETILPYSISYMRYILMGAPYMTA
FT                   SLVLNNQLRLQGNAVFAMIGLVTGAVLNIILDPILIFHFSMGVKGAAIGTIISQFAGFC
FT                   ILLVGTNVWGTLPIKLKDFSPSLQKYKAIVVGGLPSLCRQSISSFSTAFLNIASAPFGD
FT                   AAIAAMSIVNRVAMFANSAIIGFGQGFQPVCGFNYGAKKYERVIKAFYFCVKISTFVLI
FT                   LLSIFIFMNSAQIVHMFNDKDEALLEVAYRALHYQALSLPLWGFITLSSMMLQTTRKTI
FT                   RASILAVAKQGIFFIPIMYVFPKIFGLTGIEIAQPFADLLTFLLSIPLGLSIIREMKQE
FT                   LSRKAI"
FT   gene            135616..136536
FT                   /locus_tag="Bmur_0112"
FT   CDS_pept        135616..136536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0112"
FT                   /product="methylenetetrahydrofolate reductase"
FT                   /note="PFAM: methylenetetrahydrofolate reductase; KEGG:
FT                   bhy:BHWA1_00466 methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70221"
FT                   /db_xref="GOA:D5U4H6"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4H6"
FT                   /inference="protein motif:PFAM:PF02219"
FT                   /protein_id="ADG70221.1"
FT                   /translation="MNNVENFIKKLENKNEYTFTLEISPQAKYDLGYVEEKINNSNISD
FT                   YIDSFVVTDSPFANLKISSILAALQLKQRLNNNKPFITTQTMRDKNSIALQNDLIGANY
FT                   FDLRMILAVTGDAVANGNQKQAKAVFEGNSNLLINIIKNLNKGKSLGEFVFKEPLKHIY
FT                   PFCVINSYAKNNDSLKVRLAKKANSGVKAIFTQPIYEIERLELLLKWIDELPLKEKPML
FT                   IPGFFPVLTYKTAYFIYYKLPGAYIPEDWLNKLKEASDKSPEEEKKVAYELSANLFNSM
FT                   IKKHKKMHIMSMNNYDFVVSLLKSI"
FT   gene            136898..137245
FT                   /locus_tag="Bmur_0113"
FT   CDS_pept        136898..137245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0113"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: smu:SMU.987 cell wall-associated protein
FT                   precursor WapA"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70222"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4H7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG70222.1"
FT                   /translation="MKKNIIMGLLVIGLISSYIYAAPAQKLILVSGTYTTSGMPNSHIY
FT                   ISNTGAGLGNSAEITLYDNDVNYEVYTGRIRIDSNGRSYIRWSDRAEEDVVIVSSTKFG
FT                   IGLNTWELKQY"
FT   sig_peptide     136898..136963
FT                   /locus_tag="Bmur_0113"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            137315..138322
FT                   /locus_tag="Bmur_0114"
FT   CDS_pept        137315..138322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0114"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cts:Ctha_1248 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70223"
FT                   /db_xref="InterPro:IPR024952"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4H8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG70223.1"
FT                   /translation="MKSIINKLILFFLITLSLYSQSIPDWALNPGVKYNDNKYLSAIGE
FT                   GKTLKDAQINAYENLSKVFSTSIKLDINSIDRYNQLENNVYNNSFYEENTQLKSYNELF
FT                   GVEFREAHYSKNEDLYRVIAVMEKKKTIKILKTKIKDNEAAIKIYLDNNSDDLIEKYSV
FT                   TDMALILAKKDQIYYEQLVYLGEDNIELKYKVQTISALRDSILKQMTFNFMTEYNNSAL
FT                   TQNIEKIISKSGFKLNKSNPSYQFKIRIDTDDIREIPDFAGGGVMIYYQFQIDLLNKND
FT                   DLIYTFNFDENSTGKEYGNTESEAKKYILNNAAKIVNEQFESKFLEFFNQYIKN"
FT   sig_peptide     137315..137383
FT                   /locus_tag="Bmur_0114"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.904) with cleavage site probability 0.692 at
FT                   residue 23"
FT   gene            138338..138922
FT                   /locus_tag="Bmur_0115"
FT   CDS_pept        138338..138922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0115"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tde:TDE0731 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70224"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4H9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG70224.1"
FT                   /translation="MKTKLFIMMLISSILFSCAATGVTTIEDMGSSIGVKQPEWMQYIT
FT                   SVSKMDALYPKKVPFTYNETGTDLNYLKRKINSTTLSAEYSRTLTQAVLQSASEESGQD
FT                   FTEHEQSIQQASASTFSGFKKEGEWWQLKRYPNGDEKYTYYVLYLVDEDNFNRSLSSVI
FT                   KKSSGTIGEEIAQKLEKNIENVKNIYMNAQQ"
FT   sig_peptide     138338..138406
FT                   /locus_tag="Bmur_0115"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.738 at
FT                   residue 23"
FT   gene            138937..139914
FT                   /locus_tag="Bmur_0116"
FT   CDS_pept        138937..139914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0116"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: asa:ASA_3240 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70225"
FT                   /db_xref="GOA:D5U4I0"
FT                   /db_xref="InterPro:IPR041215"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4I0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG70225.1"
FT                   /translation="MKKIIFVLLILYIPLLAQNENISLFPFTGDISEKQGKVFMNEIAS
FT                   KLNRRGYKFVYRSKDLGEAIKREQGLDNIKDREYADIATKLNLAGYVLAGSIIESGAGY
FT                   AINVRIIDLTTSQYKATANEYLPSLNLGNQETAAAIENIVRDIDSKISGKKIPTVQEEQ
FT                   RQKDLQNEQLTDYQINSYKNGYNNANIAKWIGRGSWITGIVLTSIPFIIDASWGNNFGY
FT                   FLVSKPAAKIPATVNVGNGVTYQDYSGFYPESDLIAMRAVFGIGIGLFVGGVITDIVAS
FT                   TMQNSYKKKLEERGIYYSFNPIITPNYNNTVNYGIEFAMAYRFK"
FT   gene            complement(140015..140827)
FT                   /pseudo
FT                   /locus_tag="Bmur_0117"
FT   gene            complement(141054..143669)
FT                   /pseudo
FT                   /locus_tag="Bmur_0118"
FT   gene            144133..145440
FT                   /locus_tag="Bmur_0119"
FT   CDS_pept        144133..145440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0119"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="TIGRFAM: nucleotide sugar dehydrogenase; KEGG:
FT                   bhy:BHWA1_02543 UDP-glucose 6-dehydrogenase; PFAM:
FT                   UDP-glucose/GDP-mannose dehydrogenase; UDP-
FT                   glucose/GDP-mannose dehydrogenase dimerisation; UDP-
FT                   glucose/GDP-mannose dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70226"
FT                   /db_xref="GOA:D5U4I1"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4I1"
FT                   /inference="protein motif:TFAM:TIGR03026"
FT                   /protein_id="ADG70226.1"
FT                   /translation="MNICVIGTGYVGLVVGACFAEMGNFVICVDNDKEKLSKLKNGIIP
FT                   IYEPGLEDLIKFNVAEKRLSFSSDLEKAVKESLICFIAVGTPQGEDGSADMKYVYTVAE
FT                   QIGKALNGYKVIVDKSTVPVGTAEKVSEIIKNNAEEEFKNEFDVVSNPEFLKQGAAVED
FT                   SLKPDRIVIGSNSERATKIMYELYAPYLRTGNPVITMDIKSAEMTKYAANSFLAVKISY
FT                   INEIANICEKVGANVDMVRLGMAADRRIGSQFLFPGLGYGGSCFPKDVKALLNTAKENG
FT                   CEYDILKSADSVNFNQREVFIKKIEKYYNNNIKGKTFAVWGLAFKPNTNDMREAPSITI
FT                   INTLLEKGAIIKAYDPKAIETAKIIFGDKILYASSSYNTLENTDALLLITEWNEFRRPD
FT                   FNRVRDMLKDKVIFDGRNIYDRNVLEERGLKYIRIG"
FT   gene            complement(145561..147420)
FT                   /locus_tag="Bmur_0120"
FT   CDS_pept        complement(145561..147420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0120"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; KEGG:
FT                   eel:EUBELI_00268 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70227"
FT                   /db_xref="GOA:D5U4I2"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4I2"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ADG70227.1"
FT                   /translation="MFENINLKYYNGKDSYNDGDIENDILNIVLNNDGSDDYRTILDNN
FT                   NNWFVFVNLVSERRNLLEWYNFKPNSSIIEIGAGPGAITGVLCEKLNKVTAVELSYRRA
FT                   KINSVRNSKYKNLEIMVGNLNDMEFDRKFDYAVLVGVLEYASVFTNTKNPYVDFLKNIK
FT                   KLLTDDGIIIIAIENRYGLKYFAGAHEDHTGQIFDGIEGYRNVNWVRTFGKLEITNILK
FT                   DSGFNYTSFYYPYPDYKTPRLIFSDSKLPSVDDILDYNTPNYDYDKLSFFNEKLALDGI
FT                   VKNKQYDFFANSFLIFSSAKKFDNECSFVKYNRYRDNKFQIETSINNSKKVFKKALKPE
FT                   GIKYLKDMVKYYNYVKSNFNNINIAESYMIADNVLSMEYIEGDSLKNILKICIENNDIE
FT                   KYRFYFNKYIDLLRSFNIVEIDFSNLKEFENIFSNYYSDLYGPAIEYANIDLTFSNIIV
FT                   DKNDNFYIIDYELCFNFYCPLYYIISRAVDDFIYNIFCNDENTKIIYGILSEYYPIYKD
FT                   TDRIIIKHSKTELKLIDFLGTSITSTRENQLKNITDYRQNISNLKLEIENINNRYILEI
FT                   ETIKNNINKLAWWIPVKKWRDNFRNKMLNTDQTRPDQTRPDQT"
FT   gene            complement(147579..148964)
FT                   /locus_tag="Bmur_0121"
FT   CDS_pept        complement(147579..148964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0121"
FT                   /product="Radical SAM domain protein"
FT                   /note="KEGG: hba:Hbal_2322 glycosyl transferase family 2;
FT                   PFAM: Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70228"
FT                   /db_xref="GOA:D5U4I3"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4I3"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADG70228.1"
FT                   /translation="MHNFKPNDKVKICKYIESGVRFSYEGITCCCANTFISPVIITAEE
FT                   MKSGKVTYELVVERRKELFERVNGLRDGDTGSCLKCNLLMEREYKDVNFEYLGGHGYSS
FT                   GFNIQHFTSCNLRCSYCIFTKENTFKPPIYSNLIEFIELFRSRGKLVGGNWIEFNGGEP
FT                   TLLNNFNEILDYLVENNCGTVMLFSNSLKYSESVYNALKENKICITTSLDAGTPSTYKK
FT                   MKRVDGYAKVLENMIRYKKSGTKNMFVLKYIICEENRTDDDLYGFVFAMLLIKPSHVYI
FT                   CPDFPYGDRDIPEESVEFGARMWVLLEKYGKGSTIVYIQSDDMNGDPKFAKFSDDIRKK
FT                   YQELKDSMNYQEDLYNIVKINESLSNNLELYNIINSYENKLNNISNNINKLAWWIPVKK
FT                   WRDNFRNKMLNTDQTRPDQTRPDQTRPDQTRPNYYICSDYICFYNNSEFKKTQPMLQYK
FT                   IAA"
FT   gene            complement(148989..150125)
FT                   /locus_tag="Bmur_0122"
FT   CDS_pept        complement(148989..150125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0122"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   mst:Msp_0538 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70229"
FT                   /db_xref="GOA:D5U4I4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4I4"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADG70229.1"
FT                   /translation="MSFDINKDLDIILITYNRINKLKEIVSDILDENSPIKKCQITFLD
FT                   NCSTDGTSEFLEEISQKYDNITHIRHKINIGGNANIVRAFEYVTKKYFWILCDDDRLSF
FT                   EHWHKIYDALKSDQYDIIQTYTDPKVFSGETYNEKLAKLLIEIVLLPAAIYRSKYLKND
FT                   VIFNAYINIYALIPHMALISEIINNNGKIYFCDGYDKQIVLQGRSEANYKKGIKKTVHP
FT                   FVQAMDLSIGFILSLCMIKDKELKYKCIDRMRSYLGMTFPGFIGEMPYYWIKIGLKDNI
FT                   MPIYDSCNDIQKKVFLERLMEITYEFKKYNKNILKIFNFHILNLHKIERIFFSISFIGF
FT                   SFSKNREYPKLYSLFGFIKDIYYIRFTILFVFKLTIKL"
FT   gene            complement(150169..151611)
FT                   /locus_tag="Bmur_0123"
FT   CDS_pept        complement(150169..151611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0123"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   ter:Tery_2950 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70230"
FT                   /db_xref="GOA:D5U4I5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4I5"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADG70230.1"
FT                   /translation="MYNPNSNMPLLSVILTTYNRKDMLKKAIDSVLEQDYENIELIISD
FT                   NASEDGTDIMVQEYLKNNKNIIYIRRDINIGSENGYKAYDDYANGKYIFFLCDDDYLMG
FT                   TTFFSHAVDILEKHENIIIVSGHVCMYIEGMNKYLNQPYCKENFINGIDYFINQSSTTL
FT                   GGKYQEIVSLFLLMRKKDLDNNIAFKKYKYSGDVAIKTYAESMGDIYILNEYIGCYYIN
FT                   LGTNSDSSNKDRLEKEIYDTFDFIDLLIDRYTSLYPKYKKFWNDYIPIFIFDWHIRYRL
FT                   LRSFNLYDSKNHKKNLKELKIFLKKSCIKKKNKKGYKFLMNVFFPKAQFHFLLFEFSFY
FT                   KIYFNLFSIRRFQHYFRITLFSINFTFKLKKNEYYHAPALYAYATRNINKNEKLDVYYK
FT                   LEKESNNQLSSYLNINNFWASEDILKDAPITKLNSTDQTRPDQTRPDQTRPNFYIYSDY
FT                   IYFYNNSKYKKIQPMLQYKIVA"
FT   gene            complement(151604..152641)
FT                   /locus_tag="Bmur_0124"
FT   CDS_pept        complement(151604..152641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0124"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   bfs:BF2599 putative LPS biosynthesis related
FT                   glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70231"
FT                   /db_xref="GOA:D5U4I6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4I6"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADG70231.1"
FT                   /translation="MNTFPLVSVLIPTYNRKDLLKRALESVLKQTYKNIEIYVTDNAST
FT                   DGTFDFMQEFSKSDKRIIYNRREKNIGPLYNGSEAYKHLKGKYAIILCDDDYFISNTFF
FT                   ENSVKAMEENENIVIVRGVVKCFNEKNNNIFIDIYNSKEYIKGIDYLLNYANHEGYDNI
FT                   TSFFAMFRKSAADKTEVFSKALPSGDTWLWLYLFLYGDVYFLSNEIIGCYVEHNFGQDK
FT                   YNIDTISNIDYMNELIIDLKTKAKNLYPNYANEIDIKIEKIFSNILIWHTAQLCKVIGK
FT                   KKAFKIIKSKEIIKKYPKIKSAIFGSLTFTIPFKLVLFGIEVDEKFIQLFIFGFSINIR
FT                   RKKYV"
FT   gene            complement(152638..153660)
FT                   /locus_tag="Bmur_0125"
FT   CDS_pept        complement(152638..153660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0125"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   vfi:VF_0186 dTDP-glucose 4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70232"
FT                   /db_xref="GOA:D5U4I7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4I7"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADG70232.1"
FT                   /translation="MINNIILEDVEFIFNQLKILTDLSKLDDSSILITGGTGLFGKSIL
FT                   NFLMYIRQYYSFDITVLTRNKYNFLFDNPYCNTDFIHFINGDIRNFNPGKEYDYIIHAA
FT                   APASEKLEKENPSEMYSIILDGTKNIINIANSMNVKKLLFTSSGAVYGEQYESIKSFEE
FT                   TYYGSPTTFYGKAKKISEELFLNSGINVSIARCFAFVGPYLNLNIHFAIGNFIRDVIQN
FT                   KNIIIMGDGRPLRSYLYTADLVIWLFVMLLNSNNKSIYNVGSSYEISIYDLAKKVSNSI
FT                   NNYDGNIEVLTKPNYNYPTPKYVPNNSKIIEELKVKENYTLDDAIKRTIKWNLSVGVIK
FT                   "
FT   gene            complement(153710..154957)
FT                   /locus_tag="Bmur_0126"
FT   CDS_pept        complement(153710..154957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0126"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; KEGG: sun:SUN_2139
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70233"
FT                   /db_xref="GOA:D5U4I8"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4I8"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ADG70233.1"
FT                   /translation="MVLQRICPICDCEEGENLYEINFAKAKEEFIPEHYDIVACNNCGF
FT                   IFNNTVWTQKDYDKYYSNTTKYSSSFTSGAGGLSNLDKIRYNGVIDRIEKFINKDSSII
FT                   DIGCAKGGLLRAFQDRGYTNLYGIESSKEAIENLKQYNIGGEASSIFDLKNIDKKFDVV
FT                   ILSQVLEHIYDLKNVKYILENILNDNGILYIDIPDATSYIKNKLAAYYYFDLEHINHFS
FT                   LITLEYLFDNFKLVEKDSFYFDNVSNIKSYIIYGVFQKGIKLFINKLKDFEAIKKMKEY
FT                   INYSCEIDKYTINNIDNTKSTYCWGFGAFLRRILLDKKYFSNCNIDGIIDKNESFSGKK
FT                   IIDYKGNKIEVFTPNILQNTDNVIITSILYSEIIKQDLLNDVKFNGRIHELRAEQSRAE
FT                   QSRAELIFSYYCEEAA"
FT   gene            complement(154968..156749)
FT                   /locus_tag="Bmur_0127"
FT   CDS_pept        complement(154968..156749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0127"
FT                   /product="thiamine pyrophosphate protein TPP binding domain
FT                   protein"
FT                   /note="PFAM: thiamine pyrophosphate protein TPP binding
FT                   domain protein; thiamine pyrophosphate protein central
FT                   region; thiamine pyrophosphate protein domain protein TPP-
FT                   binding; KEGG: sun:SUN_2140 acetolactate synthase, large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70234"
FT                   /db_xref="GOA:D5U4I9"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4I9"
FT                   /inference="protein motif:PFAM:PF02776"
FT                   /protein_id="ADG70234.1"
FT                   /translation="MKVSDFIFKFLNEEYNVKDVFMVSGGGAMHLNDSVGNNKNINVIC
FT                   CHHEQACAIAADGYSRINGNLSVVNVTTGPGGTNTLTGVIGEYLDSVPVLYISGQVKFE
FT                   TTIASCRELNLRQLGDQEINIIDIVKPVTKYAVMVKDPLSIKYEIQKAVHIAKSGRKGP
FT                   VWLDVPLDVQASDIDENNLEEYKLKDINIPIIKEQIDEVINILQNAKSPVIIAGHGIRL
FT                   SNSIKEFYKLIDKLDIPVLSTFNGFDIIPTDNKNYVGRIGTIGNRYGNIILQNSDVVLS
FT                   LASRNNIRQIGYNYENFAKNAKHIIGVDIDNAELNKPTINYTLKINNDVNLFINTLNDS
FT                   LENIEVNKHTKWREWALNIKNKYSNLLDEYTVSNDVNPYYFTYKLTNKLSNDDIVTCTN
FT                   ATPSLALFQVGIVKENNRMFCNSGCAAMGFGLPASIGAAVSSKDKNVICLEGDGSLMMN
FT                   LQELQTISHYNLNIKLFLYNNNEYASIRQTQDNFFKTRTGCDFNSGVSFPNWEFIAKAF
FT                   NLKYFCIDKKENINNILDEILNINGPVFCDVILEKDYLFLPKISSEKLPNGKMVSRSLE
FT                   DMTPLLSKEELSENIYI"
FT   gene            complement(156758..157582)
FT                   /locus_tag="Bmur_0128"
FT   CDS_pept        complement(156758..157582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0128"
FT                   /product="pyruvate carboxyltransferase"
FT                   /note="PFAM: pyruvate carboxyltransferase; KEGG:
FT                   sun:SUN_2142 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70235"
FT                   /db_xref="GOA:D5U4J0"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4J0"
FT                   /inference="protein motif:PFAM:PF00682"
FT                   /protein_id="ADG70235.1"
FT                   /translation="MIGNITVFDCTFREAGYQTGWFFDEDFCRDYYKFAQSAGIDYLEL
FT                   GFFHNKEADPNRGHFRYCSLDNEEIKNIFSITKNTVKLSAMRDIQRPLSELLPRKETVI
FT                   DAVRILTRSSETDFSVLEKHVKEIKDLDYEVFINFTSSGHNTIDKNREFAKFAKQHDIP
FT                   VIYFADTESIFTTEYVRNTLEACREEGIEAGMHFHDKNGTAEMLLEVALHYGCKYTDIT
FT                   MMGLGGKWHDGNLSTEHFLRKYNYNPGYEQTRLKTMLIQNLIKYNKSTAAVL"
FT   gene            complement(157582..158889)
FT                   /locus_tag="Bmur_0129"
FT   CDS_pept        complement(157582..158889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0129"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /note="PFAM: DegT/DnrJ/EryC1/StrS aminotransferase; KEGG:
FT                   ypy:YPK_3189 DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70236"
FT                   /db_xref="GOA:D5U4J1"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4J1"
FT                   /inference="protein motif:PFAM:PF01041"
FT                   /protein_id="ADG70236.1"
FT                   /translation="MDRNKLLEMVREYARKEYAPKEFVKGLSSVPVSGRVFDEDDVAAL
FT                   VDSALDFHLTTYRYNDEFEKGLKEFFGLKYALTCNSGSSANLIAVTSLTSHLLKDRALK
FT                   AVDEVITVAAGFPTTVNPILQNNLVPVFVDVELKTYNVNVEELEKAKSDKTKAVILAHT
FT                   LGNPFNIQKVREFCDKYNLWLIEDCCDALGSTYNNKKVGTFGDIATLSFYPAHHITMGE
FT                   GGAVLTDNPILKKAMESIRDWGRDCWCSPGCDDTCRQRFSQKIGDLPEGYDHKYTYSHL
FT                   GYNLKITDMQAACGVAQLRKINEFIEKRKENFKKIKNKLEKFSKYLILPKEQENSDPSW
FT                   FGFLISVKEEAPFTRNDIVKYLNDNKIGTRLLFAGNIIKQPYMIGRNYRIVGELTNSDF
FT                   IMNNTFWIGVYPGIDDSMIDYVELIIGEFISNLGGK"
FT   gene            complement(158903..159964)
FT                   /locus_tag="Bmur_0130"
FT   CDS_pept        complement(158903..159964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0130"
FT                   /product="CDP-glucose 4,6-dehydratase"
FT                   /note="KEGG: mae:Maeo_0387 CDP-glucose 4,6-dehydratase;
FT                   TIGRFAM: CDP-glucose 4,6-dehydratase; PFAM: NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70237"
FT                   /db_xref="InterPro:IPR013445"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4J2"
FT                   /inference="protein motif:TFAM:TIGR02622"
FT                   /protein_id="ADG70237.1"
FT                   /translation="METLEIKTIFEIFKNKNILITGHTGFKGAWLSKLLLEVGSNLSGI
FT                   SLKANDLSLYNLLSLDKQLNSHILDIRDVDNIKKTVLDINPDIIFHLAAQPLVIDSYNR
FT                   PLYTFETNVIGTINLMEAMRQLNNLECAVMITTDKVYDNKEWVWGYRENDSLGGHDPYS
FT                   SSKACTEIAIKSYKKSFFKDLNIVSVRAGNVIGGGDFADNRIIPDIVRAIEKNIPVELR
FT                   NPNSVRPWQHVLDVLYGYLLLAYNIINKNDVSDSYNFAPIDEGNKFTVEYITKCFIDNI
FT                   GKGSYKVNIQDTNKKEMNMLRLDSSLARKELKWNERFNTEEAIKQTAIWYKEYLNNNDL
FT                   NIITDKQIKEYIN"
FT   gene            complement(159946..160740)
FT                   /locus_tag="Bmur_0131"
FT   CDS_pept        complement(159946..160740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0131"
FT                   /product="glucose-1-phosphate cytidylyltransferase"
FT                   /note="KEGG: bhy:BHWA1_02683 glucose-1-phosphate
FT                   cytidylyltransferase; TIGRFAM: glucose-1-phosphate
FT                   cytidylyltransferase; PFAM: Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70238"
FT                   /db_xref="GOA:D5U4J3"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR013446"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4J3"
FT                   /inference="protein motif:TFAM:TIGR02623"
FT                   /protein_id="ADG70238.1"
FT                   /translation="MKAVILAGGFGTRLGEETSIRPKPLIEIGGRPIIWHIMKYYSYFG
FT                   INDFVILLGYKGYMIKEFFDNYRRHLYDMKIDFRNDNSVILKKDINSNVEEENWIIELA
FT                   DTGENTMTGGRLKKAYQYLKDEPTFCFTYGDGVSNINIKDEVEFHNKHKKIATVGAVYP
FT                   PARFGALKIENDNSVSNFIEKPRGDNAYISGGFFVLNNDIFNYLRDDSTVFEQEPLRKL
FT                   SSDNELMAFRHEGFWQCMDTQRDKSILEEMWNKGNAPWKLWK"
FT   gene            160962..162173
FT                   /locus_tag="Bmur_0132"
FT   CDS_pept        160962..162173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0132"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   tde:TDE1433 glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70239"
FT                   /db_xref="GOA:D5U4J4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4J4"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADG70239.1"
FT                   /translation="MIKINCFFSIIIPVYNTERYLKRCINSIINQKFTKFEIIIVDDCS
FT                   NGDCKEIINSYYDNRIIYIRHEQNKGTLSARKTGSIQAKGDYITYIDPDDELNLNALEK
FT                   IFNTVKDNDYDVIQFSVKSVSSNPNKKEKLKEEKRVSWYLSTKRNNIDNNYLLNEVLNE
FT                   KISHNIWAKFFKSSIVKKAIIYIPDSHITFAEDMLQCLIFFYFAKTYKAIYDELYIYYC
FT                   DISYSNKTTDYLTEEKFNKMCMDSRNSLDEFYNFLIKMNDDILYKYDYMKLAYNQYKFL
FT                   LYKINNNDKEYISILNKYFDKYFLEEYNKYKYHHNYYLKTEEKLKVINNKLMPYFFSII
FT                   LDGFYTNIRIFGLNINIKNNKNYTTPIVITFSNILRILFSIQFSKQNTKINLLGFNFII
FT                   EKRG"
FT   gene            162181..163926
FT                   /locus_tag="Bmur_0133"
FT   CDS_pept        162181..163926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0133"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   rco:RC0461 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70240"
FT                   /db_xref="GOA:D5U4J5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4J5"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADG70240.1"
FT                   /translation="MKSNPLISIIIPVYNGENYIKDAINSALNQTYRNIEVIVVDDGSK
FT                   DDTANIVKSFRDKITYIYKNNGGVASALNYAIKEAKGDYISWLSHDDIYYPNKIEEEVN
FT                   ELENIDDKTVIYSGFEFVNEKLELITVFENSYKTEYRRLNNNFYSILLSDIGGCTLLIP
FT                   KEVFSNVGFFNENLLCVQDYDFWFRMFKHGYKVKYIPKVLLQYRIHKKQDSNSKKDLLR
FT                   NEGNKLWINMLKNINDDEYQSIFFNRYNVLNKIKNRMQNSIYDKLIDFINTELKTYKED
FT                   NKQYYSNNNKISIIINIYNRDCNNINLIINSIIEQNYNNIEIIFITNNKLNIDFNIEYK
FT                   IFNPEKDNNILDIIDGNFIQFINNNEILIKDKLHSQFNEFIEAPSIDISYSNYYFDKDN
FT                   NKIYPKLDSLSFNEDKQFEDMIYFWNNPIYIPLCSMLIKRKVFEKINMTYNNDYNTIMQ
FT                   LSFYGKMKFINKYFFYYTDDFQNTNYYIKVQNEINNNKYIIDRFKDYILLDNFYLYRSN
FT                   FLKEYSLKNLDKKSAFHLLKIEFNVSYLYIYIFNIRITLKRSKNFFYRIFLFLYALLNK
FT                   NRKNK"
FT   gene            163923..165044
FT                   /locus_tag="Bmur_0134"
FT   CDS_pept        163923..165044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0134"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine 2-epimerase; KEGG:
FT                   pmo:Pmob_1284 UDP-N-acetylglucosamine 2- epimerase; PFAM:
FT                   UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70241"
FT                   /db_xref="GOA:D5U4J6"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4J6"
FT                   /inference="protein motif:TFAM:TIGR00236"
FT                   /protein_id="ADG70241.1"
FT                   /translation="MKVMTILGTRPEIIKLTQVIKELDKYTDHILVHTGQNFDYELNEV
FT                   FFNDLELRKPDYFLNVADSTLSKTIGNIIANSDEVMEKEKPDALLLYGDTNSCLSIIPA
FT                   KRRKIPVFHMEAGNRCFDERVPEEINRKIVDHLADINLVITEQARHYLQREGIASERII
FT                   KIGSSMKEIFEIYKDKINNSNILDKLSLEKNKYFVVSSHREEVVDIESNLRSLIESLNA
FT                   LSEKYDYKIIFSTHPRTRRLLDKLENIKVHSNIIFSKPFGFFDYIALQKNSFCTLSDSG
FT                   TITEESSLLKFPAITIRNAHERPEGNDEGTLIMCGYKKDRVLKAVEVVIEQYKNNIIPK
FT                   TVEDYDVDSLSMKVIRIILGYTEYINENIWRKY"
FT   gene            165046..166155
FT                   /locus_tag="Bmur_0135"
FT   CDS_pept        165046..166155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0135"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   ret:RHE_CH01520 putative beta-D-1,6 glucosyltransferase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70242"
FT                   /db_xref="GOA:D5U4J7"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4J7"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADG70242.1"
FT                   /translation="MKLFDLFKKNKLSDLESEELKKYPEKISIVNFNKKWEGKEVWHCD
FT                   IFTKWILFSYNTITFCCEGRPIKSLKPYNEERLNLSKYMQKLDEVLEDMQKDNNPCTGC
FT                   RNLVKKIFPKYKLSEQIELFTIAHYTKCHINCAYCFIEHKNTDMQYNAEEAIQYFRDTN
FT                   MVIPHAHVAWGRGEPTVSKYFENNIKNISNFGYNQFINTTGIIFSENIMNGLENGNIEV
FT                   RISVDSGTPETFKKIKGVDKFDIVWNNIKKYCKFPDRVQAKYILFEWNANENDIIGFVK
FT                   KCKWAGVRNVILAPEMNAEHSFPKPPSKWNMNDKKVTDMAALLEYLCIKNNIILNQTDG
FT                   LVFTKEHNIDIKKEFDILSYNNIGENYEF"
FT   gene            166145..168385
FT                   /locus_tag="Bmur_0136"
FT   CDS_pept        166145..168385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0136"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; glycosyl
FT                   transferase group 1; KEGG: rpr:RP336 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70243"
FT                   /db_xref="GOA:D5U4J8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4J8"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADG70243.1"
FT                   /translation="MNFNPLVSIIIPVYNGSNYVKEAIDSALAQTYNNIEIIVVNDGST
FT                   DNTEEIVKSYGDKVRYFYKENGGTSTALNLAIKNMKGDYFSWLSHDDMYYPDKIKIEVE
FT                   ELSKLDNKETVIMADVEGINEKYETVYKTNYIDHINAYPPRAQSMLHPIIYNQTHGCTL
FT                   LIAKTCFDKVGLFDEKVLIAQDFEFFYRLFKKFPHKLVSQILIKARHVSTSQGMRAGEK
FT                   RNIEYSKLFISIMENFTEDDFKLLAKTKLDFYREVAEFYNTVGYTIALDYVHKKMMKNI
FT                   QINVTDLIGNKFNGYDLHLYLRDRNIDSDYLTSIKDSDDIHTHKYFDIMNIPNTENFIK
FT                   SEFFLYSELIHMHIIHNALNNIIDLNYLPIMSKLKPIIWSIHDPWVLGGHCVYHFDCEK
FT                   WKDHCYDCNYLDKPFIIENDDTAFKFEMKKQAIKDSNIVAIVASKCMEDKLKESPIWKD
FT                   KKIYRIPYGINQDIFKPRDINEAKRELEIPENSITLMFRADAGPLKGADIIKKALKNIK
FT                   TNSQISLIILGFEIDKFKDLESSYNIKFYNWIKDDNFIAKLYQACDIFLMPSRQEAFGA
FT                   MAIEAMSCGKMVLSIEGTSLPEVINSPECGLACKEEEYTNKLQYFIDNLNEVKERGKKS
FT                   LDFAIKNYNKDLYTDRTIEVYKKTISEHKIDNEYGLIIKQLKQNYIEKVKEKLMKDYID
FT                   NVNNNDTNNNYYINNSLINNNNNIFGIYIINNEKYFIINILGIKITIKKKAK"
FT   gene            168382..169212
FT                   /locus_tag="Bmur_0137"
FT   CDS_pept        168382..169212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0137"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   rms:RMA_0473 dTDP-4-dehydrorhamnose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70244"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4J9"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADG70244.1"
FT                   /translation="MKKILILGGTGMLGNTVVRHFINNKNYDVHFTYRNEKVAFDNFDK
FT                   NKGIKFDSLTDNINNLNKDFNYVINCIGIIKPFMFNNMRDSIFINSIFPWNAANWCKEK
FT                   NIKFIHITTDCVFDGLKGKYNELDEHNALDEYGKSKSLGEPRGKCMILRTSIIGEEIHK
FT                   NASLICWAKSQKGKSVNGFLNHFWNGITTKQYATICEQIIENNLYEEDLFHIHSKDIVS
FT                   KYQMLEYFNEKYDLNLKIKPYITNPICDRSLSSIKELCCKLDIPTVKEQINNLE"
FT   gene            169218..170228
FT                   /locus_tag="Bmur_0138"
FT   CDS_pept        169218..170228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0138"
FT                   /product="polysaccharide biosynthesis protein CapD"
FT                   /note="PFAM: polysaccharide biosynthesis protein CapD;
FT                   Polysaccharide biosynthesis domain protein; KEGG:
FT                   geo:Geob_1458 polysaccharide biosynthesis protein CapD"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70245"
FT                   /db_xref="GOA:D5U4K0"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR013692"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4K0"
FT                   /inference="protein motif:PFAM:PF02719"
FT                   /protein_id="ADG70245.1"
FT                   /translation="MFKDKILLITGGTGSFGNKMLRYFINNTDIKEVRVFSRDEEKQDR
FT                   MRTELKDDRIKYYIGNVRDYKSINEALRNVDFVFHAAALKQVPSCEFYPIQAVHTNIIG
FT                   SSNVIDACIENKVKKLVMLSTDKAVYPINAMGMTKAIMEKLMISKSRNLPNDGNTTLCA
FT                   TRYGNVMASRGSVIPLFIKQCKENKPITVTDPNMTRFLMSLDESVDLVLFAFNNAVNGD
FT                   IFVQKASACTIMDLALAIKEIFNPNVEIKIIGTRHGEKTYETLINKEDMIKAVDMGNFY
FT                   KIPADNRDLNYDKYFIDGNTEISSKEEYNSDNTTRLNKEQVKEKLLALDYVQSEL"
FT   gene            170282..171568
FT                   /locus_tag="Bmur_0139"
FT   CDS_pept        170282..171568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0139"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cyc:PCC7424_4582 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70246"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4K1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG70246.1"
FT                   /translation="MFELKVKDKEENGFIYKIMTLDLGNKIEEIYIKLPVSEKEYLTKS
FT                   YDPYVFFYIFKMMSIGGDCKIKGNVNKSFLDNLEMFIECWKIWLPDKCKNIKIIAYDEI
FT                   DDEPKKLNNDAVMCFSGGLDSISTLYRHYKGLAGRNNKNIKKLLKIGGARTPTVIMANT
FT                   DLDYNKINEEISKRIINIANDIKYEVIDIDTNLYTVSSIFDWGDEFIALFISVMMLYQD
FT                   TYNNLIIASDEFIAQDSIMVPHGSNPISNKFIKSNCFNLITDGEFLTRIDKMNVIKDWK
FT                   YALNKLDACDSYRSKEYKLCGRCKKCMITKLNYKIINANVNFYDIYDDPSFNLDAYSSL
FT                   GEYFNIFYKEILYYDKLHGNVPKYIINNLNNILSPQKISKSDEFIKKLAWWIPIKKLRD
FT                   KFRNYYLEQNRTEQNRTEQNRTEQNRTEQ"
FT   gene            171686..174289
FT                   /locus_tag="Bmur_0140"
FT   CDS_pept        171686..174289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0140"
FT                   /product="coenzyme F420 hydrogenase/dehydrogenase beta
FT                   subunit domain protein"
FT                   /note="PFAM: coenzyme F420 hydrogenase/dehydrogenase beta
FT                   subunit domain protein; 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein; KEGG: ere:EUBREC_2763 MurB family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70247"
FT                   /db_xref="InterPro:IPR007345"
FT                   /db_xref="InterPro:IPR007516"
FT                   /db_xref="InterPro:IPR007525"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4K2"
FT                   /inference="protein motif:PFAM:PF04432"
FT                   /protein_id="ADG70247.1"
FT                   /translation="MKNNNIDILAKSECTGCSVCYHICPHNAINMIENEKGFYNPVINK
FT                   DKCTNCGICVKQCHALNDNFKTEYEQEIYDVRANDDIRMKSSSGGIFTLISNYILENNG
FT                   YVCGASFTDDWIGVEHIIINDKKDLDKLRGSKYIESNLNNTFLEIKKLLNEKKQVLFTG
FT                   CPCQVSALNFYLNKKYDNLITIDILCNSVPAQKVWKKYLKELFSNEDIRNIEYISFRDK
FT                   SKFGWNIDHKIYIKLKNGEYLVKGLESIYLKSFFNHISIKDQCITCKYRNYKRVGDITI
FT                   GDYWSVENNDNKGVSLVLINTEKGKSTFNNIKKDCMYKDITEYKKKYEQLNWALYGKIK
FT                   KSENRKYFFHNIDNKSLNDIYDKYDVGLIGLWFASNYGAVLTYYALYKLLKKFNLSILV
FT                   IDPMENNCNVDWCINGFAREFASKYYNDIELLDEKINNKCSTFITASDQLWNIYTMEKQ
FT                   GIVTNLEKYRYFLDFVDNDKKKIAIATSYGDDNDNLIDNENTKKRLLINHYLSQFDYLS
FT                   VREKECANFINENLNLKAEFILDPVFLIDKTEYIKLIENTENKILEKDYILAYYYKVEH
FT                   IEATNNIANKLDKKIIYTTFKESPEEWLSLVNNASFIITDGFHGICFSVIFNKPFVCIR
FT                   DDYYSSQLYRIKTILELLNISERLISDIKILQSNIYNFLYLDFSEINEKLNLEIERSLK
FT                   WIKNALDSEKILKKTSYKNDLLNFLISENKKLIHITNNIYSSIDKVSNNIYSDVDKISN
FT                   SIYSDINKILEKTQSNINWIRLFGIYNDKKYIYLYFFGIKITINIVNKLDKIAWWIPIK
FT                   KWRNNFRNKFIIRPDQTRPDQTRPDLELICIYYIYSYNNIENEKLQPMVQYKIAA"
FT   gene            174636..175748
FT                   /locus_tag="Bmur_0141"
FT   CDS_pept        174636..175748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0141"
FT                   /product="putative dynein heavy chain"
FT                   /note="KEGG: bhy:BHWA1_00462 putative dynein heavy chain"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70248"
FT                   /db_xref="InterPro:IPR021729"
FT                   /db_xref="InterPro:IPR025303"
FT                   /db_xref="InterPro:IPR037126"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4K3"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00462"
FT                   /protein_id="ADG70248.1"
FT                   /translation="MKTNFKVIILSLLLVVSCSNSNNNKKSNNIQANIDIPLTENEKLY
FT                   NYEVVYFMSDSGEYVSSALTYNTNNLGTIVYTDSNQNSVTFNVERIGELDEGSISAVSY
FT                   DDKTLDGNIPNILYPFDAKIDGKEIIFNSVKSSVTGARIIEYTYTNISPNRDNIFEYKN
FT                   SIFVLNNENNSETINKINMDINKEFSITDAASFNDLESLLKKENIISNKMNTYYDEWVN
FT                   SDYIANTSEDLSQYCINYLSEKFISINRFIYEYTGGAHGTYATVYSVYSLENGNKLKIE
FT                   DLITDLKNTDLLNLIKDKLLKIDGRDKRSYFDLNELSLENNNFYITQNGLVFTWGIYEI
FT                   GPYSIGETRVLIPTEEIKPYLKDEYKTIFE"
FT   sig_peptide     174636..174701
FT                   /locus_tag="Bmur_0141"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.894) with cleavage site probability 0.492 at
FT                   residue 22"
FT   gene            complement(175794..177560)
FT                   /locus_tag="Bmur_0142"
FT   CDS_pept        complement(175794..177560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0142"
FT                   /product="protein of unknown function DUF262"
FT                   /note="PFAM: protein of unknown function DUF262; KEGG:
FT                   ppg:PputGB1_3189 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70249"
FT                   /db_xref="GOA:D5U4K4"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4K4"
FT                   /inference="protein motif:PFAM:PF03235"
FT                   /protein_id="ADG70249.1"
FT                   /translation="MLLEETFKTVKKLLENKKTIKIPNYQRSYSWDEEQIRQFLYDIEE
FT                   YAEKESHYYVGHFLFEERNGNFYIIDGQQRLTTIVLLIFSIYNMLDDNEDLKNIYNFIS
FT                   KKFSTVSYDNNFFKGIIKGEIKLNKKSKSFETLSQKRIYNACKIFNNALKKQDKNYISN
FT                   IFNIIMKASCTEHIINKQEEAVQMFIYENNRGKRPTNLDILKSLFMHTIYLNSDKVEKD
FT                   IKKITNQFKEIFTNIAKIEDILSEDNFLEVTIKTFFNDLKYRGIDDISKYLEENNNDNI
FT                   PNKIISLRDDENTQKYNIGNKIDFINDFVEELVNNGKYLSNFKDDSKFFYIHSIISLGI
FT                   SVDIYPFIVFLYKENIDKESKKNFIEILENLLIRNRVITTRKRLSIELNKRYWSLLDDS
FT                   YNFIEDINKQFETADFTWSNNELIKFLDAEIYHHPTAKFLLWKYENYLLKKDNIRYDDK
FT                   RMKKITLEHILPIEKPNIENHYYGYYDGRKHFKSVYEYETNELYMLQRCLGNYLLLKEG
FT                   INKAASNSDFKTKLEYYNNQNDNIKLEQQKEIIDNYFNKKTNELKSNWDKNAIEKRRDK
FT                   IIKAIKKIYKIK"
FT   gene            complement(177606..183434)
FT                   /locus_tag="Bmur_0143"
FT   CDS_pept        complement(177606..183434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0143"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC
FT                   transporter related; KEGG: bhy:BHWA1_00461 exinuclease ABC
FT                   subunit A; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70250"
FT                   /db_xref="GOA:D5U4K5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4K5"
FT                   /inference="protein motif:TFAM:TIGR00630"
FT                   /protein_id="ADG70250.1"
FT                   /translation="MANNSIEIRGAKEHNLKNISLSIPHKTLTTLTGVSGSGKSSLAFD
FT                   TIFKEGQRRYLESLSAYARQFLGVMAKADVEHIEGLSPTISIDQKSVNKNPRSTVGTVT
FT                   EIYDFFRLLFARLGVPYCSKCGHKISKQSEDQIAHSVLREFSEKRILVLAPIVRDRKGE
FT                   YRKEIEEVKLAGYPRIRIDNIVYKFDEDEIPELKRYEKHTLEIVIDRIKVEDKYLSRIT
FT                   DDIERAIRITKGLVAFYEEHEKSNEALEFNNYIENIESNEADTKTKKKKIKMSKQFEID
FT                   KYYKLYTTERSCANCGHSIADIEPNLFSFNNPMGACTVCGGLGVEHVFTEKHIVRDENL
FT                   NIYEGALSCFVDDHIGFDMEYGIDELEVIAKTYKIDLKKPWKDLTKTEKKYLLYGTDKE
FT                   VKWKKRFWYHSKLVEERVPGILDRLKYDYETYKNSYYANFMDEVECPKCKGKRINEDAL
FT                   SVKFNGKTIADFSSMTIEDLYDYFTKLKLKPNEEIIGAPIVKEIIYRLTFLVKVGLTYL
FT                   TVERSSPTLSGGESQRIRLASQIGSGLEGVLYVLDEPSIGLHQSDNKKLIESLKTLRDK
FT                   NNTVIVVEHDKETMEESDFLIDIGPNAGVNGGEVVGIGDYEEFLKSDGSYTAKYLRGDD
FT                   DIEIPKTRRDGNGKFLKVIGANQFNLKNIDVEFPLGLFIVVTGLSGSGKSTLVENILMR
FT                   ALHNHFYGKTLTAGSHEKMEGLENIDKVIEVDQSPIGRTPRSNPATYTKVLSPIRDLFA
FT                   ATKLAKMRGYDKGRFSFNVKTGRCPTCEGAGVIELEMQFLSNVLVPCEECGGKRFNAET
FT                   LDVKYKDKTIYDVLEMSVSEAIKFFDGITSITRILKIMEDIGLGYIKLGQPSTTLSGGE
FT                   AQRIKLASELHKISTGNTLYILDEPTTGLHFEDIKKLLKALDGLVEKGNTVLVVEHNLD
FT                   VIKCADYIIDMGPLSGDKGGRVVAKGKPEDIIKVKESLTAKELKEILKPSKKKKEIIKT
FT                   EEAKKEENTSLIIKGANKHNLKNISLTLPKNKINVITGVSGSGKTSLAFDTIFKEGQRR
FT                   FVESLSTYARRFLGRFEDANVEKIEGLAPAIAIDQKNVSRNPRSTVATVTEIYDYFRLI
FT                   FARVSKPHCPHCSDKDTLKAETPSILATEIIDTMDLHKLIIISPLYHSSFNHRFTFDDN
FT                   DAKDIKKIIEKTREAGYVRMQINNNDYVIDDITEEEIKSLSIGEIYSVGIVIDRIVVGK
FT                   DKRARIADAIERAMDLSNGVVHIKASHGIIIKESFHTKFPACLLHGILFDFEVTPRHFS
FT                   FNSHWGYCEECKGLGSKPTFSIDLAIKDSTKPLFDGALDTALHNMFSTHGKHYTDSLFR
FT                   LLKRNGITKKDLYQTPFNELDKKVIDTVFFGGDYAIGNVITAWHSNNDVTSEDYSEWKD
FT                   KSLGKFFVDEECSSCHGERLNEVMRAYTIQDKNISQVCAMTVEGAINFFDELPKLLTDR
FT                   ENTISKEAVKEINTRLSFLDKVGLNYLSLGRKYATLSGGEAQRIRLASQLGSKLTGVLY
FT                   VLDEPTVGLHPRDTSHLLDTLKELRDLKNTLVIVEHDRDTMKSADNIIDMGPFAGAFGG
FT                   EVVFEGKYDDILNSNNSLTGDYLSERKKVFEKATVRNEDTECIKLKNVSTNNLKNISVD
FT                   IPLKKIVVVTGVSGSGKSSLIIDTLYPALKKRRLNQYSKFESAEIPSIVSDTILVDQIS
FT                   IVGSIRSTLVSYSKVFDKIRNIFAKTPAAKAKAFAPGRFSYNGKEGRCNICEGKGIRKI
FT                   AMHFLSDMEIVCEACGGKRYNDETLSVRFKSLNIAEVLELTVDEAIEFFDFDKSITKTL
FT                   SIMSEVGLGYIKLSQRLDTFSGGELQRLKLATELAKKQGDEHIVYILDEPTTGLHFDDV
FT                   NKLLIALNKLVEKGHSIIIIEHNPDVIKAADYIIDLGLEGGTNGGEIIAKGTVEDILQM
FT                   KKGYTWKYI"
FT   gene            complement(183864..184403)
FT                   /locus_tag="Bmur_0144"
FT   CDS_pept        complement(183864..184403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0144"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   Transcriptional regulator PadR-like; KEGG:
FT                   cdl:CDR20291_2964 transcriptional regulator, PadR-like
FT                   family; transcriptional regulator, PadR-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70251"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR018309"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4K6"
FT                   /inference="protein motif:PFAM:PF03551"
FT                   /protein_id="ADG70251.1"
FT                   /translation="MGVLKYAILGLLNQKNMTGYDITKEFEETLCEFWSAKHSQIYPEL
FT                   KSLNEKGMVEYKIEISGTVLEKKLYSITELGRNDFMKWLESKIDIPPTFKDEFRLQLFF
FT                   SDCLSEKTREELIINHLNQHEKRLEYLKDSQRKFNGIIPEKNTNAFSDYLVLMGAIMRE
FT                   ENTCKWLEKCLELCKK"
FT   gene            185031..185342
FT                   /locus_tag="Bmur_0145"
FT   CDS_pept        185031..185342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0145"
FT                   /product="Phosphotransferase system, phosphocarrier protein
FT                   HPr"
FT                   /note="KEGG: bhy:BHWA1_00458 phosphocarrier protein HPr;
FT                   TIGRFAM: phosphocarrier, HPr family; PFAM: phosphoryl
FT                   transfer system HPr"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70252"
FT                   /db_xref="GOA:D5U4K7"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4K7"
FT                   /inference="protein motif:TFAM:TIGR01003"
FT                   /protein_id="ADG70252.1"
FT                   /translation="MTLTNVVTIKSKNGMHLRPAGVLSQISSKSAYSNIGIFLLYNGVR
FT                   ADAKSVFNIMGLGAFQGANLILEIEYEDGMENAAKEAEKELLDFFEEGYIYAEVPEED"
FT   gene            185396..186778
FT                   /locus_tag="Bmur_0146"
FT   CDS_pept        185396..186778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0146"
FT                   /product="Gluconate transporter"
FT                   /note="PFAM: Gluconate transporter; KEGG: bhy:BHWA1_00457
FT                   gluconate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70253"
FT                   /db_xref="GOA:D5U4K8"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4K8"
FT                   /inference="protein motif:PFAM:PF02447"
FT                   /protein_id="ADG70253.1"
FT                   /translation="MISYFVIAMLSISIIVVMILTIKFKVHPFIAMLLVAIFLAFTLHI
FT                   PTNKDNNYITEISALIGKGFGNALASVGIIIVLGSIIGNILEMSGAALKLGEIVIKIVG
FT                   KSHPALAMNILGFIVSIPVFCDSGYLILTPLRKAVAKKTGASPVALSVALSTGLYASHA
FT                   LIPPTPGPAAVVNLFGLEAHLLTIILIGLIVAIPTSLVGAIYGIFISKYIQKPNYPDKS
FT                   PTYETLISDIGGLPPAWKALAPIAVPILLMAIGSIVRFDSFKMSDSIIKNIFIFLGEPS
FT                   MALFIGFLFSLLLTHKFNTEEISMWIGDGIKASGSILAIVGASGAFAEVLKSTELAKII
FT                   PELGHIFASLNMGIILPFIMASALKIMLGSSTIAVVTVATLFAPLLNTLGFNTPISQIL
FT                   VLMAIGAGSMIASHANDSYFWIVVELSGLKVKDAYKARTLATFVQGITALIIILILSFL
FT                   FR"
FT   gene            186853..187287
FT                   /locus_tag="Bmur_0147"
FT   CDS_pept        186853..187287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0147"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase
FT                   Dut"
FT                   /EC_number="3.6.1.23"
FT                   /note="TIGRFAM: deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase Dut; KEGG: bhy:BHWA1_00456 deoxyuridine
FT                   5'-triphosphate nucleotidohydrolase; PFAM: deoxyUTP
FT                   pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70254"
FT                   /db_xref="GOA:D5U4K9"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4K9"
FT                   /inference="protein motif:TFAM:TIGR00576"
FT                   /protein_id="ADG70254.1"
FT                   /translation="MLKIKIINKSSNPLPKYQTEGSSGLDLHANLEKPITLNKNDIVLV
FT                   PTGLFIEIPDGYEAQIRSRSSLALKNGIFCLNSPATIDSDYRGELKIILASLTDTPFTI
FT                   NHGDRIAQMVFAKVEKIDFEEVDSISDTKRGEGGFGSTNK"
FT   gene            187326..188141
FT                   /locus_tag="Bmur_0148"
FT   CDS_pept        187326..188141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0148"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00455 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70255"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4L0"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00455"
FT                   /protein_id="ADG70255.1"
FT                   /translation="MSILKKLFISTIMLLTISCGLPDVTGITLELNQPYITKIIPGQNK
FT                   LVVEFEAQNNEPSFSGYNIYFGDSTNPRKYRLYNQQKALPTMSELRSETVKKYSFTIEI
FT                   ESYYSTNSSTIDTLRETDLANGIPIYVWISSYQITPQLESYYYYDNFVKMGTPRPEALN
FT                   QTINADQNIYMEGRDLATLINSNGKLYFRNAANGSMMVMAGSSLDDIVVPPENGYGSID
FT                   LEVKANRLYLVKITDGNNSYYGKIFVRSISGTSVVADYCRQTAANILSY"
FT   gene            188145..188891
FT                   /locus_tag="Bmur_0149"
FT   CDS_pept        188145..188891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0149"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00454 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70256"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4L1"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00454"
FT                   /protein_id="ADG70256.1"
FT                   /translation="MKKILIFIIPVIFLLSSCNEELITIVDEYNSPYDIKAIASNNAVY
FT                   IDFWSGIIASDFAGFNIYASTSDTFTQPDSAIKNASQTYPTISGSNHTRTNFVIQIPTM
FT                   TFNNGTLYYVTVTAYGTNNLVDKKYIETPISTVCPVIPREEGTGTGTTLAANGQTFGNI
FT                   DIPGGKVTVNTGWGVQYFGYQTNFNSIVIITNNTDASFDTEAVYSLNGLYVFKQTGGNG
FT                   LAKIWITSANGYRWAYQADASKWWGI"
FT   gene            complement(189193..212172)
FT                   /locus_tag="Bmur_0150"
FT   CDS_pept        complement(189193..212172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0150"
FT                   /product="Apolipoprotein A1/A4/E"
FT                   /note="PFAM: Apolipoprotein A1/A4/E; RepA / Rep KID repeat-
FT                   containing protein; KEGG: bhy:BHWA1_00453 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70257"
FT                   /db_xref="GOA:D5U4L2"
FT                   /db_xref="InterPro:IPR000074"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4L2"
FT                   /inference="protein motif:PFAM:PF01442"
FT                   /protein_id="ADG70257.1"
FT                   /translation="MNPVLQLILTFVVPLLFIGIYSVINRKKNYSDNNFSDIFAEEKAA
FT                   LEGIVEEKISEVRDNAIDLEIAVKKAGFISKSMEEDIAKLNKRIESYKDYKAAVSQYQE
FT                   QVDSLEEAYLEILNKVDTVLKERNTIEKTYKRISDVKAKMSELEKNVGSIQDKLIESYN
FT                   SKLNEFESELYKRFDALTTNLLARDAHYSTMAEQEKEKISALAEEFKLHVAKKEELFTN
FT                   QLTQLAERTARHNIEQLAELFEKGRDELINKYSSFADEIDVKSKDIENRYETLSQSKDG
FT                   LETELNNLRDTIHDRLNSITESSVLEFQDEMEKTKEMLYSTLKEGLEKISMDREEFLDS
FT                   IEQKAHSLEKSIDDIKDKADYISKDYAEKAHQLESEFSVLKDDINNRFIAEVENFSNHI
FT                   KNVLENEDDGVITLYRNKTKELNDLIISIDGMSEETMLRAESRFEDIINDIDKLKDDIL
FT                   TRAQDDMEYSIDNARSSLIAEINELRNDVETETNILKDKIDETHYQTSEIISILNNKQE
FT                   EILDSLSLQKEYLYKDLETQANDRVNEIEKLFATVKNELEENINTYIKNTSSDLTAIDE
FT                   KLSGLKEQYDKASSDIDTLSKETESNIKDNIEKRLEILEKTSVEINGLVSRANEKLDIG
FT                   MKDAEDRIEGIKKEISDYSDAYIDSLKSHLKTVLDDYEQTKMKAITDSIDSVISQVDES
FT                   EKRHDALMSSIENSLDDFRNKVDTAIDENIKFNEETKKEVADMLHDELRQATDSFDTLL
FT                   NEKRESMNKIKDEIEDILHRVENGRDAFERTINKVYENAEDKEKELMSDIEDKYNSLDK
FT                   KIDGVLDERRADLNAISAEYHAMLEKYSNNLKDDYEELKHHASLMTDEYKMRIENLGER
FT                   ISEIIDNANNMQSVVDAKTGEMNSYIADKKDEIAKRTETIFTNIEYDTSKKLDELKLLI
FT                   DNAIAKYQDEIKEIETYRLEENKSIIEDVENIGAGIRKDYEQYTNMLEELCNKEKTSLN
FT                   EYVNTLKDEIEKAREESEAKHLTNEANYIDDYLNKASSKIDDEVNRLNEELNDSFNTLY
FT                   SGFSKILAKIRKANHKKALQSIAKIKKHAEKVISNTAAEVRDSLGLTLEDLRNEFISLK
FT                   DNVDDRLREQADKLISNNENVLAILDDHEIRLEKMNDISNIIETIKETLSEQIDEIKSN
FT                   ISDSNEDVNNRMEEIKSSIIDRAELINLHDSERELLKNQIEDIKEEFELFKDNIVRTNE
FT                   VEIPALFDEEKERIERMFDEFSKNLLMRLTDNESDIHYIKDVLSEERSHLISQIELLRK
FT                   DVDDIKDDNTVTVLSEEKAVLENSLTALRDDFDKIMDLEKDFVSLKNRMEGIDSGLKDD
FT                   VKDLSDKLKSFRDNLEEKIEKDSNGLYKDIENLNKNFETVKNNISSLLDRNEVELLINN
FT                   EKERLNSIFESLASNNEDFKDRLEKRISYFEDVWSDNTRIKSIYASDIREEVENIRKEA
FT                   DVKYDNHIAQLKEKMKLIEEDIYDWKNGNLNTLLAQLEDARKGIESFIDTSESKKNQFL
FT                   IDMLSSIENKESEIYSRIDEKILNAENKLSDIDEKLNNAIGNSLESIHNRINESVAKYD
FT                   EEIKRIEHHRANEAEDLISDMEDLGNSIREDYEEYSIMIDKIYEDAVAELETHLDNIKK
FT                   EIERARAESEEKHLANEKNYIDDYLLDYSEKIEAHVNDKLSILTESKAQLDDMIKDSFS
FT                   TLNANLNDTISKFNEEANTQIYSVVERLEREAAARLFSEQKYMSDLEEQLRAISAKIDN
FT                   ELYNISSKLDSEISDVKTKYKDLSTDFDEALDMIKSSILDRDELMELHSSEKELLSEQM
FT                   ETLRTDFDTFKDELLKANEEDIPTLFNEEKEKIEKAFEDFTTAILDRMVDSENDINNVK
FT                   DAISENKASFLEKVENIKRDIESIREDNTIAQLALDKQSLEDSFNAIKNDFSKLNDLES
FT                   NFYHLNDRFEDFQLKVAADNDNLFENIDNIKSSIKDSISKSSELDDKFTSIKDNVFTVL
FT                   GKNENIENMFTEEVKKLDELFNNFKTDNAEFRSRLEKRIDYFEDIWSDSNRIRSLYAAD
FT                   LRDELDSIKAETEVKLENYLNDLNSRIETINNDAASWRDEYINDFKEKIDALDKDISSW
FT                   KDVRINELLEQLEKAKENINSYLESSEGKKEELLSDILSKIEEKENSLYGKIDSKIEEI
FT                   ENRLSVVDSKVSDDIARGLEEIQSVVNNAVNKYDEEIKNIEHHRSEESSKLLEDIQSGY
FT                   DYYSKLINNTYKDSLSSLSEYTNRIKAEIEKARKETEAKHLNNEKNYIDEYLKEYSLKL
FT                   DNQVNEKINVLNDTKNQLDDMIRESFNTLNNNLNEAVIKFNEEADIKINATLERLERDA
FT                   SEKLLDYNNYVAELEDSLRVLNSKIDNEIYNVSSKLDSEISDIKNRYKELSIDFEESLD
FT                   MIKGSILDRDELMDLHTSEKELLLSKIDEIKNDFNTFKEEAINAGKEDIPALFNEEKQK
FT                   IENAFEQFTNALLYRVNNSENDINYLKDALSEDKLSLLEKIDDLKSEIRTLKEEDKVNK
FT                   LALEKQALEESFNVIKNDFSKLEDLENHLHELKNNMYTTDVNLKDEVANLSSKFADIEN
FT                   KINENNDYIDRNISNNISALNKDIDIIKNAVNESINKSSELENNILKDREDLENKIDSL
FT                   KESLINILGDNETVEGLFSNEVKRIDELFNNFKKDSIDFRDRLEKRITYFEDTWSDSTK
FT                   IRSLYASEMRNELEEVKNAAEKRFENYLNDLSYKIESIDKDISSWKDVRINDLLEELET
FT                   ARENIEEYLNSTEGKKEELISDILSKIEAKENSIYGKIDSKIEEIENRLSIVDTKVSDD
FT                   IARGLEEVQSIVNNAVNKYDEEIKNIEHHRTEEGSKLLEDIKSGYDYYSKLINNTYKDS
FT                   LSSLSEYTNRIKSEIEKARKEAENKGSNVDKNYIDEYLKEYSDRLNNQINEKIGILNDS
FT                   KTQLDDMIRDSFEALNTNLNEAIAKLNSEADSKIDSVMSKLESEVSDRLFNYKEYISEL
FT                   DSHLQSINSKIDNEIYNVSSRLDKEVSELKEKYKSLNIDFEETLDMIKGSIFNGDDIPA
FT                   IFEEEKERIENAFEEFTSNLLDRVNTSESDINYLKDVLSEDKLSLLEKIDSLKEEIDNL
FT                   REDDTISQLSLEKQALEESFNSIKNDFSKLEDLENHLYELKNNMEDTDISLKDEVKSLS
FT                   SRFDSLEQRVSEDKDYIEKDIISNYDNLSSDIENIRNEIQNSIDKSLELENNILKDRED
FT                   LENKLDSLKENLTNILGNNKDIEGLFGSEAKKLDKLFEDFKKDSIDFRDRLEKRITYFE
FT                   DTWSDSTKIRSLYASEMRNELEEVKKETELKFENYLNELNNKIDSINNDISVWKEGNIN
FT                   ELLHQLENAKRDISDYLDTTEDSKNKLVSEVLAKIEEKEQNIYARLDEKISSIESRLSE
FT                   TDSKLHDDIEVNLENLHAMLNNAVSKYDEEIKNIENYRALEANKLLEDSKKLVDDIKAS
FT                   YDNYFNLINETYNNSLNSLTDYSNLVKEEIEKAREESESKHLSNEKNYIDEYLKNYSSK
FT                   LDNKVSEKIDVLNNAKEKLENMVKDSFGNLEADMQNAISKFEKESNSKLLEVIKKLEND
FT                   AKTVIFDKNEYSAYLTEQLGIIYKKIENEISQINQKIDADLVNMSDKIEANSKNVSEAL
FT                   DKVTESILDRDELIELQASEKELLSSRIDDIKNDFDSFKEEVLKSAKEVIPSLFEEEKQ
FT                   KVENAFEEFTTTLLDRVNTSESDINYIKDLLYEDKTLILEQIENLKDELYALRDDDTIS
FT                   RLSLEKAALEESFNAIKNDFTKLEELESNLYQLKDNMSDVDINLRDEVKDLSSKLEELD
FT                   YRIREDVSKDLEDYSNDLSNLNTNVDTLNSYIEAIRENIQDSLNKSEELENAISKDREE
FT                   LENKLSLIKENLLSMSGKNEGIESLFNEEVKKLDELFNKVNNDNTEFRNRLEKRIEYFE
FT                   DSWADSARIRSLFASDIRSEIENVKSDTELKFENSINELKEKMDSMESDISSWKDNNIN
FT                   KLLSQLEEAKNSISSYIENSDSKAEELLSDILSKIEIKEKSIYAKLDEKISSIENRLSE
FT                   ADLRLSDDIGVNLENLHTMLNNAVSKYDEEIKNIESLRDEENSKLLEDIKNGYEHYSKL
FT                   IEEVYTNSLNSLKDYSSLVKEEIEKAREESEEKHLSNEKNYIDEYLREYSLKLDNQVSE
FT                   KMLILDETKEELDNMVRESFNNLENSFNDAVTRFEYETNEKVLEAIDKLEKETESVLFN
FT                   KYMSALDDEIKSVTDRLEEETNAIRYKYDALSNDFDDAVEIIKNSILEKDNVLTLHNKE
FT                   KNDLIESLESLRKDFETFKEASLRFNTEEVPAIFEDKKKEIEHVFEEFTSAVIERVDSS
FT                   DDEVNRLKDIISSDKLDLLEKLDNLEAELDAVRKDNTIEQLSLEKKALEESFNAIKNDF
FT                   AKLEKLESNLYQLKENMSDTDVFLKDEVKALSDKLSDFESRIKDDIIRDLDEYSLELDT
FT                   LTSQVNKLDSSIDDVRGRIEDNILKSSELENIIAAEKEELDSKLSSIKEELSSASGKDE
FT                   VNEFVSYLFDKEKEKLTDLFNQIKDDNKEFRYRLEKRIDFFEDTWSDSSKLKSIFSTDI
FT                   REQLDNIRNDNEIKFENSINYLKSKIESIDNDISLWKEGQIDELVRQLDEARESISNYL
FT                   NDSEVKGEEIVSNLLSKIDEKEKYIYENIEGKVNDIENRLSIMDNKLNDDISGNLEKLY
FT                   NMVNEAVEKYDEEIKNIEHYRLDENNKLLDDIDNVGKEIKSSYENYSKLINEVYDNSLD
FT                   SLKEYSNSIKEEIDNALSEIKDKHLSNEREYIDNYLKEYSSKLEDQISDKMNVLNEAKE
FT                   ELNNILKSSFNDLETRFNESMSKFEETSNEKLSQTIEGIEKKADEVIYGENYIHKIEDK
FT                   VKDFYGRIDTKLLNVEDKYDALERKIYDLENNQSYISIFEDRIRDLHEKIDARISSVNE
FT                   RYDNLRKYFDDKLINLETIVLNNDQIQKLRDDFIAFKDDILRSNREDIPSMFDKEREKF
FT                   EESFNQFTNEILEKFNSSNNNTEEFKNTILENIETLRYELDELKNNDAVEVLEEEKARL
FT                   EDTFNSLREEFERLYDLESEVYTLKSNLDGVDSNLRSDVDKLFEELSDFKYSLEEKLDT
FT                   LEDNTVSRDLFDDDREKLYSLYDELESGNKEFKDLMDKRVSYFEDTWSNPNKVLKLYEN
FT                   AIRPEVDDFKSEIISNIQNQVNEIESNISVWKDDNLSVLLEQLKEAKENIDSFIESSKD
FT                   KKNGIIAKMIASIKDEILGKESEINNRLEEKLSSVNSRLSELENKLTSDVNRFNNMIED
FT                   AVNKYEDELKHIESYRLDETQSIMRNLEDVGRNIVSNYEDYSKMLESAYESNRNALDEY
FT                   SNSLKIEIEKARVDTNKAYIDDYLNEYSSKIENDIRERLEELEKNKYNLDIMINDSFNN
FT                   LNQSINNAVSKMAEDSEAKLRDVVDSLEVQINDILANKEEEIVSRITSYETELRDKQES
FT                   SFENIKNELSDLYNEFKDKIDYNGLMDISEKLEAIENSVAEVNGQLETQARFVSDRMDL
FT                   EKEELYNSISKLSEEFEDLKSNIDERFKAQVNDFISNNEHILSLFGKYSQKISSVTDIL
FT                   EDIENVKLSLIDEINNVKEEIDNKYFTLSKDFDKSIDEIKDAVLDKNNMLQYSINEKEL
FT                   LIKEVEALKASFESLKDDILTAADDRVPTLLDSEKARIQSSIDDVMETLTARIHNNEDS
FT                   IINLESSLSEYKSMISNAIDDFKNEVISIRDNHNYNDLIEERDRLEESFNTLKEDFSKI
FT                   GDLEDDLSAIKDKVKGVDTSINDEVVRLSEELEELKNNMANMEIISSVNNSDDVITHED
FT                   MNIIYDNFKQLSDSFEELKEDIIPQLSNFTKLEDRILESKEEIFREFNNMMNSLPKTYI
FT                   NKDELSRLEGRLDNIFNNFDESVVSIKDDLLRNIEKDAKEFKNRLEKRVEYFEDVWSDE
FT                   NKVVELYGDTISTSFGVLKQELELYFNNSFMEVKTKIDSIEKDFNSWKDTSYDSITNSL
FT                   ENAKDNVLNNDHYSEIMSMIEELKGNISDRQLELQDRIDSKLEEGISNIESQVNTFDDR
FT                   IKYLEDIQGSLNDDIAKYREQLDSILNEYEDKVKSKVVNLHDALKTEGKQTIDYLENNI
FT                   LSIKEDINSSNKGVDVKIKALESYISKVNNELNTNTLKLSNELAKEKKDLINILDEFRK
FT                   EVYDRISSEVSHKDNQLLNDFEDFKKTIIDSVPNMDELADLFVSERVDRANEFEEFRAE
FT                   IINNQIDNRNFAKMFEEEKAKLINELDHFKSAVRVEYLSAEERFEAVKKEYLDNLNNLL
FT                   DVERVNLESSFDEIRKEINNLKDKSVSKEDIEKLIDSYKSNITADIESTKAEVAKNMEA
FT                   GKVDTSYVEKLIEDERVRINDTLEAFKKNIEDNYSTVEAVAEVLSKEQEAVEAKLLEMK
FT                   EDILRDIPSLDNVSQIFVEEKESLKDELRDEFVSLRDEILGSVPTHNDLANMAQQYGAR
FT                   IKDDFEILEQDFSESIKRYKESIAKEMTEFRNEFNDRIANIKDLAEALQAERDRLMSEI
FT                   DEIRIKYESGAIYSGDALSSIEGDRDRLVNEFINFRKSIVELIKEQDETMSRFNQEKID
FT                   IIDSIEALKNQISFDTLNRDDVVSMIEDERRQVIDMFESIQNDSIGTDLRYLTDSFRDD
FT                   IIKVFEESNEEFRKRIEARIVHFEDAYASPDRIKEFYKDAIVAEVNNLRGEAVDILVDI
FT                   NDKVESAKEQIDELENNKVKDIINKIDEAENDINSLIGTIKANIKEQENELRMLSQSQK
FT                   HISQEVETVRREREALMDMVKNSDINIRNKIDSLSSAVMEAANVAAAKIAEKEAAFSTK
FT                   VKDAEDYIKSLENKLTTENVNKAKESINNLVASFNDAVVKETNELAPNITKAVQNFINN
FT                   EMKKFEKFSDVKSAIEGIENDINNKITAAFNNMNKELESNITSFKKKIDTYQEEFIGEL
FT                   KMSVGTEGEKAIDELKSMHNSEVSKLKEMYLSTEKFYTERQDKNQEDYSKLLLETYKEY
FT                   NEKIEALYAELDDTKSNITSSVEDVVADLKQALNIKDDFVISIEDNKEKLKAVEEQMDN
FT                   LQNEFAPSLEKLKSLIEEKALELQDKINAYSEDIEEQGEKFNARLEELSNNAKTTVETK
FT                   VGEVDSIIENVKGRMEALLEEKSSEFDALKAHYESLSESLTALQDSISEAVNERIADAN
FT                   NIIEENVNAIEETTNEKYEKYIARLNSNLEQTLSLLMNDAKEYVQNAKEEIIKAHTDNL
FT                   DEYDARITNMKNIVTALEEDITKYSSEIDARLESINLSYDEKTNVILKDFEDKTEDLKS
FT                   KLNDAASSIDKMLDSKTNDISLEYDAMKSKIDAIGADIQKYMNTVKVFDNAKEMAESIR
FT                   GDVAKLNDLVKDTKAATAEMAKTMSEFENLKKMHHDILDYASSIKKEKDSLKDTQEKVN
FT                   MLMDMSGEIQERFVNIAENNAMIEHTEEGIQLVIDIASQIENKLSFIRDKEEYADDVLQ
FT                   QIRKAEIETEVILERVDSIKAAMVDVEDTRKNFMDKIYSLERDFAKIDKNDKKVQIFIT
FT                   KLEELDVIIDEIQNQRENLVRMKNQYDDYDKTIVKNLERAEYFVRYLETLLDNADKYMS
FT                   DKGSKTSAKKDKNSKVDSKKEEFIIKMYKQGWKPDEIVKNTSYSRDEVERTIKAWKDKQ
FT                   SRM"
FT   gene            212802..214223
FT                   /locus_tag="Bmur_0151"
FT   CDS_pept        212802..214223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0151"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: bhy:BHWA1_00429 sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70258"
FT                   /db_xref="GOA:D5U4L3"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="InterPro:IPR032506"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4L3"
FT                   /inference="protein motif:PFAM:PF00884"
FT                   /protein_id="ADG70258.1"
FT                   /translation="MNKKPNIILITADQMRADSIGYINEEVKTPVLNELAENGSVFTNS
FT                   FCSSPVCTPSRASIFTGRYPMNTGAWNIGTELNEDEITLADHLKEEGYFNIASGKMHFR
FT                   PQLKNLNWEFEYVPKRDRVREKDKTYFGFDITHITEDDKQGEYLDFANSHGCNLETGKG
FT                   HDGINPIKEELHQTYWTAQKAIDEMDNFDFDKPLFMWVSFVDPHHPFDPIKKYYDIYKD
FT                   IKPKELNSKSKLDTKRPEYLTKQGDRGYWPGGGEEHNYSEKEIEEIKKLYYGMISFIDA
FT                   QIGRIIDKLKEKNEWDNTIIIFTSDHGEYLGDYGLLRKGPFMYDCLIKTPLLFYGKDII
FT                   KNKSDEIIENIDIVPTVLELIGKEVPYGIQGHSIKDILTGKDKEKTYKKGAIVTYDAHD
FT                   RGIFIKTYRTKKYKLSIFLNEEYGELYDLEKDSNETNNLFFSSEYNDIKNKLLLEMCHK
FT                   MIECSDPLNERYASW"
FT   gene            214265..215308
FT                   /locus_tag="Bmur_0152"
FT   CDS_pept        214265..215308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0152"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   KEGG: bhy:BHWA1_00430 putative ABC transporter periplasmic
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70259"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4L4"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ADG70259.1"
FT                   /translation="MKKTLKLIITLLIAVTSLFILASCANKGGASSGDAKTLKVAVMPF
FT                   LNSVPIEYMINNKLDQKYGFTIETVYFPSGGPMNEALGAGLWEVGTLSAASVYSLANYN
FT                   AHVVADIGHSEGGIEVLVNPDSDILTVKGVNKDFPEVYGDAATLKGKTIAVPTGTISHL
FT                   NVIHWLRAINVDPNTVNIVHMEFPQAYQALKAKKIDAAALNPPTSFSAEADGMKIVSSL
FT                   TTLNIPQFDSIIVSDEAYNNKKDTIVLYIKAFLEACDALQADTNMAAEELLNWYTKNGS
FT                   SSTIEACQSEVSTRPFVTTEEIKNIKTGDSVRITADFFASQSLITEDKLPIVDKNVDTE
FT                   LLNKALN"
FT   sig_peptide     214265..214342
FT                   /locus_tag="Bmur_0152"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.661 at
FT                   residue 26"
FT   gene            215342..216175
FT                   /locus_tag="Bmur_0153"
FT   CDS_pept        215342..216175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0153"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bhy:BHWA1_00431 ABC-type
FT                   nitrate/sulfonate/bicarbonate transport system, permease
FT                   componen"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70260"
FT                   /db_xref="GOA:D5U4L5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4L5"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADG70260.1"
FT                   /translation="MEENIIINSSLKEKEKIVIANKKRERNKFFIISVISVVIFLIIWQ
FT                   LITDVFKLFPSYSLPSPYTVFKSFIYKLTNKAPDNGTLFQHILASLQVALTGYFLGAAI
FT                   GIPLGICMAWFKKFNLVATPLFDLIRPIPTIAWIPMMILWFGIGLGAKSAIVFMSAFVP
FT                   CVINTYSGIKATTQVHLWVAQTFGASRGQMLKEVAIPTALPYIFTGLRVSLGASWTSLC
FT                   AAEMLAASRGLGFMIQLNRQLARADLIIVGMLTIGAVGAILSVGLGYLEKKFVKR"
FT   gene            216188..216982
FT                   /locus_tag="Bmur_0154"
FT   CDS_pept        216188..216982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0154"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bhy:BHWA1_00432 ABC-type
FT                   nitrate/sulfonate/taurine/bicarbonate transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70261"
FT                   /db_xref="GOA:D5U4L6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4L6"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADG70261.1"
FT                   /translation="MKDKKRIKLSDFEKPIWAIISIAGFLIVWQLLTTYTPIKITTPKP
FT                   LEVFKFLLWSINHNIGQQTILGHVLISIFRVLAGFAIGAVTGIILGISMGVNKYVRAVV
FT                   RPFFEVFRQIPPIAWIPMAILWFGIGEVPKIFIIFIGTFVNVTLNAYAGSSQVNPTLIG
FT                   AAKMLGSNDRDIFLHVILPASVPQIFNGMQVGFSVSWMGVLAAEMVSSFAGVGWVIIRG
FT                   SDTANIPQVLAGMITIGIVGLLLSSLMRYIEKRLTIWNSTGI"
FT   gene            217002..217760
FT                   /locus_tag="Bmur_0155"
FT   CDS_pept        217002..217760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0155"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bhy:BHWA1_00433 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70262"
FT                   /db_xref="GOA:D5U4L7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4L7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG70262.1"
FT                   /translation="MENKTIIKMNHVNKVFFSEHGYKEVIKDINLEVKENEFVVLFGPG
FT                   QCGKTTLINLIAGLETSEDSDIVVNGKKVTAPHPERGVVYQTTALFPFLTVMENVEFGP
FT                   RARGIPKKERREKAKYYIDLVGLNGFENSYPNQLSGGMRQRVGIARAYCNEPVVMLLDE
FT                   PFGHLDAQTRYMMEEEIEKIWQKEKRTVVFVTNNIEEAVYLGDRIILLTNCPTVVKKEY
FT                   IIDLPRPRKLTDPNFLKIRNEINDNMDITL"
FT   gene            217780..218532
FT                   /locus_tag="Bmur_0156"
FT   CDS_pept        217780..218532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0156"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bhy:BHWA1_00434 ABC transporter ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70263"
FT                   /db_xref="GOA:D5U4L8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4L8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG70263.1"
FT                   /translation="MTNDTREVKVKVSRLTKKFGDLLVLNDISFDVMKGEFLCIVGPTG
FT                   CGKTTFLNSLTKLYKPTYGAIRIDGEHVDLKKHDIAYIFQEYSTMPWLKVEENIKFGLK
FT                   IKKLPQDIINERADKVIKMVGLEKFRNFYPSELSASMLQRVVIARAFAVEPELLLMDEP
FT                   YGQLDVSLRFKLEDELLNIWKTLGTTIIFITHNIEEAVYLGERVLVLTNKPTSIKKEIH
FT                   IDLQHPRNIADPKFVEYREEITELIKWW"
FT   gene            complement(218578..219612)
FT                   /locus_tag="Bmur_0157"
FT   CDS_pept        complement(218578..219612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0157"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: bhy:BHWA1_00435 transcriptional regulator;
FT                   PFAM: regulatory protein LacI; SMART: regulatory protein
FT                   LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70264"
FT                   /db_xref="GOA:D5U4L9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4L9"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ADG70264.1"
FT                   /translation="MATIREIAKLAGVSIGTVDRALNNRGRIDPEVEQKILDIAKSLNY
FT                   KPDKIAKSLAIRKKKFKIAAVLNTYNNVFFEDVIKGIEIAGKEIEEFGMSIIIKRCKDF
FT                   DADNQLELIDDAVKEGANAMAIVAINDNRVIKKISELHHNNFPIVLLNSFVNSNDCIAY
FT                   VGCNYDLAGEIAASLLNIISNGSPINLLVFSNNFNKMLGNKKRVDSLSYRLKTDYQNVR
FT                   LQSVIEMEKDNNLNFNKSKDCLLKYSNTDVVICPGAETSKYVINAIKELGLYNKIKIIT
FT                   YDFSEVVQDGLLDRGIIASITQNPKEQGYRAIKVLFEYLLTKTIPDKRYTYIETQVIFR
FT                   ENLL"
FT   gene            220558..221085
FT                   /locus_tag="Bmur_0158"
FT   CDS_pept        220558..221085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0158"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00440 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70265"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4M0"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00440"
FT                   /protein_id="ADG70265.1"
FT                   /translation="MKKITLFLILSLIIISCKNDGGSIYAMEKRYKNFLNILPTDIRSD
FT                   YTLESDKYGNMYKEWINEFNAWTENTLNTEVQREQEISSRITPDKIEYALETLTSKDYE
FT                   RNLPVELMSKVKAHTDELSSKIEALEKDEAFSNAMIKLKKDEAVENFTTKDTIFYYVWN
FT                   YLITIDRPRRFQ"
FT   gene            complement(221627..222322)
FT                   /locus_tag="Bmur_0159"
FT   CDS_pept        complement(221627..222322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0159"
FT                   /product="alanine racemase domain protein"
FT                   /note="PFAM: alanine racemase domain protein; KEGG:
FT                   bhy:BHWA1_00441 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70266"
FT                   /db_xref="GOA:D5U4M1"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4M1"
FT                   /inference="protein motif:PFAM:PF01168"
FT                   /protein_id="ADG70266.1"
FT                   /translation="MNRDEILKRYNLIEDNINRIKEKYNINYDVSLVAVSKYSSIETIK
FT                   EFLSLNIDLPLGESKAQSLRDRVGEIGKIKDNVKWHFIGRIQSNKVKYIVKYADLIQSV
FT                   DSIEIAECINKEALKNNKVQDILLQFNISDEVQKGGFTADDYIGVYENIMKMPNISVKG
FT                   LMAIGKDTEDSYVIEEEFEHLNLIYKEINKKYNNTLSILSMGMSSDYELAIKHGSNMVR
FT                   IGSSFLGNS"
FT   gene            222774..223241
FT                   /locus_tag="Bmur_0160"
FT   CDS_pept        222774..223241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0160"
FT                   /product="protein of unknown function DUF327"
FT                   /note="PFAM: protein of unknown function DUF327; KEGG:
FT                   bhy:BHWA1_00442 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70267"
FT                   /db_xref="InterPro:IPR005585"
FT                   /db_xref="InterPro:IPR024042"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4M2"
FT                   /inference="protein motif:PFAM:PF03885"
FT                   /protein_id="ADG70267.1"
FT                   /translation="MRVQDRRNREMNLNSILMTSQDASMASSMKVAVSSSPFATMLEEE
FT                   KEIKKYSYELDELKRQIYDAGNLLEKSANIKDFQKFRDLIRSLTDKLVKDAYRIRIVSS
FT                   YMRRGREYQVVSKINEELDSLYKLIMTEQKNHIAIANKVMRLKGLVLDLMS"
FT   gene            223238..223918
FT                   /locus_tag="Bmur_0161"
FT   CDS_pept        223238..223918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0161"
FT                   /product="peptidase M22 glycoprotease"
FT                   /note="PFAM: peptidase M22 glycoprotease; KEGG:
FT                   bhy:BHWA1_00443 inactive metal-dependent protease, putative
FT                   molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70268"
FT                   /db_xref="GOA:D5U4M3"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4M3"
FT                   /inference="protein motif:PFAM:PF00814"
FT                   /protein_id="ADG70268.1"
FT                   /translation="MSNILAFDTVSASFSIAIKKEDGSIIEYNKENVKNHNEELLPVLR
FT                   NFLTDNNLTLDNISYIALGIGPGSFTALRIAFATIKTICYAKKIPIIGISSLDTLYENI
FT                   AEKEGIKAAMIDARKGSVYANIYNDNEKITENADLTYQQFIDIINSIETSNKNITLCGD
FT                   GFSKNSDFFIENLKNYNINKLDNSYNIIKALNTIKLSANKKFDDVFSLLPLYVRKSEAE
FT                   YKKM"
FT   gene            224065..226203
FT                   /locus_tag="Bmur_0162"
FT   CDS_pept        224065..226203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0162"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: bhy:BHWA1_00444 methyl-accepting chemotaxis
FT                   protein McpB; PFAM: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70269"
FT                   /db_xref="GOA:D5U4M4"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4M4"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADG70269.1"
FT                   /translation="MRKLQSLKVKIPFFVMLLVTVMTIILVTLLIRIGSQGIRSSAIFG
FT                   FESTTKVYARMINVWLEQSIYTSEAISRGYPQLITFLQDRTAENRVLLETSLKNVVENN
FT                   SNIQGIVVLDSTGNVVADSLDGKVVNSSSTRNFGGTPLWQKVMSGQSAVLSTVDPSPAD
FT                   NTKYVVKIFSPIKNSAGSVVGAISTMIDWLGFIDKELNLVKFGNTGHPFIVDPERWIIA
FT                   DPVPSHVRSEVLRNADYIQYAVANESGYYEFKSPFNGKDSIATFYKEPVSGWTVVMSIE
FT                   SDELFSHINTMKKYAIIGTIAILIIASIVIVFYISRITNILHLLAVDLTILSKGDLSWS
FT                   TPPGFENRKDEFGEIAVALINILDQLNEKVRIVYDSAYTVKASANEVAQGNIDLSNRTE
FT                   NQASGLEETASSMEEIASTIKSSAEHTLEGNNMMINSKKAIEEAGRIIEESTQNIEAVY
FT                   ESSSKISAITKIIEDIAFQTNILALNAAVEAARAGEQGRGFAVVASEVRNLAQTTQTSV
FT                   KDITSLVADSEEKIAAATETARESKEIFQNLRAQIEETAKIMQDLSSTAMEQQAGVDQV
FT                   NIAITQMDMTTQQNAALVEESTAASEALFSQAEELVTAMEFFKLRGSNVKKNITKVERK
FT                   KSSPTTDSKAVQENKPAAAQKSSSAPKAPKKPELKSPIKKHHEEKITPQVSSRTVKDNE
FT                   FGNTFDTSKDTSDGFESF"
FT   gene            complement(226255..227325)
FT                   /locus_tag="Bmur_0163"
FT   CDS_pept        complement(226255..227325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0163"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein; KEGG:
FT                   bhy:BHWA1_00173 TPR domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70270"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4M5"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ADG70270.1"
FT                   /translation="MSNLDDLLQLANDAFNCGDYKNSIEYFDKLIFYYGDIAELYNNRG
FT                   LSKSGLRMYEEAIRDFEKVISIDPNYVHAYNNIGLVNHNLGNYKEAIKYYSKALELDNN
FT                   CIQVYNNIGLANHNLGNYEEAIKNYIKAIEISPNVHTYNNIGLVKNDLGLYEDAIKDFN
FT                   KVLELDKNYFKAYYNIGLSKYNLKMYDESIEYFNKALELDNNSAYTYNNIGIVKHDLGK
FT                   YKEALEYFDKALELDNNYSKSYYNRGVSKVNLKLYDEAVNDFYKVIELEPQNFNAYFRL
FT                   AYVKLKLKMYEEAIEYYDKYIDCNNVSDDVYFNRGFAKYKLSDYKNAVKDFDKVNNNIK
FT                   ASILKMISKIRAVLKK"
FT   gene            complement(227702..228199)
FT                   /locus_tag="Bmur_0164"
FT   CDS_pept        complement(227702..228199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0164"
FT                   /product="Dihydrofolate reductase"
FT                   /EC_number="1.5.1.3"
FT                   /note="KEGG: bhy:BHWA1_00172 dihydrofolate reductase; PFAM:
FT                   dihydrofolate reductase region"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70271"
FT                   /db_xref="GOA:D5U4M6"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4M6"
FT                   /inference="protein motif:PRIAM:1.5.1.3"
FT                   /protein_id="ADG70271.1"
FT                   /translation="MIVSLIAAVDSKNGIGLNGVMPWGHIKEDMQFFRSTTTGYPVIMG
FT                   RVTFESLGCKPLPKRKNIVISSSINNEFQYDNLFFDTSFENALSKLLLEKHNQIFIIGG
FT                   ESIYKKALDYADIIYLTHINKNYNCDRFFPEVDKTLFNSNKLKSFIYDNINIDIIEYSR
FT                   LK"
FT   gene            complement(228196..228996)
FT                   /locus_tag="Bmur_0165"
FT   CDS_pept        complement(228196..228996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0165"
FT                   /product="thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /note="TIGRFAM: thymidylate synthase; KEGG: bhy:BHWA1_00171
FT                   thymidylate synthase; PFAM: thymidylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70272"
FT                   /db_xref="GOA:D5U4M7"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4M7"
FT                   /inference="protein motif:TFAM:TIGR03284"
FT                   /protein_id="ADG70272.1"
FT                   /translation="MKNYLELLKKVLEEGEETLDRTGVGTRRIFAPQLRFKFEGNKIPI
FT                   ITTKRVFMKGVIIELLWFLQGSTNIKFLLENNVHIWDEWADDMGELGPVYGKQWRAWET
FT                   KEGNKIDQISNIVNTLRNNPTSRRNILNAWNVGEIDKMHLPPCHMMCQFSVNNKGGIIA
FT                   HLYQRSADLFLGVPFNISSYAILTRLLAMHSGLHASELIMTFGDAHIYNNHIEQVKLQL
FT                   SREPYENTTELFIENRPNIFSHVYEDFRLEGYKYYPTIKGEVAV"
FT   gene            complement(229153..230397)
FT                   /locus_tag="Bmur_0166"
FT   CDS_pept        complement(229153..230397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0166"
FT                   /product="peptidase T"
FT                   /EC_number="3.4.11.4"
FT                   /note="TIGRFAM: peptidase T; KEGG: bhy:BHWA1_00150
FT                   peptidase T; PFAM: peptidase dimerisation domain protein;
FT                   peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70273"
FT                   /db_xref="GOA:D5U4M8"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010161"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4M8"
FT                   /inference="protein motif:TFAM:TIGR01882"
FT                   /protein_id="ADG70273.1"
FT                   /translation="MLNDDIKKFQIDSFFKYASIPSQSVAGANTIPSSEGQRKLAKVLA
FT                   EDLKALGLKDVIVNDNAIVTALLEKNKDNIHSIGFVAHLDTVDVGLTGDVHPQILKFEG
FT                   NDLCLNKEKNIMFRVSEHPEIKKYINDDIIFSDGTSVLGADNKAAIATVMSALKYIKDN
FT                   NIEHGDIHIAFVPDEEIGLIGSKALDLNVFKPDFAYTIDSCEIGEVVYETFNAGSASID
FT                   IEGVTAHPMSAKGVLVNPILIAIDIANEFDRKSTPECTEKKEGYIWVQGISGNQRNASL
FT                   KLNIRDHSKELYEQKKNKIKEAVEKYQKLEPRAKISLTIEDVYANISDSIKDDRLPIDV
FT                   IYEAMKNLNIEPKTISMRGGTDGSALSVKGLLTPNYFTGAHNFHSIYEFLPISSFHKSL
FT                   QTTLEIIRIISSKSK"
FT   gene            complement(230441..232003)
FT                   /locus_tag="Bmur_0167"
FT   CDS_pept        complement(230441..232003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0167"
FT                   /product="AbgT putative transporter"
FT                   /note="PFAM: AbgT putative transporter; KEGG:
FT                   bhy:BHWA1_00149 ABG transport, putative transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70274"
FT                   /db_xref="GOA:D5U4M9"
FT                   /db_xref="InterPro:IPR004697"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4M9"
FT                   /inference="protein motif:PFAM:PF03806"
FT                   /protein_id="ADG70274.1"
FT                   /translation="MQSDGKAVKKSNKFESFLNIIEAVGNKLPDITILFLIAFFIMLIV
FT                   SWILSHFTFNYFHPTTGEQIKIINMLAPSELTKFITKMTANFVSFPPLGITVVATLGIG
FT                   AAEGSGFIRMILIKLLAIIPKKAIAPAIIFISVVSHITSDSSYVILMPIASVMFFAVGR
FT                   HPLAGIAASFAGLAGGFSASYTPSTIDPIMQGFTQGAARLIDPTYTVNVLCNYFLSVSS
FT                   TFAVILVCWFITDKIVEPFLWKTMPIDEGVMPEDTSISSITKEENRAFKIAFAVLIFMF
FT                   IILIVLLVPKTSLLRSPNGSLTTPDAPVMQAIVPILFLFLVIPGYIYGKLTNKFKTTKD
FT                   FSLAMAGSVKNLASFLTFSFFCAQFLYVFGNSNVGTLIAIAGAEFLKSLNMAPQITIAG
FT                   ITLLTAILNLLITSASSKWAILAPIFVPMLMAVGISPELTQAAFRVSDSAINVVTPMFA
FT                   FYPLIISYCQKYCKKTGVGTLSSMMLPFSIGLLVVLMIMLYIFWALNIPIGFNSGYVYP
FT                   PVN"
FT   gene            232367..232738
FT                   /locus_tag="Bmur_0168"
FT   CDS_pept        232367..232738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0168"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00170 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70275"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4N0"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00170"
FT                   /protein_id="ADG70275.1"
FT                   /translation="MHKLYIFTLLILSALLFSCHKKEIISTEKGVVDYRFIGTWEFINA
FT                   TNKEKYTFFNNNKIVYSNNDKNTPDNNKVYTYEWKKEGDNYYYRLWDNELDNWSDFPIK
FT                   YINTNTIKIYSDFFKKSYI"
FT   sig_peptide     232367..232432
FT                   /locus_tag="Bmur_0168"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.798) with cleavage site probability 0.764 at
FT                   residue 22"
FT   gene            232779..233051
FT                   /locus_tag="Bmur_0169"
FT   CDS_pept        232779..233051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0169"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00169 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70276"
FT                   /db_xref="GOA:D5U4N1"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4N1"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00169"
FT                   /protein_id="ADG70276.1"
FT                   /translation="MDLLVIIFFIIIIIIFILMFGILFFVSGISKIVDLISMIIFRNHE
FT                   DCPFCNCKNSMRIIKTSNGYKKVCSKCKYSIEIKDDNTNEEKKDE"
FT   gene            complement(233058..233138)
FT                   /locus_tag="Bmur_R0004"
FT                   /note="tRNA-Leu4"
FT   tRNA            complement(233058..233138)
FT                   /locus_tag="Bmur_R0004"
FT                   /product="tRNA-Leu"
FT   gene            233194..234945
FT                   /locus_tag="Bmur_0170"
FT   CDS_pept        233194..234945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0170"
FT                   /product="ribonuclease BN"
FT                   /note="PFAM: ribonuclease BN; KEGG: bhy:BHWA1_00167
FT                   ribonuclease BN, ribonuclease BN-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70277"
FT                   /db_xref="GOA:D5U4N2"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4N2"
FT                   /inference="protein motif:PFAM:PF03631"
FT                   /protein_id="ADG70277.1"
FT                   /translation="MTKIQKINKFLNKVKKFLVEDIYFIDQNTFNPIQKFLVNTYRVIT
FT                   FAITDFFKDDCTIRAAALTYLVTLSFIPALIVGLFILRIFNIYQNIFLVIFDWMEKNAP
FT                   FYEPMVRQILNIADNTNLASFGIIGIISTIVSTALILHSIQKSLIKIWRVKITTSIPRV
FT                   VANYIALLFLIPILIGISFTLITYTSINLHNLPALIKILLSWVTPIISTSILILFSYVL
FT                   VPQTKVNWSNAAISSILVAIAIITLFSVYFKLNIDVKNYKQIFDSDRYKIEYIVKEINT
FT                   EATENTINNKNNYYYNDTLNENIITNETAATNENILQKNQKIDVENITSIKIERISYVI
FT                   MENVGNGISGITYEKKPIETNMLDFKSFSPNVGEQLVKYNFRIDDVVTINSENNMLTSI
FT                   SPAELSSASSFAQIPVLLLLLYIVWIIILFGAELTYSIQYFRSYGIDKSNIRLSFAEKE
FT                   AIALEFMYIVTYRFINRKKAITMYELAKELRTAPNTITEISNALEKSMFVIKIVNGSNI
FT                   SYSLGSQPESITIGDILYSLRMDGGFRSKNINSSDKYKSMIYKNKAISIKDYNTNLLHL
FT                   VYYKNKK"
FT   gene            complement(234993..236246)
FT                   /locus_tag="Bmur_0171"
FT   CDS_pept        complement(234993..236246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0171"
FT                   /product="Homoserine dehydrogenase"
FT                   /EC_number="1.1.1.3"
FT                   /note="KEGG: bhy:BHWA1_00358 homoserine dehydrogenase;
FT                   PFAM: homoserine dehydrogenase; homoserine dehydrogenase
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70278"
FT                   /db_xref="GOA:D5U4N3"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR016204"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4N3"
FT                   /inference="protein motif:PRIAM:1.1.1.3"
FT                   /protein_id="ADG70278.1"
FT                   /translation="MDKKKEFKVAVAGYGHVGKDTVKTIIENNSIMENRTRIKLTVKTI
FT                   FSRNIDKVQNDKFLDKVEIKTKDLNDILNDDDIDIVIEVLGGMDTAKELLMKIKKPVVT
FT                   ANKALLANCFGELIKNRKTDIAFEASVAGAIPIIKAMKESLVSDRMEGVYGILNGTCNY
FT                   ILTNMTKNNLDFNVVLKDAQEKGYAEADPTFDIDGIDTAHKLCILSSIAFCNVISFDRI
FT                   FIRGIRNIILDDIVFASELGFTIKLIAEAALDENDNAYIYVIPTLLNDSNMLSKVDYAF
FT                   NAITVVGDRSGDTVFYGSGAGGRPTSSAIVSDAVTLARNSLITDELRVPILGFVNENKN
FT                   VKLKDFKDKNETFYVRFTSNNNNLLAFNEAFYDINIEKSIERNGYFMYVLKDVSINTII
FT                   EAIEKVEKIENIFIAKIK"
FT   gene            236583..236750
FT                   /locus_tag="Bmur_0172"
FT   CDS_pept        236583..236750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0172"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: bhy:BHWA1_00357 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70279"
FT                   /db_xref="GOA:D5U4N4"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4N4"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ADG70279.1"
FT                   /translation="MPRVINNDCVACGSCKPECAFDAISEGDIYVIDPDKCTDCGACEP
FT                   VCPSNAIHQA"
FT   gene            236833..237621
FT                   /locus_tag="Bmur_0173"
FT   CDS_pept        236833..237621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0173"
FT                   /product="DNA repair protein RecO"
FT                   /note="KEGG: bhy:BHWA1_00356 putative D repair protein
FT                   RecO; TIGRFAM: DNA repair protein RecO; PFAM: Recombination
FT                   protein O RecO"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70280"
FT                   /db_xref="GOA:D5U4N5"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="InterPro:IPR042242"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4N5"
FT                   /inference="protein motif:TFAM:TIGR00613"
FT                   /protein_id="ADG70280.1"
FT                   /translation="MIKNTQAFILSYNQYKTSSIIASFLTNNSIIQAICYKAKKSSKSF
FT                   GSDLESISKLNINIYEKKQPQLSILKESSITKNYSSLEKSIYSSLLVFYIREVLLYCAR
FT                   DFDERYFILMEKSLNALEELEEAESLKDDDKIKKMYINILMRAFEMKTLHIAGISPHLD
FT                   RCILCENNNASFYSITEGGLICSKCKAIIKDAFEITEDDKNFMRIIKHTSLIDIVNSKN
FT                   IINLYNNSIGNVRDIMNKSLFYHINRNIKSKKVLEEILFF"
FT   gene            complement(237610..238275)
FT                   /locus_tag="Bmur_0174"
FT   CDS_pept        complement(237610..238275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0174"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: bhy:BHWA1_00355 phosphatase, HAD family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70281"
FT                   /db_xref="GOA:D5U4N6"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4N6"
FT                   /inference="protein motif:PFAM:PF00702"
FT                   /protein_id="ADG70281.1"
FT                   /translation="MSKYYNILFDLDGTIIDSSLGIMNGILYGIKKINETCNLDIDIPD
FT                   SETLRKFIGPPLDASFRNYCYDDEKLSLEFIKFYREDYNGNNGLFNCSLYDGIYDLLKN
FT                   LSENNYKVFLATAKPKESALRIIEHFGMEKFFTGFYAPILGGKIKNKLDVLKEALEKEN
FT                   FEKDKTVMIGDRIDDIDAAKNVGIDSIAVRYGFGNDDEFKNAVYIANNTKEIFNILKK"
FT   gene            complement(238299..239264)
FT                   /locus_tag="Bmur_0175"
FT   CDS_pept        complement(238299..239264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0175"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00354 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70282"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4N7"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00354"
FT                   /protein_id="ADG70282.1"
FT                   /translation="MSLKINELYMAAVECGIDADPRGRECVEKELENTKDIYNNLDENK
FT                   KEYFDKDTIFNPYADTRVLNIAEDKDIKKIFCGIDMQTSELLLADRLNEKNAYIDLVIT
FT                   HHPNGYGFVNFYDVIEMQAEKNALHNVPINVSEALTNKRLNEVSRSVYGANHYRDVETA
FT                   KLLKLNYMCMHTVADNFVESFLTEKMKLENPNTLSDIIDILYTIEEYKISAKRYNPPKI
FT                   FNGTNKSKVGSIIVDMTGGASFDSAMIDALSKAGISTIIVMNISDRLLDECKKHYINVI
FT                   CAGHMSSDSLGLNLLFKAIKEKTKEDFEIIPASGYIFVSK"
FT   gene            complement(239290..241272)
FT                   /locus_tag="Bmur_0176"
FT   CDS_pept        complement(239290..241272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0176"
FT                   /product="protein of unknown function DUF342"
FT                   /note="PFAM: protein of unknown function DUF342; KEGG:
FT                   bhy:BHWA1_00353 polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70283"
FT                   /db_xref="InterPro:IPR005646"
FT                   /db_xref="InterPro:IPR032782"
FT                   /db_xref="InterPro:IPR038247"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4N8"
FT                   /inference="protein motif:PFAM:PF03961"
FT                   /protein_id="ADG70283.1"
FT                   /translation="MNELKRKILQSDFYKEVYNNKNTRSVELSVASLERGMQEAAAIFQ
FT                   CPIYELSYKVLEEGSKGFFNIGAKPFLVRYTHITYDKSNIGLAVGSDYTVGNVQDYNQE
FT                   KVVFNKDTEIIVRVKRDGVFLKVNPPVADGKRIEDMTALEGKLIDAGIKEYDSHLAKKM
FT                   LHEQTGQYAKVAEWDVGRSGNNAKISYSISDDKMRAYVTVTKPNKGGREMDLQDVKEIM
FT                   ENNGITFGFQEENVVKCLEDGTFNIPILAAEGRPPVNGKNAKVEYLVNVNKKVIPKYIG
FT                   EDQSIDYKDLSIVENVEQGQKLARKIPATDGEVGRTVLGVKIETKSGKDIDIKEILGDN
FT                   VEMSDDGEYIISSINGQVVLRGKSLNVEPIFEVSGDVGPETGNINFIGSVVVKGSVSDN
FT                   YSIKAEGNIDVHGTVGKCDLEAKGDIMVKLGIQGNENSSVKAGGDVIAKFIQFSNVQAG
FT                   NNVVVTEAILNSNIDADNRIILIGKRASASGGRLRALREVNGKVLGSQAGAVTLIETGI
FT                   SPAKRRAIDDLDKEKEELDNSIEETERNIKSLEQAAKLKKLDDEKKEQLQSYKDQLAQA
FT                   NSRREEVVLEREALNQDIEVEKVESTVSAGKEMLPGVKLVIGSAEFTIRQSYKSITFFE
FT                   EGGMIQTEKYRGEPKNDSKKNEDDE"
FT   gene            complement(241288..242106)
FT                   /locus_tag="Bmur_0177"
FT   CDS_pept        complement(241288..242106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0177"
FT                   /product="RNA polymerase, sigma 28 subunit, FliA/WhiG"
FT                   /note="KEGG: bhy:BHWA1_00352 RNA polymerase sigma factor
FT                   WhiG; TIGRFAM: RNA polymerase sigma factor, FliA/WhiG
FT                   family; RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   sigma-70 region 4 domain protein; sigma-70 region 2 domain
FT                   protein; sigma-70 region 3 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70284"
FT                   /db_xref="GOA:D5U4N9"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012845"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4N9"
FT                   /inference="protein motif:TFAM:TIGR02479"
FT                   /protein_id="ADG70284.1"
FT                   /translation="MKMNKKEKGKIPNITNDNEQEYWQEFKNTQSPYIREALIIKYSPL
FT                   VKYVASKISVNMGSHKHIEFQDLVGFGSFGLMDAIDKYNPNRDIKFKTYAVTRIRGAIY
FT                   DELRKLDYLPRSIRKDVKEIEKAREILEARLSRNIKPQEIADMLGIPISKYNETMKRYI
FT                   EASPTSLSDVWYVGDDSDEISVIDTLKSNDKTNPEYLAEREDVKNKIVAALKKLPEKEK
FT                   QVLILYYYDDLTLKEIGKVLEVSESRISQLHTKAIQQLRYSLSEIKKQLL"
FT   gene            complement(242356..242949)
FT                   /locus_tag="Bmur_0178"
FT   CDS_pept        complement(242356..242949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0178"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00351 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70285"
FT                   /db_xref="GOA:D5U4P0"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4P0"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00351"
FT                   /protein_id="ADG70285.1"
FT                   /translation="MNNIVEKVKQYFSSNFGKLASIIAGLSFVITLILSVSYKNRIDIS
FT                   LLKAIFSAIITIVILFLLGTILKKYLGDVIDEADTNSNMDIDYNAIDDNSTNNTSADND
FT                   NIPFTPDLNLDTSSPKPLNTDKTANKPTYQSSGDDIGDIVFSKPSTASYTSSSSMFPDK
FT                   KVTSEEMEREVREDPEKVAKAVRTMIAKDEKDDK"
FT   gene            complement(242984..243847)
FT                   /locus_tag="Bmur_0179"
FT   CDS_pept        complement(242984..243847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0179"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   bhy:BHWA1_00350 flagellar synthesis regulator FleN"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70286"
FT                   /db_xref="GOA:D5U4P1"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4P1"
FT                   /inference="protein motif:PFAM:PF01656"
FT                   /protein_id="ADG70286.1"
FT                   /translation="MKDQADELRKMMGVKDKRPQRIISIASGKGGVGKTNIAINLSIAL
FT                   QELGQNVLLIDADLGLGNVNVILGNMPEYNLYHVIKGVKKLHEVVLETDYGIRYIAGAS
FT                   GFSSLANLSGRALTKLVNSMDSLNDADIIIVDTGAGISDTVLYFLLSSDESIVVTTPEL
FT                   TAILDAYGVIKSIAPENSNADIKILVNRVTKASEGKEVGDKIIMTSKKYLDMDVKYLGH
FT                   ILEDKTIPYAVSQQLPFYQYDNKCHASMSIYNIAKKIVDMEYDDDREVKGLGGFMESLL
FT                   SFVSKK"
FT   gene            complement(243883..245856)
FT                   /locus_tag="Bmur_0180"
FT   CDS_pept        complement(243883..245856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0180"
FT                   /product="GTP-binding signal recognition particle SRP54
FT                   G-domain protein"
FT                   /note="KEGG: bhy:BHWA1_00349 flagellar biosynthesis
FT                   regulator FlhF; PFAM: GTP-binding signal recognition
FT                   particle SRP54 G- domain; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70287"
FT                   /db_xref="GOA:D5U4P2"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR020006"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4P2"
FT                   /inference="protein motif:PFAM:PF00448"
FT                   /protein_id="ADG70287.1"
FT                   /translation="MVDIRTIRGKDKTDAFAKARVEYGGNFVILTSKDVKVGGFLGLGM
FT                   KTEHELRIMLNNSIYDRKNNSEEKNSYDSSTEDDDMHRSKLLSDRIEMKKHTTETIDAS
FT                   EMADRIVAVTKALKEASRERNANRTSSSSAIKNSLNSSSQSVHSDSFDDDSRDGISSIN
FT                   EELVNETLESNNHSYIEEKNENISAREINNNSTDNFTPLPHFNNSPYSNFSSSTFTNVK
FT                   GSILSDYNTNNSFSPINNYSNFANNSFMNGMNSNMNNFNSNVIPNHINTSNNHNNNSVN
FT                   AANAIDENVKKLVQEQIRDMVKEYLEGSLPNINKNKYSSQNNSNSSNNKNAFTDTEDEE
FT                   INNAIEEIKEYREENNLTREHKEKKTNIRDYFEDTDEISDDYNNNDESSDNSPADGMEE
FT                   SFNYLRDREFPEEVLLELREYLLTSSNARFFQSKDVIREEVEKYFSDKLILANGIDVGA
FT                   KKKIIVFVGPTGVGKTTTIPKIAAQHMKSGKKVSFVTIDNYRIAAVDQLQRYASIMKVP
FT                   FTSASTPEALRAEIRKMDNSSLLFIDTMGRSPKSAEEIVAMSKYFTTVGRFDMDIQLVM
FT                   SATAKYKDAVKILNGFKPTNYKGVILTKVDETDYLASSICAITRKKLPITYITHGQGVP
FT                   KDISTAKKYGYKIMEGLFGSSK"
FT   gene            complement(245934..246107)
FT                   /locus_tag="Bmur_0181"
FT   CDS_pept        complement(245934..246107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0181"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00348 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70288"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4P3"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00348"
FT                   /protein_id="ADG70288.1"
FT                   /translation="MKTIKIFGKNREEIEKQARDKYGESYFIISVRESKRKNIFGMIKK
FT                   EFEVSIGILEQY"
FT   gene            complement(246172..248292)
FT                   /locus_tag="Bmur_0182"
FT   CDS_pept        complement(246172..248292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0182"
FT                   /product="type III secretion FHIPEP protein"
FT                   /note="PFAM: type III secretion FHIPEP protein; KEGG:
FT                   bhy:BHWA1_00347 flagellar biosynthesis protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70289"
FT                   /db_xref="GOA:D5U4P4"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:D5U4P4"
FT                   /inference="protein motif:PFAM:PF00771"
FT                   /protein_id="ADG70289.1"
FT                   /translation="MATMNGAKSILDNIKLPANMSRHSDIMFAVGAVMVIMMLIIPLPS
FT                   FVLDFLLIVNIIVSLLILLMVLSIKSANDFSVFPSVLLVMTAFRLALNVSTTRAILTEG
FT                   ANFNGKVITSFADFVVGGNIVVGVVIFIILIIVQFVVITKGATRVSEVAARFALDSMPS
FT                   KMMAVESELQAGAITDKEAEEKRKKIRGESDFYGTMDGASKFVQGDVIAGIIITVINIV
FT                   GGLIIGMTMRGEPFAQAVNAYTRFTVGDGLVSQIPSFFMSFATGLLVTRSSSEDNLSTQ
FT                   IAVQIFAKPKNLFIGAGFAFFLMLLPGFPKIALFVIALALFLAGYALKKEQQELGLNED
FT                   GTKTDAGEQVHQGPLDVTPFLKVEKIELSVGASLIPLALESEGGDLINRISQIRRELAL
FT                   EVGLVVPPVRIVDNSVIEPDEYTVSINGTEMAKGFVRPNMLLALNANSPDGPSPDCEKV
FT                   REPAFGLPAYWIKVDEKDMAEKKGFMLFQPTSVIATHFSETIKRNANLLIGREEVQNML
FT                   DLIKDDHKALVSEVLAAKPHNESPLGYIQKVLQNLLQEEVPIRNSVAILEGVADAISIM
FT                   GSEQATELVRSRLASQISQMVADQDRNIRVITLSQQLQNNIAQNLANTGNLQGSQMIAM
FT                   SFESMQNLIKNIKDAVKLVSDSGVDDIVFLTSPIIRRPLYQFIAKNIGKYKVIATTEIA
FT                   QGYNVQGVASIK"
FT   gene            complement(248305..249504)
FT                   /locus_tag="Bmur_0183"
FT   CDS_pept        complement(248305..249504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0183"
FT                   /product="flagellar biosynthetic protein FlhB"
FT                   /note="KEGG: bhy:BHWA1_00346 flagellar biosynthesis protein
FT                   FlhB; TIGRFAM: flagellar biosynthetic protein FlhB; PFAM:
FT                   type III secretion exporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70290"
FT                   /db_xref="GOA:D5U523"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:D5U523"
FT                   /inference="protein motif:TFAM:TIGR00328"
FT                   /protein_id="ADG70290.1"
FT                   /translation="MKNIISSVLELLIIFKAKLYRKYLRITKKGYVLTLFASPEDEGRT
FT                   ELPTERKKRKAREEEGRVVNSAEINQTLVLAVTIAVIALLTTYLTDTVSKFFMTILNKI
FT                   STADATMNVLSLPDMFLEIVVLIAKTAGIVLAVALVVGVGINLAQTKFLFTTKKLKPNF
FT                   KRIAPTWSNFKERVFVSSQNLMNLAKILFKMVVISFLTFTTIYGKSTELFNMTNMELPQ
FT                   AMHLFFFIVLEMLAKVIVFMIIVSAFDYFFQRRQYINSLKMTKHEMKEEFKEMEGDPLV
FT                   KSQLQDMARKIVSRTMLKAVPEADVVITNPTHFAVALKYENGDYAPVVTAKGADHIALR
FT                   IKEIAKENDVQIVENKPLARELYFNVEIGQYIPEKLFHVVSRILGEVYRIRNEKMARAI
FT                   "
FT   gene            complement(249501..250304)
FT                   /locus_tag="Bmur_0184"
FT   CDS_pept        complement(249501..250304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0184"
FT                   /product="flagellar biosynthetic protein FliR"
FT                   /note="KEGG: bhy:BHWA1_00345 flagellar biosynthetic protein
FT                   FliR; TIGRFAM: flagellar biosynthetic protein FliR; PFAM:
FT                   type III secretion system inner membrane R protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70291"
FT                   /db_xref="GOA:D5U524"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006303"
FT                   /db_xref="UniProtKB/TrEMBL:D5U524"
FT                   /inference="protein motif:TFAM:TIGR01400"
FT                   /protein_id="ADG70291.1"
FT                   /translation="MDNFVNFFQIYLLIMVRFIAILMVAPLFSSNVIPNSIKMALAFIA
FT                   TATIFPLVADISVQAAPTFMEYFLTLLNEALIGILIGFLMSIIFAAYQVMANFFEVQMG
FT                   FGISETVDPISQVTVPVLGQLQSLVVVLIFIAIDGPSWVVRTLFYSFKAMPVLSDASKA
FT                   VFASSFNGVIDRMIYYMSSLFSIALSLALPIMLTLFLLSLSLGLLAKAAPQMNILMLGF
FT                   PMQIGVGIVSYYILIPVLVSNFMRILEYTISDVNNIITFLSGGTI"
FT   gene            complement(250344..250613)
FT                   /locus_tag="Bmur_0185"
FT   CDS_pept        complement(250344..250613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0185"
FT                   /product="flagellar biosynthetic protein FliQ"
FT                   /note="KEGG: bhy:BHWA1_00344 flagellar biosynthetic protein
FT                   (FliQ); TIGRFAM: flagellar biosynthetic protein FliQ; PFAM:
FT                   export protein FliQ family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70292"
FT                   /db_xref="GOA:D5U525"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006305"
FT                   /db_xref="UniProtKB/TrEMBL:D5U525"
FT                   /inference="protein motif:TFAM:TIGR01402"
FT                   /protein_id="ADG70292.1"
FT                   /translation="MSDTSIIVLVQETLWVFMLLSAPVLGVSIIVGLIISILQATTSIQ
FT                   EQTLTFVPKMIAMLAVIYMLASWMLNYTSAFTVRLFSILPSIAR"
FT   gene            complement(250666..251454)
FT                   /locus_tag="Bmur_0186"
FT   CDS_pept        complement(250666..251454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0186"
FT                   /product="flagellar biosynthetic protein FliP"
FT                   /note="KEGG: bhy:BHWA1_00343 flagellar biosynthesis protein
FT                   FliP; TIGRFAM: flagellar biosynthetic protein FliP; PFAM:
FT                   type III secretion system inner membrane P protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70293"
FT                   /db_xref="GOA:D5U526"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:D5U526"
FT                   /inference="protein motif:TFAM:TIGR01103"
FT                   /protein_id="ADG70293.1"
FT                   /translation="MRKFLMVVLVLCLLIPAAAYAQNNTQIPIPTIGLNVTQAQTPQQV
FT                   SLGLQILFLLTILSLSPSIIIMTTSFIRVSIVLSFVQRALSLQETPPRALIMGLSLFLT
FT                   FFIMMPTLTQVNNEALQPYLNGSIGVNELYSRGIQPIRMFMFNSLRGENGMKSLDLFLS
FT                   ISDTNIRLRDIQTVDDLNRIPTIVVVPAFIINELTIAFKMGIYLFIPFIVIDLVVASIL
FT                   MAMGMIMLPPIMISLPLKIILFVAVDGWKLLILQIVQSFQ"
FT   sig_peptide     complement(251389..251454)
FT                   /locus_tag="Bmur_0186"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 22"
FT   gene            complement(251673..252173)
FT                   /locus_tag="Bmur_0187"
FT   CDS_pept        complement(251673..252173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0187"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bhy:BHWA1_00342 acetyltransferase, GT family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70294"
FT                   /db_xref="GOA:D5U527"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D5U527"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADG70294.1"
FT                   /translation="MNNIREAHIEDAQDIIEYIKKVSDETDFLVSGSEERQLNVKREEE
FT                   FLQSIQHLTLEKMFLYEISGKIVGICNLKGVNKVRIKHRADLGIAVLKDYWSRGIASEL
FT                   INHAIYYCRLNSIKKIELTVRTDNERALKLYKKAGFEIEGEIKSFFCINGIYYNCYIMG
FT                   LFI"
FT   gene            252351..253067
FT                   /locus_tag="Bmur_0188"
FT   CDS_pept        252351..253067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0188"
FT                   /product="protein of unknown function DUF306 Meta and HslJ"
FT                   /note="PFAM: protein of unknown function DUF306 Meta and
FT                   HslJ; KEGG: bhy:BHWA1_00341 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70295"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="UniProtKB/TrEMBL:D5U528"
FT                   /inference="protein motif:PFAM:PF03724"
FT                   /protein_id="ADG70295.1"
FT                   /translation="MIKKLTYILIFLAYSIALFSETDFNIDDSIITKILSGKVYTLDNL
FT                   AKNSITIIFDDNKISGKSTINTYSASYRIIGDNIEINDISASKMNGPQNLMKEEEEYLQ
FT                   LLSEAHNLEIKGNILKIKTNTDKELIFKEVIELSSNYLKGKEFVLKNSSDELNITIGFT
FT                   KNYIYGYNNRDKYFSAYTISDDRILIKDIKTESTEETANDKYINLLGSISKISLEGDEL
FT                   ILTTKDKEKLIYKMKS"
FT   gene            253698..256097
FT                   /locus_tag="Bmur_0189"
FT   CDS_pept        253698..256097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0189"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /note="KEGG: bhy:BHWA1_00340 membrane carboxypeptidase;
FT                   TIGRFAM: penicillin-binding protein, 1A family; PFAM:
FT                   glycosyl transferase family 51; penicillin- binding protein
FT                   transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70296"
FT                   /db_xref="GOA:D5U529"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:D5U529"
FT                   /inference="protein motif:TFAM:TIGR02074"
FT                   /protein_id="ADG70296.1"
FT                   /translation="MKFLKKIWDNYNKINIEQFKKFYIVFMSVIFLAVTIVLSILAADI
FT                   VLQPDVQAVELYKPTIPTKIYDIKGEVISEFFTEQRALVEYKDLPPELIEAIISMEDNN
FT                   FMTHFGIDIFGIFRGTIGNILTGKRARGASTLTQQVARNIVLKSSERTIMRKLKEIWVT
FT                   FQIEKRLTKEEIVTLYFNQIYFGHSVYGVQAASRFYFNKDVKDLDLAECAMLATLPPAP
FT                   NAYSPINNPNISIARHKVVLNRMADLKFITREEAAEAHKEFWETYTGKIGRRGSTAYSA
FT                   SIDRAPYVTEYVRRQLVDRYGEKALKEDGLKIYTTIDIEKQEEAQRLLTEALTEYNNKY
FT                   EGGSMDIINIYNRETIDRVKMLSILFNLPENSAYNKFNIAVRDTLNKYTTLPLALISDI
FT                   FGMEEVNDITMEVMKADEAELSRQIEGALVAIDPRNGYIVSMVGGSGFTARNQFNRATQ
FT                   ARRQAGSAFKPFVYAASMDISNYSPSTIVSDAPIGFVPEEGEDGEVWIPKNYSGNFKGD
FT                   VSLRYALAASLNIATVNVLNYVGITNAINYVEPIFKAEHNSDKSKRMFNPDLTLGLGTG
FT                   LFTPLELTTGFAEFANEGKEVNPILIRYVTDRYGIVIDNFEEELKKEVTLRGGPKQVIS
FT                   KEAAYLISDILMGVLRGGTATSAMYEAGFTRRGAGKTGTSNDWKDAWFVGYTPELATGI
FT                   WIGFDSFKYSLGNNQVGGRVAAPIWGKYMVAALKEVKPTWYDRPDDIVSMQVCAISGKL
FT                   PGPSCYSFQTDLFITNKIPTETCNVCSHYLEDSNELDSIIDSFLNY"
FT   gene            256124..258001
FT                   /locus_tag="Bmur_0190"
FT   CDS_pept        256124..258001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0190"
FT                   /product="TraB determinant protein"
FT                   /note="PFAM: TraB determinant protein; KEGG:
FT                   bhy:BHWA1_00339 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70297"
FT                   /db_xref="UniProtKB/TrEMBL:D5U530"
FT                   /inference="protein motif:PFAM:PF01963"
FT                   /protein_id="ADG70297.1"
FT                   /translation="MVDINSDILRYKNILAIPSIHSRVYFSMAVREAFYNFKPDIVAIE
FT                   HPANFADSLREAVSRLPYISLIIREIENEAVYIPIDPCDSIIEAVRLAIDEEIPFFPID
FT                   KDITSINTNSHYLMPDDYIMKNIGIDRFYSEVKSKYIFHKDDTDEEREIYMAKNIHELS
FT                   KKYNKILLVIGMSHWESIVSILKKLDKLNSKEKEEIINKKFYEDYEEYEYSEPKIYNVH
FT                   KESLNKMLGEFPFTTYMYELYRNGELESFDKINIIETIFKEAKLRYKLPISLLQQKNMM
FT                   KYLRNICLLDNYIIPDYIDMLTAAKCMINNDYALEVMEGMEYYPNYTEEDENYPTIKLN
FT                   RDPSTNGMEGMLKDKKIKLHKYDNVWRTSFKKVHVTTRPSEKYEGEWEDVWNKRTNLLS
FT                   HVPEDILMEKHMNILREKIRNMLTEDKAKIEPFTVSIKDGIDMRETIRNYYKNEIYVKE
FT                   IPKMKGNIGHMVVIFDDDHDEDYDWNIVWYSEAHDDSDLILYSTEPGNTLVGPGISKCY
FT                   FGGYASLMPPQAPHDVWRMYYELKKENIVRNYADLLLYTAIIYSVDKYLGYVAPNPPSD
FT                   ILKEFAKKNAVEIVYVPLATFSSETLRKLRHFHVLGNKRLRKIADDYII"
FT   gene            complement(258009..259838)
FT                   /locus_tag="Bmur_0191"
FT   CDS_pept        complement(258009..259838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0191"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cai:Caci_4166 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70298"
FT                   /db_xref="UniProtKB/TrEMBL:D5U531"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG70298.1"
FT                   /translation="MNIESYPKWDNYYVEDDNNSEFQSDKMERPPLTGKNRYVPNGLYD
FT                   EKWGNVYDAYGKADLTPYYIEALTSNDDNDVNFGVYGLYSATTHQGSVYKSSKMAVPYL
FT                   ADLLKFNNNSSELACIFLSRIALGENHFINTPFFYKTKYYSSVKKYKDEIINYYNKSNS
FT                   LNAMRLLCFISKSLPKVLNVSYEECLKIENGNKNNAYIRQASTLLVQGFTAAQYNYKIS
FT                   DKNYYKEYPNIDMTDDSYKKLEVHNHIEEVYNIMKTSESLLVRGSAAICLAYTGVFNKD
FT                   ISDLLLYIAENNCTGVDWVWDDNFSNIAKHAWTYSSDIETLLNTEGIKTKSDVCIAGSV
FT                   SNEKSYDDILIEAVVRVFPYKEKRNELINMELNNIQKRVLKIIIDKAPNLLESYELVAI
FT                   NMPLNIEAVNRLIDDDYIKNKILCKIISSKPLWYIIEEALIKKDEKTITDTIINNNIDA
FT                   LKLLYEIYVPIKNIVNRDVIKNTLNIYIDLDKKILDETNTILLSSIADCIVYNIGSYKN
FT                   EIFNYLDETLIKVRDFKDDYDYSEKLIGEYAGVFLLALGRSKLLDEKYYILVRPFHRYV
FT                   KYSSFPSKLFFELLNYTSLEHIEYIKNRFSIKI"
FT   gene            complement(259835..260884)
FT                   /locus_tag="Bmur_0192"
FT   CDS_pept        complement(259835..260884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0192"
FT                   /product="TPR repeat-containing protein"
FT                   /note="KEGG: pmt:PMT0296 TPR repeat-containing protein;
FT                   PFAM: TPR repeat-containing protein; SMART:
FT                   Tetratricopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70299"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D5U532"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ADG70299.1"
FT                   /translation="MVDDLLKLAYEAFDNEDYENAIEYCDKLIFYNGDNEGVYNYRGLA
FT                   KSNLGKYKEALDDFNTALKLDNNNADIYYNKGVTEYHMGDYDKAIEDYTKSIELDNSID
FT                   DVYNNRGLCYSALGDFEKAIEDFTYAIELNNEDSQYYYNRGLAKDNLEDFESALDDYDK
FT                   AIEINPKYSNAYNNRGNAKAELNYDEEDIIKDYDKAIELDNNNINAHFNKALYYDINEN
FT                   YEQALNIYNQLLEIDEYYIEGYGNRALILYKLNKYDESIKDCDKAIELDSKYWLLYLNR
FT                   AEIKLEVAKKNIDDFKKLNDEVFEDIKKSYELALEDEDNLNEFNNFVSELANEGFEAAI
FT                   KFCKEYKLL"
FT   gene            261167..262522
FT                   /locus_tag="Bmur_0193"
FT   CDS_pept        261167..262522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0193"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diamin
FT                   opimelate/D-alanyl-D-alanylligase"
FT                   /note="KEGG: bhy:BHWA1_00736 UDP-N-acetylmuramoylalanyl-D-
FT                   glutamyl-2,6-diaminopimelate--D-alanyl- D-alanyl ligase;
FT                   TIGRFAM:UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-di
FT                   aminopimelate/D-alanyl-D-alanylligase; PFAM: Mur ligase
FT                   middle domain protein; cytoplasmic peptidoglycan synthetase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70300"
FT                   /db_xref="GOA:D5U533"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D5U533"
FT                   /inference="protein motif:TFAM:TIGR01143"
FT                   /protein_id="ADG70300.1"
FT                   /translation="MGKTSLKNIIKVSKELNSKYSKNIEELDIDKELEISTDSRDSFDS
FT                   TKLFLAIKGDKFDGNKFALETYNKGCRYFILSDQTINMPDNAKVFYTDDTILFFIKLAR
FT                   EYRRRFNIPIISVTGSCGKTTTKELTHLFLSTKYKALKTEGNFNNEIGVPKTMFNLDTS
FT                   YEIAVIEAGMNHKNELLRISECIEANTVIINNVEPVHIAHLGSIENIAYAKAELFNHTK
FT                   ENANAVINKNTNCADILKKEAKRNNIKNIIEADIKEIVKKDDNSFEYKGIIFNHNLVGD
FT                   FNLYNVLSALKAAEIYNIDLKKCADILLNYQSQKNRMQIINIKGCNIINDCYNSNPAAL
FT                   KNMLKYLSQRNESKKIAVIGDMLETETENSSYHKEIGNNINELKNIDTVIAVGEHSKDI
FT                   YNIVNCEKYYFENAQSAIEKVKDFLKDNTAMLIKASLGMGFAVIIDSIKENK"
FT   gene            262525..263286
FT                   /locus_tag="Bmur_0194"
FT   CDS_pept        262525..263286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0194"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00735 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70301"
FT                   /db_xref="InterPro:IPR025357"
FT                   /db_xref="UniProtKB/TrEMBL:D5U534"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00735"
FT                   /protein_id="ADG70301.1"
FT                   /translation="MNNLIQNNYVIGFILLDDKNFNDFSNQLKKDWNIDINIVSYNNKN
FT                   TFTIDNINFEYELAHFKVPDKEAEILINYNDIDNTTKEKILNHKSFVSINANSKNISFK
FT                   DIALTFSKIIYSIIKQNNVSAVLIGEINLLISNNTYLSEMEEYIKNNKYFPTRLWVRVD
FT                   IFSDNNGNHAFTEGLKNFGKYEIMAYKTVRDAKSIINLLTILSRSIIENNLNLEDGNTM
FT                   QTDDNYIGMFKFFDNKFIMLEKNFKDINKNQ"
FT   gene            complement(263421..267020)
FT                   /locus_tag="Bmur_0195"
FT   CDS_pept        complement(263421..267020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0195"
FT                   /product="cell division FtsK/SpoIIIE"
FT                   /note="KEGG: bhy:BHWA1_00612 DNA segregation ATPase
FT                   FtsK/SpoIIIE-like protein; PFAM: cell divisionFtsK/SpoIIIE;
FT                   DNA translocase ftsK gamma; SMART: DNA translocase ftsK
FT                   gamma; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70302"
FT                   /db_xref="GOA:D5U535"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR025199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:D5U535"
FT                   /inference="protein motif:PFAM:PF01580"
FT                   /protein_id="ADG70302.1"
FT                   /translation="MFGLFKRKLAIQKRAEIRNANKKYTSDNFDDNYENRNIFFDIAGF
FT                   LCILFSGILLLSYFSMNMEDLNSGKEIKNLLGIFGAYISAYSFLAFGFSSYIIPAFFMY
FT                   AGVNIILKNSTDKILVSALSSSILMILLSILLNIFLGNLDFYNKGGMMGEFIGGSLVSL
FT                   FGKTGAVMIVLSAFLITAIIFAKVSIIDLVNYLIEMFKNVKVIEKKVVDGIKDFEMKNM
FT                   HHDDSIINNQTSENNSSDNKSYTKDYLPLFYTKEISELELKTVPFIEKVNDFDEKSYRE
FT                   KFLRKNNVSHNFNDNFFNRSSKESKEIDSIVSELKNHRFGGINVNTMESREEDLGLTLA
FT                   EAVFGRDRANRGHNNVYESSMEREDNFYREYYNDIINKKKNDEIENNKNNIEDNEIFEG
FT                   LDYNINYLRKSDFKRAAYDDSVNNYAKYNVSEQYIKAKETEHFNDDFIYNYYENDFNTE
FT                   EEDSFEKLQRLVEENKESKKIKEIKELEYNADIDNIIETINNKKDNIEAEKYQSRNSNN
FT                   NKKEVFEFAMGYASKRAYNRADHIPNYSNYSYNNSIDTRIDEFDLDEEELYNADNNSDS
FT                   IEDIRLKTRTINKTDDYEEENNYLNDTYLDSSKNNFNPNINDNNSSENTSETITIIEEK
FT                   NNDITEDFNDYADKENSDNIFENNTEINNAQKEETAGFINMESQRNVDTLNKPKKVILG
FT                   TKNIRNMDSERIQSNFDTKYVDKHYKHPPFDLLNRSIPVNDSAMMESIKQTAMQLEHTL
FT                   LDFNIEAKVTGVSRGPVITRYELEIASGIRVSKISNLTDNIALALASESVRIIAPIPGR
FT                   SVIGIEIPNKVRNAVFLRDVLESTDFRKSKLDIPFVLGKGIYGNNVISDMSEAPHLLVA
FT                   GTTGSGKSVCLSTIILSLLYKFRPDELKFIFVDKKRVELSIYNGIPHLMSPVVSDEKKA
FT                   TIVLRYIVDIMEKRYERMERFFVRNVKTYNEKVRQLLKEGETEFNGEPLELFPYIVLVI
FT                   DELHNLMVVASKEVEDLISRLAGMSRAVGIHLIIATQRPSADVVTGVIKANLPTRIAFQ
FT                   VPNKTNSRIIIDMSGAEQLLGKGDALFCASGSQMPDRVQGAFVSDNEVKKVVDYLSGQM
FT                   SPMFDESLIAALEGSDADDKNSDEEDILDEELWEDAVQLVARTGKASASFLQRRLKIGY
FT                   NRAARIVEIMERQGIVGPENGSKPREVLITLDE"
FT   gene            complement(267036..267845)
FT                   /locus_tag="Bmur_0196"
FT   CDS_pept        complement(267036..267845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0196"
FT                   /product="Bacitracin resistance protein BacA"
FT                   /note="PFAM: Bacitracin resistance protein BacA; KEGG:
FT                   bhy:BHWA1_00613 undecaprenyl pyrophosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70303"
FT                   /db_xref="GOA:D5U536"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/TrEMBL:D5U536"
FT                   /inference="protein motif:PFAM:PF02673"
FT                   /protein_id="ADG70303.1"
FT                   /translation="MIKAVILGFIQAITEFLPVSSSGHLRIAEYFLNFHAENILSFEVA
FT                   LHFGTFLATCIIFHKDIIKAISGFFLGLKDAKNSSRNNEGFRTSLMVIIASIPVAAVGP
FT                   LLEEYLSNLEIQRIGLNLVITGSILLLTRKFDKNTYINDTKDVFSMSYYNAFIIGLAQA
FT                   IAVFPGISRSGMTISIALFIGLNRDWAGRFSFLISLPAIFGALLLSIKDLADFNITYAL
FT                   VGFITAFIFGIIALKFLMAFLKKGKLFYFGFYCMIVGIAVLVYFMGL"
FT   gene            complement(268017..268745)
FT                   /locus_tag="Bmur_0197"
FT   CDS_pept        complement(268017..268745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0197"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00640 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70304"
FT                   /db_xref="UniProtKB/TrEMBL:D5U537"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00640"
FT                   /protein_id="ADG70304.1"
FT                   /translation="MKKIFLAIISIFIIQIQTAFADFNAGIGLYVPLGASISQSYQDYK
FT                   LGVNNNDGKLTTGAAFEWGVGITPGIYNGFDNYMGFSLSLDIAYHRDVYAYNESKSAGA
FT                   TGQFQNVKTTYYFDTLTIGILPKFNIKSFFIGVGAGVKILLAGGESTQNYNTTYSQFEK
FT                   VNYYYNLSDIKNKYKMPVIPYVKLTLDYLFYFSDETALGIGIYAGYDFGPGIVNDSRFS
FT                   KNDFGAVDIGGQISLYLVDN"
FT   sig_peptide     complement(268680..268745)
FT                   /locus_tag="Bmur_0197"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.961) with cleavage site probability 0.958 at
FT                   residue 22"
FT   gene            complement(268876..275883)
FT                   /locus_tag="Bmur_0198"
FT   CDS_pept        complement(268876..275883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0198"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="KEGG: bhy:BHWA1_00641 hypothetical protein; PFAM:
FT                   Tetratricopeptide TPR_2 repeat protein; WD40 domain protein
FT                   beta Propeller; TPR repeat-containing protein; SMART:
FT                   Tetratricopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70305"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D5U538"
FT                   /inference="protein motif:PFAM:PF07719"
FT                   /protein_id="ADG70305.1"
FT                   /translation="MKLKYYIKLKLLILFSFILFACASSQKNDDSVFSSRPFLREYKRY
FT                   SLTSGEVNPALDAVIDRDGTWVYYARENAGNTDIFAIDSYTLETFRLTRSPGIDTSVSV
FT                   DDKSKYVVFSSTRDDAFGDIYAYKLVNLVGIRTSKNNLENLEQSIIRLTDYKGYDVDPV
FT                   ISHRGNMIAFVSDRDAGIKKLFTMRNNGKDVRKLSDIEASSPAFSFDDTKIAFITSKIG
FT                   EPYSQLAILDLTSSTNDQTNLTILTSTKTFKFNPTFYNDDTIIFFEIEKDSDRDGNLTY
FT                   YDKRRLMSYSLATHQAYVLSEDTQLTTFNVAYPSALVGAYVVSEDGTSIVTMGSTKEYF
FT                   IKDDNSQTMYESFVELPYDRKVDVIDRFSEYFPFQDDEGNVAKAYFNIMISSYTNNNIN
FT                   EYNKAKNTLTQEYSNTFVGFLTSRIYTNFYTNENIFNLDFYTNDFFATNKNFKNLDITN
FT                   LLGWAGYISANEKYKNNNSDKDTLLILDNLINLNISKDLYILAAKLYAHSVEDNGYKYP
FT                   EDEDMYNVPYKRKDLLFSDRLEIAKDFIRDTKISYNIIINNAHPYAPLSAAARLIYLDG
FT                   LILSRNYEEAANLFIPYTESKNDIMLALGYYGNAKVLLAQNDDGAYALLKNALTSGGEN
FT                   FKSTYEAEDCKNKLASYYKSLADDAYNQGRYAAAYDNYNEVLKYSPNDTTASARVIESG
FT                   LRAYSTIDSLERTIYERERTILSTRYSDHEAHAELANAYYYLANRYYGMALSKQYSKER
FT                   YVISDKKREDGFYLYLNKSFEAIVDKAVSYIDFAIFLYPDEEDYYIKKAEMLTFAQALK
FT                   MQVLQDTKTYKSVIELVPAYKDNTVTNDVYMGYNLLAFQTADLDSEIIDALIMAKSKVK
FT                   TKPNIVSIMLANSYLINGRYSDAVNEYKEAESLLNQVGTDKSRAWYHFFYGYSLWMNND
FT                   IKGAYREYDTARKLFEKLGDKESIYKIVGYTSVAAIEQEDYEKAIESLLERDKLTENDV
FT                   NKNELNQLLLAACYLKLEDYNNALAYCDSVKAQIDSLDSSVYTPNYVSITLYGANINIV
FT                   NLGLASFGGYIPGEPLNVDKQQMLYSIYQELYEKMGRYSEAREALSSYRNYIMQDKPKK
FT                   SIQPLMLATYFNNEGYLYYKQGDQSNSIMSFKSSIKEYQKTLDPKTLENNPSLQYQNAE
FT                   NDAKNYLSLSSLYLRYLSENDLTSIKKEFFIELFNTTKTLKVLSTNNAVSTKDRLLLYS
FT                   HIAAFQYIMAFKLTADNSIEYKRTNNDDPTDMTDYDINVQRLTMLKDAIDRYKYILSSN
FT                   SNFPVDLKTEIIVRYNLAKAYELAGYIEEAAREYMSAFSKAQVSAFAVEEIAILTTLID
FT                   FSTKYRNRYPDSLDYPVQYVFRILQRISESVFMITFVEDNNFILIQAKRKVIEFLQDKY
FT                   PDASLNILAMFDAIDMRRKFLDRRLYTLGENNYYLREYYKLYENALYAYQRYLDAVATP
FT                   YDSKREAAALKEIANYEKEAIKRFSNTPIEPIVICDVKPADIDKSMRKDETLIWDTFFG
FT                   YRFVRENGKTSFYLQSNAMPKTKNYVTHIGFRPIIISNKNIFVRELYDSTEYMLPAKTA
FT                   YIDTKLISFYRTTRSAEKEINSSMSMMSNTNSTNSAYSYNINAQETNNYEYRRNTLAMN
FT                   VAYNTAETNLSETNYTTNALSTNNTSSTNRRRRGNFRFIELKDIAANSYVPLIVDITGA
FT                   GASDISNVMSKNLYIVYSDKETFDKNRRVLRNINNIALVVGNSGRDSRVMFYTNYFRKL
FT                   STNSLEDAMKGYDNNLFTIYGKPDYSMTSLSNAAYNFKTRLYASYADTENPSVSMMSNV
FT                   IAYSQSDDEKMFNYAVIVEDRYAAKDTNTAYLFSEEGYKFFASSYSNISDSNAYKFIKS
FT                   MLPVYRRMGEDGAVKGANRALHFVYLYTNNNYDLVDEYFTPRTLSRFLKAKDNPEESVK
FT                   YLNYIANRVNGDNKEKILEVAVLYDLIYAKTPIDTVTNFLNRMQNTNEVLTVANTILDT
FT                   SVTNESDIFTTMNYIYGNQYVFETETVSSFADRFYSLYKTNSAYIYGLLNKIRVPESDF
FT                   DKNIANAYDIFSNESTNTMFIFYAYENDKYTAYSYVVGDSEVKKSSLIDMKKLSGYLES
FT                   FTNATKARDRRTALRSIESGMLSSDIIKDAQRAQRIYITGSYANLFTVPFAYLNSFRSN
FT                   DVVKIRELEYSPSYVLNVGKPKIKLNTETNFYTSLETSAVEKFTNPNGNIPLTHYIGID
FT                   TNRNKPFDKEDIFLSPARNADIFMYLAARSDTKLMFTYTTNSAGDYYTIMKYLYERFDN
FT                   GIIDAYRFIKTNRVNVNTINSSDRDTLYNANYALFDYILPGIPKDVNR"
FT   gene            complement(275986..276318)
FT                   /locus_tag="Bmur_0199"
FT   CDS_pept        complement(275986..276318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0199"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="KEGG: bhy:BHWA1_00642 anti-sigma factor antagonist;
FT                   TIGRFAM: anti-anti-sigma factor; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70306"
FT                   /db_xref="GOA:D5U539"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D5U539"
FT                   /inference="protein motif:TFAM:TIGR00377"
FT                   /protein_id="ADG70306.1"
FT                   /translation="MSLNIDDKGKVKVVSLAGKLDVNLSVSIEAELEQLVESGSHFLIL
FT                   ELSGIEYLSSSGIRVFISIMRKIKDKNGRLVLACVPDIIKKILKTVELEDLFEVYDTVD
FT                   DAVASF"
FT   gene            complement(276520..277038)
FT                   /locus_tag="Bmur_0200"
FT   CDS_pept        complement(276520..277038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0200"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00643 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70307"
FT                   /db_xref="UniProtKB/TrEMBL:D5U540"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00643"
FT                   /protein_id="ADG70307.1"
FT                   /translation="MQYVFIILVILLVLIVLFFINHKSVISYDNAWVRLVQNKTVKDAD
FT                   KSYLFKEDAELIIGGKKKLNFVKAKCDNMAVYSNTDYLNKFMLVFSGYPSVKVTFMEGY
FT                   IVENNKLYYTYAYKASYYTKLNNWMKINGVFQTKEVWVAKKNIKWSAFPYPTASDINWE
FT                   KKAMIGSLS"
FT   gene            complement(277047..277577)
FT                   /locus_tag="Bmur_0201"
FT   CDS_pept        complement(277047..277577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0201"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00644 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70308"
FT                   /db_xref="UniProtKB/TrEMBL:D5U541"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00644"
FT                   /protein_id="ADG70308.1"
FT                   /translation="MKKIIILISLFVLCFNLLNAQNITKDSDYSKNWANFIFRKTIDMR
FT                   GALYEGRPGGDLELVSGKSPMFLIKMYKFMGARSDTHAYYTHQVPISMFYDNAPALGVN
FT                   LVEGYSIEGGKIMRYSKYIRSYQGKLDSWKKSNSVYTNERWVANSDADWGSYPVPQPED
FT                   VNWAEGEYAGELY"
FT   sig_peptide     complement(277515..277577)
FT                   /locus_tag="Bmur_0201"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.903 at
FT                   residue 21"
FT   gene            complement(277807..278394)
FT                   /locus_tag="Bmur_0202"
FT   CDS_pept        complement(277807..278394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0202"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /note="KEGG: bhy:BHWA1_00645 regulatory protein TetR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70309"
FT                   /db_xref="GOA:D5U542"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039532"
FT                   /db_xref="UniProtKB/TrEMBL:D5U542"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00645"
FT                   /protein_id="ADG70309.1"
FT                   /translation="MKNSSNKNNARVKKTKKILEDSLGLLLEEKPFEDIRVIDICAKAN
FT                   MHRSTFYTYYNDKYELLKSKLDEYEAKFLEDLNRYKIENKLKDEHVDIMEKILQYFYLN
FT                   RKYLKIIFQNNKDGSITKILREYLASYVIEGIKDFKTIRPDKENVVRIMGSFYSGAFIS
FT                   VLTDWILNDCFISVEDLAVYISDIIMQRVFSE"
FT   gene            278710..281883
FT                   /locus_tag="Bmur_0203"
FT   CDS_pept        278710..281883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0203"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   bhy:BHWA1_00646 acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70310"
FT                   /db_xref="GOA:D5U543"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D5U543"
FT                   /inference="protein motif:PFAM:PF00873"
FT                   /protein_id="ADG70310.1"
FT                   /translation="MKQLIYFFASNRMLVNIIIFVSIMIGLYSYYNIDKESFPSTDLEL
FT                   MILQVVYPGASPLDVEQNAVIQIEDQLRSISGIDEFTSIITENAAIIFVQLDMEIDTSK
FT                   AKDDIFRKMQSVPDMAEEVETIEITDINPKLTPIYNIGVHFKKGFEGDEKVLYDFSKEL
FT                   ERQLKYVDGVADITVQGRTDPEVKILADPKKLQEYYISLTDIVNSLSARNIRATSGDFK
FT                   KPLYEDLAENEEEKTIVTMGQFENPIEATNVVVRSTFNGQRVRIQDLAKVNRDFVEKSI
FT                   YVRINSVAGYSLNIQKKENADIVKTTENINNFLKNNQNIIPENVEVTTMGETSRMVLAL
FT                   TNVAASNLIFGFIIILIVLLIFLDFKSALFTSIGMIVVIFITFSYINFSDLTFNIISLA
FT                   GIITVIGMVVDNSIVVCENIYDFQKAGKTGLEGTVEAVRDVVSPIMVATMTTVVAFMPM
FT                   LLTKDVVGKLIAPFPKVVVVALIASLFQAIFLLPNNLQDKTNKNLKFLKKIKNPLDFDK
FT                   EKLFNAMKNPFNKALKTLLKFRYLVVLFFIVLLIFSFFLAKESLKKFILIYDTSSDSIM
FT                   INIDSGIGNSINNTMKYVEQIENIIYKSVDDKNLIAVNSVVGKQVNQNIVDISEESANL
FT                   AGITVYLIPSTERKKTAYDIMDDINRELEKTSLREELDALMVSVKLPMDPGKAVDIKIV
FT                   GNDLEQTRKVRDEVKSYLLSLNGVINYYDDDKAGKNELRVLFDYDEIAQLGMNVANVAN
FT                   ELRTAYSGTVATSIQELDYKLDFRVQLDRNYIFDTNVLNNLVIPNTYNRLLYLKNVANI
FT                   VETNGVSSIRHYNGQRCITINADLVQGQNTSIQVMFAVQNKFKDISQRYPGIIIGFGGE
FT                   ADQTVGALDGLTVTLLIAIVLIYLILLLQFKKFVQPLMIMFLIPFTLTGVFIAFYLHGM
FT                   PMSFIGFIGIVGLCGVLVNDGIIMIDLINKIIESGKTDAEALSNPKKFAFSSIAEGATQ
FT                   RLLPIFLTTVTTVGGLLPTVYGIGGRADLIVPIVMSLAYGLIFSTLITLIFLPCVFMIA
FT                   FDLRLIKLK"
FT   gene            complement(282218..283849)
FT                   /locus_tag="Bmur_0204"
FT   CDS_pept        complement(282218..283849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0204"
FT                   /product="chaperonin GroEL"
FT                   /note="KEGG: bhy:BHWA1_00165 chaperonin GroEL; TIGRFAM:
FT                   chaperonin GroEL; PFAM: chaperonin Cpn60/TCP-1"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70311"
FT                   /db_xref="GOA:D5U544"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:D5U544"
FT                   /inference="protein motif:TFAM:TIGR02348"
FT                   /protein_id="ADG70311.1"
FT                   /translation="MAAKQLLFDEEARRALMRGVDALANAVKVTLGPRGRNVVIDKKFG
FT                   PPTIINDGVTIAKEIELEDPFENMGAQIVKEVATKTNDVAGDGTTTATVLAQAMVKEGL
FT                   KNVTSGANPMLIKRGIEKAVNEIVGYIKSEAKQIKGKEEIAQVATISANNDKEIGSLIS
FT                   DAMEKVGKEGVITVEEAKSLETSLSLVEGMQFDRGYISPYFVTNGDSMTAELEDALLLI
FT                   YDKKISNMKELLPILEKIAQTGRPFIIIAEDIENEALATLVLNKMRGVLNVCAVKAPGF
FT                   GDRRKAMLEDIAILTGGQVISEDLGMKLENASIEQLGKAKKITVDKENTTIVEGAGSKE
FT                   DVKNRVTVIKKQIEETDSDYDREKLQERLAKLSGGVAVINIGAATEVEMKEKKARVEDA
FT                   LSATRAAVEEGVIPGGGITYLHAQGKLDSLKADNADEQVGINIVKRAIEEPIRMIATNA
FT                   GLDGSVVAIQAKEQKGNMGFNALTNEWVDMLKAGIIDPAKVSRSALQNAASIASQVLTA
FT                   EVIITDIPEPEKAMPPMPGGGMGGMY"
FT   gene            complement(284041..284250)
FT                   /locus_tag="Bmur_0205"
FT   CDS_pept        complement(284041..284250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0205"
FT                   /product="ribosomal protein S21"
FT                   /note="KEGG: bhy:BHWA1_00164 30S ribosomal protein S21
FT                   putative; TIGRFAM: ribosomal protein S21; PFAM: ribosomal
FT                   protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70312"
FT                   /db_xref="GOA:D5U545"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/TrEMBL:D5U545"
FT                   /inference="protein motif:TFAM:TIGR00030"
FT                   /protein_id="ADG70312.1"
FT                   /translation="MVRVFANEGEPVESVIKRFRRACENEGILQDLKEKQFYKKPSLEK
FT                   KLQREKALKRMKRKIKKERRLGLL"
FT   gene            complement(284280..284353)
FT                   /locus_tag="Bmur_R0005"
FT                   /note="tRNA-Met3"
FT   tRNA            complement(284280..284353)
FT                   /locus_tag="Bmur_R0005"
FT                   /product="tRNA-Met"
FT   gene            complement(284385..284457)
FT                   /locus_tag="Bmur_R0006"
FT                   /note="tRNA-Met2"
FT   tRNA            complement(284385..284457)
FT                   /locus_tag="Bmur_R0006"
FT                   /product="tRNA-Met"
FT   gene            complement(284513..285448)
FT                   /locus_tag="Bmur_0206"
FT   CDS_pept        complement(284513..285448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0206"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00161 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70313"
FT                   /db_xref="UniProtKB/TrEMBL:D5U546"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00161"
FT                   /protein_id="ADG70313.1"
FT                   /translation="MNNKFNIEMFDDVNVLKELSKTWHSYYDFRMSCISLKNSEYLLSI
FT                   LSLILNPSNNCEFKDIAMISYSILEEYHSKYKEFSILKDFIQSDYNSEVFSKIVSRLEE
FT                   REIKIDRSYDEEISYVDNIDLDPLLKLLVYQKISYEYVKDYQSCFIICRVVFNIYSYKL
FT                   KLLDKPILYPYQFFEMSMNESSNKESIIKYLQFLRGICLYAVDTISFVHSNLKVLRDKL
FT                   LQNKNFKKLADSSVFYMIFITPYIRIIDLMNMFDWKRDKAARLLSRLKSEGLFIESKLK
FT                   KEKIFINKYIINLFESGEALKPEEFLNKFI"
FT   gene            complement(285502..286392)
FT                   /locus_tag="Bmur_0207"
FT   CDS_pept        complement(285502..286392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0207"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00691 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70314"
FT                   /db_xref="UniProtKB/TrEMBL:D5U547"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00691"
FT                   /protein_id="ADG70314.1"
FT                   /translation="MDSKEIKHLVNELFNGEYSDILKPLSVGNTFLAKSTLNSYIREFN
FT                   GKRKLNALELFTSENSKLHYEDDGSVIKVIKNLIDNKDINGIDNIDFNLTANNALLYGD
FT                   FVRFIYAFYFGGYREELNILVKRIYELISKISHNIVSSFKNTASINRVSIVITSSIYRS
FT                   ILDVLSDFSEIAGDARSRAEVMYYKSYITCNVMANYRGLVGPDMIKTALCFEEIEDFER
FT                   AEKMYDAVITDFECVLSGITYHFDNYNIDDKAEDYVALISLWQACDGINRIEDINKYEA
FT                   KMEAIEKAIKKLSSI"
FT   gene            complement(287066..287872)
FT                   /locus_tag="Bmur_0208"
FT   CDS_pept        complement(287066..287872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0208"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   bhy:BHWA1_00630 Ttg2B, ABC-type transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70315"
FT                   /db_xref="GOA:D5U548"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:D5U548"
FT                   /inference="protein motif:PFAM:PF02405"
FT                   /protein_id="ADG70315.1"
FT                   /translation="MELFDVKIELRKGVKNKINYFLATLGEFAFLIIEVFRYTFRSSFS
FT                   FKLLKEQIIRMGVDSFVVAAVTVLCTGMVMSLQIAVVLDSVLKGISQFVGSMVGKAMVK
FT                   ELSPMLLALIFAGRVGSSVTAEIGTMQVSEQLDALKTLYTNPIEYVAVPRFWAAVISLP
FT                   MLTVSANIIGVVGGAIVTVFVLHSDPMHYFDRAIAVISVGDFIGSLIKSTIFGAEVIII
FT                   SCFYGFRTSGGAEGVGKATTTSVVYSFMIILITDYILVSILGLFGM"
FT   gene            complement(287894..289297)
FT                   /locus_tag="Bmur_0209"
FT   CDS_pept        complement(287894..289297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0209"
FT                   /product="replicative DNA helicase"
FT                   /note="KEGG: bhy:BHWA1_00631 DNA helicase, DnaB type;
FT                   TIGRFAM: replicative DNA helicase; PFAM: DnaB domain
FT                   protein helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70316"
FT                   /db_xref="GOA:D5U549"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:D5U549"
FT                   /inference="protein motif:TFAM:TIGR00665"
FT                   /protein_id="ADG70316.1"
FT                   /translation="MNNTPCSIEAEESLLGAMLQNSQAISAALSKIKSTDFYSERNRLL
FT                   YESIIEMNNRGIAVNAETTLRYLKENGLFEKIIQNDEAYLMRIIDGTPFHQNAKYYAEI
FT                   IAEKSLLRDLITAAQDIQKSAYEAKDAETKEIADFAEKKIFEVTQRRLSNDFIHIRELL
FT                   YEALTTIESRKKHKGTVTGVPSGFISLDKITHGFQPSDLIILAARPSVGKTSFALNIVE
FT                   HVITNIETTGFGIGFFSLEMSRMQLVERLIASKARISLSRIRSGDLEKQEWTKLGQTFN
FT                   SLSQANLLIDDSSQLTIMEIRGIARQMKYRFAEMSKTSGKEIDLKLIVVDYLQLIHSGV
FT                   QTRRNGTREQEIADISRGLKALAKELNVPVISLAQLSRAVEQRQDKPRLSDLRESGSIE
FT                   QDADIVMFLHRQKPNKEEKDDEVIDDKTNQVEVILAKHRNGAIHDGIPLHFIADQTRFE
FT                   NIYNNNNDA"
FT   gene            complement(289335..289853)
FT                   /locus_tag="Bmur_0210"
FT   CDS_pept        complement(289335..289853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0210"
FT                   /product="ribosomal protein L9"
FT                   /note="KEGG: bhy:BHWA1_00632 50S ribosomal protein L9;
FT                   TIGRFAM: ribosomal protein L9; PFAM: Ribosomal protein
FT                   L9-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70317"
FT                   /db_xref="GOA:D5U550"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/TrEMBL:D5U550"
FT                   /inference="protein motif:TFAM:TIGR00158"
FT                   /protein_id="ADG70317.1"
FT                   /translation="MEVILKKDFISLGYEGDICKVKDGYARNYLIPRNIAVIKNAANLR
FT                   TLAQMQKSLEKKRAKRKMEAEILKGKIVDISVVIPMKVAENGKLYGSVSQQTIVDALKE
FT                   KEIDINKRDVHMEKHIKELGEFDVEIKLYHSVNAVIKIKVVNIDNNEVVEVTEEIKEEN
FT                   NNTSETVQA"
FT   gene            290039..290554
FT                   /locus_tag="Bmur_0211"
FT   CDS_pept        290039..290554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0211"
FT                   /product="flavodoxin/nitric oxide synthase"
FT                   /note="PFAM: flavodoxin/nitric oxide synthase; KEGG:
FT                   bhy:BHWA1_00633 flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70318"
FT                   /db_xref="GOA:D5U551"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D5U551"
FT                   /inference="protein motif:PFAM:PF00258"
FT                   /protein_id="ADG70318.1"
FT                   /translation="MKYSIVYTSKSGNTEKLALAIKESANGECLQCVKADAADANKIAE
FT                   SDLVFVGAGSYKGTCDEAAGKFMQTLKNKKVFLFMTVGYGNNQEYYDKMLNPAKTFLDS
FT                   SNTLAGTYACQGQWIDGQKKNLENMLEKAATDDEKKVVQSKLANYDNAMGHPNADDLNK
FT                   LKEAIKTL"
FT   gene            complement(290633..291445)
FT                   /locus_tag="Bmur_0212"
FT   CDS_pept        complement(290633..291445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0212"
FT                   /product="hydrolase, TatD family"
FT                   /note="KEGG: bhy:BHWA1_00634 TatD protein; TIGRFAM:
FT                   hydrolase, TatD family; PFAM: TatD-related
FT                   deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70319"
FT                   /db_xref="GOA:D5U552"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D5U552"
FT                   /inference="protein motif:TFAM:TIGR00010"
FT                   /protein_id="ADG70319.1"
FT                   /translation="MIDSHCHLTYISKKSKELEEVLERANKAGIFYFVDIGVHPNDIDE
FT                   RMFILSDAEGVFFSMGYYPDYANENDEDTLKAFELKIKNLNKKTLKNKNKSIYAVGEIG
FT                   LDYYHDDSNKNEQREFFLALCEAAKNTDLPILIHSRNAFKDTFKILREADIPKRGIFHC
FT                   FSGNVEDAKNALDLGYILSFSGSSTYIKNDFIREAFKYVPKDMFTIETDAPYLTPQKVR
FT                   GRANEPSFIPYTVEVLAEASGEKSEDIMRKALENTVRVLELPIDLNRI"
FT   gene            complement(291466..291816)
FT                   /locus_tag="Bmur_0213"
FT   CDS_pept        complement(291466..291816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0213"
FT                   /product="histidine triad (HIT) protein"
FT                   /note="PFAM: histidine triad (HIT) protein; KEGG:
FT                   bhy:BHWA1_00635 protein kinase C"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70320"
FT                   /db_xref="GOA:D5U553"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:D5U553"
FT                   /inference="protein motif:PFAM:PF01230"
FT                   /protein_id="ADG70320.1"
FT                   /translation="MSNYNDDKYFDKDCIFCKIIKGDIPSNFIKENEYCVVFADLNPKA
FT                   KVHLLVVPKPHVQNILETDEFLMNKVLETIKEVSKEQKLESFRVINNCGKGAGQSVFHV
FT                   HFHILSGDNLEE"
FT   gene            291995..292801
FT                   /locus_tag="Bmur_0214"
FT   CDS_pept        291995..292801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0214"
FT                   /product="zinc/iron permease"
FT                   /note="PFAM: zinc/iron permease; KEGG: bhy:BHWA1_00636 zinc
FT                   transporter ZupT"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70321"
FT                   /db_xref="GOA:D5U554"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:D5U554"
FT                   /inference="protein motif:PFAM:PF02535"
FT                   /protein_id="ADG70321.1"
FT                   /translation="MIENIPPALLALFGGTITFTFTALGSALVFFFSKEIKHKVFASMY
FT                   GFAAGVMMAASFWSLLAPSIELSKNTNLPNWVIPAFGFLFGAFFIWVLDKILPHMHIVN
FT                   GNEQKEGTNTKLSKNILLFLAVTLHNIPEGLAVGITFGAFSIGNADVTFNAALVLALAI
FT                   GLQNFPEGAAVSLPLKTNGVSNIKSFLFGAISGIVEPIAAVIGALAVTKLTLILPIALS
FT                   FSAGAMIYVVVEELVPEAVAEEHNHFGVFGFIIGFAVMMVLDVALG"
FT   sig_peptide     291995..292072
FT                   /locus_tag="Bmur_0214"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.819) with cleavage site probability 0.794 at
FT                   residue 26"
FT   gene            292822..293772
FT                   /locus_tag="Bmur_0215"
FT   CDS_pept        292822..293772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0215"
FT                   /product="hydrolase of the alpha/beta superfamily"
FT                   /note="KEGG: bhy:BHWA1_00639 hydrolase of the alpha/beta
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70322"
FT                   /db_xref="GOA:D5U555"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5U555"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00639"
FT                   /protein_id="ADG70322.1"
FT                   /translation="MIIVLYIMLSVIIITAVTLIITANHFVNKLLIKTNKKLFERKEKT
FT                   KEEDEEKKLIKEKRKIWFEENQKDIYTVSSDNLKLHAHLINNNSNVYVIIVHPYEGRGS
FT                   YMKYFIEKFYNMGFNVLAIDLRSHGESEGNIYSLGYLERLDVLAWIKYINNNYNNAKII
FT                   LYGISMGANAVMMCSGENLNEDSNKDLNNIKAIIEDAGFTNAYEQLKERLDIANKFSFL
FT                   PIVELTSLMAKIRLRFSFNDINVEKSVSKSKVPILFIHGDKDELVNCNMLHKLYNSCSS
FT                   EKEKLIIKDGGHISAVMKDESLYWNTINNFINKYI"
FT   gene            complement(293805..294743)
FT                   /locus_tag="Bmur_0216"
FT   CDS_pept        complement(293805..294743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0216"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00660 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70323"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:D5U556"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00660"
FT                   /protein_id="ADG70323.1"
FT                   /translation="MRDINVLNDYFVRYLFSSKDSNFILLDFINSTMLDANMKTFRSVE
FT                   ILTPSPKAGSRLNYKENYDDKESIAPKVARKVDRCRRRLDVKCITQNGTVVIIEIQLQG
FT                   NSRFPERILYYWASNYSKLLKQGEKYDALTPVISINLLNFNLDNNDCIHSCYMIYDTKS
FT                   KRLLTDHLQIHIIEIKKFKDNLLDKDLDCWLKFFTIKEKDNREVIMSELVKEKPIMEEV
FT                   QKRYNNFIKDRLMMNEYDKREAYLYGNQIMLEEERRLGIEEGFKKGIEKGIEKGIKENQ
FT                   ILTAKNMKNKNIDIALISDITGLSIKEIEEL"
FT   gene            complement(294808..296145)
FT                   /locus_tag="Bmur_0217"
FT   CDS_pept        complement(294808..296145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0217"
FT                   /product="MATE efflux family protein"
FT                   /note="KEGG: bhy:BHWA1_00118 MATE efflux family protein;
FT                   TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70324"
FT                   /db_xref="GOA:D5U557"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D5U557"
FT                   /inference="protein motif:TFAM:TIGR00797"
FT                   /protein_id="ADG70324.1"
FT                   /translation="MTKDMTVGSPFKTIIYFSIPMLVGGIFQQFYGVADTIIIGKFVGS
FT                   RALAAIGATTSTMFFFLSFAIGFTNAFSIVMGQFFGAKNETMLKRTFLNSIYVTLFSSI
FT                   ILLILGVFFSRPLMVLLKTPDDIINNSVLYLQICIGLSFGQLIYNGAASILRALGDSKT
FT                   PLYFLILTTIINIILDLVFVALLNMNVAGVAIATVISQIISAFLSVLYIIKKFPMLKLN
FT                   KDDRVFDFDNLFMIIKIGFSMSIQAVFLSIGEMIISGVVNTFGTNVVASYTTGNRISQF
FT                   ASMAYFVISEAFAVYVAQNFGACKFDRIREGFKSIIILSLSLSILAAVIIFLFGDNLIE
FT                   LFISKNDKYIDTIKDICRGYLRISSLFYPFLAIILLYNNSIRAIGNAFIPLMSGIAELI
FT                   IKVGGSVFLSIPFGYVGIWFANPVGWAIGIIPTCIYFHKYAFKTKK"
FT   gene            complement(296228..297115)
FT                   /locus_tag="Bmur_0218"
FT   CDS_pept        complement(296228..297115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0218"
FT                   /product="protein of unknown function DUF58"
FT                   /note="KEGG: bhy:BHWA1_00117 von Willebrand factor type A
FT                   (vWA) domain containing protein; PFAM: protein of unknown
FT                   function DUF58; SMART: von Willebrand factor type A"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70325"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D5U558"
FT                   /inference="protein motif:PFAM:PF01882"
FT                   /protein_id="ADG70325.1"
FT                   /translation="MFTNNNMTTSELLKSVRQIEIKTSKIVNSYFAGQYHSAFKGHGIE
FT                   FDEVRKYTVGDDVRTMDWKVSARYNEPFIKRFREERELSVIILADFSASTDFGFTKTKH
FT                   NLIVELSALLGFSALKNNDKVGLLIFTDTVEKFIPLNKGRNHVLRIIRELIEFEPKSAN
FT                   TNIASALEYFNRIQKRDSITFLVTDACADLPKKEIDITRKRHDFIVCLVNDDLEYNLPN
FT                   LGGTLVLSDLENEDYVYFDMSNKRIREEYFNEQNNIMEDRLNFLKKNSIEKIVLDTSSD
FT                   YVTEVMKFFVKRRR"
FT   gene            complement(297232..298380)
FT                   /locus_tag="Bmur_0219"
FT   CDS_pept        complement(297232..298380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0219"
FT                   /product="Ankyrin"
FT                   /note="PFAM: Ankyrin; KEGG: bhy:BHWA1_00116 ankyrin
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70326"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:D5U559"
FT                   /inference="protein motif:PFAM:PF00023"
FT                   /protein_id="ADG70326.1"
FT                   /translation="MLRRLIFIIFILSLNILYSQEEQEPPVNIPIIKAVANNDINNLKK
FT                   LIEDGADINIKDTEGNTPLIWASLLGYEKIVKELLSNGADINMGNSFGNTPIMAAVLEG
FT                   NNSTVRELISSGADLNLKNKDGWTALMWACVKGDLSVFRMLVDAKADINIKDINGSTPL
FT                   MVASDSGYSSIVKELIKLGCDVNQKNNFGDTALMMGSIIGDASIVIELIKAGANINEKG
FT                   SNGGSALIYASRFGKIDAVRELIKNNADVNIYADDGTTPILAACIDGHSDVVKELIKAN
FT                   ADINRADNVGYNPLIVSAIEDHIFIVEALIDAGADIDFSTKEGYTPLMGAAIKGNIEMA
FT                   QVLLDAGADINHKANNGKTALIMAQEKEQEEMVDFLKANGAK"
FT   gene            298546..299376
FT                   /locus_tag="Bmur_0220"
FT   CDS_pept        298546..299376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0220"
FT                   /product="beta-lactamase domain protein"
FT                   /note="SMART: beta-lactamase domain protein; KEGG:
FT                   bhy:BHWA1_00115 metallo-beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70327"
FT                   /db_xref="GOA:D5U560"
FT                   /db_xref="InterPro:IPR001018"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D5U560"
FT                   /inference="protein motif:SMART:SM00849"
FT                   /protein_id="ADG70327.1"
FT                   /translation="MRLLQKTCLIFLILLFSLSAAEKTPMDYLNDNTPLKPAKVFDNVY
FT                   CIGSVSVVAWVINTSDGLILIDSMWDDRDAKLIEEGIKGFGLDPKNLKYIILSHGHGDH
FT                   YGGAKYLREKYGAKVVLTKTDEDLMYNLNTGANSPRSPKTKVDIYSKDKDIITLGDISI
FT                   TILETPGHTAGCTSFIFPVKFRGKEYTAVLWGGTGLPKEKELISEYKKSAEYFKKEALS
FT                   RDARVSLTAHLFADNGYANLEKVGNLKSGEENPFIMSKENMEKYLNSLIERAKQ"
FT   sig_peptide     298546..298614
FT                   /locus_tag="Bmur_0220"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.427 at
FT                   residue 23"
FT   gene            299443..299877
FT                   /pseudo
FT                   /locus_tag="Bmur_0221"
FT   gene            complement(299915..300289)
FT                   /locus_tag="Bmur_0222"
FT   CDS_pept        complement(299915..300289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0222"
FT                   /product="truncated hemoglobin"
FT                   /note="KEGG: bhy:BHWA1_00113 truncated hemoglobin"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70328"
FT                   /db_xref="GOA:D5U561"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:D5U561"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00113"
FT                   /protein_id="ADG70328.1"
FT                   /translation="MKYTEINDEGIEKLMDIFYARIRVHKDLGPIFNGAVGIDDESWER
FT                   HKEKIAKFWKTMLLNKRLYMGNPVQPHINLLPFDIKLFDTWLDLFKECLNEVFEEKAAN
FT                   KYYEVAENIGRNFKAVLFQQ"
FT   gene            complement(300495..301337)
FT                   /locus_tag="Bmur_0223"
FT   CDS_pept        complement(300495..301337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0223"
FT                   /product="3-hydroxybutyryl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.157"
FT                   /note="KEGG: bhy:BHWA1_00112 3-hydroxybutyryl-CoA
FT                   dehydratase; PFAM: 3-hydroxyacyl-CoA dehydrogenase
FT                   NAD-binding; 3-hydroxyacyl-CoA dehydrogenase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70329"
FT                   /db_xref="GOA:D5U562"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5U562"
FT                   /inference="protein motif:PRIAM:1.1.1.157"
FT                   /protein_id="ADG70329.1"
FT                   /translation="MKVGVIGAGAMGSGIAQAFAQTEGYEVYLCDIKEEFAAGGKDRIA
FT                   KSFAGRVAKGKMQQADADKILAKITTGLKDICKDADLIVEAAFENLEVKKTTFKELHEI
FT                   CKPDCIFSSNTSSLSITEIGAGIGRPIVGMHFFNPAPVMKLVEVISGLNTPRDVVEKVI
FT                   KISEEIGKTPVEVNETAGFVVNRILVPMINEGIELYSMGIASAEGIDNAMKLGANHPMG
FT                   PLALGDLIGLDIVLAIMEVLQKETGDPKYRPSALLRKMVRGGLLGQKTGKGFYDYSKK"
FT   sig_peptide     complement(301275..301337)
FT                   /locus_tag="Bmur_0223"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.791 at
FT                   residue 21"
FT   gene            complement(301447..302223)
FT                   /locus_tag="Bmur_0224"
FT   CDS_pept        complement(301447..302223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0224"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   bhy:BHWA1_00111 3-hydroxybutyryl-CoA dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70330"
FT                   /db_xref="GOA:D5U563"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D5U563"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ADG70330.1"
FT                   /translation="MEFVKYEEKGMIGIITISREKALNALNSQVLDEIEKTFDSVDLNN
FT                   IRCLILTGAGEKSFVAGADISQMSTSTKAEGEAFGKKGNDIFRKIETFPIPVIAAVNGF
FT                   ALGGGCEIAMSCDIRICSDNALFGQPEVGLGITPGFGGTQRLARIVGVGMAKQMIYSAK
FT                   NIKADEALRIGLVNAVYPQAELMAAAEKLASSIAAAAPIAVRNSKKAINEGLQVDMDKA
FT                   IVIEEKLFGSCFETEDQKEGMKAFLEKRKVEKFVNK"
FT   gene            complement(302860..304047)
FT                   /locus_tag="Bmur_0225"
FT   CDS_pept        complement(302860..304047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0225"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="KEGG: bhy:BHWA1_00110 acetyl-CoA acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70331"
FT                   /db_xref="GOA:D5U564"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D5U564"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ADG70331.1"
FT                   /translation="MSRKIVIASACRTAIGSMGGALSTVPAAELGAIVIKEALNRAKIA
FT                   PNQVDMVYMGCVIQASQGQNVARQCSIKAGLPVEVPAMTLNVVCGSGLDAVNVAANMIA
FT                   AGNADIVVAGGTENMSLAPYALKKARYGYRMGNDTIIDTMVNDALWDAFNNYHMGITAE
FT                   NICDDWKLTREELDAFAANSQQKAVKAQESGAFKKEIVPVTVKTKKGEVVVDKDEGPRP
FT                   GTTVETLAKLKPAFKPDGGRVTAGNASSINDGAAAVVVMSEEKAKELGIKPMATWIAGG
FT                   LGGVEPRIMGIGPVAATKKLMAKTGLTIKDFDIIESNEAFAAQSVAVGKELGIDVEKQL
FT                   NPNGGAIALGHPVGASGCRILVTLLHEMEAKNAKRGLATLCIGGGMGCATIVERE"
FT   sig_peptide     complement(303976..304047)
FT                   /locus_tag="Bmur_0225"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.607) with cleavage site probability 0.438 at
FT                   residue 24"
FT   gene            304424..306250
FT                   /locus_tag="Bmur_0226"
FT   CDS_pept        304424..306250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0226"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /note="TIGRFAM: DNA mismatch repair protein MutL; PFAM:
FT                   MutL dimerisation; ATP-binding region ATPase domain
FT                   protein; DNA mismatch repair protein domain protein; KEGG:
FT                   bhy:BHWA1_00109 D mismatch repair protein; SMART: MutL
FT                   dimerisation; ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70332"
FT                   /db_xref="GOA:D5U565"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:D5U565"
FT                   /inference="protein motif:TFAM:TIGR00585"
FT                   /protein_id="ADG70332.1"
FT                   /translation="MNKNIMKLPQSVANRIAAGEVIERPASMLKELLENAVDSGASDIE
FT                   VSVEEAGIKSMIVEDNGDGIHFDELPLAVTHHATSKIHSIEDLDSIYTLGFRGEALASI
FT                   SDVTNLEIVSKSRDENNGGKIIIEGGKIIEHKPAAASQGTKVIAKNLFFNIPARYKFLK
FT                   HISREFFLVKEVFDMEALVQPQISMKLKNNGKVVSSYIKADTLKDRIENYLSDSNIFRN
FT                   LIEIEIEKNDVLIYGLFSNSKISQSIRKNNFIFLNNRPIENRVLSYAIKNAYSNAIPKE
FT                   RYPFFFLYINIDSSKIDVNVHPSKKEVRIKNEREISGMLYNAISNNINNAGNNFDSVNI
FT                   EVDIDKDITPTFPIQNNNFYNNTDSANNSKNNNVINNINQTSQNYSNKNNLGNYTFDNT
FT                   YPKTINNNKTNYENKEFGEYTRAIGQVFSSYIVAERGSEMYIIDQHAAYERLNYERIYK
FT                   TLISKKIEYEKLLIPCEIEYKDYEIDILNSSKKSIEEIGIKFEVNSKHSIIIEDIPIYI
FT                   PRNQKIEKIIKDILDIYINKGDNNNLEKIIKHTCSTISCKYSPKAGDKLSNSDMQTLLD
FT                   LLEEENILTNCPHGRPFVLRLSKEYLDKKFFR"
FT   gene            complement(306666..307160)
FT                   /locus_tag="Bmur_0227"
FT   CDS_pept        complement(306666..307160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0227"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_01149 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70333"
FT                   /db_xref="GOA:D5U566"
FT                   /db_xref="UniProtKB/TrEMBL:D5U566"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_01149"
FT                   /protein_id="ADG70333.1"
FT                   /translation="MKKVSYKICMNEEELVDALLNDDDVIYAEYKLGKKISNIKNTGKI
FT                   AWGVLIGGVLVAATAIISSKKLGKDKALIASSIATIPSAAAAVIYIGLPSTISLIQIIV
FT                   SAYKKNDGINGAKDIILKLRNNYYIAEKDREKLTLKKTAGEKVREVKITEITKPENKKE
FT                   K"
FT   gene            complement(307284..308696)
FT                   /locus_tag="Bmur_0228"
FT   CDS_pept        complement(307284..308696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0228"
FT                   /product="amidophosphoribosyltransferase"
FT                   /note="KEGG: bhy:BHWA1_01148
FT                   amidophosphoribosyltransferase; TIGRFAM:
FT                   amidophosphoribosyltransferase; PFAM: glutamine
FT                   amidotransferase class-II; phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70334"
FT                   /db_xref="GOA:D5U567"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:D5U567"
FT                   /inference="protein motif:TFAM:TIGR01134"
FT                   /protein_id="ADG70334.1"
FT                   /translation="MNNITTYDKPREECGVFGIYSKDIKKDILKTLNYALYSLQHRGQE
FT                   SAGITISNYRHLFTYKAMGLVSDLFTSNIPKDTEGNIAIGHVRYSTTGASKIENAQPIE
FT                   NLFRLGQIAIAHNGNLTNAEELRYELEEGGATFNATSDTEVIIKLIARKTVSNFIEGIK
FT                   ESVNIIKGAFALVIVVDGKLIGVRDPYGIRPLCLGTNANGDYFLASESCALDAVGSKFV
FT                   RDIEAGEMVIIDDEGVKSFKYAKEDVKHCPCAFEHIYFARPESNIDGINVYNVRFQTGV
FT                   LLARQNKVDADIVIGVQDSGTIAALGFSQESGIPYSIGLVKNRYIGRTFIMPEQSTREE
FT                   TVKLKFNPLKHLIDGKRVILIDDSLVRGTTSRILIDIVRRAGAKEVHFRSASPVIKSPC
FT                   YYGVDISSKKELIGAKLSVEEIRKEINADTLEYLTIEDMLEALGNKNYCIGCFSGSYPT
FT                   EIPKKVSIDKTC"
FT   gene            309281..311428
FT                   /locus_tag="Bmur_0229"
FT   CDS_pept        309281..311428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0229"
FT                   /product="Ankyrin"
FT                   /note="PFAM: Ankyrin; KEGG: bhy:BHWA1_00072 ankyrin
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70335"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:D5U568"
FT                   /inference="protein motif:PFAM:PF00023"
FT                   /protein_id="ADG70335.1"
FT                   /translation="MKKLFIILLLFNALLYSKTLDEYLFSAVENNNIKKVKSYLEQGAS
FT                   CNALDSYNRTALINASVRGYDDIAKLLIEEGTDVNIQDKAGATALMYTARNTNYEMAEV
FT                   LLENGADVNIRDTAGETALYYNIEHNSFGQENETENAIKILNLLIKYGADVNTKNDKGT
FT                   SLLDVSYRISESFDKNKEMFKILVENGFDLESRIKADRSDYDYTPLMIAVYKKDYDMVK
FT                   YLLDKGANPNTSNNENKTALMIAIANDNFDISKLLIQQGANINTKDEYGYTALMRAAMI
FT                   GSYEMVKFLLENGANINTKDNDGNTVLYYNIRYDHYGKEEMLENAKKIFNLLIKYGADV
FT                   NTKDNYGASLLNAAYSLEGLTPNREMFKVLVENGFDLESRIKAGEDYPAGYDYTPLMIA
FT                   ALRNDYDMVKFLVEKGADVNAKTHSEYRSVVTPLLLSLDYEHIESRYDENSSVAEYLIN
FT                   NGADINVTNEDGETPLMYASKVHNIKVIELLIQKGADINAFDNYGNTALIYGVNNLETV
FT                   KLLVENGADVNFYKGGSTALISACEYSHERNIDVIKYLVSKKANINAQDNEGDTALNKT
FT                   LDTSDEGSIDILDFEIAHFLIEQGADVSIKNKREYTPLIYLGMGEGNFNNKSFQEYRIK
FT                   LAEVLLEKGADINAQDYDGYTSLIWACSRKFDEPYVKFLVEKGADVNIENDHGDTALDM
FT                   AEYFKLRKIAGILKKAQRNRN"
FT   gene            311480..312352
FT                   /locus_tag="Bmur_0230"
FT   CDS_pept        311480..312352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0230"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00126 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70336"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:D5U569"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00126"
FT                   /protein_id="ADG70336.1"
FT                   /translation="MRSINVLNDYFMRYMFAKEGHEHILLNLINAIRTDYNQEPFEEVK
FT                   VLNTFNLKETINDKQSIVDVRAITKSGETVLVEIQRVGNQSFVYRSLYYWAKGYISNLR
FT                   NNEKYNDLKQVIVINILDFNLLKDINKEHSCYVIKELETNHILTNHLEMHFLELPKYLF
FT                   SSSRLTDELYAWFYFLTIKEKREKMEEIMEMLVKKNPIMKEVYDEYNKFVNTKDLFDNY
FT                   TEYEKNYFDMLALNEERIKGREEGLKEGIEKGEKNKAISMAKNMKKDKVDFNTISKYTG
FT                   LSIEEIENL"
FT   gene            312572..313330
FT                   /locus_tag="Bmur_0231"
FT   CDS_pept        312572..313330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0231"
FT                   /product="phage SPO1 DNA polymerase-related protein"
FT                   /note="KEGG: bhy:BHWA1_00105 uracil-DNA glycosylase;
FT                   TIGRFAM: phage SPO1 DNA polymerase-related protein; PFAM:
FT                   Uracil-DNA glycosylase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70337"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:D5U570"
FT                   /inference="protein motif:TFAM:TIGR00758"
FT                   /protein_id="ADG70337.1"
FT                   /translation="MNKIENYFLQHNKIKFSNVVFSQHNKKIILRNPKKAQQAVKKEEK
FT                   NITNKGIELMKEIKNEDLKKIYNEVEKCMKCEALCNSRLNVVFGRGDEEPDIVFVGEAP
FT                   GADEDKQGLPFVGRGGKLLDKWIEKMNINKEKYYIMNALKCRPPENRDPLPEEKANCRD
FT                   FFVRQLQILNPKIICALGRHGFGNLIDFDLKTPFGKARNKVHYYSNNGKDVPVIATYHP
FT                   AYILRNQKEEDKVISDLEFMLSELEKIRNK"
FT   gene            313362..314165
FT                   /locus_tag="Bmur_0232"
FT   CDS_pept        313362..314165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0232"
FT                   /product="Ankyrin"
FT                   /note="KEGG: bhy:BHWA1_00104 ankyrin repeat-containing
FT                   protein; PFAM: Ankyrin; SMART: Ankyrin"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70338"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:D5U571"
FT                   /inference="protein motif:PFAM:PF00023"
FT                   /protein_id="ADG70338.1"
FT                   /translation="MKKYLILMLIICKCLMANSFDNIEDASSYETYENIEYSNIPKKPT
FT                   IFDCITHDNKLPYIISSIDRYLENDNDINSTNKNGNTLLMEAVSIGYYDLADYLIDKNA
FT                   DITITNNKGENALILSANYPYILNLLINNNANVNIADNNGKTALHYACEYGDLYSVKLL
FT                   IKSGADISKRDILGKTILMYAVENEHLDLIKYLVEELKVDINEKDDWGQNAVFYATKID
FT                   IARYLIYNNINYTEPNSIGLRAYEVMKYNGYINVSTYVQKLEKRR"
FT   gene            314233..315069
FT                   /locus_tag="Bmur_0233"
FT   CDS_pept        314233..315069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0233"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00103 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70339"
FT                   /db_xref="UniProtKB/TrEMBL:D5U572"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00103"
FT                   /protein_id="ADG70339.1"
FT                   /translation="MNIKVILLFVSINMLLFAQYTSVTNNNILVNTGEGRVDYTTYTIY
FT                   ADATADFLTDTRLHPEALLILQQQAEEETIKTLYDTLGNIPINSEDTIYSMIEENRILK
FT                   EKVVSSINNARLVGISYPTRTSVKVLMALDITTNNLMYDLVNNINEYKTEPIITYFDTG
FT                   TDYDSLVIDARNIGFTPSLFPTVYDENGNEIYSIAYINKNVAATNGYITYSTNSFLTNA
FT                   NITNIIGQKPYNVVAWRARGRLASDLVIGNEDASIIMSSTNLKNAIKNCKVVFIID"
FT   gene            315137..318421
FT                   /locus_tag="Bmur_0234"
FT   CDS_pept        315137..318421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0234"
FT                   /product="molybdate metabolism regulator"
FT                   /note="KEGG: bhy:BHWA1_00102 molybdate metabolism
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70340"
FT                   /db_xref="InterPro:IPR025406"
FT                   /db_xref="UniProtKB/TrEMBL:D5U573"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00102"
FT                   /protein_id="ADG70340.1"
FT                   /translation="MSIDKTYIDDIFKKHPYIDNIKKYVYNETENIDFNPKEIEYSISN
FT                   NHIIYSKLLDLYTVNKEDNSLIRLFKVISMHDIENIYIFEILIINIVSGLSIKEALLKC
FT                   ISLKKINNWNREYKRHSYHINPISNEVMNAKMNTFIYLYYAKKYFPKETEHYIDDILSS
FT                   NTENIISEYKEDILIPLMASAQKIYYGDYSNIDKLLEYSDKAEYLDAILSLILVIDRDE
FT                   KIQNKFLFLFENKLLNENKDLLINLAYLVRLFFLTRKNLITKFQDKNFNEFLDYLDSFK
FT                   IPKYFIFLVKYLDYNVLINSNKIFYGIKLLYQKDKEAFYKLSDILKQVEIPYIIEIKSV
FT                   LTCILLNAKDDKADINVLEKSIDYFIANLKSEIEKIYGKKSDNIFELLESIDKYNINIT
FT                   LSNEIIFAAKIISLMYDYNEKARKIVRALLKSMPYNLAIPLMIKDRKEFYNIKLKEILE
FT                   YLEGYDLDLKDLIITYIYSYPIYIFKQQYILKLINKHTDYVIDLFHDKKFLKAVSHKSY
FT                   ALIDFLEMLYKKDKAALTNYSALCYVLHLKDKEVLKCALELIEKDEYNSRPYVESSIHA
FT                   YREDVQFHLKNIIKRWNYNRKSFKFQTINDVIQYIDDYYDYNYEHMIDFIDKALISDVV
FT                   LRKDKNTKVPVRVMKYILLEYMLLEEPYRIRDIDKIADLFDMPSFRAALENVYRYWIDN
FT                   GADENKKNIIIPYCIYADYNQIVNLYDRIEYWHDNFKSSLAAYIIPAIAMNGEKFALMI
FT                   INNIIYMSKNKKLKNAAIESFKKASECLNIPIDNLFDKVLPNLGFNTERNKIINYGKQS
FT                   FTLQLLSDSYLEIIDNSNHKIIKELPDAIDGDDEEKVKNAKMDLVNIRNSLEAIITYQK
FT                   EKLKKVMFNGRKWDYETFFEVFVENPVMQYFTLAFVWGVYDEDNNLIECFRYMEDGSLI
FT                   SIDEDLYELPKNIKYYITLYHPIDKDEDYQKIWVYQLELYEINQPVEQIKLKRYFLKES
FT                   DIENDAIVCLKNKQLSFEYMEKLSKELDMKVEYFEEHVSYYLLDDVLKIAAEINCSLYD
FT                   EDIEIDNIKFYRLEDHNRFGVNIHPQEISHRFISTLIYYLSLGFYG"
FT   gene            318414..319724
FT                   /locus_tag="Bmur_0235"
FT   CDS_pept        318414..319724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0235"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN"
FT                   /note="KEGG: bhy:BHWA1_00101 RNA polymerase, sigma 54
FT                   subunit, RpoN; TIGRFAM: RNA polymerase sigma-54 factor,
FT                   RpoN; PFAM: sigma-54 DNA-binding domain protein; sigma-54
FT                   factor core-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70341"
FT                   /db_xref="GOA:D5U574"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:D5U574"
FT                   /inference="protein motif:TFAM:TIGR02395"
FT                   /protein_id="ADG70341.1"
FT                   /translation="MVNNTSLSANTSIRTAIKNDLRLNYQTRLWLDTISSSAVELKEKI
FT                   EKAMEDNPFLEYDIKDKYTSKSSSSDIDSIIENTAANGKESLFSHLKSQIEISFKSKKE
FT                   MELAEQICSFINHDGYLKITSGEMSNILNASVSEIEKIVSVIKTFDPYGVAAKDINECL
FT                   SIQLKMKKKEDLKENGFLYDTAIDIVENYLDKLSKKDYDYIASSIGVEKDTVIKALKLI
FT                   QTLEPYPAREYDTSAVKYIVPELFILKENGIWIVKTDETFIPPLKISKKYIKLLDREKS
FT                   KDSINFLKEKKKEAESLINAANERKKSLLKIGEALLKFQLDFFEYGKEFIKPLTLKDMS
FT                   LEVNLSESTVSRIANGKYLNTVWGTFSIKYFFSRAINGGLGSRGVKEIIKRIIENSQAK
FT                   LSDEKIRLILKSEGIDISRRTIAKYRKSMNIFSSRNR"
FT   gene            319740..320510
FT                   /locus_tag="Bmur_0236"
FT   CDS_pept        319740..320510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0236"
FT                   /product="sigma 54 modulation protein/ribosomal protein
FT                   S30EA"
FT                   /note="KEGG: bhy:BHWA1_00100 hypothetical protein; TIGRFAM:
FT                   ribosomal subunit interface protein; PFAM: sigma 54
FT                   modulation protein/ribosomal protein S30EA"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70342"
FT                   /db_xref="GOA:D5U575"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:D5U575"
FT                   /inference="protein motif:TFAM:TIGR00741"
FT                   /protein_id="ADG70342.1"
FT                   /translation="MHQNIIGKNVRITKNVREHIANKMQNIKIHADRIIDANIICDYMH
FT                   GEYTVQGTIAFGKKVFHDKEKEKDLYVAIDAMFQKIEREIRKSKERNIDKSQRAVVDKS
FT                   MQNDEEDNAYSITSAGIYEKPLDELDAVLHFKSDKKPYMAYLPIKQGDDLYSIKIGKFP
FT                   VFLFKNNDKVLEVYYNDEYWNIDEVSVTPDNNIDASKSENYLIKEYNVSEAVTYLTENT
FT                   DKKFVVYISSITEQAEALYKESDNSFVLIRMFDI"
FT   gene            320552..321016
FT                   /locus_tag="Bmur_0237"
FT   CDS_pept        320552..321016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0237"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: bhy:BHWA1_00099 PTS
FT                   system, fructose subfamily, IIC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70343"
FT                   /db_xref="GOA:D5U576"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D5U576"
FT                   /inference="protein motif:PFAM:PF00359"
FT                   /protein_id="ADG70343.1"
FT                   /translation="MSLIDYINKESIMIDVQETEKERLLSKMVERLDSSGLLVSKDDAE
FT                   HAIIAREQLMSTGVGNGIAIPHAKTDAVKNIVLSVATIKNGINYKSVDKKKVFAVFMLL
FT                   APKNSASENLKVLTAIAKILRDNPHFLEKLINAEKPDEIMELIAKEEMKI"
FT   gene            321016..321978
FT                   /locus_tag="Bmur_0238"
FT   CDS_pept        321016..321978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0238"
FT                   /product="HPr kinase"
FT                   /note="PFAM: HPr serine kinase domain protein; KEGG:
FT                   bhy:BHWA1_00098 HPr kinase/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70344"
FT                   /db_xref="GOA:D5U577"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:D5U577"
FT                   /inference="protein motif:PFAM:PF02603"
FT                   /protein_id="ADG70344.1"
FT                   /translation="MPKVSISKFLELNEKRNNFLKIRRLTGFVGMENEISSCDINRPGM
FT                   ALFKYFKDFAYDRIQIFGKGEANYVLTLNEENKKDVFEEMLSYKIPICIFTYNITPPEI
FT                   FLEIAKNNNICVIISELQTADMIRGIDTLIEEEFVESFTIHGGLVEVFGVGVLILGKSG
FT                   VGKSEATLELISKGHRLISDDTVEFRKLRDGRIIGKTNEFIKHNMEVRGIGVVDISRLS
FT                   GMSAIRDKKRLDLIVELEHWKDDEQYDRMGLFEKTYNMLNTEIPYIKLPVRSGRNICIL
FT                   IETAAKNFRLKQMGYNSAKELDKALIAQIEKKKANNSNK"
FT   gene            complement(321986..322318)
FT                   /locus_tag="Bmur_0239"
FT   CDS_pept        complement(321986..322318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0239"
FT                   /product="septum formation initiator"
FT                   /note="KEGG: bhy:BHWA1_00097 septum formation initiator"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70345"
FT                   /db_xref="GOA:D5U578"
FT                   /db_xref="UniProtKB/TrEMBL:D5U578"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00097"
FT                   /protein_id="ADG70345.1"
FT                   /translation="MNKQQNTQENKTYSIGSVFIVIVIFVIIISIFTFARNVKANDILK
FT                   EISALDKEIEHLEKEVKVLSAEEAEYSSPNRFIEMAIINGFTSVTGDNNDILYLKIESE
FT                   NKNQNN"
FT   gene            complement(322355..323290)
FT                   /locus_tag="Bmur_0240"
FT   CDS_pept        complement(322355..323290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0240"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /note="KEGG: bhy:BHWA1_00096 S-adenosyl-methyltransferase
FT                   MraW; TIGRFAM: S-adenosyl-methyltransferase MraW; PFAM:
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70346"
FT                   /db_xref="GOA:D5U579"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5U579"
FT                   /inference="protein motif:TFAM:TIGR00006"
FT                   /protein_id="ADG70346.1"
FT                   /translation="MIFVPIILVMDNDIELNIVHTPVMLKEVLSYIPENAKIVIDATLG
FT                   EGGHTKAMLDLNLEVHSFERDSTILDIAKRRLKDYPNFHYYNNTYDKMMECLDEKVIGN
FT                   ADFMLYDLGVSLFHFKKAERGFSFKDNTMLDMRLGINEKSAYDVINGYSEEELERVFRD
FT                   YGELSNARKMARIIVKERDKRKIETSKELESIIFHNTDKSQRYGKIHPATLVFQAIRIE
FT                   VNDELNILEKSILNIPNILKNNGVAVIISYHSLEDRIVKRFFKENEKTKNKDGIFKLLN
FT                   NKVKLPTNDEIKSNPASRSAKMRAVQLIKM"
FT   gene            323609..324139
FT                   /locus_tag="Bmur_0241"
FT   CDS_pept        323609..324139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0241"
FT                   /product="protein of unknown function DUF308 membrane"
FT                   /note="PFAM: protein of unknown function DUF308 membrane;
FT                   KEGG: bhy:BHWA1_00095 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70347"
FT                   /db_xref="GOA:D5U580"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="UniProtKB/TrEMBL:D5U580"
FT                   /inference="protein motif:PFAM:PF03729"
FT                   /protein_id="ADG70347.1"
FT                   /translation="MGKLGRVLWLIFGILLIISGIATMFNPIETVLMLAYVIGFLTIFS
FT                   GISSIFYFFGLKHKSGSTLILLDGIISALCGIIIISNLQISGAFVPYIAAFFVIVRGVV
FT                   AISSSIELKKEGYNQWGLPMISGILTLLAGIILAFNPLLGAVYVSVVLGLSLVLYGIIT
FT                   LQLWFAYGKFFKI"
FT   gene            324207..324419
FT                   /locus_tag="Bmur_0242"
FT   CDS_pept        324207..324419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0242"
FT                   /product="BFD domain protein (2Fe-2S)-binding domain
FT                   protein"
FT                   /note="PFAM: BFD domain protein [2Fe-2S]-binding domain
FT                   protein; KEGG: bhy:BHWA1_00094 nitrite reductase [NAD(P)H],
FT                   large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70348"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:D5U581"
FT                   /inference="protein motif:PFAM:PF04324"
FT                   /protein_id="ADG70348.1"
FT                   /translation="MFQRNINSTLCFCKNIKYKEVIEAIKEKELKTLEEVMHCTKAGIT
FT                   CWSCRGDIKDLLAEYKETGDIKIDE"
FT   gene            324412..324588
FT                   /locus_tag="Bmur_0243"
FT   CDS_pept        324412..324588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0243"
FT                   /product="BFD domain protein (2Fe-2S)-binding domain
FT                   protein"
FT                   /note="PFAM: BFD domain protein [2Fe-2S]-binding domain
FT                   protein; KEGG: bhy:BHWA1_00093 putative Fer2 BFD, BFD-like
FT                   [2Fe-2S] binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70349"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:D5U582"
FT                   /inference="protein motif:PFAM:PF04324"
FT                   /protein_id="ADG70349.1"
FT                   /translation="MNDNKFICQCKELSLEEIEVLKKEYGIDTLKEVVKKKAGTACGGC
FT                   RNKLKDLFKDRLK"
FT   gene            complement(324663..325580)
FT                   /locus_tag="Bmur_0244"
FT   CDS_pept        complement(324663..325580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0244"
FT                   /product="Transketolase central region"
FT                   /note="KEGG: bhy:BHWA1_00092 transketolase, pyridine
FT                   binding subunit; PFAM: Transketolase central region;
FT                   Transketolase domain protein; SMART: Transketolase central
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70350"
FT                   /db_xref="GOA:D5U583"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D5U583"
FT                   /inference="protein motif:PFAM:PF02779"
FT                   /protein_id="ADG70350.1"
FT                   /translation="MEKKAIRNAYGEALKRLGEINKNVVVLDGDLSGSTMTKIFKSAFP
FT                   ERFFNMGIAEQNIMGAAAGLAIDGKIPFASTFAMFGAGRAFEIIRNSICYPKLNVKVAV
FT                   THAGISVGEDGASHQAVEDVSIMRSIPNMTVIVPCDALEAEKAVFAAAEFDGPCYLRMA
FT                   RPATNIITNENTPFKIGKANVLREGKDICIFASGIVVPEALEAAQMAEKDGISVTVVNV
FT                   HTIKPIDREVVVDMAKKHSKLISVEEHSIIGGLGSAISEVLTDEYPCKLIRLGIKDTFG
FT                   ESGTVDELMNKYGLNAKAIYEALK"
FT   gene            complement(325612..326409)
FT                   /locus_tag="Bmur_0245"
FT   CDS_pept        complement(325612..326409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0245"
FT                   /product="Transketolase domain protein"
FT                   /note="PFAM: Transketolase domain protein; KEGG:
FT                   bhy:BHWA1_00091 transketolase N-terminal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70351"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D5U584"
FT                   /inference="protein motif:PFAM:PF00456"
FT                   /protein_id="ADG70351.1"
FT                   /translation="MSSLNTQIRKDIVSMVYNANSGHIGGSLSLVEIMHTLYFKIMNID
FT                   PKNPNMDGRDILIMSKGHASAVLYSTLAHRGYFPTDELLTYRKLGSRLQGHPDKKHLPG
FT                   VEASTGSLGQGVCIAVGTALGYKLDKKNGKIFAIAGDGEAQEGSFWESAMAASNYKLDN
FT                   YTLIIDNNGLQIDGKNDDVMSLGDLEAKMKAFGFETFIADGHNEAELEEIFNKKVSGKP
FT                   KCVIAKTVKGKGVSFMENAAGWHGKAPNKEEYERAMEELNKLD"
FT   gene            complement(326625..328559)
FT                   /locus_tag="Bmur_0246"
FT   CDS_pept        complement(326625..328559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0246"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: bhy:BHWA1_00135 methyl-accepting chemotaxis
FT                   protein McpB; PFAM: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   chemotaxis sensory transducer; histidine kinase HAMP region
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70352"
FT                   /db_xref="GOA:D5U585"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:D5U585"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADG70352.1"
FT                   /translation="MFKKMGLQFQITFIILVPIILIIIASNLFIQMYAGKISKELSYKV
FT                   LEETSLKEASNIKFGIEKDLYSSLGLKINLENLYRRGIRDRETYKQLTSVFFNSLPDDI
FT                   NGLSIAFEPNALDNDSDYTNSEYRAANGRFNYYISRNGEAYLSIDTFNVDYYTEPKRTG
FT                   QTYVSGVYNSTVNADTVLFTLCIPIMPDNKFIGVIYVDIFIDSITSILENIIPFEDTTA
FT                   ALYDQNGLVVYDNYNMNNVSKNVYEVYPDYKNYGVFDSIKKGELLLIEAHSSVSGENLV
FT                   YAFAPIEISKGVYWCLELASAREVILKDSYIMRNVLIIVLIAIIAALVLIVPFIIGRKV
FT                   SNIISALSKDILAMSDGDLTRGIPKHFDKRKDEWGDIARGWDKAMNNFNKVINTVKNSA
FT                   EQVSTAANEVLIGNNDLSERTESQASSLEETAASMNQMASAIKESAENVATSTSMVSEA
FT                   KEHLNKAGEIVEDSVSKMNDVYESSNKIMDITKLIENIDFQTNILALNASVEAARAGDQ
FT                   GKGFAVVASEVRNLAQNTQESVKNITSLITDSNEKINLAAKSVKESKDIFMEISEKMDN
FT                   ASSLMDRINTAAQEQEKGIEQINIAINNMDSALQKNASLVTEAASASESLLNEANELIK
FT                   AIEYFKLRN"
FT   gene            complement(328750..329133)
FT                   /locus_tag="Bmur_0247"
FT   CDS_pept        complement(328750..329133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0247"
FT                   /product="Excinuclease ABC C subunit domain protein"
FT                   /note="PFAM: Excinuclease ABC C subunit domain protein;
FT                   KEGG: bhy:BHWA1_00090 endonuclease containing a URI domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70353"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:D5U586"
FT                   /inference="protein motif:PFAM:PF01541"
FT                   /protein_id="ADG70353.1"
FT                   /translation="MKENNNYWYVYIILCEDNCYYTGITNDLINRFTKHKNGKGANYTR
FT                   SHKPLKFLSAWEVDSVNIALSIEHYIKSVNKKIKVLFAENNRLLKQYYINDIKTKGKKD
FT                   YRSISIRSVNKKKLDIINAMSNK"
FT   gene            complement(329130..329804)
FT                   /locus_tag="Bmur_0248"
FT   CDS_pept        complement(329130..329804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0248"
FT                   /product="acylneuraminate cytidylyltransferase"
FT                   /note="PFAM: acylneuraminate cytidylyltransferase; KEGG:
FT                   bhy:BHWA1_00089 spore coat polysaccharide biosynthesis
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70354"
FT                   /db_xref="GOA:D5U587"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5U587"
FT                   /inference="protein motif:PFAM:PF02348"
FT                   /protein_id="ADG70354.1"
FT                   /translation="MKKIVIILASRLGSTRLPKKALKPMAGCDSMLELIIKRLRSSKKA
FT                   NDVVVATEEKSYDSFKNIFDKLKCSYFVGSEEDVLNRYTKAAEKFNADIVVRATGDNPL
FT                   VSIKALDMIVDYHIDKNADLSHYDLLPYGSGVEVINYEALKYADDNSKDPFEHEHITQY
FT                   HYRHADKFKIENPKVTESFAMPDLRTTVDTIEDYNNVCNIFNKYNNDIYIDVDTIISDI
FT                   IK"
FT   gene            complement(330078..330893)
FT                   /locus_tag="Bmur_0249"
FT   CDS_pept        complement(330078..330893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0249"
FT                   /product="2-dehydro-3-deoxyphosphooctonate aldolase"
FT                   /EC_number="2.5.1.55"
FT                   /note="TIGRFAM: 2-dehydro-3-deoxyphosphooctonate aldolase;
FT                   KEGG: bhy:BHWA1_00088 2-dehydro-3- deoxyphosphooctonate
FT                   aldolase; PFAM: DAHP synthetase I/KDSA"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70355"
FT                   /db_xref="GOA:D5U588"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5U588"
FT                   /inference="protein motif:TFAM:TIGR01362"
FT                   /protein_id="ADG70355.1"
FT                   /translation="MIFDYKGITNKNKDLIFVAGPCVIESEEMTMTIAKKLKEIKDKLN
FT                   IQLVLKGSFDKANRTSLSSFRGLGMKEGLQILQDAGKEFNLPTITDIHVPTDAEEAAKY
FT                   VDFLQIPAFLCRQTDMLRAACETKKAVNVKKGQFISGYDCKYIADKCSDAIDEKRFFLC
FT                   ERGTMFGYGNLIVDMKNLEIMKNYAPVMYDATHSLQMPSANNGQSGGAREFIPALLKAA
FT                   AALGVDAVFMEVHPNPDKSPSDSGTIFDLSKVEELWASVIKINALVKNI"
FT   gene            331054..331617
FT                   /locus_tag="Bmur_0250"
FT   CDS_pept        331054..331617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0250"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bhy:BHWA1_00087 acetyltransferase, GT family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70356"
FT                   /db_xref="GOA:D5U589"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D5U589"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADG70356.1"
FT                   /translation="MIKLIEMKYNLENIDFYKKLYNDAFPKEERWSFDMILENKGNNNY
FT                   RLYAVLDDNTPIGLTMIWYLDNFNFGEYLAIDKKVRGKKYGSEVLTKILDMLKDKLIVI
FT                   EVEPYELNETAQKRIEWYKRFGFILADYEYDMPSLDENNKISSIKMKIMTSRKLKNKEE
FT                   HDNITKTLYNTIYKPRLDEVDKWK"
FT   gene            331791..334163
FT                   /locus_tag="Bmur_0251"
FT   CDS_pept        331791..334163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0251"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: bhy:BHWA1_00085 glycoside hydrolase, family 3 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70357"
FT                   /db_xref="GOA:D5U590"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:D5U590"
FT                   /inference="protein motif:PFAM:PF00933"
FT                   /protein_id="ADG70357.1"
FT                   /translation="MYNKYSKKIKEIINEMTLEEKVSLLSGKDFWSTKPIHRLHIDSIY
FT                   LTDGPHGVRRQSTEADKLTLQKSEASTCFPTACCSACSFDSNIMYEMGEAISREAKANN
FT                   VSVVLGPGINIKRSPLCGRNFEYFSEDPYLAGKMASGWISGLEDNGIQSSLKHFAANNQ
FT                   ETLRLVIDSVVDERALREIYLYAFEIAVKESKPSTVMCSYNSVNGTFASENKYLLTNIL
FT                   RDEWGFDGIVVSDWGAVNDRVEALKAGLDLQMPSTNGYDDKKVYEAIKENKLDEKILNK
FT                   AVERLLYFALYSMDNIYNNFTYDKEENHNTARKIAENSIVLLKNEDKILPAKKESKIAV
FT                   IGEFAQKPRYQGNGSSLINAYKIDTAEEYFKENNLEFNYAKGYNSDSSEIDNSLIQEAV
FT                   NISKDKDLVIIFAGLINSYESEGFDRKHLNLPENHNHLIEEISKVNKNIVVVLSIGAPV
FT                   LMPWVDKVKGIVNLYLAGEAAVSAAFNIIFGIVNPSGKLAETFPLSLEDNPSYKYFPGG
FT                   NKAVEYRESIFVGYRYYDKAEKEVLFPFGYGLSYTTFKFSNLIVSDANTVAGLDNIHVV
FT                   FDVQNTGDVFGCEAAQLYVSAPENNIFKAKRELKGFIKVFLEPNETKTVILKLNKRSFS
FT                   FYNTETKKYEIESGIYTISVGNSSRNLPLSKNIEINAESYYQKRIPSYFNFKDINIPDE
FT                   DFEELMERKLKPINIKAVKPYNLNNNLSDLMHEKIAEDFYNKLLSGLNDMFKDDKTDTK
FT                   KMFESMILETPLRSLATMSCGLITRNDIEKLLNTLNS"
FT   gene            complement(334271..335269)
FT                   /locus_tag="Bmur_0252"
FT   CDS_pept        complement(334271..335269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0252"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: bhy:BHWA1_00075 sucrose operon repressor;
FT                   PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; SMART: regulatory
FT                   protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70358"
FT                   /db_xref="GOA:D5U591"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D5U591"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ADG70358.1"
FT                   /translation="MKSGKGSNKKITMKDIAELAGVTKTTVSRYFNGGYIKKETKEKIA
FT                   KIIKKYNYEPNTFARLNAKQSRMIGIIVPALDSIVGSRVLTGLEKTFREKHYMPIIMNT
FT                   NHEAFLELKYIEKLKRLNVDGIVLSATEITEEHRKLLKKLDIPIVIYGQEYSDGISIVN
FT                   DDYNAGVQIGEYIGRKKHKNVGFIAVDEKDVAIGVTRRNGVLDGLKNYNIMDVSIAMAD
FT                   FSYESAMRAAQELLKYKKLDAIICSTDRQAHGVYKVIKERGLKMPEDVSVISFGGYEID
FT                   EIIEPRLSTIKFDSLNAGICAANTLIDLINKVQVRKVLYINYEFIEGESVR"
FT   gene            335661..337085
FT                   /locus_tag="Bmur_0253"
FT   CDS_pept        335661..337085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0253"
FT                   /product="PTS system, glucose-like IIB subunint"
FT                   /note="KEGG: bhy:BHWA1_00076 PTS system, IIABC component;
FT                   TIGRFAM: PTS system, glucose-like IIB subunint; PFAM:
FT                   phosphotransferase system EIIC; Phosphotransferase system
FT                   EIIB/cysteine, phosphorylation site"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70359"
FT                   /db_xref="GOA:D5U592"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:D5U592"
FT                   /inference="protein motif:TFAM:TIGR00826"
FT                   /protein_id="ADG70359.1"
FT                   /translation="MAIDYKKTAEEIIKVVKRENIISAECCATRLRLIVKDRESIKDSD
FT                   VQKIDGVKGVFFNSGQYQIILGTGVVNKVYDEVVKLGITASSQKNDDKDVKKSDDKNKF
FT                   RKFIRIFADVFVPIMPAMIATGLFLGLKGALINDSFLGLFNLQVSNIPVSVMTFMSVLT
FT                   ETTFAFLPALVCWSAFRVFGGSPILGILLGLMLVSPALPNAYLVANPDSGVKPIMLFGF
FT                   IPIVGYQGSILPALIAGIIGSKLELKLRKIIPNIIDILATPFLTLLIMLLLSLAVIGPI
FT                   FHMVEQWILIAINFSLSLPFGLGGLIIGFGIIFIVVTGVHHIMNLIEISLLAATALNPI
FT                   NPLLSVANLAAGAACLAVTLKTRRKSVKAMGYGAALSAWLGITEPAIFGINIRYGIKPM
FT                   VCGAIASGITGLIVRLLNLQGTANGVTGIPGILLYIYDTKQLIGYISVAILTIVLSFAI
FT                   TWFFGVPKEYMQEDDE"
FT   gene            337229..338719
FT                   /locus_tag="Bmur_0254"
FT   CDS_pept        337229..338719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0254"
FT                   /product="sucrose-6-phosphate hydrolase"
FT                   /note="TIGRFAM: sucrose-6-phosphate hydrolase; PFAM:
FT                   Glycosyl hydrolase family 32 domain protein; KEGG:
FT                   bhy:BHWA1_00077 beta-fructosidase (levanase/invertase);
FT                   SMART: glycoside hydrolase family 32"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70360"
FT                   /db_xref="GOA:D5U593"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR006232"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR013189"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR018053"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D5U593"
FT                   /inference="protein motif:TFAM:TIGR01322"
FT                   /protein_id="ADG70360.1"
FT                   /translation="MNLVSKIFKEAIIKKENEYLAKNNKDKWRLNFHIMPPVGWLNDPN
FT                   GLSYFKGIYNIFFQYSPFETEGGLKFWGHYQTKDLINYKYVGVSIYPDEKYDCHGVYSG
FT                   SAFIEDDKLYIYYTGNVKLLGIHDYIESGREANTMLTVTEDGINFSEKECLMEMKDYPK
FT                   DITNHIRDPKVWKENDSYYMVQGARKYGIDRNNDIGEVLLFSSKDKRKWTHTSTIHTKD
FT                   IFGYMWECPDLFNLDGQDILITCPQGVKQVESIYENLYLSGYFLINDDYKNKESIEVNN
FT                   FTILDRGFDFYAPQTFLDENGNRVIIGWMGVPDTEDIHKNLTVDYGWQHCLTIPRELSF
FT                   KNGKLYQKPHRNLEKLREKKIFENKYSNNTLSDNLIYNDISSYEVIIDNIKIDNNINSF
FT                   EIIISEGLCAKYKDNKFILEFIGDTGKTIGGGRNKRSSYLENLKNIRIMADTSSLELFI
FT                   NDGELAFTTRYYPLEYSFKILGEMNITIYKLSGFNFNP"
FT   gene            338792..339256
FT                   /locus_tag="Bmur_0255"
FT   CDS_pept        338792..339256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0255"
FT                   /product="transcription elongation factor GreA"
FT                   /note="KEGG: bhy:BHWA1_00078 transcription elongation
FT                   factor GreA; TIGRFAM: transcription elongation factor GreA;
FT                   PFAM: transcription elongation factor GreA/GreB domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70361"
FT                   /db_xref="GOA:D5U594"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:D5U594"
FT                   /inference="protein motif:TFAM:TIGR01462"
FT                   /protein_id="ADG70361.1"
FT                   /translation="MAKPITKEGYDKVKAKLAELKAEFETLPAIIAEAREKGDLKENAE
FT                   YHAAKEKQGLLNAQISKLEGDLAGCEIIDPSSLDKNTVTFGKRVKVKDKNRNAVFEYRI
FT                   VGELEADMSKNEITIVTPIAKGLLAKKVGDVVTIKVPAGDKVLEILEINI"
FT   gene            339435..340928
FT                   /locus_tag="Bmur_0256"
FT   CDS_pept        339435..340928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0256"
FT                   /product="glycogen/starch synthase, ADP-glucose type"
FT                   /EC_number="2.4.1.21"
FT                   /note="TIGRFAM: glycogen/starch synthase, ADP-glucose type;
FT                   KEGG: bhy:BHWA1_00079 glycogen synthase; PFAM: Starch
FT                   synthase catalytic domain protein; glycosyl transferase
FT                   group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70362"
FT                   /db_xref="GOA:D5U595"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/TrEMBL:D5U595"
FT                   /inference="protein motif:TFAM:TIGR02095"
FT                   /protein_id="ADG70362.1"
FT                   /translation="MSKMKVMIASSEAAPFIKTGGLADVVGSLPIYLKKLGVEACVVLP
FT                   KYRDINFQDCYLENVLPTMGVWMGNGEEWCSVFKTVKDGIDFYFIEHHSFFSRDGLYHD
FT                   ASFNDYQDNAWRFGFFSRAALQLCKDLQLNVDVVHANDWQTAAIPAYIKTWHWNDPVGH
FT                   AASLLTIHNANYQGIYSANTTYDYLGLGWNNFSSDTFEDHGNINFLKGGIFFADVVTTV
FT                   SPTYAKEISSPYGGHGMAPYLQNKTTSFFGILNGIDEDVWSPEKDKFIPANYSANSMEG
FT                   KKICKKELQKRFLLEEDDDVVLIGAIGRFVDQKGYHFIASIIDPLINNMKVQFCILGTG
FT                   DKGLEGFFGDLPKRYPGRVGSYIGYSNELSHLIEAGCDLFVMPSLFEPCGLNQMYSLRY
FT                   GTLPIVHATGGLEDTVENYNEQTGEGTGFKFYDSNPSALYNTIGWAVSVYYDHRDRFNE
FT                   MQQRGMKIDNSWEKSAKEYVKAYELAILNKNNYDKNCGL"
FT   gene            340961..341485
FT                   /locus_tag="Bmur_0257"
FT   CDS_pept        340961..341485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0257"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG:
FT                   bhy:BHWA1_00080 intracellular protease"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70363"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="PDB:4HCJ"
FT                   /db_xref="UniProtKB/TrEMBL:D5U596"
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /protein_id="ADG70363.1"
FT                   /translation="MGKTNNILYVMSGQNFQDEEYFESKKIFESAGYKTKVSSTFIGTA
FT                   QGKLGGMTNIDLLFSEVDAVEFDAVVFVGGIGCITLWDDWRTQGLAKLFLDNQKIVAGI
FT                   GSGVVIMANAKILEEINVTCLSADESHVRHGNANIMSENVVVSGNIVTANGPTSSKDFA
FT                   NAVVGVLNSLS"
FT   gene            341682..342479
FT                   /locus_tag="Bmur_0258"
FT   CDS_pept        341682..342479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0258"
FT                   /product="Cof-like hydrolase"
FT                   /note="KEGG: bhy:BHWA1_00081 hydrolase 3, haloacid
FT                   dehalogenase-like hydrolase; TIGRFAM: Cof-like hydrolase;
FT                   HAD-superfamily hydrolase, subfamily IIB; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase type 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70364"
FT                   /db_xref="GOA:D5U597"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D5U597"
FT                   /inference="protein motif:TFAM:TIGR00099"
FT                   /protein_id="ADG70364.1"
FT                   /translation="MIKAVFFDIDGTLVSFNTHKISELSKKAIRELREKGIKVFIASGR
FT                   ALFQIDNLEDLEFDGFILLNGCSCIVKENNSMKEIYKVSINKDDLFSLMNYLNNDRFPC
FT                   TVITTDNIFLNYADDVINMLYGMANVKIPKTIDFNEYIKNNYEEIVQLNIFADENKEKY
FT                   LMENILKNSISSRWHFSFADVNPKGGGKDIGIDKIIEHYKIDLSETMAFGDGGNDLGMI
FT                   KHAAVGVAMGNANENVKEAADYITDSVDDEGVYKALKHFNLID"
FT   gene            342498..343283
FT                   /locus_tag="Bmur_0259"
FT   CDS_pept        342498..343283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0259"
FT                   /product="Cof-like hydrolase"
FT                   /note="KEGG: bhy:BHWA1_00082 hydrolase 3, haloacid
FT                   dehalogenase-like hydrolase; TIGRFAM: Cof-like hydrolase;
FT                   HAD-superfamily hydrolase, subfamily IIB; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase type 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70365"
FT                   /db_xref="GOA:D5U598"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D5U598"
FT                   /inference="protein motif:TFAM:TIGR00099"
FT                   /protein_id="ADG70365.1"
FT                   /translation="MIKAVFFDIDGTLVSFNTHKISYSSKEAIKQLKDKGIKVFIATGR
FT                   IKKHINNLDNLEFDGYITANGFDCYIGEKSIYRHSIAREEIYSLMDYLKNKENFPCSIM
FT                   MNSGIFINYITKEVEEVSKSINLPIPAVDNYYEFLEQNIDDILQINLFVDEKKEKELMK
FT                   NIFKNCESSRWHPAFTDVNTKGGGKHIGIDKIIEHYKIDISETMSFGDGGNDITMIEHS
FT                   AIGVAMGNANKEVKLAADYITDDVDNDGIYNALKHFNIL"
FT   gene            343362..344648
FT                   /locus_tag="Bmur_0260"
FT   CDS_pept        343362..344648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0260"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.27"
FT                   /note="TIGRFAM: glucose-1-phosphate adenylyltransferase;
FT                   KEGG: bhy:BHWA1_00083 glucose-1-phosphate
FT                   adenylyltransferase; PFAM: Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70366"
FT                   /db_xref="GOA:D5U599"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5U599"
FT                   /inference="protein motif:TFAM:TIGR02091"
FT                   /protein_id="ADG70366.1"
FT                   /translation="MRAFNTVALILGGGRGTRLYPLVKARSKPAVSLGGQYRMIDIPVS
FT                   NCINSGFRNIYVITQFNSASLNNHIYNAYRFDNFSGGHVSILAAEQTDTNIDWYQGTAD
FT                   AVRKNLSHFDKEYVNNVVILSGDQVYRMNYNVMLQHMLETGADIVVGTVPVVREDAKGF
FT                   GVMLVNKRGQITNFHEKPKEDDTLNALKLSEEQKKMFNIEDPNKEYLASMGIYVFRHSV
FT                   LKELLADVSMIDFGKDIIPEAIKRYKVYSYAFQGYWEDVGTIKAYFEANISFGSKNPPF
FT                   DFYDENAPIYTHVRYLSPSKVEKASITSSIIADGCRIENATIKESVIGVRSVVQSGSTL
FT                   ERVVMMGSDYYEDNDDIERLNVKHIPKIGIGKKCTLKNVIIDKNVRIGNDVVITNKKKI
FT                   QHQDSEFYCIRDGIVILPKNTIVKSGTII"
FT   gene            344753..345763
FT                   /locus_tag="Bmur_0261"
FT   CDS_pept        344753..345763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0261"
FT                   /product="pseudouridine synthase"
FT                   /note="KEGG: bhy:BHWA1_00533 ribosomal large subunit
FT                   pseudouridine synthase C; PFAM: pseudouridine synthase;
FT                   RNA-binding S4 domain protein; SMART: RNA-binding S4 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70367"
FT                   /db_xref="GOA:D5U5A0"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5A0"
FT                   /inference="protein motif:PFAM:PF00849"
FT                   /protein_id="ADG70367.1"
FT                   /translation="MKKAKNKLHLNTEEIYQKSVIRKCRIEENIDDSIRLDKYMGDRFS
FT                   YYSRNKWQDLIGQGLVLLNGKKVKYTRTINKGDEIEYHIIGMKEPEVDKNVTIIYDDGD
FT                   LIIANKPANLPVIPSGKYYHNTLHTIVKQMLNCNINMLNRIDRETSGCVVMSRGHETAS
FT                   KFCAMIARRKNTKKKIKKTYIAVVENAKNIEDNFIVEGYMLESGHEYYRRFQTLHKENI
FT                   EGSKYSKTAFKTIKRLGDYAIVMARLYTGRMHQIRVHLYSKNLYMVGDKIYGKYGPKVF
FT                   DDFIEKNIIPEGFFHRQALHAYSLEFNHPINDKLIKIKAPLAKDLKEFIKKIKNI"
FT   gene            345896..346327
FT                   /locus_tag="Bmur_0262"
FT   CDS_pept        345896..346327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0262"
FT                   /product="periplasmic protein"
FT                   /note="KEGG: bhy:BHWA1_00532 periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70368"
FT                   /db_xref="InterPro:IPR021533"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5A1"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00532"
FT                   /protein_id="ADG70368.1"
FT                   /translation="MKKLSILFLSLMVLSASSLFADDWVVPPSALPANAASFIQRVFPG
FT                   VQIWKVERDGRKFDVKLSNGVSIDFLGNGDWENIDSEYAPIPDAAFPPAVVQAVKNAYP
FT                   QAAIIDAEKEWGNYKIKLNNMMEVMVTGNGQIMGQKFDD"
FT   sig_peptide     345896..345961
FT                   /locus_tag="Bmur_0262"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            complement(346456..347691)
FT                   /locus_tag="Bmur_0263"
FT   CDS_pept        complement(346456..347691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0263"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   bhy:BHWA1_00838 GltP, Na+/H+-dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70369"
FT                   /db_xref="GOA:D5U5A2"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5A2"
FT                   /inference="protein motif:PFAM:PF00375"
FT                   /protein_id="ADG70369.1"
FT                   /translation="MKSSFWKNYKFPILLVSGVVIGSILGIILKEKAAVLKPFGDVFIN
FT                   ILFTVVVPLIFLSITNSIIQMDDMKRLGKIVASMFVVFIITGLIAATIMIITVRVFNPA
FT                   EGFQIPITQVEEPNPPKVSEQLVKMITVTDFKDLLSISNMLPLIVFSLFFGFSIKLVGE
FT                   KAKPLVAVIDGATLALMKLVSIIMYYAPIGLGAYFANLVGKFGPELIGTYARACAVYYP
FT                   AAFLYFIIFFPIYGYIAAGKYGVKSMKHLITPMITSLSTQSSIATLPINLEASEKIGIS
FT                   EDVRNIVLPIGATAHMDGTCLSGILKIAFLYGVFGMNFTGIEVWIGSIVFVVLAGMANG
FT                   AIPGGGLISEMLIVSIYGFPPEAFPLIATIGILVDPPATMVNSVGDNVAGMLVSRIVEG
FT                   KDWFKHAINSSN"
FT   gene            complement(347709..348908)
FT                   /locus_tag="Bmur_0264"
FT   CDS_pept        complement(347709..348908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0264"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   bhy:BHWA1_00840 bifunctional PLP-dependent enzyme with
FT                   beta-cystathionase and maltose regulon repressor
FT                   activities"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70370"
FT                   /db_xref="GOA:D5U5A3"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR027619"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5A3"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADG70370.1"
FT                   /translation="MTIEEFNSKYLVNREGTNSQKWDTIKDRRFKVGGLIPMWVADMEF
FT                   RAPDEVLEALNKRVNHGVFGYTVLWDSYFEAFFNWQKKRYNIDLKEEWINFSTGLVTAL
FT                   YWLVNAYTNKGDSVVILTPVYYPFHNAVKDNERNLIKCELKNDNGVFSIDFEKLEDDIV
FT                   KNNVKLMIFCNPHNPAGRVWTDEEIDKTFDICKRHNVYIVSDEIHQDINLGYRPFISAL
FT                   SIKNKDKYLDRLVVLTSPSKTFNLACLLNSHIVIPDEKMREKYNKFVNTVNRTELSLLG
FT                   MVAAEAAYRYGEDWVDGLLKTIRRNYEYIRDELKAKVPEIITSPLEGTYLPFIDLRKVV
FT                   SSDRVKEFIQDDCKIAIDFGEWFSDNCKGFIRVNVATDFKYIEEFVNKVSSQLKNKNYK
FT                   "
FT   gene            349093..349761
FT                   /locus_tag="Bmur_0265"
FT   CDS_pept        349093..349761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0265"
FT                   /product="YheO domain protein"
FT                   /note="PFAM: YheO domain protein; KEGG: hin:HI0575
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70371"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5A4"
FT                   /inference="protein motif:PFAM:PF08348"
FT                   /protein_id="ADG70371.1"
FT                   /translation="MDNYTKSGSVVLDDTDRAIIQSYENAVKGIANIFGTYCEVLVHSL
FT                   DNYEHAVLFIENGHNSSRDVGAPITDLALELINSVHKDKKFLESYESKFPNGDRCKSVT
FT                   IPIKNKDKLIGLLCININMEVSLIDFMREFSINKNDSVEHTHSENYSSNIDDMIKSILN
FT                   KNINDIILDMSIPNQEKNKQIILKLHKIGFFQLKGSVEALAEKLHISVHTVYSNIRKYT
FT                   "
FT   gene            complement(349963..350724)
FT                   /locus_tag="Bmur_0266"
FT   CDS_pept        complement(349963..350724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0266"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_02621 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70372"
FT                   /db_xref="InterPro:IPR025349"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5A5"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_02621"
FT                   /protein_id="ADG70372.1"
FT                   /translation="MNEDIKFITDFLKCDYDILEGGLEDDTDIMNWYKENLEKGKKEGY
FT                   IPLIIIPSDMLTEAIECFLEDNDCDIKDSRKLINEYIEKSKDIDYKKYLNQNIEDIYED
FT                   KEYIEEIRKSFNAPVEGGFEVFDSFGSYYDYETKSTVDLILAKIPTLNPYELACYIPMG
FT                   GFNDCPNPETQTAIFKYWYEKYNAYPAVVGYDTWELFIEKLPNTEEEARELAIEHYYFC
FT                   LDRVDQYGENYDHGKLAGTLLKSNVWYFWWD"
FT   gene            complement(350796..352412)
FT                   /locus_tag="Bmur_0267"
FT   CDS_pept        complement(350796..352412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0267"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: bhy:BHWA1_00181 extracellular solute-binding protein,
FT                   family 5"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70373"
FT                   /db_xref="GOA:D5U5A6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5A6"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ADG70373.1"
FT                   /translation="MKKNILITFLLFIIICFLASCNKKPKNILNEITVSVGPEPQTIDP
FT                   TINSAVDAMIYTTHLFENLTIKDENGNIIPGAAESWVSSNNNTIYIFNIRSNAKWCDGM
FT                   DVTADDFIYAWKRIVDPKNGASYSILLDVIKNASDIMMGNKDKDTLAVKALDDKTLYVE
FT                   LEYPVPYFPEMVAHTAYTPLREDIVSQDEDGWTLKTDTMVGNGAFQIVRWDHNSRLVVR
FT                   KNTDYWNYKEIKPDIINFEFIDNDNTAMSAILNGEISFYHNAPINDRAKLIEEGIARVV
FT                   TNVSLYFYEVNHKKAPFNDERVRRAISLAIDRDYIVNNIMKAGEKPAAAIVPYNIKDVY
FT                   GTNDFRYQKDGYFSVNSEDYQKNVEEARSLLAEAGYPNGEGFPVFEFLTNPGFHVTIAE
FT                   SIQSMLKEALNIDMVISQEEWAVLLQTRRDGNFDMARQGWIGGYNSPQAFLSLVKTGYV
FT                   LNEGRYSNPEFDKALYDAAFSQSDLERSEYLHKAESIAMDDMAIIPIFYYSGTVMQSKN
FT                   LNDVIYDIFGIYNFSRAYMSE"
FT   gene            complement(352491..352793)
FT                   /locus_tag="Bmur_0268"
FT   CDS_pept        complement(352491..352793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0268"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   KEGG: bhy:BHWA1_00438 restriction modification system DNA
FT                   specificity domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70374"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5A7"
FT                   /inference="protein motif:PFAM:PF01909"
FT                   /protein_id="ADG70374.1"
FT                   /translation="MISLTENEIQIIKDILKKHIKYGKVYLFGSRVKGTNKKFSDIDIV
FT                   IDINAKLSLNEMSRIKDDFDESDLIYIADIIDYNAVDNSFKSIIDNEKVLIYETI"
FT   gene            complement(352790..353233)
FT                   /locus_tag="Bmur_0269"
FT   CDS_pept        complement(352790..353233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0269"
FT                   /product="nucleotidyltransferase substrate binding protein,
FT                   HI0074 family"
FT                   /note="KEGG: bhy:BHWA1_00437 nucleotidyltransferase
FT                   substrate binding protein; TIGRFAM: nucleotidyltransferase
FT                   substrate binding protein, HI0074 family; PFAM:
FT                   Nucleotidyltransferase substrate binding protein HI0074"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70375"
FT                   /db_xref="GOA:D5U5A8"
FT                   /db_xref="InterPro:IPR010235"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5A8"
FT                   /inference="protein motif:TFAM:TIGR01987"
FT                   /protein_id="ADG70375.1"
FT                   /translation="MKDALFLRFFMILNLDSLKKSITALEKSINVYDRIKTDDEDLILT
FT                   IRSGVIQNFEVAFEQSWKFIQRWLNENINPDITSGITKKELFRLAAKHLLIDDVEKWIR
FT                   FKDARNYTSHIYSNEVSLEVINEASAFLPYAKYLLKRLEENNE"
FT   gene            complement(353280..354470)
FT                   /locus_tag="Bmur_0270"
FT   CDS_pept        complement(353280..354470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0270"
FT                   /product="acetate kinase"
FT                   /note="KEGG: bhy:BHWA1_00180 acetate kinase; TIGRFAM:
FT                   acetate kinase; PFAM: acetate and butyrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70376"
FT                   /db_xref="GOA:D5U5A9"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5A9"
FT                   /inference="protein motif:TFAM:TIGR00016"
FT                   /protein_id="ADG70376.1"
FT                   /translation="MNVLVINSGSSSIKYQLFAMPEAKVLAKGLLEKIGEETSALKHTA
FT                   VEKGKEKKLEQKVADHKAGMSLIFSLLTDKEVGVISDMSEISGVGHRVVHGGEAFSKST
FT                   LVTDEAIKAIEACCDIAPLHNPAGLQGIAACKEILKDVKMVAVFDTSFHQTIPEYAYMY
FT                   AVPHEWYDKYKIRRYGFHGTSHRYVYGEFCKAENKPNANVIVCHLGNGASVTAVKNGES
FT                   VDTSMGLTPLEGLVMGTRSGDMDPAAATFVMAKENLSPKEMDNILNKKSGLLGVSGVSN
FT                   DMRNLEEASKTNHRAELAIQMFCYRVKKYIGAYMAALGHVDGIVFTGGIGENSSSIRGR
FT                   ILEGLDELGIKCDADKNSKARGCASFEKDGAAIKLYVIATDEEKAIAMDTYNIALK"
FT   gene            complement(354842..356083)
FT                   /locus_tag="Bmur_0271"
FT   CDS_pept        complement(354842..356083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0271"
FT                   /product="Peptidase M30, hyicolysin"
FT                   /note="PFAM: Peptidase M30, hyicolysin; KEGG:
FT                   bhy:BHWA1_01703 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70377"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5B0"
FT                   /inference="protein motif:PFAM:PF10460"
FT                   /protein_id="ADG70377.1"
FT                   /translation="MKKYIILFILSIIFLNSCGVVGSILGSNYNNPVYDDGVLTYYDEY
FT                   TSVTKRFRVINENNTVEIKLFRTYAESDNLIIYVENGADVKRSSVSKIGSDFNKYYSDL
FT                   VSIYGQHTDVDGNGKIDILLFSMNPPGASTVTLGYFYGADLLLGYFNDAEILYMDLTLV
FT                   NSVPETMSGTILHELQHLINFNVNDINKGRAMDVWLNEALSESTSILYSPITAASRIEE
FT                   FNDMGGYYCFYTWSLPMNIFANYPSASVFVNWIYNESGNDKTVFRDIASSSQVNDYNKI
FT                   LSSVSRRGIANTWEELLLNWMEGVFSYQLSGVNPVFRSSGETVPLYPGALVAYYGSLGT
FT                   VSDNNLSTRKLSSNIEIALNKDTYVGDNPSAVNIQIPNSINAMQYKSSSQISKPYVPKY
FT                   RNILLDIDGNVKKY"
FT   gene            356411..357184
FT                   /locus_tag="Bmur_0272"
FT   CDS_pept        356411..357184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0272"
FT                   /product="SCP-like extracellular"
FT                   /note="PFAM: SCP-like extracellular; KEGG: bhy:BHWA1_00178
FT                   spore coat assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70378"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5B1"
FT                   /inference="protein motif:PFAM:PF00188"
FT                   /protein_id="ADG70378.1"
FT                   /translation="MKKLNFIIVLMFISTLILSANTIEDEVFRLINLERSKVSLPPLPN
FT                   NQRLHSLALYHADNMAKNKFFSNIDLDGLDSKARQVKLYPEMVGNISESLGKLDVIPFT
FT                   DKKAAESIVKNLMATPDSKKNILNKNFNAIGVGAVKRGVGVYVTVTFADIVAESVDFTP
FT                   TAKYGEDITVKYRILNGAAFTDFKIAVEMADKEARITGDDGKTYIGNIIYDVKDMGNSI
FT                   LGRTFKAEYGKGDYKISILYKGQHFLSNVRTITVE"
FT   sig_peptide     356411..356473
FT                   /locus_tag="Bmur_0272"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.952) with cleavage site probability 0.431 at
FT                   residue 21"
FT   gene            357209..357619
FT                   /locus_tag="Bmur_0273"
FT   CDS_pept        357209..357619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0273"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   bhy:BHWA1_00177 biopolymer transport protein ExbD/TolR"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70379"
FT                   /db_xref="GOA:D5U5B2"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5B2"
FT                   /inference="protein motif:PFAM:PF02472"
FT                   /protein_id="ADG70379.1"
FT                   /translation="MKFRRRFDIKSGIDLTPMIDIVFNLLIFFMVGTTIIETPQIEISL
FT                   PKSTSAVGAEKNETIIISISRDGKKYINGYEVENLDNNLKELANTEGELEKPVEIRSDE
FT                   DVRTQVLISVIDSVKNAGFTRLSIATENAKEN"
FT   gene            complement(357626..358681)
FT                   /locus_tag="Bmur_0274"
FT   CDS_pept        complement(357626..358681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0274"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /note="KEGG: bhy:BHWA1_02691 dTDP-glucose 4,6-dehydratase;
FT                   TIGRFAM: dTDP-glucose 4,6-dehydratase; PFAM: NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70380"
FT                   /db_xref="GOA:D5U5B3"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5B3"
FT                   /inference="protein motif:TFAM:TIGR01181"
FT                   /protein_id="ADG70380.1"
FT                   /translation="MRKFDTVLVTGGCGFIGTNFIKYIFEKTSYDIKVINIDDLTYAGN
FT                   IKNLIDIKNKYKDRYYFERVNICDAKKVNSIFQKYKPDCVVHFAAESHVDRSIFGPKNF
FT                   VETNIIGTFTLLEAARNLWKDNADGKLFHHISTDEVYGSLSDTGYFYETTAYDPRSPYS
FT                   ASKASSDHIVKAYYHTYNLPVTISNCSNNYGPYQFPEKLIPLMILNIIEEKYLPVYGDG
FT                   KNIRDWIFVEDHNNAVLDIINKGRVGETYNIGGENEMTNIDMVNILCEKLASKMNKEKD
FT                   YYKKLIKFVKDRAGHDRRYAINCEKIKNELGWKRQYDFNTAIDITIDWYLNNKEWVYDV
FT                   KRSGEYKKRIN"
FT   gene            complement(358719..360674)
FT                   /locus_tag="Bmur_0275"
FT   CDS_pept        complement(358719..360674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0275"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bhy:BHWA1_00176 ABC transporter, transmembrane
FT                   region; PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70381"
FT                   /db_xref="GOA:D5U5B4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5B4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG70381.1"
FT                   /translation="MLIKKVKEFFKKDSRPFDYGAVTEEHRKKYYSNPEKHPYKRMFSY
FT                   AMRHKKLFIPSFLLSIGYTIINILPPFFGQMAIAITGGKRVDILDKIPFVADLTARFSN
FT                   INTKDLAQQFLTADPIANPVIIAQFTFIIIIGFIYVLFRVGFDYVKTFLFAFTAQEIGK
FT                   DVRADMMKGLLNTDIAYFKQEKEGDLMSRVINESGSIESFLSSTLPNMVTVPLTLILTL
FT                   AMLLILNVKLTIACFVAAPLIALGIDKVSKLIRTRVTAQQNFLGSTTSVIQEDIRGIEV
FT                   IKIFSKEDAEVSRYKTLYSELINLMRKMSLLTSLNRPMTELVMIVAMLVILAYGGFLIF
FT                   KGEMPFEFLWGFLLYMLNISTPVRDLSGIVINLQMTKMIAMRVFEIIDLPAENVNDPTK
FT                   KEMKPIEHSITFENVNFEYPRRSNSDPFHLGPVSFNVKKGDVVAFVGNSGGGKTTLISL
FT                   IPKLFTPSSGVIRFDGIDINELNTRSVRNQIGVVSQENILFYGTVRENILYANPNATDD
FT                   ELVRAAKIAHADEFILKLPNGYDTHIGPRGVMLSGGQRQRIALARAVVKKPSILILDEA
FT                   TSALDTESEMYVQKALNDIINLQTTFVIAHRLSTIKNATYICVVENGKIIESGTHEELM
FT                   KRGGKYQYLYSLQFRE"
FT   gene            complement(360719..361399)
FT                   /locus_tag="Bmur_0276"
FT   CDS_pept        complement(360719..361399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0276"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bhy:BHWA1_00175 lipoprotein releasing system,
FT                   ATP-binding protein; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70382"
FT                   /db_xref="GOA:D5U5B5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015854"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5B5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG70382.1"
FT                   /translation="MSDVIINIENLKKTYIGPPKVEVLKSLSLQVYKNEILAITGESGS
FT                   GKTTLLNLIGGIDNITDGIINIAGNNIGKMNEGQLAHFRNSSLGYVFQFHNLLGEFSAV
FT                   ENVMIPSLMLKYNKKEAKQKAEYLLETVGLKDRMDHRIGELSGGEAQRVAIARALINKP
FT                   SVVLADEPTGNLDKKNAELVRELLWNMTKQSNASLIIVTHSVSIANMADRKLRLEYGEN
FT                   LIEY"
FT   gene            complement(361392..362687)
FT                   /locus_tag="Bmur_0277"
FT   CDS_pept        complement(361392..362687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0277"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   bhy:BHWA1_00174 lipoprotein releasing system, hypothetical
FT                   protein, LolC/E family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70383"
FT                   /db_xref="GOA:D5U5B6"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5B6"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADG70383.1"
FT                   /translation="MLGVRYLRAKKKFSFVSVITIICVLGILVGDMVMITVLSVMNGFQ
FT                   DDIRDKILGMRAHINISSYSDGAISDYKYVVDNIMDNKDITSAYPYIVIPCIMRSYNFT
FT                   ILITVRSFEDNIFSTDKDFIKYFNFVEGNNKDMKTNEALIGSEMAKDYALSVGDTIDII
FT                   SASGSFDRGFKPQKTTFTIKGVYKTGYYEYDSRMVIVPLSAGQSMVGYSNAVTGVAVKV
FT                   KNFFDADKVAKQIDSDLKEFYNVMPWMLFDRNFFQALHTEKLMLALILSFIILIAALNI
FT                   ASSQIIFVKDKRRDIAIIKTLGLRPSNVAKVFFLEGAIIGVIGTVLGVIFGVLLANYVN
FT                   EALEGIRIILQAIVNIIWFIPSAISSNISIPIVPDFFPSDIYYVSGGLPSIIHASQVIM
FT                   VACISFLLSVLFAIIPAYIASRYKPAEVLRYE"
FT   gene            363072..363260
FT                   /locus_tag="Bmur_0278"
FT   CDS_pept        363072..363260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0278"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70384"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5B7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG70384.1"
FT                   /translation="MFKQWLMILLEEKIEENGFVSIHKFNNGKKYEEKITNIEDLAQCN
FT                   IGMLISIVNNYRMLPKN"
FT   gene            complement(363522..363920)
FT                   /locus_tag="Bmur_0279"
FT   CDS_pept        complement(363522..363920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0279"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG:
FT                   bhy:BHWA1_00123 putative purine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70385"
FT                   /db_xref="GOA:D5U5B8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5B8"
FT                   /inference="protein motif:PFAM:PF00156"
FT                   /protein_id="ADG70385.1"
FT                   /translation="MEYDVISWADIDEAIEILAKQIEDSKIHYEVIYGLARGGLVPAVM
FT                   LSHRLKIPMVLNMEEVWRLKVKNKAALIVDDISDTGETLKYFDDQKFDIATLFVREHTS
FT                   KIKPRYNYKNINHDNWLLFPWETKSSSK"
FT   gene            complement(363939..366362)
FT                   /locus_tag="Bmur_0280"
FT   CDS_pept        complement(363939..366362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0280"
FT                   /product="phenylalanyl-tRNA synthetase, beta subunit"
FT                   /note="TIGRFAM: phenylalanyl-tRNA synthetase, beta subunit;
FT                   KEGG: bhy:BHWA1_00122 phenylalanyl-tRNA synthetase alpha
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70386"
FT                   /db_xref="GOA:D5U5B9"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5B9"
FT                   /inference="protein motif:TFAM:TIGR00472"
FT                   /protein_id="ADG70386.1"
FT                   /translation="MRVPLSWLKEFVNLDGFTVEEIAKKITLAGSEISSIETTGGDIPS
FT                   VIIGKIISVHKHPDADKLSVCKVDVGDGDTLSIVCGAPNVREGIYVPIAMIGAKLPNGL
FT                   TIKKASIRGFESNGMICSRTELGYEEIEGVYGIWILDDDIEKVNADKDSILGNSLSTIV
FT                   GTTDHIFNVEITANRGDLVSIIGFARECSLVLERRVSIPSVNTYDAAGGNIDITVENQE
FT                   SCYKYVGRLIKDITVGPSPDWMQKRLIMCGINPINNIVDVTNYVMLEYGQPLHAYDFDK
FT                   VKDGKIIVRNAVNGEKIKLLDGRDVELTDEVLVIADSEKPIGVAGVMGGDATKIEPETK
FT                   TILIESACFDHIAVKKSTIVTNTKTDASYRFEREIDHTLTLAALNRVVDLIVTLDNSCK
FT                   IASRSKELNVRQFDSTIIVFDCGLVKRYLGLNMSKMEISSIFKRYGFKAVALGENNLKV
FT                   EIPSYRHDLSIAEDLIEEIARVYGYNNIESNVPHIKCNPIKTDYKEVSFVKHRMASYGL
FT                   YETKQYSMGDSNIFKSIGIEEEKLIKVVNPLTTEMDVLRPTTLVSLLNSVLYNQNHRHK
FT                   NGALFEVGNIFYKENDNFVEEKHLSAVMFGLYQEKLWNKDSRPYDFFDMSGIVEELLIK
FT                   DLKCTDYNLIPKEHKWFIPTMSAEIMIFGERIGIIGRLHPKLLSLFDINTEVYFLDIDI
FT                   RKTLKLVKERVKKQKLKDIGKYPAVFRDLALVCDNNIEFNKVIKSISRFNNIIQNVDVV
FT                   DRYVGEQVGEGKQSIAISITYYDPNKTLREEDINNAEKSLLEMLKTRFNISLRS"
FT   gene            complement(366430..367449)
FT                   /locus_tag="Bmur_0281"
FT   CDS_pept        complement(366430..367449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0281"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="TIGRFAM: phenylalanyl-tRNA synthetase, alpha
FT                   subunit; KEGG: bhy:BHWA1_00121 phenylalanyl-tRNA synthetase
FT                   alpha chain; PFAM: phenylalanyl-tRNA synthetase class IIc;
FT                   aminoacyl tRNA synthetase class II domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70387"
FT                   /db_xref="GOA:D5U5C0"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5C0"
FT                   /inference="protein motif:TFAM:TIGR00468"
FT                   /protein_id="ADG70387.1"
FT                   /translation="MDNLEELYSFLKNSIENANTQSEIDDIRIHYLGRKGKITELLKSL
FT                   SSIENIEEKKEFGKKINEIKNYCENALSEKKNEISDREFLLSLEKNKIDITMPGRRPKA
FT                   ASVNLLTSVEEEIVSILTEIGFRVVEGNEIEDDFHNFEALNIPYYHPSRDSHDSFFISK
FT                   ENVLRTHTSGMQIRTMLETPPPIAVVSPGKCARRDAIDSKHSPVFHQVEGIMVDSGISF
FT                   NDLKGILELFCKRMFGDKTQIRLRPDYFPFVEPGADLSATCVICGGSGCKTCGGEGWLE
FT                   LMGAGMIHPNVFKHVGYDITKYTGFAFGMGIERVAMIKYGITDIRMFYENDIDFLKQW"
FT   gene            368219..369241
FT                   /locus_tag="Bmur_0282"
FT   CDS_pept        368219..369241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0282"
FT                   /product="metalloendopeptidase, glycoprotease family"
FT                   /EC_number="3.4.24.57"
FT                   /note="TIGRFAM: metalloendopeptidase, glycoprotease family;
FT                   KEGG: bhy:BHWA1_00427 O-sialoglycoprotein endopeptidase;
FT                   PFAM: peptidase M22 glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70388"
FT                   /db_xref="GOA:D5U5C1"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5C1"
FT                   /inference="protein motif:TFAM:TIGR00329"
FT                   /protein_id="ADG70388.1"
FT                   /translation="MKILGIDTSCDDTSAAIVEDGNKVLSSVLSSSIDAHKDFQGVVPE
FT                   IAARKHLEAILYVIDKAVKDADTSLDKIDLFAVTNRPGLLGSLLVGVGSAKSLAFSLNK
FT                   PLLALDHIAAHIYSPHLTNNIEFPYIALVVSGGHTIITEVHDYGEYKVVGTTLDDAVGE
FT                   AFDKVAKFLNLGYPGGPIIDKLAKEGNKEAIKYPVILLNGIDEYNFSYSGLKTACVYST
FT                   KKYLKEGCEATNENIAAAFQISAIEPLYIKTLKYVQKSGIKRVTLSGGVACNSYLRERF
FT                   GNSKDFECYLPALKYTTDNAAMVAGLAYYMKDKESFADYNLDCSSRVLNKKYNKNKSIK
FT                   "
FT   gene            complement(369339..370823)
FT                   /locus_tag="Bmur_0283"
FT   CDS_pept        complement(369339..370823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0283"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00277 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70389"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5C2"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00277"
FT                   /protein_id="ADG70389.1"
FT                   /translation="MKKIFLLITIMSLIIIQCGNKSDNQTTSNNNVNTNETVQSNETIL
FT                   GVTVEILSQADEAFLEKVKNKIIISGSAKYTFKDNGDIEYVFEHGKYREDKNYIFESSK
FT                   DGTNAYYYELYNIQDKYEKGPSNIAANYKGFSVKNGILYEDNYQGYESDPNETIMSKWE
FT                   KENYYSNYYYREVKENPNFDNFPYDNKADVTFDEYNRISRGILISESDYKPEEVGDINN
FT                   YNFDGVYSNNNSSIELKKNDDGTFYFYAINITTDENGQTVTNIQSTDTDKMVLSENQYV
FT                   EPYCGIGSQTLDYEEVVGADGGYIISIQPISADTIMVTEPNGSYGFTGIYKKAPEIIND
FT                   DDKSTKEKAYYNACRWYAENYSELNDIFNKIVDFDFEGGGYYEINMENVYLYIAKFENS
FT                   GYFSDNYIKNLENRFEEIKNYLEENKQNDGAVEGMEADWFLAAQEIDYYLNIITNEMTL
FT                   KDIVNYDGDSLCISNEAGESVILEVKKYGDEWLIEK"
FT   gene            complement(370986..371972)
FT                   /locus_tag="Bmur_0284"
FT   CDS_pept        complement(370986..371972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0284"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00276 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70390"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5C3"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00276"
FT                   /protein_id="ADG70390.1"
FT                   /translation="MKKILLLITIMSLFIIQCGNKTNTVNTNESVQSNETIPAAEILSK
FT                   EDASFLEKVKNKILIGGNAQYTFKDNGDIEYVFEHGSYREDKNYIFESSKDGINAYYYE
FT                   TYNIQDRYKEGPSNIATNYKGFSVINGILYEDNYQGYEGDPIETIMTKWEKENYYSNYY
FT                   YREVKENPNFDNFPYENKADVTFDEYNRISRGILISKSDYRPKEVGDINNYNFDNVYTN
FT                   GYNASIELKKNDDGTFYFYAINITTDENGQTVTNIQSTDVSKMLLSENQYVEPYCEIFD
FT                   NSMEYGEVYGADGTYMLDITPISSDALVLVENNGSYGFSGVFKKQSN"
FT   gene            complement(372022..373794)
FT                   /locus_tag="Bmur_0285"
FT   CDS_pept        complement(372022..373794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0285"
FT                   /product="protein serine phosphatase with GAF(s) sensor(s)"
FT                   /note="KEGG: bhy:BHWA1_00275 serine phosphotase RsbU sigma
FT                   factor regulatory protein; PFAM: Stage II sporulation E
FT                   family protein; GAF domain protein; SMART: protein
FT                   phosphatase 2C domain protein; GAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70391"
FT                   /db_xref="GOA:D5U5C4"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5C4"
FT                   /inference="protein motif:PFAM:PF07228"
FT                   /protein_id="ADG70391.1"
FT                   /translation="MDIYDIVDNPEKQLEVFSGIIKRMNASGDHDETLVTIISEIKTIM
FT                   YTDSILLYLVDQELYNLHYEMSIGPLGSKFFGNIIDSERPLAVRAYTTSCSLYSNDPQE
FT                   DSAFIPMKEVLGEELKNILFVPLKVRKKNIGSLFLINKKNGKFIEQDTVVMSLFANIVS
FT                   LALVNKMVYDRAQSRAYEVGALYQMSISINKCETIEEILNDNISIVCEAFEAHRVSVIL
FT                   KDNGVFKFKAGIGIDEDVLKYGIVTVDDNVLSEVLRTGKPVYSYDVDRDSRFRPNKSLR
FT                   YKRNSFMVAPIAAKDEIIGFLSATERNIDKAFNLSNLSLLEMLAQQIGENYMHVLLSEE
FT                   SKIKESLTEEINFTEQLQKSVLPKEFPNDGLFDIAAVSIPSKNVGGDFYDYIKISDAKY
FT                   ALVIADVSGKGLGAGFFMTMTRSILRVYFSEMDDPAKILESANKHIYKDSNNGMFVTCF
FT                   LVVIDTENKTLTYSNAGHLTQYLLKKYQISSLDSILEMHTHGKPLGFIEDAKYQNKQIS
FT                   YSNGDTIILYTDGITETFNKDEEEYGEERLKNILKNDYDDAKELVDDIVNETISFRGKT
FT                   PQFDDITLLVARLL"
FT   gene            374003..374977
FT                   /locus_tag="Bmur_0286"
FT   CDS_pept        374003..374977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0286"
FT                   /product="dihydrouridine synthase DuS"
FT                   /note="PFAM: dihydrouridine synthase DuS; KEGG:
FT                   bhy:BHWA1_00274 dihydrouridine synthase-like (DUS-like)
FT                   FMN-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70392"
FT                   /db_xref="GOA:D5U5C5"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5C5"
FT                   /inference="protein motif:PFAM:PF01207"
FT                   /protein_id="ADG70392.1"
FT                   /translation="MKRGITIEGVNIPSRFFLAPMAGYTDYIFRRLSRRFGAGLLITEL
FT                   VSAAALARQVKKTYRYMEHKEDEYPISLQLFGANEDDYKKAIEITNLSGFSFIDINMGC
FT                   PTKKVVKNNGGAGLLEDTGKMVSILNAVKSVSPLPVSVKIRLGLKRGEGGEIERALALK
FT                   ENGACFLTLHGRYASDLYRGTADWEAIARVKEALGKDYILIGNGDIKTKEDALKAFNIS
FT                   NVDGIMVGRGAVGNPWIFRELNTIFEDNDDYNNDITENDSLKNIIKEHINGCCELYGEI
FT                   SGIHFMRKFVMKYLTGYRMENKIELMKCESKEELFKILDSIIS"
FT   gene            complement(375042..376157)
FT                   /locus_tag="Bmur_0287"
FT   CDS_pept        complement(375042..376157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0287"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: cpf:CPF_2654 putative maltose/maltodextrin ABC
FT                   transporter, ATP-binding protein; PFAM: ABC transporter
FT                   related; Transport-associated OB domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70393"
FT                   /db_xref="GOA:D5U5C6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5C6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG70393.1"
FT                   /translation="MSSIKFEHVRKVYDNNVEVVKDFSLYIEDKEFVILVGPSGCGKST
FT                   TLRMIAGLEDITDGKLYIGDRLVNDVAPKDRDIAMVFQNYALYPHMSVFKNMAFGLELR
FT                   KTSKDEIKKRVKWAAEILDIAHLLDRKPKALSGGQRQRVALGRAMVRNPSVFLLDEPLS
FT                   NLDAKLRVQMRTELIKLHKQLQTTFVYVTHDQIEAMTMGTRIVVMKDGDIMQVDDAKTL
FT                   YNSPKNLFVAGFIGAPQMNFINAVLTKKSGKWYASFDGYEIELNNDRISKLDDSYDGKE
FT                   AVLGIRPENVFLYKDKSESNSPNLIQAVIDVIEMIGSESYLYMNFGDSQITIRINTSED
FT                   YKRDQQAFMDFDLNKLHIFDKDTEKNILVEQ"
FT   gene            complement(376227..377237)
FT                   /locus_tag="Bmur_0288"
FT   CDS_pept        complement(376227..377237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0288"
FT                   /product="Phosphotransferase system EIIB/cysteine,
FT                   phosphorylation site"
FT                   /note="PFAM: Phosphotransferase system EIIB/cysteine,
FT                   phosphorylation site; KEGG: bhy:BHWA1_00273
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70394"
FT                   /db_xref="GOA:D5U5C7"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5C7"
FT                   /inference="protein motif:PFAM:PF00367"
FT                   /protein_id="ADG70394.1"
FT                   /translation="MKDNKKDIKFILPLSLLGGRKNIVKVNNCATRLRLEVKDADKVNA
FT                   EEIKKYYPAVQKISDTEVHIVVGTNAGLLAESLEKILASDDSSDNMALQLIPLLGNREN
FT                   IVKVNNCATRLRLEVKDMSKVNAEEIKKYYPAVQKISDREVHIVVGTNVFSLAEELEKI
FT                   LNIANTSSDENNNENNYGSRAWSIIPLLGGIENIEKVNNCATRLRLNIKDMNKVNTDEI
FT                   KKYYPAVQKISDTEVHIVVGTDASLLADALRKLLDSQKVKTVLLLPLLGGIENIVKVNN
FT                   CATRLRLNVKDMSKVDTDEIKKYYPAVEKINNNEVHIVVGTDANLLADELKKFVL"
FT   gene            complement(377367..378827)
FT                   /locus_tag="Bmur_0289"
FT   CDS_pept        complement(377367..378827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0289"
FT                   /product="PTS system, N-acetylglucosamine-specific IIBC
FT                   subunit"
FT                   /note="KEGG: bhy:BHWA1_00272 pts system, N-
FT                   acetylglucosamine-specific IIBC component; TIGRFAM: PTS
FT                   system, N-acetylglucosamine-specific IIBC subunit; PFAM:
FT                   phosphotransferase system EIIC; Phosphotransferase system
FT                   EIIB/cysteine, phosphorylation site"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70395"
FT                   /db_xref="GOA:D5U5C8"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010974"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5C8"
FT                   /inference="protein motif:TFAM:TIGR01998"
FT                   /protein_id="ADG70395.1"
FT                   /translation="MFNYLQRIGKSLMVPVAVLPAAAILLGIGYWIDPNGWGGGSPVAA
FT                   FFIKAGGAIIDNMPILFAIGVAFGMSKDRNGAAALAGLVAFLVVTTLLAPATVAMIQSK
FT                   PVDQVPAGFAKINNQFIGILCGVIAGGLYNKFAEVQLPEFLAFFSGRRFVPIITSVVMM
FT                   VVSFILMVVWPAIYNALVSFGEAIIGLGPIGAGIYGFFNRLLIPVGLHHALNSVFWFDV
FT                   AGINDIPNFLGGQASIDAGTATIGVTGMYQAGFFPIMMFGLLGACVAFVKNAKPENKNK
FT                   IKSIMLAAGFASFFTGVTEPIEFSFMFVAPVLYVIHALLTCISLIISASMKWMAGFGFS
FT                   AGLIDLLLSTKNPLATHWYMLIVQGIVFFILYFVIFDFAIRKFNLKTPGREDDDEAEVE
FT                   VTISGDASYAEKALMLLPLLGGIENIVDIDNCATRLRLEVKDNTIIQADEIKKLFPGVL
FT                   TPGKTSVQVIVGPKVQFLADEFKKVAKK"
FT   gene            379120..379584
FT                   /pseudo
FT                   /locus_tag="Bmur_0290"
FT   gene            complement(379675..381009)
FT                   /locus_tag="Bmur_0291"
FT   CDS_pept        complement(379675..381009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0291"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="KEGG: bhy:BHWA1_00270 response regulatory protein
FT                   (AtoC); PFAM: sigma-54 factor interaction domain-containing
FT                   protein; response regulator receiver; helix-turn-helix Fis-
FT                   type; SMART: response regulator receiver; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70396"
FT                   /db_xref="GOA:D5U5C9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5C9"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ADG70396.1"
FT                   /translation="MPKILVIDDEKNIRDGIKKSLEFEGYEVVTAENGEKGIETVYKGG
FT                   IDLVITDLKMPEKTGEEFLKDILEFDKHIPVIVLTGHGNVETAVEMMRLGAYDFMTKPF
FT                   NLDKMLLIIARALESKNIKKTNETLEKRVDYNESFYGMIGHSAKILKVYEAIKQVARTK
FT                   ATVLIEGESGTGKELVASAIHQISDRAKQPYITVNCAALSEGVLESELFGHEKGSFTGA
FT                   VDKKIGRFEAANKGTIFLDEIGEINQAVQVKLLRVLEERVIERVGSNTPIDVDIRVIAA
FT                   TNKKLSEEIKEGKFREDLYYRLNVIKIEMPPLRERREDIPLLIDNFIKEFSKVHSIEIN
FT                   SVDKKVYKILSSLQWEGNVRELRNTIETMVVMCKDGKIDESSIPDWALKSSSNDDFVVD
FT                   GNVTLEELEKMYINYLLSHNNFNKAQVAKILGIERATLYRKLKED"
FT   gene            complement(381002..382183)
FT                   /locus_tag="Bmur_0292"
FT   CDS_pept        complement(381002..382183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0292"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: bhy:BHWA1_00269 sensory box histidine kinase;
FT                   PFAM: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein; PAS
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70397"
FT                   /db_xref="GOA:D5U5D0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5D0"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADG70397.1"
FT                   /translation="MNRTNQFFDKIFQNFDKVSDAEKKKVFQRLSTLWYSQNIIIENLE
FT                   EGIIAIDNEGMIQGINKKACFLFSIPRNSEGESLSKCMPDNDIGKTILELINSSNAETK
FT                   LLKDNESERILQINILPIGERGRIIGTLIKAFDITKTYESAQKLKRAEQLASLTTLAAG
FT                   VAHEIKNPLGSISIYVQLIDKIIKKNMDNDCQCYKDFKEYSDIIKEEIGRLEDTINSFL
FT                   FSVRKLELNIEDVNINALILSTVSFLKYEIEKNNVSIDIKFDKDNLILKLDERYIKQAL
FT                   INIIQNAIDAMNDNKKEIYIKLKTIDNYAVISIKDTGIGIKEEDLNKIFEPYFTTKRHG
FT                   TGLGLTNVVRIIEAHNGNITIESEYGKGSEVIIKLPLKQENQKFLNTDLLDYA"
FT   gene            complement(382711..383754)
FT                   /locus_tag="Bmur_0293"
FT   CDS_pept        complement(382711..383754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0293"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /note="KEGG: bhy:BHWA1_00578 3-deoxy-7-phosphoheptulonate
FT                   synthase; TIGRFAM: phospho-2-dehydro-3-deoxyheptonate
FT                   aldolase; PFAM: DAHP synthetase I/KDSA"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70398"
FT                   /db_xref="GOA:D5U5D1"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006268"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041071"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5D1"
FT                   /inference="protein motif:TFAM:TIGR01361"
FT                   /protein_id="ADG70398.1"
FT                   /translation="MIVVMKPNAKEEHINNIIERLTEAGLGINKSVGVDYTVIGMVGDT
FT                   SKIDRDLISSLPGVSKVLKVQEPFKRANRAFKKEDTIVDVSGVKIGEGNPTIIAGPCSV
FT                   ESEEQVINIAKSVKASGASILRGGAFKPRTSPYAFQGLALDGLKILKLAREEVGIPIVS
FT                   EIVSIRHLEDFDNTVDMIQIGARNMQNFELLKEVGKLKKPILLKRGLSSTIEEWLMSAE
FT                   YILNQGNENVVLCERGIRTFETYTRNTFDVSAIPAIKRLSHLPVIGDPSHASGKSWMAL
FT                   PLTLSAISAGADGMIIEVHNDPEHALCDGAQSIKPDVFADIMESVNMISDTVQKIKQKH
FT                   NGKIYTK"
FT   gene            complement(383851..383946)
FT                   /locus_tag="Bmur_0294"
FT   CDS_pept        complement(383851..383946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0294"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00578 3-deoxy-7-phosphoheptulonate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70399"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5D2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG70399.1"
FT                   /translation="MIVVMKPNAKEEHINNIIERLIIVANKNCSF"
FT   gene            complement(384252..384950)
FT                   /locus_tag="Bmur_0295"
FT   CDS_pept        complement(384252..384950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0295"
FT                   /product="purine nucleoside phosphorylase"
FT                   /note="KEGG: bhy:BHWA1_00579 purine nucleoside
FT                   phosphorylase; TIGRFAM: purine nucleoside phosphorylase;
FT                   PFAM: purine or other phosphorylase family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70400"
FT                   /db_xref="GOA:D5U5D3"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR004402"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5D3"
FT                   /inference="protein motif:TFAM:TIGR00107"
FT                   /protein_id="ADG70400.1"
FT                   /translation="MATPHIGANKGDIAETILLPGDPLRAKFIAENFLENVVQYNSIRN
FT                   MFGFTGTYKGKKVSVQGTGMGMPSCSIYSYELIHFYGCKNLIRIGTAGALSDKLHIGDL
FT                   VIAMGACTDSNYASQYELPGTFAPIASYELLRKAVNKADEMNINYQVGNIVSSDVFYGA
FT                   NNATPKWAKMGVLAVEMEAAALYMNAAYAGVNALCMVTISDSLVTGEATTAEQREKTFT
FT                   NMMEVALSLA"
FT   gene            385085..385642
FT                   /locus_tag="Bmur_0296"
FT   CDS_pept        385085..385642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0296"
FT                   /product="conserved hypothetical GTP-binding protein"
FT                   /note="KEGG: bhy:BHWA1_00547 hypothetical GTP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70401"
FT                   /db_xref="InterPro:IPR025529"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5D4"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00547"
FT                   /protein_id="ADG70401.1"
FT                   /translation="MSKVLKQSKAVLITALMYNDINIYNLALEKLINNFGEIEVISDEY
FT                   LFSHSIYYKEEMGDTLNKRFIVFKNMIERDYISNVKRITDNIEREYLDDKNNRKINIDP
FT                   AILTLENFILVTNKNFTHRIYLKDGVFADLTLIYKKKEGYTELPWTYADYSSDETKKFL
FT                   KKIRELFYNRLIESSPFGSNWK"
FT   gene            complement(385646..387907)
FT                   /locus_tag="Bmur_0297"
FT   CDS_pept        complement(385646..387907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0297"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="TIGRFAM: hemerythrin-like metal-binding protein;
FT                   PFAM: chemotaxis sensory transducer; histidine kinase HAMP
FT                   region domain protein; Cache domain protein; Hemerythrin
FT                   HHE cation binding domain protein; KEGG: bhy:BHWA1_00548
FT                   methyl-accepting chemotaxis protein McpB; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70402"
FT                   /db_xref="GOA:D5U5D5"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5D5"
FT                   /inference="protein motif:TFAM:TIGR02481"
FT                   /protein_id="ADG70402.1"
FT                   /translation="MKIYSLRFKIPVLFITAIVLSMFLSIGTVLFLSTKVIDNTIESGF
FT                   ESTSISYKNLINLWLDDNNSSMANFVTTEALVSFLQNQEDPNLRLRAEEALKYFKNSRN
FT                   SFINFILLDLNGRAIIDSENGILNNVSMNVNDEGWKKFVSGGYNSGGETTITKSVATGN
FT                   PTYRIWRGIKDNNGRVIGVLAGNVDWGDLIDRYILNAKIGESGRISIIDSNKMLLAHQD
FT                   KNKILSVENNADYYDEVIRNGNGMLHYKDANKQGYLMSYYNIDNTNWYIIISILESELY
FT                   ASLGKTVLFAVLFSFIIIVIVAVMITGFTRRLISPLKEALRLANLISTGDLTFDIREKY
FT                   LARKDEIGELIMSFDHMKTSIKNIINIANSNVALTKRTAYSLSYSNKDLASRTLSQAAD
FT                   LEKTAEATEEISSTIKKTAENAAIINDMMINARNAVEEAGSIIAETAQNTSQAFEYSQK
FT                   ISGLVKFIEDIAFQTNILALNASVEAARAGDQGRGFAVVASEVRNLAQTTQSSVNNITS
FT                   FIGESNEKVKKATDSANMSRTLFEDIESKIEETTKVIADMANTTKEQLIGIDSINNAMS
FT                   NMDAQTQGNSSLVSSMHESSKELEQQMEELADAMSFFKVGARQLEWLDQYYTHNKTIDS
FT                   QHVQIIEYANKVHSALYNGVKADVDEAFKGAINYTKYHFAEEQKIQVANKDKYHKIKEH
FT                   FEEHRRFEKAIDDQYKAFKSSSDWKKVATDFSELLAKLLIEHIGVWDKEFVRIAGIKDS
FT                   "
FT   gene            complement(388099..390348)
FT                   /locus_tag="Bmur_0298"
FT   CDS_pept        complement(388099..390348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0298"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="TIGRFAM: hemerythrin-like metal-binding protein;
FT                   PFAM: chemotaxis sensory transducer; histidine kinase HAMP
FT                   region domain protein; Cache domain protein; KEGG:
FT                   bhy:BHWA1_00549 methyl-accepting chemotaxis protein McpB;
FT                   SMART: chemotaxis sensory transducer; histidine kinase HAMP
FT                   region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70403"
FT                   /db_xref="GOA:D5U5D6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5D6"
FT                   /inference="protein motif:TFAM:TIGR02481"
FT                   /protein_id="ADG70403.1"
FT                   /translation="MKLHSLTFKIPLIMGLSITLSIFVITVIMFLISLKSVDIAAQNGF
FT                   ETTAIAYESTANLWIEQQQSIVDAFSTNESIVNYLLDKTEENTSAAENSLTAFKNYRKS
FT                   SIHFVILDTEGNILLDSEDGNLIHINQGVDPDFHLYQNNLKGEKMWISKSSITGKPVFK
FT                   MYSDINAPDGTKIGVLSYHIDWEDFMRHSISNYKFGDTGSIMIIDEDKNIVAHKDENKV
FT                   LTNIKDFEALKDITELKTGIKHFKNDDGKLYMLYFNTIIYPHWYIIVTIAESELYNPVK
FT                   FMLILPIIVGVVLDILSVIIIWIFSKYLISPINNAVKEAENIANGDLTAVISEKYLNRK
FT                   DEIGEILNSFNKMKRVIKDIIKVVNSNISQTKRTAYSLYYSNKDLSDRTVSQAAEINQT
FT                   SIFMKNISSAIEESATNIRSISESMIDARNDISDAGSIIDDTARNTSLVFESSKKIGDI
FT                   IKIIEDIAFQTNILALNASVEAARAGEQGRGFAVVASEVRNLAQSTSESAKNITVLIED
FT                   SNDKIKKATESANMSQKLFSNIEKKIDNTTTIMENMVETMHKQEEDVHKINTSMLNIDS
FT                   KTKENSHLVDLMKTSSSELEKQTNDFFSAMSFFKTGVHRLEWMDNYNTNNSHIDEQHMN
FT                   LINFINDIYSAIYEDDLERVKNIFNMTLDYTKYHFSDEEKFQKENADKYKKIKEHFEQH
FT                   INFEALVGRKIEELNASNDWKKTASDMADILSKWLIQHIGVWDKEFVKIAGISDC"
FT   gene            390534..391727
FT                   /locus_tag="Bmur_0299"
FT   CDS_pept        390534..391727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0299"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00597 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70404"
FT                   /db_xref="GOA:D5U5D7"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5D7"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00597"
FT                   /protein_id="ADG70404.1"
FT                   /translation="MSENKLMNSSSKKIIYFVLAFVLMIVSSIPANVYILFVDTTYAYD
FT                   AEKLIYNMIFNSFYFQVFYFFCYSFLFSVNSNFENVNKKTILITFLSFLLVFLLSIFTS
FT                   APLKDSIPDMLEFFMSNIMINKSILSYIMFFIIILLADNNFKNNTYNSFTKIGDIIFFS
FT                   TIAAIIAFVFWVFIVFLYDKFIFRADILSDLEPLIEKLIFMSIVFVLSLIPFIFFFVQK
FT                   RFKTVLSIYISRGLLFLYSFLIFAFFFALLYEPIIPFYNTKSFIIYNALLILSVLTLYF
FT                   IRADYKAGIITKAMYIIFPILAFLFNILVLSSSIYRVTISEVKINYISITVLNTITAVN
FT                   LIYIIVQNIRSIIKILKNNININEAVIGNNKIYNFIYIYGIYSFIFSFIAPIIIKFL"
FT   gene            391786..392703
FT                   /locus_tag="Bmur_0300"
FT   CDS_pept        391786..392703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0300"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00853 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70405"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5D8"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00853"
FT                   /protein_id="ADG70405.1"
FT                   /translation="MKDLDRLKQILNEPVTIENLNRINDYFIRYLFSHTGNENIALNFI
FT                   NAVFKDLNFETFKKIEILNPFNIADNYDEKESIVDIKATTETGITVLIEIQARGNEDFI
FT                   KRALYYWAYNYSSSLNRGSFYDELKPTVSINITNFILTDEDKVHSCYVLKELNNNKILT
FT                   DHCQLHFLELPKFNLKNISAIESLDNIHREFISWIKFFKGEDMSVLMKENTIFEEVEKK
FT                   CQTFVNDNPVMDKYKKREVDTYFFNKSIELDIKKAKEQGIEQGIEKGIKENQILTAKNM
FT                   KNKNMDINLISELTGLSIEEIKKL"
FT   gene            392850..393959
FT                   /locus_tag="Bmur_0301"
FT   CDS_pept        392850..393959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0301"
FT                   /product="Ankyrin"
FT                   /note="KEGG: bhy:BHWA1_00591 ankyrin repeat-containing
FT                   protein; PFAM: Ankyrin; SMART: Ankyrin"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70406"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5D9"
FT                   /inference="protein motif:PFAM:PF00023"
FT                   /protein_id="ADG70406.1"
FT                   /translation="MKKFIILFGMFLFTLGLYSQNDDNNKSKVSEKLINYVNEGNIKEA
FT                   ENILKKYSDYVNNRNYEGFTLLSLAVMDNNIEMAELLLKYKADVNANVDLGDSVLIGAV
FT                   DNKNMEMVKLLLSYGADIDYQGFRGRTALFSSLNKGGENKENIEMVKLLIKNKADVNIA
FT                   YDGDNENEETPLMYAAMKGYKETVKILIENKADINKRNIYNANALIYAYMYGHEDIADI
FT                   LLQNGSDSLDKSLKVCNLNKETLLSYDVPLITAAVYSTNEVFLQKLIDNGANVNYKTYD
FT                   NKTALIEAADYNNINAVKVLLKNNADVNVQNKYGMTALMWACHSGNLEMTKMLLDAGAD
FT                   KNIKDGNYDALYYAREYGKNEEIIKLLTQ"
FT   sig_peptide     392850..392915
FT                   /locus_tag="Bmur_0301"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.868) with cleavage site probability 0.501 at
FT                   residue 22"
FT   gene            complement(394313..394822)
FT                   /locus_tag="Bmur_0302"
FT   CDS_pept        complement(394313..394822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0302"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_01574 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70407"
FT                   /db_xref="GOA:D5U5E0"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5E0"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_01574"
FT                   /protein_id="ADG70407.1"
FT                   /translation="MKNKIIILLIFLAVLLVIAFILSYGKIKSRAKEIKREYIEKYKPD
FT                   ITFKSASIDEITLSYITLNTLIEVKNNLPFELPIEKAEVKLINNSDKVFASANSSDTSE
FT                   NLKIPANSSISFNMKFKAQYSDLFETVIDAIKSKSFKCNANIIITFTVYGKYFEFSYDE
FT                   KLVFIQ"
FT   sig_peptide     complement(394745..394822)
FT                   /locus_tag="Bmur_0302"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.560 at
FT                   residue 26"
FT   gene            complement(394989..395345)
FT                   /locus_tag="Bmur_0303"
FT   CDS_pept        complement(394989..395345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0303"
FT                   /product="FMN-binding domain protein"
FT                   /note="KEGG: bhy:BHWA1_00763 FMN-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70408"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5E1"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00763"
FT                   /protein_id="ADG70408.1"
FT                   /translation="MSFKKIMVLVLALVFAASMFLFAQGKVDLSKVPDGTYLGNYKATY
FT                   KTRQGDYQAKVTVAGGKLTKVVLTKCAHSSGPARGKAAYDKMIQANDIYVDGVSGATWV
FT                   ALVEDALTKLTPAK"
FT   sig_peptide     complement(395274..395345)
FT                   /locus_tag="Bmur_0303"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.919 at
FT                   residue 24"
FT   gene            complement(395416..395844)
FT                   /locus_tag="Bmur_0304"
FT   CDS_pept        complement(395416..395844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0304"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00764 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70409"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5E2"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00764"
FT                   /protein_id="ADG70409.1"
FT                   /translation="MKYNYLILIVFAFLALSCKTVEKNNTQASNIINLNEGWVNESKFI
FT                   ATSIGYPNGYASTEEEIKTSAFNAALALSKVKIENAFAKELPNRESENTELKDIVEKYI
FT                   KVEYSSFIDDRYYQLKTTVEYDNLLSLLRSGNIKKILN"
FT   sig_peptide     complement(395782..395844)
FT                   /locus_tag="Bmur_0304"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.717) with cleavage site probability 0.334 at
FT                   residue 21"
FT   gene            395993..397597
FT                   /locus_tag="Bmur_0305"
FT   CDS_pept        395993..397597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0305"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00765 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70410"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5E3"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00765"
FT                   /protein_id="ADG70410.1"
FT                   /translation="MKRLYIVSILFLLLYTRAFTQIYTLQNNERLNNSYISSETNYALI
FT                   IEKNSANEGKTFDIIYKNSRLTGYKDAGIIKILPNGTLTATMLKTSLGKDMWVLIYGNT
FT                   EQEFDSIERTIFSGNNSIIFARLMNYGIAVINGEAKLQYSELFDSVINDNSYAFSYSRD
FT                   GLYYININGEEKQVSSKADRLKFSNDGTNIVYVIENEGNAVIFTGTSDSENFRLVDDLA
FT                   SFNNNSIAYAVKMMPQIDTNNQTNTNSVTNNLEITNDIVTNTSTITNYNLSNISVYTNE
FT                   EGITVKGQSNTIALMTVTNVITNIRYNEIPSLPPAADTSNTIVTNEFIMTSVIANGRNY
FT                   GEFNLVTNMSFSPNGKTLVFINVNTNNTMQLYVGGNMTTNYDIIHNYKYSDDSSILAYG
FT                   AQTNGVSFIILNGRRLPNNYDSINDIYFSTNNNLVYNASRNEREYIIGNDFESPSYNNI
FT                   TSFKFLGDSFAFTGERLGKYYYFILNKNASLRREFGGYDYVSPLDNANENAISIVSDGK
FT                   KIYIIENGMIMNDNQQN"
FT   gene            397837..399744
FT                   /locus_tag="Bmur_0306"
FT   CDS_pept        397837..399744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0306"
FT                   /product="RNA-metabolising metallo-beta-lactamase"
FT                   /note="KEGG: bhy:BHWA1_00766 predicted hydrolase of the
FT                   metallo-beta-lactamase superfamily; PFAM: RNA-metabolising
FT                   metallo-beta-lactamase; SMART: beta-lactamase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70411"
FT                   /db_xref="GOA:D5U5E4"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001587"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5E4"
FT                   /inference="protein motif:PFAM:PF07521"
FT                   /protein_id="ADG70411.1"
FT                   /translation="MNSNDKIRIIPLGGVQEIGMNMTVIEYGNEVLVVDCGFMFPRYHM
FT                   LGIDYVIPDTSYLENKNVIGLILTHGHEDHIGAIPHFLRKFPDIPIYGSRLTIAFLTAK
FT                   LNDYKNEYKDAKLYEVEPRNKIQLGMNFDIEFIRVNHSIPDGVGIAITTPLGVIIHTGD
FT                   FKIDLNPTTDKFIDLYKFAEYGENGVLLMLADSTNCQKEGFSMSESVVQNNMTPLFAYE
FT                   DGMIIVAVFASSIERIQDLVTAAKVNNKYVAFSGRSLLKFTKIAQDMGYLNLYDIVIPI
FT                   DKINRYPREKIVCITTGTQGEPYSSLSLIAAEAHKHIKVEDGDMIIFSSSVIPGNEMAV
FT                   TRMINNLFDLGAKMVGEDKKLLHVSGHASSEDLKLMYRLVKPKYFVPIHGEKRHLITHI
FT                   KLVENLNGLDTKGFLLYNGDVLEIDETLEAKLAEPIEIRNIYVDGKGVGDLEESIFHDR
FT                   EQLSLNGVVVANVIAKKNKTGQYDIKVDLESKGFTYNGGEKEGLIHKTEQLREEGINSA
FT                   MAAVKKLLDRNKRTPSTIKYEVREALRKKFMQIIGREPVIFVCLYMDHVYIENTETSED
FT                   DINIDNIDNISNEKIITENEEEIKCHTKKKKRIKKIAAKKKTAQIKRTKSKKKKAVKES
FT                   "
FT   gene            399762..400736
FT                   /locus_tag="Bmur_0307"
FT   CDS_pept        399762..400736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0307"
FT                   /product="signal peptide peptidase SppA, 36K type"
FT                   /note="KEGG: bhy:BHWA1_00767 SppA, periplasmic serine
FT                   proteases (ClpP class); TIGRFAM: signal peptide peptidase
FT                   SppA, 36K type; PFAM: peptidase S49"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70412"
FT                   /db_xref="GOA:D5U5E5"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5E5"
FT                   /inference="protein motif:TFAM:TIGR00706"
FT                   /protein_id="ADG70412.1"
FT                   /translation="MASIIIGIYSLFFNNENKTTPIQITKNINSISANTQEGIAIIDLT
FT                   GVITHAKRKTSIGLEYPSVTEELMEDFEYYLKDPKVKAIVLQVDSPGGALTSCEEALKY
FT                   LQDLKAKYPKPIVASFRSMAASGGYYMSMIADKIYANESTLTGSIGVISQFFNVSGLMD
FT                   KYGVKMYTIKSGRNKDSLSPFREPREDELAYWQDMTYEFVAQFTNVVEQARGDKIKGNR
FT                   EEIFDGRVFSGKRALEVGLIDAIGTLQDAIKDAAKLGGIEDEEPYIIKKPQQKDNLLNM
FT                   LFSGISENIKPKSSLPIPYEEIINTKYIGVPMYIYIPNYIGEN"
FT   gene            400736..401302
FT                   /locus_tag="Bmur_0308"
FT   CDS_pept        400736..401302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0308"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00768 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70413"
FT                   /db_xref="GOA:D5U5E6"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5E6"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00768"
FT                   /protein_id="ADG70413.1"
FT                   /translation="MRISKAIYLYMMHPKYAMRSNINFESSLLIYLLSILSIAVSALYT
FT                   SHSKCNIINLFLLAFGIAAYIAVSNIVKIAIINLTVSVFFKNNDKKNITAFINNCFGIY
FT                   GIFIFILPITLIFGNFSSIYWIQAGTLLILQLYYIVLMYNNIKYSFNIKSPFRAVLILF
FT                   APIIYDYLVYMALAILILGSFINII"
FT   gene            401304..402557
FT                   /locus_tag="Bmur_0309"
FT   CDS_pept        401304..402557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0309"
FT                   /product="permease YjgP/YjgQ family protein"
FT                   /note="PFAM: permease YjgP/YjgQ family protein; KEGG:
FT                   bhy:BHWA1_00769 permease YjgP/YjgQ"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70414"
FT                   /db_xref="GOA:D5U5E7"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5E7"
FT                   /inference="protein motif:PFAM:PF03739"
FT                   /protein_id="ADG70414.1"
FT                   /translation="MKKITKYIILETIGPFLAGILFFTFVFVIQLLPELIRLIMNNGAP
FT                   LLMSLETFVYMLPFNIAITIPMSILMASIIGYGRLSSDNEIIVMRALGFPHMRIYMPII
FT                   ILGFFTFMFSLFFNNVIMSESNYRYRALISYMVNIRPSIAVGKLEFTEISDMGFSIGAK
FT                   YADDKSISNVVIYDKSDTKRVITAKYGLWKNNEANSQVVTLTLYDGVVQEMPNYGFVTN
FT                   DYTVFDSMDINIIRNVSTLTSHERGLREMPSWEILKKIKEAKSNANKSVDEQITGMINN
FT                   SYNNVKNTGIDITSFSNEYIKTNSAELVSIREKAIEESVPYFYYVEFYKFISIPAACLF
FT                   MVLIGAPLGIVGKRSGKGFGFGISVIVVVIYYLLITAAELLAGGKKVPPILAMWFPNIV
FT                   LAIMGGFFMVRSFFSRGK"
FT   gene            402561..403274
FT                   /locus_tag="Bmur_0310"
FT   CDS_pept        402561..403274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0310"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="KEGG: bhy:BHWA1_00553 RNA methyltransferase, TrmH
FT                   family, group 3; TIGRFAM: RNA methyltransferase, TrmH
FT                   family, group 3; PFAM: tRNA/rRNA methyltransferase (SpoU)"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70415"
FT                   /db_xref="GOA:D5U5E8"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5E8"
FT                   /inference="protein motif:TFAM:TIGR00186"
FT                   /protein_id="ADG70415.1"
FT                   /translation="MFITSKNAITEAISKNLVETLYIKFPISKREKDIIKLAEKKKVLI
FT                   KNVDKNEMEKIVGKVYSIAADIKENAEIGIENFLQKALEKKDNPLIFILDSITDVHNLG
FT                   AIIRNAYFFGSSGIIIPKDNSAPINEKVYEISAGAAYHLPISIETNLNRTIELMKDKGF
FT                   WIYYASEEGETSLEDFKFNTPTAIILGNEHSGVRDILKKNSDGSIIINKSNDFDSLNVS
FT                   AASAVIAYAYSIYKK"
FT   gene            403391..403753
FT                   /locus_tag="Bmur_0311"
FT   CDS_pept        403391..403753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0311"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00554 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70416"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5E9"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00554"
FT                   /protein_id="ADG70416.1"
FT                   /translation="MPIAPLDLQQLYMQQSHIGRMEHTRMAAKTIAMQSEDRDIHRDSY
FT                   IKDSTVVKSENISDETKVKEKKDDEQKQKDQGYMSYRKKNKKRIIDNNENENNIIEIEE
FT                   VSATEKTKGSKIDLLG"
FT   gene            403769..404530
FT                   /locus_tag="Bmur_0312"
FT   CDS_pept        403769..404530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0312"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00555 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70417"
FT                   /db_xref="GOA:D5U5S6"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5S6"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00555"
FT                   /protein_id="ADG70417.1"
FT                   /translation="MQILISVIINITILAVVLPLFYIYIVSKARERLEKETMSKAREEI
FT                   EALVKEFNNIALSRISILEDAITRANKLTGELTSNNKEIHTENNTIKEVKENKEEINNN
FT                   ITIHNESPKKKLDIRVEDENVELNIKPEENKKEVKENKEIKKEEVKKTVKKNNIDTAAK
FT                   AIDDEARKEAIERLRSKLDRTIKSNMSVYDKNNDTYKKISKEEDNTTLSSDDKNANIIK
FT                   LYKEGMSKEDIAKKLNCSITEIDIVIDLELE"
FT   gene            complement(404534..404983)
FT                   /locus_tag="Bmur_0313"
FT   CDS_pept        complement(404534..404983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0313"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00709 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70418"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5S7"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00709"
FT                   /protein_id="ADG70418.1"
FT                   /translation="MFKKIIVFNTLIFILISCSNKSNMDIVPVDSTKSFSVLGYCTPVP
FT                   ENSFNVKYSIVNKTIAESNFDYNNINFYYRASKNLGELLVLYDNLKEYKTYTDNETSTE
FT                   IIMETYDKEYVAHWNVKGIYYSLSGEDENELYNLSLILIKNKALN"
FT   gene            complement(404987..406393)
FT                   /locus_tag="Bmur_0314"
FT   CDS_pept        complement(404987..406393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0314"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bhy:BHWA1_00710 ABC-type
FT                   dipeptide/oligopeptide/nickel transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70419"
FT                   /db_xref="GOA:D5U5S8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5S8"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADG70419.1"
FT                   /translation="MKNNISKKLAPLIEFFEEFKKDKTGVVGLCILVLAILVSLFEPLL
FT                   LTYKEAPKRWRDITYWQDNPASAAPEWLNFFQREKSAITTDINPISIETNYIDNQLTYK
FT                   AIFEYDYKFDKSPVDLIFHANVNGSAAAVWTVTRPDGAMITLSDSLHNINGDLRISAFN
FT                   DSKNRIFRFYRDSVPRMLARQIDTLTTNPMKILFNTKKDDMAKDFKALKGIYKFEVLLK
FT                   FSDNNNTSFENPYMVLVGSMSGIMGTDNMKRDIFSGLVSGLKWALFIGIATSFISVIIG
FT                   VMYGIVSAYFGGIVDNIMQFIYQIFIGIPVLPVMIVMSAIFKPSIWTMITMMIFFSWTG
FT                   SVMTVRSMAMQLKEETYIEAARTIGAGHFRIIFNHLAPLLLPFSFASMALAVPSAIVYE
FT                   SSLSLLGLGDASIVTWGQILHDAMKGSAVLSGLWWWIIPPGILIAVLGMSFAFLGFALD
FT                   KILHPKLRSR"
FT   gene            complement(406393..407433)
FT                   /locus_tag="Bmur_0315"
FT   CDS_pept        complement(406393..407433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0315"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bhy:BHWA1_00711 ABC-type
FT                   dipeptide/oligopeptide/nickel transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70420"
FT                   /db_xref="GOA:D5U5S9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5S9"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADG70420.1"
FT                   /translation="MFTYFVIKRILKGIIMFIILMFMSSAIFNTVSEKTLKSQIEENIN
FT                   AEVRGLSNMRTEDIENFIKERRAYYYDIYWLNRSIGERIFIRAVNTITFQFGKSAIMMD
FT                   SNGSREVIKIIGEALPRSIILFTTASVIQMIIGLIIGLIKARKAGGLFDRTTSIITMIV
FT                   YGMPTWWLSMILIMVFVYKFNLFPSGGVHSIPVPTGIMYYLDMLWHMSLPLITLTLIGF
FT                   WGLSFVVRNIVLSTLQEDYIMAARARGISEKSVLLGHTLRSSAPPIVTITLLGLLGSIA
FT                   GSIIFEGIFSWPGLGNLYWISVQQNDIPVLMGNLAITTALYQFGLVVLDISYGFLDPRI
FT                   KVGGRL"
FT   gene            complement(407526..408515)
FT                   /locus_tag="Bmur_0316"
FT   CDS_pept        complement(407526..408515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0316"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /note="KEGG: bhy:BHWA1_00243 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70421"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5T0"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00243"
FT                   /protein_id="ADG70421.1"
FT                   /translation="MISSVTNEPYFSLIEAVEDCELLEIKIENINKIDNHNIIKRISSY
FT                   LLFTLEVWLSKYYNILINNKIDLYNKEDTLLMAKIYKNNGFEDACYKLCISHINTFKDC
FT                   ENCDNVIEFLKNLKPADEPIKVDKNIYKFSKGYCLYTELDIINNIYCIKSGKIGIYNII
FT                   NSKQTAGVVYKSNHILNFVNPKLEYKPLFITAIVLEESVIEILTYNDFIKKLYTDISLR
FT                   LDYIKMNSIKIITTILKIKALNKKNVKEKIIVLIFAILKIETLFNDNKTIKLSYSYEDI
FT                   KNMLNLSISNNEIYLLLKNINYIETDLFNNIIITDSESYLNEYSNYIE"
FT   gene            complement(408841..409332)
FT                   /locus_tag="Bmur_0317"
FT   CDS_pept        complement(408841..409332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0317"
FT                   /product="Ribonuclease H"
FT                   /EC_number="3.1.26.4"
FT                   /note="KEGG: bhy:BHWA1_00712 ribonuclease H; PFAM:
FT                   ribonuclease H"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70422"
FT                   /db_xref="GOA:D5U5T1"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5T1"
FT                   /inference="protein motif:PRIAM:3.1.26.4"
FT                   /protein_id="ADG70422.1"
FT                   /translation="MIRDNIIIYTDGGCRGNPGLGAWGAILISEKHNLRLEIGESEDNT
FT                   TNNRMEMKAAIKALERLKHSHNIKLYSDSAYLVNGMTKWIYSWQKNNWIKSDKKPVENK
FT                   EYWIRLIELSKKHDIEFIKVKGHSNNKENNRADEIVNILMDKHIESGKTSSFNEKTQYC
FT                   "
FT   gene            complement(409357..410391)
FT                   /locus_tag="Bmur_0318"
FT   CDS_pept        complement(409357..410391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0318"
FT                   /product="phosphoesterase RecJ domain protein"
FT                   /note="PFAM: phosphoesterase RecJ domain protein;
FT                   phosphoesterase DHHA1; KEGG: bhy:BHWA1_00713
FT                   phosphoesterase, RecJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70423"
FT                   /db_xref="GOA:D5U5T2"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5T2"
FT                   /inference="protein motif:PFAM:PF01368"
FT                   /protein_id="ADG70423.1"
FT                   /translation="MLTEIKEDKLNSQINDDRINTSKEQIIERLSKAQNITITGHRNPD
FT                   CDCICSGLALSLIIKKLFNKEAFVVNTDKMQRDLHNVLFVDRVIFEVNENNIPKKDVLV
FT                   ILDSGDIDRIGWLSDITDEYNEVIFIDHHKVRNIKGVTMFYDDTSAGATCEIIFDIFQD
FT                   YADKMDSSIATLLYSGICTDTGSFIFSNTTERTLLYGSKLMKIGVIQENLGNVVRKRYT
FT                   KNDVDALMEIYKRMVIDYDRKIGYICLEDTICGTSIKELGVSASDTLIQMEDVLIGFII
FT                   HEGEDNFRVSIRSRCSKDIRDVAESFGGGGHPKASGFSVSKKDYTKERLAEDINNKLID
FT                   LLAS"
FT   gene            complement(410420..410788)
FT                   /locus_tag="Bmur_0319"
FT   CDS_pept        complement(410420..410788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0319"
FT                   /product="ribosome-binding factor A"
FT                   /note="KEGG: bhy:BHWA1_00714 ribosome-binding factor A;
FT                   TIGRFAM: ribosome-binding factor A; PFAM: ribosome-binding
FT                   factor A"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70424"
FT                   /db_xref="GOA:D5U5T3"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5T3"
FT                   /inference="protein motif:TFAM:TIGR00082"
FT                   /protein_id="ADG70424.1"
FT                   /translation="MSSHRILRVNENIKQTLSLIIMREIEDPRIKNNLVTITKVDTAKD
FT                   LKNAKVYFVCLNEDKKNEVLNGLNSAKGVIFSYLRKQLTIRYVPNLTFHYDKNLIETNK
FT                   VLTDIKNLTIPEESTEDN"
FT   gene            complement(410794..411276)
FT                   /locus_tag="Bmur_0320"
FT   CDS_pept        complement(410794..411276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0320"
FT                   /product="CheW protein"
FT                   /note="KEGG: bhy:BHWA1_00715 purine-binding chemotaxis
FT                   protein; PFAM: CheW domain protein; SMART: CheW domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70425"
FT                   /db_xref="GOA:D5U5T4"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5T4"
FT                   /inference="protein motif:PFAM:PF01584"
FT                   /protein_id="ADG70425.1"
FT                   /translation="MSDAIPTNQILVFKINNELYGIDILKVQEILNFMQPSPIPNCPEY
FT                   LKGIINLRGTIILVIDLRARFHFDEPMNPENCVIVVVAIGDKKYGLVVDSVSDVLTINS
FT                   ENIQEDIDMHVGIDSRYIMGLVKANEQMIILVDIDKVFLKDELDDLSDAVNNSIVK"
FT   gene            complement(411424..412725)
FT                   /locus_tag="Bmur_0321"
FT   CDS_pept        complement(411424..412725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0321"
FT                   /product="protein of unknown function DUF1063"
FT                   /note="PFAM: protein of unknown function DUF1063; KEGG:
FT                   cbb:CLD_2825 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70426"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR021144"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5T5"
FT                   /inference="protein motif:PFAM:PF06354"
FT                   /protein_id="ADG70426.1"
FT                   /translation="MNEKLNRLTSLIKYDMKPALGVTEPAAIAFAVSKARSYTKGDIES
FT                   AEIVLNSGIYKNAFTCGIPNSNEFGNLFAAALGLVAGNYEKGLEALEDVKDEDNDKAKK
FT                   LIDENKIKIVLGDMSSNIYIKASVKTKTDTAEVIIKDYHTNIVSIKVNDTVIFNKEDDE
FT                   KQKTENKSENISSKEILDYTVNDILEYINNVSIEDISFIMEAHKMNIDLFYLSLESKRT
FT                   DIAKKLLKMNNDTVFSDDEICTARLLTAGAIEARVLGLNKPAMSITGSGAHGIICTMPL
FT                   YALFKVNKLSDDILLRSTALSFLITMYIKEHSGRLSAFCGCGIAGGTGAACAVGYLKGA
FT                   DYKEIVHIINNMSAGITGMICDGGNQGCVMKAIVALDAGFRAVELSLSGSYIFPIHGIN
FT                   AETPEDTMRNMGLIASEGMVETEKTIIKIMETKS"
FT   gene            complement(412822..413274)
FT                   /locus_tag="Bmur_0322"
FT   CDS_pept        complement(412822..413274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0322"
FT                   /product="molybdenum cofactor biosynthesis protein C"
FT                   /note="KEGG: bhy:BHWA1_00523 molybdenum cofactor
FT                   biosynthesis protein C; TIGRFAM: molybdenum cofactor
FT                   biosynthesis protein C; PFAM: molybdopterin cofactor
FT                   biosynthesis MoaC region"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70427"
FT                   /db_xref="GOA:D5U5T6"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5T6"
FT                   /inference="protein motif:TFAM:TIGR00581"
FT                   /protein_id="ADG70427.1"
FT                   /translation="MSDKLTHVDKNGNANMVDVGDKDIIKRTAEAIGKIYLSKETLKLI
FT                   EENNIKKGDVISVARIAGIMGAKQTSNLIPLCHNINIEKVSLDFALEEDGILIKSYLRC
FT                   SYKTGIEMEALTAVSIAALTIWDMCKAVDKNMRISDITLLSKTKEI"
FT   gene            complement(413296..414093)
FT                   /locus_tag="Bmur_0323"
FT   CDS_pept        complement(413296..414093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0323"
FT                   /product="Radical SAM domain protein"
FT                   /note="KEGG: bhy:BHWA1_00524 molybdenum cofactor
FT                   biosynthesis protein A; PFAM: Radical SAM domain protein;
FT                   SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70428"
FT                   /db_xref="GOA:D5U5T7"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5T7"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADG70428.1"
FT                   /translation="MLDSFNREINYIRVSVTDRCNLRCVYCMPEEGIIKKSHNEILTFE
FT                   QIYSIVKEASELGIKKVRITGGEPLVRKNIEELVSMIRSIEKVEIIAMTTNAVLLYSLA
FT                   EKLKNAGLDSINISLDTLDSERYKHITRGGNIDDAVKGINKASDLGFKLKINTVVYDEK
FT                   SREELPLLRDFAKTVNAELQTIQCYDINKQKEDALEYDRPAKCKYCNRIRLLSDGYLLS
FT                   CLHSNIKFKVDFNDIRGSIIKCIEGKPENGSYSDVKSVSMIGG"
FT   gene            complement(414077..415288)
FT                   /locus_tag="Bmur_0324"
FT   CDS_pept        complement(414077..415288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0324"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; PFAM: molybdopterin binding domain; MoeA domain
FT                   protein domain I and II; MoeA domain protein domain IV;
FT                   KEGG: bhy:BHWA1_00525 molybdenum cofactor synthesis domain
FT                   protein; SMART: molybdopterin binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70429"
FT                   /db_xref="GOA:D5U5T8"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5T8"
FT                   /inference="protein motif:TFAM:TIGR00177"
FT                   /protein_id="ADG70429.1"
FT                   /translation="MGRTFLHPNEALELVLNNCEDYGNEKISVLDSYNRVLINDIYALN
FT                   DDPPFSKSSMDGYAYKKEDENKESYILNDDKVIYAGLCNKISINSGECIKIMTGAMIPD
FT                   NCNAVQRVEWTEEKKENNKIIINFTKKEISNNIIKKGSNKKSGDKILYKKFLLPKDIAI
FT                   LAGFGYSNIEVKKKINTAVISTGNEIANIGETLKDGQIYDANAPMLVSRTSALSCSSKF
FT                   YGKVDDNEKEIRDILSKALQENDIILISGGVSMGDFDYVHKELINLEVNQIFHGIAMKP
FT                   GKPLFFGKLDKKAVFALPGNTVSSFMTFEIMVKPYILKCLGLEYDNNYTKAVLLEDFKR
FT                   KDTERLEYVPVKLVYDETRLSIQLIKYNNSSMISSFSEANGILKIDIGVSCINKGSIVD
FT                   VRFL"
FT   gene            complement(415327..416187)
FT                   /locus_tag="Bmur_0325"
FT   CDS_pept        complement(415327..416187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0325"
FT                   /product="putative dehydrogenase accessory protein"
FT                   /note="KEGG: bhy:BHWA1_00526 putative dehydrogenase
FT                   accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70430"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR014308"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5T9"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00526"
FT                   /protein_id="ADG70430.1"
FT                   /translation="MNNKYILDKALEFVNNNIETLLIKIDKTSGSSPRTLDAFMIVYNE
FT                   DNKQKTIGTIGGGILEFEAVKDAFEFLAKKENHNKKYNLSPEASGGIGMVCGGSVDISF
FT                   IYLNSNKDFINTLKKEIEDKEINVYIFGAGHVSFDLAEVLYKIGFNCIVIDDREEFANK
FT                   ERFPNAYKVFAEDYNNVFDKINITNKDYIIIVTRGHADDYVVEKNALKTNAAYIGMIGS
FT                   KNKIKTLHDRLKKEENYTDEMISRVHAPIGLAIGAETTEEIAISIAAELILTRAISENR
FT                   RKIKK"
FT   gene            416354..416803
FT                   /locus_tag="Bmur_0326"
FT   CDS_pept        416354..416803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0326"
FT                   /product="MOSC domain containing protein"
FT                   /note="PFAM: MOSC domain containing protein; KEGG:
FT                   bhy:BHWA1_00527 MOSC domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70431"
FT                   /db_xref="GOA:D5U5U0"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5U0"
FT                   /inference="protein motif:PFAM:PF03473"
FT                   /protein_id="ADG70431.1"
FT                   /translation="MEKKYFELISLNISKNTGTVKTPVDKITLVEDKGVLNDAHFNKLT
FT                   DRQVSILAIEDIEYTNNKMQSTLKAGDFAENITTRGIELFTLPLGTKIYIGDTILEVSK
FT                   IGKECHKGCDIKKLVGDCIMPKRGIFARVIKGGEINLENTCYYCF"
FT   gene            416775..417251
FT                   /locus_tag="Bmur_0327"
FT   CDS_pept        416775..417251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0327"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="KEGG: bhy:BHWA1_00528 molybdenum cofactor synthesis
FT                   domain protein; TIGRFAM: molybdenum cofactor synthesis
FT                   domain protein; PFAM: molybdopterin binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70432"
FT                   /db_xref="GOA:D5U5U1"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5U1"
FT                   /inference="protein motif:TFAM:TIGR00177"
FT                   /protein_id="ADG70432.1"
FT                   /translation="MRILVITVSDRAYKGIYEDKSGAVIIKTLEEKLKNKITNIEKVII
FT                   PDEFDIILNTLKENKEKFDIIITTGGTGLSKRDVTPEATESFCKKEVRGVSDYLRQESM
FT                   KETIFASLSRMYAGINDNVFVVNFPGSEKAAKYCTDLIIPFLEHIVSMIKGEGH"
FT   gene            417280..418062
FT                   /locus_tag="Bmur_0328"
FT   CDS_pept        417280..418062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0328"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="KEGG: bhy:BHWA1_00529 ModA, ABC-type molybdate
FT                   transport system, periplasmic component; TIGRFAM:
FT                   molybdenum ABC transporter, periplasmic molybdate-binding
FT                   protein; PFAM: extracellular solute-binding protein family
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70433"
FT                   /db_xref="GOA:D5U5U2"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="InterPro:IPR041879"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5U2"
FT                   /inference="protein motif:TFAM:TIGR01256"
FT                   /protein_id="ADG70433.1"
FT                   /translation="MKKLILITLIISYIFVSCSFSNTDDNKTSSSNNKEILVLAAASLT
FT                   DVLTELANNYKTETQVTFSFASSGALQSQIESGARADIFFSAAQKQMDALQEKDLIDTN
FT                   TRKDLLENKVVLIAPSNSKLNIKSFTDITNADVLKIGLGEPKSVPVGQYSEEILSNLSI
FT                   LDIVKQKTVYGSDVRNVLSWVEMGEVDCGIVYATDAKIAKDINIISEAPEGTHKKVIYP
FT                   IAIIKSSKNKEEAKKFIDYISNDKSIEIFKSYGFTVIQ"
FT   sig_peptide     417280..417351
FT                   /locus_tag="Bmur_0328"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.939) with cleavage site probability 0.591 at
FT                   residue 24"
FT   gene            418075..418755
FT                   /locus_tag="Bmur_0329"
FT   CDS_pept        418075..418755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0329"
FT                   /product="molybdate ABC transporter, inner membrane
FT                   subunit"
FT                   /note="KEGG: bhy:BHWA1_00530 ModC, ABC-type molybdate
FT                   transport system, permease component; TIGRFAM: molybdate
FT                   ABC transporter, inner membrane subunit; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70434"
FT                   /db_xref="GOA:D5U5U3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5U3"
FT                   /inference="protein motif:TFAM:TIGR02141"
FT                   /protein_id="ADG70434.1"
FT                   /translation="MQYTPLILSIKTAFYSTIITFFVGIYAAIIAVKIKKFSSLFDIIF
FT                   TLPLVLPPTVVGFFLLLFFGRNSFIGGVVEKLGFPFVFTLRGAVLASFIVSFPLMYRTS
FT                   KGAFEQIDKNIINAARTLGKSENWIFWKLILPNSWHSILGGTILSFTRALGEFGATIMI
FT                   AGNIPNKTQTMSLAVYTAVQAGDRELAFKWVMIIAAISFISIMFMNMIEPISNTFKKRL
FT                   GGLY"
FT   gene            418752..419801
FT                   /locus_tag="Bmur_0330"
FT   CDS_pept        418752..419801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0330"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bhy:BHWA1_00531 predicted transport protein;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70435"
FT                   /db_xref="GOA:D5U5U4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5U4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG70435.1"
FT                   /translation="MSLIVDIKKKLSNFNLDLQFEVKNGVFSILGASGSGKSMTLKCIA
FT                   GIENPDSGYIELDGKVFYDSKKRINIKPQKRNVGFLFQNYALFPNMTVEENIKCGIRDK
FT                   KINHNIDFIMKKFFIYDIRNKKPREISGGEQQRTAIARIFVSSPNILMLDEPLSALDYH
FT                   IKWELEKFISSSIKEFNITTLFVSHNRDEVYRLSDNIGIINNGKFDIIDSKYNLFENPK
FT                   TYFSALLTGYKNFSKIKILPNKKIECLDWNIIITLKEDKENIENANYIGIRPYSFFDYD
FT                   LNNNNNIYIKSKITNITEDMFSYIITSVPINTNTQITWRLDKKNYKSSYKEGNDLNLSF
FT                   DIDNVIFLK"
FT   gene            complement(419865..421304)
FT                   /locus_tag="Bmur_0331"
FT   CDS_pept        complement(419865..421304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0331"
FT                   /product="dihydropyrimidinase"
FT                   /note="KEGG: bhy:BHWA1_00074 dihydropyrimidinase; TIGRFAM:
FT                   dihydropyrimidinase; PFAM: amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70436"
FT                   /db_xref="GOA:D5U5U5"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011778"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5U5"
FT                   /inference="protein motif:TFAM:TIGR02033"
FT                   /protein_id="ADG70436.1"
FT                   /translation="MKKIIIKNGTIVNASETYKADVLIEDEKISKIGADFKCCDAEIID
FT                   ASGKYVMPGGIDVHTHMDIDVGIGRAVDDFFTGTVAAACGGTTTIVDHMGFGPKGCDIF
FT                   HQLKYYHTLADNKAVIDYSFHGVLQHVDEDVLKGLEVLSKEEGLQSTKLYLTYNYKIED
FT                   DNIVRVLKKMKELNAVSAFHAENHYVIEYLKKKFVEEGKISAHYHPISRPPEAEAEAVN
FT                   RIIHLSVIAGNAPVYIVHTSAGKSVDEIVNARFLGHKNIFSETCPQYLVLTDKEYDRED
FT                   GLKFVMSPPLRKKEDSERLWKAIAEGHIQVIATDHCPFNYESDKVKGKDNFTKCPNGAG
FT                   GVEERYPLMFSEGVMKGRITINKFVETLCYNPALIYGLYPEKGAIIPNADADITIIDPN
FT                   KKSVITKSNMHGACDYTAYEGMELLCSVDTVISRGKIVFKDNKFLGSKGDGKFIKRKTL
FT                   DNYTDFNNHFKLGDYIDIDCN"
FT   gene            complement(421452..421679)
FT                   /locus_tag="Bmur_0332"
FT   CDS_pept        complement(421452..421679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0332"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70437"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5U6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG70437.1"
FT                   /translation="MSSEFYIIFENIYWYYTSKDKIKQKIMSLETFIYILLGITMHPAN
FT                   IEKDLKEFCNWFRLNTIIKIQDEYFNISNW"
FT   gene            complement(422918..424498)
FT                   /locus_tag="Bmur_0333"
FT   CDS_pept        complement(422918..424498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0333"
FT                   /product="Amidohydrolase 3"
FT                   /note="PFAM: Amidohydrolase 3; KEGG: bhy:BHWA1_00195
FT                   amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70438"
FT                   /db_xref="GOA:D5U5U7"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5U7"
FT                   /inference="protein motif:PFAM:PF07969"
FT                   /protein_id="ADG70438.1"
FT                   /translation="MRIFKNAKIYSMDKNDSIYEALAVENGRIAFAGTNEDVLKKYSDA
FT                   EDIIDLEGRTVIPGFNDSCVNFVGFARFNTMLNLSKCKSIKEVIELAKKAEKYEGWVIG
FT                   WGWNQDYFEEKRMLNKNDLDNISSEFPVAFRRCCGEMIVANSKALELCGINEKMKSDSI
FT                   DFENGLISSKDMILILSKIKSLEIDTLKTIILDTQEQFFKMGITSVQTDDLRSLPDFDY
FT                   RKIIDAYQKLNREKKLKIRVCEQAQFINKKDIDDFRDYYYYQYINDERFKVARIKVIID
FT                   GGIGSRTALLRDDYNDAKGFRGVTQYKQEELDELVEYANSLDYSLAIQATGDGAIDMAL
FT                   KSIEKIKDTKDFKYRRNGLVHCQITDKELFERMKKLNVGIYYQPIFLHYDMHIVEDRVG
FT                   HEKASTSYAYKTAMDMGVKIGFGSAGPVDGISVMEGIHCAVNREDLNGWPEGGWMPQEK
FT                   LTVKEAVYLYTMGSAYMSSEDNIKGSIEEDKLADFIVLDRDIFEADVKDIKNIKVLKTI
FT                   VDGDIVYSA"
FT   gene            complement(424529..426349)
FT                   /locus_tag="Bmur_0334"
FT   CDS_pept        complement(424529..426349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0334"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bhy:BHWA1_00194 hypothetical ABC transporter
FT                   ATP-binding protein; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70439"
FT                   /db_xref="GOA:D5U5U8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5U8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG70439.1"
FT                   /translation="MARSIINIVNISKRFVHKVLLDNVNLLIEEKSKIGMIGRNGAGKT
FT                   TLLKILMGLEEPDDGEIIFSDDVRIGYLRQQGDFDESEKVIDYLTRVTSKESWKCSKIA
FT                   SRFGIDHIKINYNLGSLSSGYRMRVKLAEMMLYEPNFLILDEPSNFLDLNTLIDLENFL
FT                   MDYNGGFLIVSHDREFLKTTCEKTIEMENGKITYFPGNIEDYFEYKEEKEYTIKKYNKN
FT                   VEERKAHLERFVERFRYKATKAKAVQSRIKQIEKLKTIEITHPAKNVRIKLPEVPEKKG
FT                   FALISDDLAVGYGEKIVAESGRIEIARGSRVAVLGQNGEGKTTFLRTIAGRLEPVSGSY
FT                   NYSYGIKIAYFGEDTYKNVTSNDTVLSYLKKNAKQGLLTQELLTLLGSFLFSGEDVNKD
FT                   VKVLSGGEMARLSLLAAITQCADVLILDEPTNHLDFETVEALASSLRDYGGTIFFTSHD
FT                   RTFASMLADTIIEVKDKKLSLYSGDYEAYVYRVRIEALEEEEKELEYQEKNSVKESTHN
FT                   TEEKNNSNYEERKKIRNKLSKCESMLKKHEKQIEDYKKEEADILKFFETSSSYDDEKSK
FT                   RLLEVKRLIEETENEWLLVNEEIDNIKAML"
FT   gene            complement(426451..427866)
FT                   /locus_tag="Bmur_0335"
FT   CDS_pept        complement(426451..427866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0335"
FT                   /product="UDP-N-acetylmuramoylalanine/D-glutamate ligase"
FT                   /note="KEGG: bhy:BHWA1_00193 UDP-N-acetylmuramoylalanine--
FT                   D-glutamate ligase; TIGRFAM:
FT                   UDP-N-acetylmuramoylalanine/D-glutamate ligase; PFAM: Mur
FT                   ligase middle domain protein; cytoplasmic peptidoglycan
FT                   synthetase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70440"
FT                   /db_xref="GOA:D5U5U9"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5U9"
FT                   /inference="protein motif:TFAM:TIGR01087"
FT                   /protein_id="ADG70440.1"
FT                   /translation="MILDLNKTYIKVLKKQNILILGAAVRSGVSIANILYDINTTLNIN
FT                   IKYALSDSKTEEQLQDSIEALKDKNAKLFFGNQEISILDGITLIIISPGIPHTIDIVKE
FT                   AKRRGIKIIGEIEFAYNLLPNRNYIAVTGTDGKTTTVTLIYKIISSYKKARLVGNVGNT
FT                   FSKELETIEPDEDIVLELSSFQLETVEKFHAHIAAILNIAEDHLDRYKDIEEYFNAKKN
FT                   ISINQNKNDFLILNYDNIYTNIWYNELNNNCKMKLLTFSLKSKFADIYYNEEDEYIYYE
FT                   NEKLFSIKERKILGKHNVANILAAVLVCLKDNIPAEHIEHVVNNFKGIEHRVELVAEIN
FT                   GVKYINDSKATSMNAVMSALKSFDKDIILIMGGRNKNIDFTSLNNLIESRVKKLILIGE
FT                   AAEALDDMIHFENKIIIKDFTDAFNYASAISINGDTVLLSPGCASFDMFKNYEERGKYF
FT                   KSLVYKLDSITKE"
FT   gene            complement(427942..428750)
FT                   /pseudo
FT                   /locus_tag="Bmur_0336"
FT   gene            complement(428851..429318)
FT                   /locus_tag="Bmur_0337"
FT   CDS_pept        complement(428851..429318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0337"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70441"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5V0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG70441.1"
FT                   /translation="MVYEKCQTDVVNKYISGYNWDRPLTFIDNKRFVLACDNTNFNDED
FT                   FVYNQLMFYNIDNIKIDNSDKYRYLESYKSININLFSLDENNEVHGKLYFYNDNLIALD
FT                   FNKYCINVNSYNIKNSTVKNIAVINNNNCFFNDMFGIIYYIENDTIKEINI"
FT   gene            complement(429432..429848)
FT                   /locus_tag="Bmur_0338"
FT   CDS_pept        complement(429432..429848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0338"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00191 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70442"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5V1"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00191"
FT                   /protein_id="ADG70442.1"
FT                   /translation="MIENAVFNDKNFEEYFLFTDDAKLIKYNKVYNSYKDLIKIENINS
FT                   KEEVTVLKLMYPYICITEEKGLNSAVVNIETLDIINLQREDYCSKYSSYSNEFCIINNE
FT                   IHLITQTKWNTLNIINLKTKEMITDINRDEKSSV"
FT   gene            complement(429941..430822)
FT                   /locus_tag="Bmur_0339"
FT   CDS_pept        complement(429941..430822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0339"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="KEGG: bhy:BHWA1_00190 cation efflux system protein;
FT                   TIGRFAM: cation diffusion facilitator family transporter;
FT                   PFAM: cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70443"
FT                   /db_xref="GOA:D5U5V2"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5V2"
FT                   /inference="protein motif:TFAM:TIGR01297"
FT                   /protein_id="ADG70443.1"
FT                   /translation="MNSISNEKKSKYMIIEGVVSVIINILLFAFKYIVGLLTGSLSIMA
FT                   DAWHSLSDCISSVIVIIGGIFSKRPPDKEHPFGHGRIELITSFIVGIMLVFIGYSFFSE
FT                   AVKNIMNKKTASFTTMAIAAMVVSILVKELLAQYSLWGYRKSGSKSLYADAWHHRSDSI
FT                   TSIIILVGILFGKSFWWIDGVLSILVSLVIFYAAFDVIKSSIKPLIGEYPSEEIIKSIN
FT                   DIAKELNINDDAANLHHFHIHTYGDHSEITFHMRFPKDMTVFEAHNKASIFENEIRKRL
FT                   NIEPTIHIEAYK"
FT   gene            431081..431995
FT                   /locus_tag="Bmur_0340"
FT   CDS_pept        431081..431995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0340"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /note="KEGG: bhy:BHWA1_00189 malonyl-CoA-[acyl-carrier-
FT                   protein] transacylase; TIGRFAM: malonyl CoA-acyl carrier
FT                   protein transacylase; PFAM: Acyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70444"
FT                   /db_xref="GOA:D5U5V3"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5V3"
FT                   /inference="protein motif:TFAM:TIGR00128"
FT                   /protein_id="ADG70444.1"
FT                   /translation="MSNIAFLFPGQGSQCAGMGKSLYDNVAESKAIFDKAANILDDVDI
FT                   KALCFEGTEDDLKKTENTQPALVTVGIAVYEALKAKGIKGNLFAGHSLGEITALSAAGY
FT                   ISFEDAVKIARTRGLLMAKAGADAPYGMAAVLGLSYDDVAKCMPENKEVVAANYNLKDQ
FT                   IVISGLLSAIEAVTPKLQEAGAKRVLPLKVSGAFHSPFMKPAADSLKEFLEKIEFHKND
FT                   NKVLSNVTAEVHEFDSIKENLYKQMFSTVRWYESMLNIQKQGITKVFECGPGKVLVGMS
FT                   KKITPDIDAISVFDIDSLNAACN"
FT   gene            complement(432144..432707)
FT                   /locus_tag="Bmur_0341"
FT   CDS_pept        complement(432144..432707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0341"
FT                   /product="peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /note="TIGRFAM: peroxiredoxin; KEGG: bhy:BHWA1_00188 alkyl
FT                   hydrogen peroxide reductase; PFAM: alkyl hydroperoxide
FT                   reductase/ Thiol specific antioxidant/ Mal allergen;
FT                   Peroxiredoxin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70445"
FT                   /db_xref="GOA:D5U5V4"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5V4"
FT                   /inference="protein motif:TFAM:TIGR03137"
FT                   /protein_id="ADG70445.1"
FT                   /translation="MSLINKKLIDFKVEAYQNGEFKTVEKKDVLGKWSVFFFYPADFTF
FT                   VCPTELADLNTVYEDLKKINCEVYSVSADTHFVHKAWADATETIKNLKYTMLGDPTGVL
FT                   GRFFEVYVDEAGQNFRGSFIVNPEGQIKAYEVHDMGIGRDANELLRKVQAAQYVAEHGG
FT                   EVCPAKWKPGAKTLKPGIDLVGKL"
FT   gene            432942..433511
FT                   /locus_tag="Bmur_0342"
FT   CDS_pept        432942..433511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0342"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: bhy:BHWA1_00328 HDIG domain protein; PFAM:
FT                   metal-dependent phosphohydrolase HD sub domain; SMART:
FT                   metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70446"
FT                   /db_xref="GOA:D5U5V5"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR005249"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5V5"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ADG70446.1"
FT                   /translation="MRAFNNQELEIVKYINEYLPFREKHILSTRELSIKIAEKYGADTN
FT                   KASISALCHDLGKRYKDDDMRKIILENDNIEYPSYITGALLHARVSAIITEKEFNITDK
FT                   EILKAIESHTVGHANMSMLEKIIYAADYLEPTRKLETADKIREKIFTDFDDAFLEVVYE
FT                   SISFVLSKKQYLSDKTIELYNSLVIK"
FT   gene            433765..434880
FT                   /locus_tag="Bmur_0343"
FT   CDS_pept        433765..434880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0343"
FT                   /product="GTP-binding proten HflX"
FT                   /note="KEGG: bhy:BHWA1_00327 GTP-binding protein HflX;
FT                   TIGRFAM: GTP-binding proten HflX; small GTP-binding
FT                   protein; PFAM: GTP-binding protein HSR1-related"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70447"
FT                   /db_xref="GOA:D5U5V6"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5V6"
FT                   /inference="protein motif:TFAM:TIGR03156"
FT                   /protein_id="ADG70447.1"
FT                   /translation="MDIKVNNIKKAYIIFVADSKQYRNSKINIDNILDELSMLCDTAGY
FT                   EVAERYSFIQQKITAGTYIGTGKLESLKESALVDNVEYFVFDNELSGSQVNAIEEGSNI
FT                   RALTRTEIILEIFAMRAKTMTAKMQVELAFLEFEYPRLKGKRTNLSQIKGGIGLRGGAG
FT                   EKQLEYDRRRARERIHKLKTQLSKVEKSASTGRKSRGNAFRVAIVGYTNAGKSTLFNLL
FT                   CKESVYVEDKLFATLDTHTRKLYLGDDTPVEAIISDTVGFIDRLPHTLVASFKSTLSEV
FT                   VEADLLLHLVDASDENINNKLIQVESIIKEIDASHIKRIVVFNKIDNIDEVQKNKISTS
FT                   YDDSILISAKNNINIEMLRKKILDYILELKS"
FT   gene            complement(434885..435343)
FT                   /locus_tag="Bmur_0344"
FT   CDS_pept        complement(434885..435343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0344"
FT                   /product="SCP-like extracellular"
FT                   /note="PFAM: SCP-like extracellular; KEGG: bhy:BHWA1_00326
FT                   SCP-like extracellular protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70448"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5V7"
FT                   /inference="protein motif:PFAM:PF00188"
FT                   /protein_id="ADG70448.1"
FT                   /translation="MFNIIIKALFILYFCSLSVLYSQYNYEAETTLKALNEVRENEGLY
FT                   PFELSDELNKVADIRAKELSINFSHIRPNNTRYDELLYENRIRVFSSDENIAYRFKNAE
FT                   TVVSYWMNSSQYKINILSDKFTHVGVSHYAINGEDFWVVIFAQLRRQN"
FT   gene            complement(435417..437138)
FT                   /locus_tag="Bmur_0345"
FT   CDS_pept        complement(435417..437138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0345"
FT                   /product="Site-specific DNA-methyltransferase
FT                   (adenine-specific)"
FT                   /EC_number="2.1.1.72"
FT                   /note="KEGG: bhy:BHWA1_00325 site-specific DNA-
FT                   methyltransferase; PFAM: D12 class N6 adenine-specific DNA
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70449"
FT                   /db_xref="GOA:D5U5V8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5V8"
FT                   /inference="protein motif:PRIAM:2.1.1.72"
FT                   /protein_id="ADG70449.1"
FT                   /translation="MITNAEANTKEKYLKENLIAYIGNKRRLLPFIEAAILHILEEDSS
FT                   IKTALDLFAGSGSVSRLLKTLNLEVYSNDWEYYSYILNYAHLSINIKDLDNMFIHTGGL
FT                   ENTINMINSIDYINDNDRYISKYYAPSDDNNPDLINERLFYTQYNASRIDIIRHNIEEL
FT                   YKNNAINQNEYYYLIASIIYESATHTNTSGVFKAFHAGFGGRNKDALNRILSPISLKQI
FT                   PLFEGANCYASMLDANEFVIKNKDKHFDLVYLDPPYNQHQYGSNYHLLNTIALWDKPPI
FT                   NKNIYIDGKKTDKGGIRKDWVKTKSLYCYKKTAKDTLINLLDNINSNYIVMSYSTDGII
FT                   EYDDLISILEEHGKLDIITSEYTKYRGAKRSIVNKTKNVEYLFVVDTRKHNFYFSNFNK
FT                   NLKYIENIRLKLENPLDCSKDSIIFDYDKDDIIVIYLEYSTHIMNKEEICLKLQNKSLE
FT                   YIKMFSLFLERYIREDNIGALKIYSYHFNAAVLSNNIKLIKYFGEYILKTYSRLCSRKS
FT                   NEYLFDITNDILDIISYYKNNDISIIDKIRKRIIYNITHSNISEINKNKLLLRLEK"
FT   gene            437317..439137
FT                   /locus_tag="Bmur_0346"
FT   CDS_pept        437317..439137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0346"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="KEGG: bhy:BHWA1_00522 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   Cache domain protein; histidine kinase HAMP region domain
FT                   protein; SMART: chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70450"
FT                   /db_xref="GOA:D5U5V9"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5V9"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADG70450.1"
FT                   /translation="MIENVKKNSLVFKFLIPYMAALFIICVLIYIAYRPQYKVRFLTSN
FT                   KYNISNISDELENNISSLYGKINIFCSYVEKETDSNKLLEVFANVIKNESDLMNIFYAD
FT                   TIPYKNGGTVLNTVGQLPNDYDQTTKEWYQKALASREIVISDPYIDAVTQNLVITFSKS
FT                   IYRDGELYGIVGIDVQLSKVVNEILNLAKNYNYDLSIIDDEGLYILNSDTNYILKENAF
FT                   NNNIISPHKNDILNNTHYEWIDKDFSYLTSKIKNSQWYLIVKTGNEELKSSLLKLLILI
FT                   IAVFIILSAIEAVLVLLIAIPISRTLDNTISIISSMAKGNFNTLFDERELKKNDQTGDV
FT                   IRALNEMQNKLGDIIYNMKNEINGINNSVNIITNGNINLSDRATSQASSLEELTRSIEF
FT                   VFSSLKETAENAGNAKSMSEKVSNATKNGVNAINATSENMAEISEASKKISDITKIIES
FT                   IALQTNILALNASVEAARAGEQGKGFAVVASEVRNLAQNVGNAAKDITSIANETVDKIQ
FT                   NGSASVQASSYILNQIESSVNDVLTLLTEISSAIIEEENSVSEINTAVVEINKITQDTS
FT                   KIANDGANASKDVLDKSNNIVEQVSYFRFN"
FT   gene            complement(439190..440554)
FT                   /locus_tag="Bmur_0347"
FT   CDS_pept        complement(439190..440554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0347"
FT                   /product="MATE efflux family protein"
FT                   /note="KEGG: bhy:BHWA1_00650 NorM, Na+-driven multidrug
FT                   efflux pump; TIGRFAM: MATE efflux family protein; PFAM:
FT                   multi antimicrobial extrusion protein MatE"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70451"
FT                   /db_xref="GOA:D5U5W0"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5W0"
FT                   /inference="protein motif:TFAM:TIGR00797"
FT                   /protein_id="ADG70451.1"
FT                   /translation="MSSNSNAVKRNYMFSNKYLAKLFIPLVIEVFLEYLVGLIDSIMVA
FT                   NVGEDAVSAVFLVDFVIAFLISIFAAIATGGAVASGQYIGAKNIEKADDSINQLIRFLL
FT                   LFSVVITILIYIFKDYLLTILFGSITEEVRNNANTYMFIVAASIPFLALYNGGASMFRT
FT                   IGNSKISMKIMISMNILNVIGNAVLIYVFKMGIAGAAISTLISRIGAALIIIILGLNKK
FT                   NLIYIKNKVKYKMTFSAVKRILSVGVPYGIENGMFYFGRLLILSLVSTFGTASIAANSV
FT                   STLIASFEVLPGMAIGLGLTTVISQCVGANDYNQTKYYTKKIIAIIYISQTITSIIILS
FT                   LLPFILHIYHLSAEATSYTYKLSWYHAVMMIIWPLGYSLPVVFRASGDAKFPMAVASIS
FT                   MIVCRIVLAYVFALYFHMGMIGTWIAMFADWIVKALIFTYRYFSGKWIKFKYVNA"
FT   gene            complement(440719..441726)
FT                   /locus_tag="Bmur_0348"
FT   CDS_pept        complement(440719..441726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0348"
FT                   /product="Aldose 1-epimerase"
FT                   /EC_number="5.1.3.3"
FT                   /note="KEGG: bhy:BHWA1_00264 aldose 1-epimerase; PFAM:
FT                   Aldose 1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70452"
FT                   /db_xref="GOA:D5U5W1"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015443"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5W1"
FT                   /inference="protein motif:PRIAM:5.1.3.3"
FT                   /protein_id="ADG70452.1"
FT                   /translation="MFRSKKENFGKNTYLYTLENDKGLKIKLAEVGATITGIFFKDKNG
FT                   KEIETAFGSDDIEFYTDKAKNGHMGATVGRVAGRTIGAKFKIDDKEYHITANKSPDHTH
FT                   GGVNGLSYVIYNSIQKKDNEVLFSYVSKDREEGYPGNLNLIVKYTITDENEIIIDYIAT
FT                   TDKTSPLNIMNHSYFNLNGGGKINDHEIFIDAAYYLGDDENGITSGEILKTKNTPYDFT
FT                   KSKKIDDIIKSKGGCDNCFVFDDNDINKQRVKVISKETGISLEVFTTMPSVLFYTANSL
FT                   NNCKVRNQTLGKHEAFCLEAQYFSCSLNFNHFPSIMLYPDREYNHRTIYKFGLI"
FT   gene            complement(442056..442451)
FT                   /locus_tag="Bmur_0349"
FT   CDS_pept        complement(442056..442451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0349"
FT                   /product="protein of unknown function UPF0047"
FT                   /note="PFAM: protein of unknown function UPF0047; KEGG:
FT                   bhy:BHWA1_00265 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70453"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5W2"
FT                   /inference="protein motif:PFAM:PF01894"
FT                   /protein_id="ADG70453.1"
FT                   /translation="MHTINVKTKSRFDIVDITDEVQRCVNEEKVENGIAVIFVPHTTAA
FT                   VGINENADPDVVFDMKNAFNKLVPQHDNYEHSEGNSQAHVLSSLVSPSLTVIIENKKIV
FT                   LGTWQDIYFFEFDGARNRKVYVQIISK"
FT   gene            442527..443039
FT                   /locus_tag="Bmur_0350"
FT   CDS_pept        442527..443039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0350"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related FMN-
FT                   binding; KEGG: bhy:BHWA1_00266 nitroimidazole resistance
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70454"
FT                   /db_xref="GOA:D5U5W3"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5W3"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ADG70454.1"
FT                   /translation="MYIIDFMFREMKRKKQLLSHSESIKILEKCTSGVLGLIGDDNYPY
FT                   TVPLSYVYSDNKIFFHAAKSGYKIDAIKNNNKASFCIIEKDDVKMKEYTTYYRSVIVFG
FT                   RVFIIEDENKKIEAIEKLAIKYYPNDNKENRNNIIDKEYNAMCMIELEIEHITGKEAIE
FT                   LVKNKGE"
FT   gene            443040..444428
FT                   /locus_tag="Bmur_0351"
FT   CDS_pept        443040..444428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0351"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   bhy:BHWA1_00267 peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70455"
FT                   /db_xref="GOA:D5U5W4"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5W4"
FT                   /inference="protein motif:PFAM:PF01523"
FT                   /protein_id="ADG70455.1"
FT                   /translation="MKYFNFDENFLHTVLQEALKNGGEYADLFFEDTKINSIGYLDSGV
FT                   DNTSLGNNYGVGLRIIVNKKTIYLYSNDTSNESLINLAKSASSIVNDKKHIINGFIESH
FT                   EKNHHPLHINPFDINFDEKIAMLSYLDKKAREVSDKIKQVNLRYMEKQRNILVCASNGI
FT                   LKEDSQTYVRLVMVSMASDGVNTQTASRTKGALDGYQVIRDINLDEMALETANSAIKML
FT                   NAKYPKSGKYPVVIDNAFGGVIFHEACGHALEATSVADNASVFCGRLGEKIASDVVTAV
FT                   DDGTIQNAWGSYNIDDEGNEAQRTVLIENGILKSYLVDELGSLKMNQKVTGSARRENYK
FT                   YPPTSRMRNTFIDKGNSSFEDLISQIEYGLYAKKMGGGSVDPATTDYNFAVSEGYIIEK
FT                   GKITEPVRGATLIGRGDETLMNIEAVSSNLELADGMCGSISGSVPTTVGQPAIRVKELT
FT                   VGGR"
FT   gene            444432..445790
FT                   /locus_tag="Bmur_0352"
FT   CDS_pept        444432..445790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0352"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   bhy:BHWA1_00268 peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70456"
FT                   /db_xref="GOA:D5U5W5"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5W5"
FT                   /inference="protein motif:PFAM:PF01523"
FT                   /protein_id="ADG70456.1"
FT                   /translation="MAELNNYMERIKEIYSTVKNKSNDIDEIEVYISSSGEEEFSVRER
FT                   DLDKYTFAESGGIGLRLIKDGKVGISFTEKIDSNDSIETLINNAKISLSYANAEPDYNV
FT                   LIEKEDDEEVYNIINNDIVNIPNEELKKISLSIEDKLYSLDKRIVNVPSAGLARYDFIK
FT                   CIVNSNGVCKGEIKNNITYYAEVIAKDSNSTKTYFDVYSSKDIFFDIDSFTKNIADNVI
FT                   SKLNSKEIESGKYKTVFTSKAMRTILGAYLGLFSAENVQKKLSLLQGKLNQKIANSIIN
FT                   IKDIPVFDKGIYNTHFDGEGSKTKDLNIITNGVLSSYLYNNYTARKDSVKTTSHASRGF
FT                   KTPIGISCHNFILEEGKNTQEELISQIKNGILVNSLTGTHSGVNSISGDFSLQAEGIKI
FT                   ENGKLSYTANPFIVSGNILDLLNDIEMLANDTEYHHSSIYTPSALIRELSFAS"
FT   gene            complement(446359..447612)
FT                   /locus_tag="Bmur_0353"
FT   CDS_pept        complement(446359..447612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0353"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /note="KEGG: bhy:BHWA1_00772 tryptophan synthase beta
FT                   subunit; TIGRFAM: tryptophan synthase, beta subunit; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70457"
FT                   /db_xref="GOA:D5U5W6"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5W6"
FT                   /inference="protein motif:TFAM:TIGR00263"
FT                   /protein_id="ADG70457.1"
FT                   /translation="MKNSNKGFFGKFGGRFVPEALEKLLIELEEAFAHYINDKEFLSEL
FT                   EELRADFIGRPTPLMYAKNLSEKIGGAKIYVKLEGLANTGAHKINNSIGQALLAKKMGK
FT                   KKIIAETGAGQHGLATAAACAKLGLECSIYMGEIDVKRQQPNVASMELYGANVVSVTRG
FT                   GRGLKDAVDAALEDWVKDLKDTHYLLGSAVGPSPYPDIVRTFQSVIGRELEKQIEQKNL
FT                   NVKAMIACVGGGSNAIGFFEPFIERENPKLIAVEAGGISMNLGENAIRMQNPYAKDVAA
FT                   QGYMSKFILKENGEISETMSISAGLDYPGVGPQLAYLGEAGRIEFTYATDKEAINAVKE
FT                   FARNEGVIFALESAHAGAKAIEYAKQYTKDDVIIVNMSGRGDKDIFITSPIFRADKWKE
FT                   FLKSELERLEKNIDIHKF"
FT   gene            447784..449838
FT                   /locus_tag="Bmur_0354"
FT   CDS_pept        447784..449838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0354"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein; KEGG:
FT                   bhy:BHWA1_00771 TPR domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70458"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR021352"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5W7"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ADG70458.1"
FT                   /translation="MIKDRIESLFIQARFYFNLEKYSSALRIYFKIINCFENYDKVLDS
FT                   NYKDRYFARSYYKTALTLYYLNRYEEAIDYYSKAIEINPLYEKAFINKGIILAKLMAFD
FT                   EALYSFNMALEINDKSEISYFNIGIIYSRLERYEDALYYFNKASELGYDYAYLNVAIVL
FT                   EKIGKIEEAFEAYDKAVSINKSLEVIYLNKASLLINIKKYKEAIECLDKSLSILDEKNS
FT                   KGDTIIKNKDYIEYIEIGMMENDTIYDRIYFLKSEALIGLEQYDYALTLILNIKDSKSV
FT                   NIFSIISRFIEYIGIEKIINTILKEDSFWTEEKEEYFNFIVRDINIENRIKLKKLWILQ
FT                   YVFLYLVSVKDNDKINEISHYTSIEVFDDMAFDKRYDKADSSKYNTYLKKNKLRMTSIK
FT                   NANDPKEGKILMQLLRNNNVNSKYGNINNFIALQTSFSRCKDSLTMYRLYGKYDNKEGT
FT                   GCCLVFDKSFFDTSFNNCGSSILFSFSYDKNNYSNIEFYEEQTLPLYFVLYYNFKRNEI
FT                   IFNPCESDYDNLIINLNKEYDLWNEGSKFYDKLKNNIGYVFYSMFKVIKDFNSEEAVLS
FT                   YQLLMNIQYLIKDASFIEEQEMRIIQLIEYGSNPLHIDDKMKRSYKNYLYIFDNKSLKE
FT                   VILAPKVEDADFLVEKFNDRLAKATSIYNSKKMKNKYKINVYISNAPIS"
FT   gene            449894..450391
FT                   /locus_tag="Bmur_0355"
FT   CDS_pept        449894..450391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0355"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00770 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70459"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5W8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG70459.1"
FT                   /translation="MRNIYLILFIVLSLFFVSCQKDKSAIDKAADKINEKIDDASEAAK
FT                   DGVKKAGGALEDVSKAIENIDTDKLLNEASKAIENIDTSKLLDEASKAIENIDTNKLSE
FT                   DISKAMENIDTSKLLDEASKALENIDTNKLPEDISNAIKNIDTGKLLNDLSKVLENAKK
FT                   SN"
FT   sig_peptide     449894..449959
FT                   /locus_tag="Bmur_0355"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.657) with cleavage site probability 0.447 at
FT                   residue 22"
FT   gene            450410..450841
FT                   /locus_tag="Bmur_0356"
FT   CDS_pept        450410..450841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0356"
FT                   /product="flavodoxin/nitric oxide synthase"
FT                   /note="PFAM: flavodoxin/nitric oxide synthase; KEGG:
FT                   bhy:BHWA1_02556 flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70460"
FT                   /db_xref="GOA:D5U5W9"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5W9"
FT                   /inference="protein motif:PFAM:PF00258"
FT                   /protein_id="ADG70460.1"
FT                   /translation="MSKKIAIVVWSKTGNTRLMSKAIKDGAEESGASVEVFKSYNFGIE
FT                   EAKSYDTIAFGCPAMGAETLEDTEFLPMYETVKPYLKNKKIFLFGSYGWGDGKWMRDWK
FT                   EDTINNGVSLFKEPIIAKEKPSDDILYKLKSVGKELASS"
FT   gene            complement(450954..453056)
FT                   /locus_tag="Bmur_0357"
FT   CDS_pept        complement(450954..453056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0357"
FT                   /product="NHL repeat containing protein"
FT                   /note="PFAM: NHL repeat containing protein; KEGG:
FT                   bhy:BHWA1_00661 NHL repeat containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70461"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013017"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5X0"
FT                   /inference="protein motif:PFAM:PF01436"
FT                   /protein_id="ADG70461.1"
FT                   /translation="MRVKLLAVIVFFLTVMPLSYTFDKTPYYVNTETYDSYRELLRGVH
FT                   YYNQERYDAAIASFRNSLNTNPTDKFIRYWYSKSLYKAGYMSLAINEWLNIARMGYEDP
FT                   IILSKINKYDSANAVEEKKDILSNFIYLKAFSTNANFLKNINQPIQVQTMADGTLYVLD
FT                   YSDSSLKRFDVNGNLLNKISYGKRLEVVQPSWWRKALQFIARVYPYEKLENPRGFTIDN
FT                   SGNIYIANTKRDKIFKYNSNGNYITNIGVSGIGDGQLLGPSSVFADNDGKLYVSDTGNN
FT                   RISVFDIEGNFLYSFGKLGENEGELFSPAGIVVNSQYIYIADMGNKRVQQFDLNGNYIK
FT                   TIKHALFNEPRGLSFAKDGNLYIADGSKVFYYDINADTFTIFNNSERYTATPTSVSEGP
FT                   NGDIYLTDFMSGRVDVYTRKEEYYANLDVFVDREYLNKFPIVVASVTVRDRMANPVIGL
FT                   TADNFFVKENSSVDYKVGFYDAPELHEYRFVYLIEDSAAAKPYENRIKEEISNFTMNLQ
FT                   GNDEVLVIHYNDQVYKADNYDARNLRILENANNFHFTGGISALDDAYYEAVRLAGNSFK
FT                   KTAVIHFTVSSPDDRVFNMMNFSDIASFAKNNAISLNQVYIGNEKSNYFLDLMTKNTYG
FT                   YTINADLSVNYSAELERIKNINFGRYYIYYSSFRNLSQSGQFRALNVRVQYRDMYGEEE
FT                   VGYVIP"
FT   gene            complement(453094..453166)
FT                   /locus_tag="Bmur_R0007"
FT                   /note="tRNA-Thr3"
FT   tRNA            complement(453094..453166)
FT                   /locus_tag="Bmur_R0007"
FT                   /product="tRNA-Thr"
FT   gene            complement(453240..453983)
FT                   /locus_tag="Bmur_0358"
FT   CDS_pept        complement(453240..453983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0358"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   bhy:BHWA1_00664 lytic transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70462"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5X1"
FT                   /inference="protein motif:PFAM:PF01464"
FT                   /protein_id="ADG70462.1"
FT                   /translation="MIESVQRIQSRIGEIQETFNKLGFAPINTTLPSKPFAEHLNEAMA
FT                   GNNTESKVNSVEVNNNLDGSVINDTNKKLDNGKVINGDTSSDAFKGKISFGVYEENTNN
FT                   FARAINAYKKASVESFPTKYDDIIKEAAEKYSLPENLIKAVIKQESNYVSNAVSHKGAV
FT                   GLMQIMPQTGVGLGVTDKEMLKDPYTNIMAGSKYLSQMLNRYDGRLDLSLSAYNAGPNL
FT                   VDRLKRIPNIEETQNYVKNIIGYIK"
FT   gene            complement(453995..454447)
FT                   /locus_tag="Bmur_0359"
FT   CDS_pept        complement(453995..454447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0359"
FT                   /product="flagellar export protein FliJ"
FT                   /note="TIGRFAM: flagellar export protein FliJ; KEGG:
FT                   bhy:BHWA1_00665 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70463"
FT                   /db_xref="GOA:D5U5X2"
FT                   /db_xref="InterPro:IPR012823"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5X2"
FT                   /inference="protein motif:TFAM:TIGR02473"
FT                   /protein_id="ADG70463.1"
FT                   /translation="MKRFNFKLEPLYKLRKNIEKQRQAEVAEVSAEYNKERDGKDSCLL
FT                   KIDDGIRYVDSIEDDNEMLSMSIYLGEYITALNSQISIHEDNMAEISVELRRRQEILQE
FT                   ASRQRRAVELLKEKKLLEYKKLMNKEEQAKLDEWKKEYVAGDAYEY"
FT   gene            complement(454479..455936)
FT                   /locus_tag="Bmur_0360"
FT   CDS_pept        complement(454479..455936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0360"
FT                   /product="ATPase, FliI/YscN family"
FT                   /EC_number="3.6.3.14"
FT                   /note="SMART: AAA ATPase; TIGRFAM: ATPase, FliI/YscN
FT                   family; KEGG: bhy:BHWA1_00666 flagellar biosynthesis/type
FT                   III secretory pathway ATPase; PFAM: H+transporting
FT                   two-sector ATPase alpha/beta subunit central region"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70464"
FT                   /db_xref="GOA:D5U5X3"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5X3"
FT                   /inference="protein motif:TFAM:TIGR01026"
FT                   /protein_id="ADG70464.1"
FT                   /translation="MIKDENVDFIKEVRKTFDKYRKVVDDVALLKSYGKVKEVIGSLVI
FT                   SEGPFCKLGDMCRIYMNDDTYLDAEAIGFRNQDVLLATYGPVNGITFGNMVYSFERPLS
FT                   VMCCDEILGTVLDARGKPLAGGGHNFYETPVAVSHNAVNPMNRPRIKKHIQTGVRAIDG
FT                   LLTVGQGQRMAIMSGTGVGKSTLLSMIARNTNADVNVIALIGERRREVRDFIERDLGEE
FT                   GLKRSVLVVATSDDAPLLRVRAAYTATTIAEYFRDKGKNVMFMVDSVTRFALAQREIGL
FT                   SRGEPPTTRGYTPSVFSELAKLLERTGTSNKGTITAFYNVLVEGDDLDEPITDTVRGIL
FT                   DGHIVLSRDLANRGHFPAIDVNKSISRIMNEVVSNMHKKAAREFLKMSADYNEAKELIM
FT                   IGGYAKGSMPEVDRAIDYKPMMDRYLQQDVYEVSSFADSKEALLSMFYSQEEIEEDLVN
FT                   SGDVKRAEDRTNISDNVEYANNDVVIL"
FT   gene            complement(455974..456876)
FT                   /locus_tag="Bmur_0361"
FT   CDS_pept        complement(455974..456876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0361"
FT                   /product="Flagellar assembly protein FliH/Type III
FT                   secretion system HrpE"
FT                   /note="PFAM: Flagellar assembly protein FliH/Type III
FT                   secretion system HrpE; KEGG: bhy:BHWA1_00667 flagellar
FT                   assembly protein H"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70465"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5X4"
FT                   /inference="protein motif:PFAM:PF02108"
FT                   /protein_id="ADG70465.1"
FT                   /translation="MPEKVFKSKSIVELTQKVNIAVPHHKSQEELDYEESQEEYKGPSI
FT                   EEIEAEIAGLRAQWEEDLRDMRRKAVDEADRIIEDAKTQAFEIFKSKQNEAHVISEQAK
FT                   VDASRIIQDANAEKEKIQSESESIKDAAYKEGYAKGYDEGFEKSFSDSNNDLIKLTEKM
FT                   KKILAETINKRNEIIDAAEAQVIEVAVLIAKRVVKMLTERDKGIVIRNIQEALRRIKGR
FT                   TKITIRVNIDDLEVSARHKDEFYQMLDKIEGVTVLEDPNVDVGGCMIETDFGDIDARIN
FT                   TQLNEIETAIKEVEPIKGF"
FT   gene            complement(456921..457952)
FT                   /locus_tag="Bmur_0362"
FT   CDS_pept        complement(456921..457952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0362"
FT                   /product="flagellar motor switch protein FliG"
FT                   /note="KEGG: bhy:BHWA1_00668 flagellar motor switch protein
FT                   G; TIGRFAM: flagellar motor switch protein FliG; PFAM:
FT                   flagellar motor switch protein FliG"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70466"
FT                   /db_xref="GOA:D5U5X5"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5X5"
FT                   /inference="protein motif:TFAM:TIGR00207"
FT                   /protein_id="ADG70466.1"
FT                   /translation="MAADKEKDKKQRVLSGRQKVAIFLVSLGMETSSEIFKHLREEEIE
FT                   QITFDIARLENIEAADKDAVFREFQEMMIAQDFITQGGIDYARDLLERSVGSQKASDII
FT                   NRLTSSLQVRPFDFIRRTDPAHLLNFIQGEHPQTIALILAYLEAQKAASILGALPTEIQ
FT                   PDVAKRIAIMDRTSPEVLREVERVLERKLSTLASEDFTSAGGIDSIVEIINSVDRSTEK
FT                   SIIESLEEDDPELAEEIKKRMFVFEDIVLLDDRAIQKVLREVDSSDLAKALKSVDTDAQ
FT                   DKVYRNMSKRAAALLKEDMDFMGPVRLKDVEEAQQKIVNIIRKLEEQGDIVVARAGEDE
FT                   MVV"
FT   gene            complement(458011..459714)
FT                   /locus_tag="Bmur_0363"
FT   CDS_pept        complement(458011..459714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0363"
FT                   /product="flagellar M-ring protein FliF"
FT                   /note="KEGG: bhy:BHWA1_00669 flagellar MS-ring protein;
FT                   TIGRFAM: flagellar M-ring protein FliF; PFAM: Flagellar
FT                   M-ring domain protein; secretory protein YscJ/FliF family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70467"
FT                   /db_xref="GOA:D5U5X6"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5X6"
FT                   /inference="protein motif:TFAM:TIGR00206"
FT                   /protein_id="ADG70467.1"
FT                   /translation="MQDFINKLTSQIRNIFSKTTTLQKAVLIGVLVVGLGAIIATIMLT
FT                   SRKTGTLLFQQALTQEDARNVIAVLDANNIRYQYRNGFITLNNQNDKARAELELVKEGR
FT                   MPTGVDGWELFDAPRIGITDVELDINKRRSLTKAITQLLTKLDFVQEATVDLAFPKKEY
FT                   LTDIDSPVTASVVIKAQPFKEDVLRDPKTVRGLQQLIAMGVDKLKPEFVTITDSTGYVL
FT                   TDFTDEAANLKLKVAQEELKIVDRERKNIENKIRQTLGRIYTNRVETTIALELIWDDVS
FT                   ITNNLVLPIILKEDDPTTPYDDSQFTNKVQVSSRTVTEDWKGQQFIPQGAAGAEENVPP
FT                   GYKDKSDRWQTYTKTDSQDNYELSKRYEAIKKGSYQIGKISAAVALDGRWTKVYDVNGD
FT                   PVITNGNSYVREYHPVTTEEIRNVTSLVQAAIGYDLKRGDQVSVTHIQFDHWDRFNAED
FT                   AKLMRDRFIKKTLIITMISLLILFVLALVIRAIQKELARRRRLREEELERKQMEMRRQA
FT                   MMNANEEPISEMSLEDAARKKLMDEVIRVSHERPDDVAQLLRTWMADDKS"
FT   gene            complement(459945..460424)
FT                   /locus_tag="Bmur_0364"
FT   CDS_pept        complement(459945..460424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0364"
FT                   /product="CinA domain protein"
FT                   /note="PFAM: CinA domain protein; KEGG: bhy:BHWA1_00670
FT                   competence-damaged protein CinA"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70468"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5X7"
FT                   /inference="protein motif:PFAM:PF02464"
FT                   /protein_id="ADG70468.1"
FT                   /translation="MNYEKSKEVVALLIKRGLKITSAESCTGGLFAANITSVSGSSECF
FT                   EGSFVTYSNEIKHKIINVKEETLEKYGAVSEECVLEMAENSRKIMESDISIAISGIAGP
FT                   SGGSEDKPVGLVWICLSAEGYIKAYKNIFSGNRDEVREQSVLFSLNLVESFVKKC"
FT   gene            complement(461020..461811)
FT                   /locus_tag="Bmur_0365"
FT   CDS_pept        complement(461020..461811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0365"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   bhy:BHWA1_00589 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70469"
FT                   /db_xref="InterPro:IPR012816"
FT                   /db_xref="InterPro:IPR037238"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5X8"
FT                   /inference="protein motif:PFAM:PF08719"
FT                   /protein_id="ADG70469.1"
FT                   /translation="MKNIMPPVWFVNNSSYNRVFHNYFNKLSNDDKEEYKKLFEEPIIF
FT                   KGFYDSYLINDYRTVYCNVKLNQKYSLLKLQKDFNAGNKIDFLFFYGHSNDKKEINKSS
FT                   LSQWYIKDFRENDLTFNCMEKYMMYNKALLFDDKNIADEILNTNQPKAIKELGRKVKNF
FT                   NDNIWNNMKYKIVFIGNYYKFSQNTDLRNFLLSTKNKVLAEASPYDKVWGIKMKYDDEN
FT                   IENPFCWKGENLLGFALMQVRDEIKRVYKNYDLIDCRKFFI"
FT   gene            complement(461836..462831)
FT                   /locus_tag="Bmur_0366"
FT   CDS_pept        complement(461836..462831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0366"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   KEGG: bhy:BHWA1_00329 oligopeptide/dipeptide ABC
FT                   transporter, ATP-binding protein, C-terminal; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70470"
FT                   /db_xref="GOA:D5U5X9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5X9"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADG70470.1"
FT                   /translation="MDKDIILKLENVKKYFNPHANIIESLMKKSKEIKAVDDISFELKR
FT                   GEILAVIGESGSGKTTIGKLIMKLINPTSGNIIFENENINNFNKEEAHRYRRNVQMIFQ
FT                   DPYASMNPRFKIKDVLKEPLYIHNIDGDEKVYDEIVIKALRDVKINPPEEFMERYPHML
FT                   SGGQRQRIATARALILNPKLVVADEPVSMIDLSTRAEILYMMKELQIEKNLSYIYITHD
FT                   LSTARYFADVIAVMYLGTIVEIGDADEIIDNPKHPYTKALIAAVPDASSGRVNIIKELP
FT                   IKGEIPNASDIPSGCRFHTRCIYAKDECKNNIPALKNISENHSAACIFAE"
FT   gene            462962..463171
FT                   /locus_tag="Bmur_0367"
FT   CDS_pept        462962..463171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0367"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cation channel family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70471"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5Y0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG70471.1"
FT                   /translation="MKQTNKQTNKQTNKQTNKQTNKQTNKQTNKQTNKQTNKQTNKQTN
FT                   KQNNIHNYLYFFNIYRNNNQNRAN"
FT   gene            463194..464642
FT                   /locus_tag="Bmur_0368"
FT   CDS_pept        463194..464642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0368"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_02536 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70472"
FT                   /db_xref="GOA:D5U5Y1"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5Y1"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_02536"
FT                   /protein_id="ADG70472.1"
FT                   /translation="MIEHYYHMRQYYDNKKLPVTGAFLVGAEYTANEYDSNSTLFSDKI
FT                   PKIPGGFFYIEYIVYYFLSGENLYIARILYGVAMSLFSCIFLLWIYKKFEVKIFAIMTS
FT                   LIFVNITFFTVTNRFYNPHTVFILSYISIPIILEYITSKKLNFIYAILIFPIIALEAMG
FT                   HIAAFFSIVPTLIVYFIIRWKITKKYIIPISIGIFISFLLYVPYLISEINNGFQNFNNV
FT                   IELKNQAKHILQPPQIWSILFFPTNESNANYGNTISAIFSPWFNGDIKLIFSFIFYIAS
FT                   VLIGISSFIILLKDFFQHKLEGDNNLIFKETALIYFLYIIVTVAVFMIFNLGAARARYF
FT                   FNIYPLTFIPIIYLIKKIENKKIFNVFLIFILLNPLAVYIETKYIIYKTSDNEGWNFMV
FT                   NHIEAINEDISNSQFYTFDLSANNDYPYILFKIENKNFYIDTNAKIKYNIIPSFDKNFN
FT                   HSNMEMIYSNKQYITYKEFKTNIN"
FT   gene            complement(464635..465594)
FT                   /locus_tag="Bmur_0369"
FT   CDS_pept        complement(464635..465594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0369"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   KEGG: bhy:BHWA1_00330 oligopeptide/dipeptide ABC
FT                   transporter, ATP-binding protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70473"
FT                   /db_xref="GOA:D5U5Y2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5Y2"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADG70473.1"
FT                   /translation="MENILQVENLKMYYHTSKGLIKAINDISFNIKKGETLGIVGESGC
FT                   GKTSLGTSLLRMPSIPGKYESGKIILDNEDIIPLKEEYIRKNIRWSKISMVFQGAMNSL
FT                   TPVYTIGSQMLETLKRHVDMDKTEANKLIEEYLEYVGLHSSIYKRYPHELSGGMKQRVV
FT                   IAAALFLKPKLIILDEPTTALDVIVQAQIINLLKKLKKDFDLSFIFITHDLALEAEISD
FT                   RVCVMYGGKIAELASNEDIYTKAKHPYTRRLLAATPRLNKAVSKLEFIEGTPPDLLNPP
FT                   KGCMFYDRCKKRIDKCKDEEPILKDTGNGHLCACHLVN"
FT   gene            complement(465692..466141)
FT                   /locus_tag="Bmur_0370"
FT   CDS_pept        complement(465692..466141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0370"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bhy:BHWA1_00331 acetyltransferase, GT family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70474"
FT                   /db_xref="GOA:D5U5Y3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5Y3"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADG70474.1"
FT                   /translation="MIKIEKASVDDIEEISMLVKNMYLKYNSHIDTEEGINNVLLFISS
FT                   DNMRLRFFMEGSLILIARNENNSILGMIEIINYDHISLFFVDDKYFKSKIGTRLFEEAK
FT                   NILKSDKYTVKASDYALEFYKKLGFMKLYNDIQEENGVHFHYMIY"
FT   gene            complement(466158..466517)
FT                   /locus_tag="Bmur_0371"
FT   CDS_pept        complement(466158..466517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0371"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00332 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70475"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5Y4"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00332"
FT                   /protein_id="ADG70475.1"
FT                   /translation="MLTFKTIDEKEMQNIIDTKEVSDDIKKSSENVIAIFTQDWCGDWK
FT                   GLERELKVNEEKSPIDITVYICMYNQSPLYEPFMNFKETVWNNGLIPYLRYYKNGSFVK
FT                   DTNHLPFQRLIKVFE"
FT   gene            466658..467401
FT                   /locus_tag="Bmur_0372"
FT   CDS_pept        466658..467401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0372"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   bhy:BHWA1_00333 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70476"
FT                   /db_xref="GOA:D5U5Y5"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5Y5"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ADG70476.1"
FT                   /translation="MKKIIICTIAIFNIISSVSFADSFLDEQKRYARVRTAIKEKDALI
FT                   KQNIINNNIKLNEMSILITAYKQEDILEIYAKNKNDKTYKKIAEYKIAAKSGILGPKRM
FT                   EGDLQVPEGFYYIDRFNPASSYYLSLGINYPNEADRKKSNAKRLGGDIFIHGANVTIGC
FT                   MPMTDDKIKEIYLYAIYAKDNGQNKIPVYIFPFKMTDDNFNYYKEIYESSLIDFWKNIK
FT                   EGYDIFQNTKKEINIKIDNNGNYIF"
FT   sig_peptide     466658..466723
FT                   /locus_tag="Bmur_0372"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.994 at
FT                   residue 22"
FT   gene            467468..468448
FT                   /locus_tag="Bmur_0373"
FT   CDS_pept        467468..468448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0373"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00334 hypothetical hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70477"
FT                   /db_xref="GOA:D5U5Y6"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5Y6"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00334"
FT                   /protein_id="ADG70477.1"
FT                   /translation="MIQENKNNSFISKYNFWSYILIAIVFFNYLLFRAIVIDSNSSIYL
FT                   ITFILDYIVLISFFLLVFYKFYNFIFTSQLLLSIIGILFLIFGTLKLYAIDISVYNIIE
FT                   LLFFISLLVLTLMILIPMILSKTITEAERGIYIFILLSLLSSNINYLIISANKIIDTDS
FT                   FHYISTYISNYMSKLSSFSFLVLMIYYILIFIKEVIMKNINISFMFAVIAIILSIAAIF
FT                   YFGNSFFLIIISFFSALGIVMYLHFVVYMVIMIMFFITLFTSFMTSIVSKEYYPKLIIF
FT                   TLFILAGLDMSNFSLRLIAVFAIMEMSGIQNNQKDAASYLTNNDL"
FT   gene            468503..468952
FT                   /locus_tag="Bmur_0374"
FT   CDS_pept        468503..468952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0374"
FT                   /product="protein of unknown function UPF0079"
FT                   /note="PFAM: protein of unknown function UPF0079; KEGG:
FT                   bhy:BHWA1_00335 nucleotide-binding protein putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70478"
FT                   /db_xref="GOA:D5U5Y7"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5Y7"
FT                   /inference="protein motif:PFAM:PF02367"
FT                   /protein_id="ADG70478.1"
FT                   /translation="MKKEILKEEENIDINSIENIAEYLKSILKDGDIVIMEGNLGFGKT
FT                   TFVRILSRLLESDNIVSSPSFTLINEYDIILKGKESTLRHVDLYRLDSREELDDIGFKD
FT                   KIRENGITIIEWGNNFIDYFESPYYLFEIEMKEENSRLYRISLIS"
FT   gene            468949..469980
FT                   /locus_tag="Bmur_0375"
FT   CDS_pept        468949..469980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0375"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00336 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70479"
FT                   /db_xref="GOA:D5U5Y8"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5Y8"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00336"
FT                   /protein_id="ADG70479.1"
FT                   /translation="MKKIFLLFIILFLTLFILSCSNRVIDNNTVIYSKTTVSSVNIIIG
FT                   NAIEYEVHIISKNGIDYNYEDVSFDDRNNKTRIISVENKTKDRGKYKERIIKYQIGFYD
FT                   IGQFVIYPFKISYNYNNEYRELLGEDVNILVNSFSDGETLPPMKRTMSIPMPKYVWIFA
FT                   VLIVIAVMAIIILIFSIIKYIEKKFNEKINIKEDTEALNALKTLDCTTYYNENKYAEYY
FT                   FELTFIFKRYLTKRFMFNIEDMTTSEINELFQNHHFNESEYIMNMLEESDYIKFAKQIP
FT                   ELNIMQKDYDFCVNYIINNGNLQTALKLQEKENKRIAKEERKKLKQEKKMNKKIHKLEE
FT                   NNS"
FT   sig_peptide     468949..469017
FT                   /locus_tag="Bmur_0375"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.663) with cleavage site probability 0.369 at
FT                   residue 23"
FT   gene            469996..471390
FT                   /locus_tag="Bmur_0376"
FT   CDS_pept        469996..471390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0376"
FT                   /product="tRNA modification GTPase TrmE"
FT                   /note="KEGG: bhy:BHWA1_00337 tRNA modification GTPase TrmE;
FT                   TIGRFAM: tRNA modification GTPase TrmE; small GTP- binding
FT                   protein; PFAM: GTP-binding protein TrmE-like; GTP-binding
FT                   protein HSR1-related"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70480"
FT                   /db_xref="GOA:D5U5Y9"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5Y9"
FT                   /inference="protein motif:TFAM:TIGR00450"
FT                   /protein_id="ADG70480.1"
FT                   /translation="MSEYDIKDTIAALSTPYSKSALALIRMSGSKALEIASKICFYAGD
FT                   ENKNITKFEHRKSYYALVKDENNTPIDELIVLSTLAPNTFTSEDTIEFISHGSIVVIDS
FT                   LLNLLIRNGARAANRGEFTYRAYINGRIGISEAEAIHDLIDSNNRLMAEASIYKMRGRL
FT                   TREIDKLRDNIKNSLILVYGELDFPEDDTETFSYDKLIENFINIKKDIENILYNSNRVE
FT                   NLINGIKIAILGRVNAGKSSIFNMILDKNRAIVSNIAGTTRDFLSENIYIDNIPFYLMD
FT                   TAGFHKEADNDIELEGIERAKKCAYEANIILAVFDSSRNADENDINLIEFLTTLKDKNI
FT                   IYILNKSDEEKKFDYNIDSNNIITISTKTKEGKDKLIKELKNYVNDSDIDIFNKESYVN
FT                   NRERGYLEKGLKQLDICIEKSKMSFSLDEVAEEMNILNNILGNVSGKIDAEEVINEIFA
FT                   NFCIGK"
FT   gene            471522..472247
FT                   /locus_tag="Bmur_0377"
FT   CDS_pept        471522..472247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0377"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00338 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70481"
FT                   /db_xref="InterPro:IPR025665"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5Z0"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00338"
FT                   /protein_id="ADG70481.1"
FT                   /translation="MRKLFSTAAIFILINLSLFAESGFEGIFNIPLGLSAGIPMGTKDN
FT                   TVKKIGLGFDIGITAQFGYIVDFKNGVGLSILGEAGYSYDTYAYTIPSSDKSIKNLSSI
FT                   SFHSLQVGLLPKINIKDFSIGIGGGLKIPIAGTIDNKTTTYGTNYTAEGYNVNILDIVN
FT                   EYDKMNVIPYVKLTFDYSVFNDYNVAANFGLYFDYEFGTRKKIDEKTYTSVDSFGAGLQ
FT                   IGLRFSPFKKLPVSNDTNK"
FT   sig_peptide     471522..471584
FT                   /locus_tag="Bmur_0377"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.985 at
FT                   residue 21"
FT   gene            complement(472275..473471)
FT                   /locus_tag="Bmur_0378"
FT   CDS_pept        complement(472275..473471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0378"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /note="PFAM: cyclic nucleotide-binding; KEGG:
FT                   bhy:BHWA1_02646 cAMP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70482"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5Z1"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ADG70482.1"
FT                   /translation="MINYNNIVSFKKSSIIFIEDNYPKKSFYVIRSGKAVSYGKYFDSN
FT                   MEYTNGDILGLVNSVLNEPYFFNVKADTDIEALEINVDDIINIYNKDLIKKMHNYLENS
FT                   LEIWLSKYYINLSHNHSMTKYDINEGYVLNLAQVYNDNNFPTAAYEIYNQYLKFFPNSS
FT                   SIKDIKDMIASMKEYNLPEPEAIEDNIFYYKKGYCLYTEFMASNYLYLINSGKVGVYNV
FT                   INSKLVTRAIYSSNNLIDGYIPDITYQPLSTTTIVLEDSKIKLLKKEEFISIVANVNSL
FT                   RPYYLQIICTKIRNSVLKVMALSSKDIFMKLLITIYYIVRTESLFLNKDVNTAKLLYKL
FT                   QDIAAVIGYNNDINMIKNELKKIRFISIDDENYIHILDINNFIKEYEIYKKRLSLKKS"
FT   gene            complement(473602..474894)
FT                   /locus_tag="Bmur_0379"
FT   CDS_pept        complement(473602..474894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0379"
FT                   /product="adenylosuccinate lyase"
FT                   /note="KEGG: bhy:BHWA1_00426 adenylosuccinate lyase;
FT                   TIGRFAM: adenylosuccinate lyase; PFAM: fumarate lyase;
FT                   Adenylosuccinate lyase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70483"
FT                   /db_xref="GOA:D5U5Z2"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5Z2"
FT                   /inference="protein motif:TFAM:TIGR00928"
FT                   /protein_id="ADG70483.1"
FT                   /translation="MIKRYTRKEMGELWSLQNEFQVMLDVEIAACEAMAEIGEIPSEAV
FT                   KNIKEKAAFTVERIAEIEKETNHDIISFVTAVQENVGEGGQYIHKGLTSSDVKDTALAV
FT                   MMKRSAEIILDDLKRLSEVLLRRAKEHKYTPCIGRTHGIHAEPMTLGLKFILWYDENER
FT                   NIKRVEEAKKQVSVGKISGAVGTYSNIDPRIEEIVCKKLGIEADKVSTQIIQRDRHAQY
FT                   LTTLAIVASSLEKFATEIRNLQRTDIREAEEYFSEKQKGSSAMPHKRNPITCERISGLA
FT                   RIVRGNALASMEDITLWHERDISHSSVERVILPDSTIAVDYALNKFIDIVDKLLIYPDA
FT                   MKANIEKTGGLIFSQRILISLVNKGIDRDNAYRWVQRNAMKRWLNNEDFRENVHKDEDI
FT                   KKYLSDKEIDDCFDYAYYLRNIDVIMKRFGI"
FT   gene            475065..476081
FT                   /locus_tag="Bmur_0380"
FT   CDS_pept        475065..476081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0380"
FT                   /product="Threonine aldolase"
FT                   /EC_number="4.1.2.5"
FT                   /note="KEGG: bhy:BHWA1_00425 L-allo-threonine aldolase;
FT                   PFAM: aromatic amino acid beta-eliminating lyase/threonine
FT                   aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70484"
FT                   /db_xref="GOA:D5U5Z3"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR023603"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5Z3"
FT                   /inference="protein motif:PRIAM:4.1.2.5"
FT                   /protein_id="ADG70484.1"
FT                   /translation="MKIYDLRSDTITKPSEAMRKAIYNAECGDDVYMEDPTVNKLQKMA
FT                   AEITGKEKAIFVSSGTMGNLIPMMILGRKNKQVLLEEESHIVHYELGGASSLAGIMPLT
FT                   VKADRGILTKDIVKNYIKEQPYYMSTVSIVEVENSHNRHGGSVYPIEILKELYDFTKSK
FT                   NIHLHMDGARVFNASIASKKSVKEIASNTDSITFCLSKGLGAPMGAMICGNKDFIDEAF
FT                   SIRKLIGGGMRQIGLMAAACIYALEHNIESLEEDHQKAKKIAKAIIESKIGDINLDNVE
FT                   TNIVIADTKEPSSNILSKLSEQGIKASSFGDYKIRFVTHRDISMEETEEVCSIIKKL"
FT   gene            complement(476152..477977)
FT                   /pseudo
FT                   /locus_tag="Bmur_0381"
FT   gene            complement(478095..478991)
FT                   /locus_tag="Bmur_0382"
FT   CDS_pept        complement(478095..478991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0382"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG:
FT                   bhy:BHWA1_00423 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70485"
FT                   /db_xref="GOA:D5U5Z4"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5Z4"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADG70485.1"
FT                   /translation="MICEVCGSKNYSEIGTIKNIWQSDKKVYQCSNCGLYFIDLPTDEE
FT                   IYILYKNEYHNNIKNKLFETAKSKMRYARSLSQFNFIKKYIDFHNKKVCEIGAFDGLLL
FT                   NIFKKNGCDVYGYELNDNARLYAKNKYDIDLNTNFLESKEKYDIIMLSHVIEHFKNPFD
FT                   VLIKIKNMLKDNGYLYIEVPNSPNKNQCSYDILMRYLSTEHIVNFNIENLKMFVKKADL
FT                   NIIECQYSNYSVSRYNDKLRANILEGSIPSLINFFSFSLFAFKTFAAPNSTFINYYDNN
FT                   NLWSYGENIRIIAQLKN"
FT   gene            complement(479014..480510)
FT                   /locus_tag="Bmur_0383"
FT   CDS_pept        complement(479014..480510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0383"
FT                   /product="NusA antitermination factor"
FT                   /note="KEGG: bhy:BHWA1_00422 putative transcription
FT                   elongation factor NusA; TIGRFAM: transcription termination
FT                   factor NusA; PFAM: NusA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70486"
FT                   /db_xref="GOA:D5U5Z5"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5Z5"
FT                   /inference="protein motif:TFAM:TIGR01953"
FT                   /protein_id="ADG70486.1"
FT                   /translation="MFENVGTYLQQLSDEKDISVELLKEVIASTMELALKKKYGNDINF
FT                   HIHFDNKNNPTVYKGANVVEEVRDKNKEISLEEAKKLDQDINLGDEVLILVDQVEAFGR
FT                   IESMVAKTTFFQKISDLEKNIIYNEFKRRENQLVNGYFQREHKGTIYINLGKTEGELQK
FT                   KDQSPREHYTVGDRIRAYIYKVQGGKDDRTGKEIPTKILLTRTKADFIKKLFELEIPEI
FT                   ADGTIEIKNVVRQPGLKIKVAVVSNKPEVDPIGACIGQKGIRIQSIIKEIEGEKIDVVK
FT                   WSKDIREYIAEAITPAKPIRIIITDPEKKEAMIIIPDEQLSLALGKSGYNVKLASQLTG
FT                   YYFDIKTETDIKENPELLKDIVPLNQIFSDTAEETENSSEAEAAEAAEVFESNLYSLQG
FT                   IDESIIKTLIDNGINSIEELYNLSAEEIMEKTNLDKDTVDNLMLVMKDVVEIVESEDEY
FT                   ETTSEEVVEEIEVYECPNCGSSITEDMTKCPKCGIELSFE"
FT   gene            complement(480553..481119)
FT                   /locus_tag="Bmur_0384"
FT   CDS_pept        complement(480553..481119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0384"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00421 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70487"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5Z6"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00421"
FT                   /protein_id="ADG70487.1"
FT                   /translation="MNNKNSKIKPQKQKEYGRVPKKKKLQKEKSNKTTPIIDEVLLFNG
FT                   IKDILEKDGIYLLDLKVRAISDNKKVYAVIYKKKESVSHTHCIETTRKIQECIKQNGYD
FT                   EGDYTITVSSAGFRWKFNDRYELFEGMPIKIKYRDGEQFITSYAELKEAEDDYIIINVL
FT                   DEDNIINEKNIKILKNDIIKARLNC"
FT   gene            481363..482889
FT                   /locus_tag="Bmur_0385"
FT   CDS_pept        481363..482889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0385"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="KEGG: bhy:BHWA1_00420 cardiolipin synthase; PFAM:
FT                   phospholipase D/Transphosphatidylase; SMART: phospholipase
FT                   D/Transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70488"
FT                   /db_xref="GOA:D5U5Z7"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="InterPro:IPR030874"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5Z7"
FT                   /inference="protein motif:PFAM:PF00614"
FT                   /protein_id="ADG70488.1"
FT                   /translation="MVFYILTIIFFLYVVSIAIKMLLENRPPYSFIAWLTVLVFLPYIG
FT                   VIFYIFLGMDWRKSKKKISAKLPEDMIKKYFSSLLKEQITILDNMQGNYGRNINLVKLA
FT                   INSGYSPITVQNEVYVFDEGEKLFNAVIEDLKLAEKTIHMEYFIWRSDELGERIKNVLI
FT                   KKAKEGVEIRLIFDGVGSLMRISKKYRKELKKNGIKFLYYHDPFSILWTRFVNYRNHRK
FT                   IVVVDGVVSYMGGMNMGQEYIDGGKRFESWKDVHMRIVGDACNLIQNVFVCDWYNAGGR
FT                   DLEAFNISEKKHKLSRKLKYIDKELDEERISIIRKDLFPISATDKFLPIQIISSGADSK
FT                   WDSIQKVYSKMIEEAKESIYIESPYFVPDDSFLAALENAALSEVDVHLMITGKPDKLVA
FT                   WWVAQTYFETLLKAGVNIYLYEKGFLHSKFCIMDGRIVSCGTCNMDIRSFYLHYEMNAV
FT                   IYDTDIAKKFEDIFKKDMMNSHKVTIEEYSKQPMLVRLRNSACRIIAPVL"
FT   gene            482918..483862
FT                   /locus_tag="Bmur_0386"
FT   CDS_pept        482918..483862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0386"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00419 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70489"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5Z8"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00419"
FT                   /protein_id="ADG70489.1"
FT                   /translation="MKNIKISVLDNQAISNLNASEESLTLFVDDIGIPKENISALNEVL
FT                   RVREDFFLNISSDKNDSYKNNIMGNDLLRALPDLKNLVYHASMKYPLKSIDIFARLINL
FT                   KSLHLYGDLPKDMELKPLDNIENLESIYIENGLTLRQDVYLAMRSTIKEIGAGTFRMES
FT                   FDKNPNLKKIAILSGVSHEEEMPKKLPELEELYIEKGKNIRSFKFLSEMKTLKTLELNN
FT                   IPELKELPDFSLLEDLKKVVLKNLRNLENMDSVLNHARVRTLILENIKCFNIDAISKET
FT                   APRLKFVSVITDDKIWDKRTQKLLEEKGFKPAL"
FT   gene            complement(483952..485805)
FT                   /locus_tag="Bmur_0387"
FT   CDS_pept        complement(483952..485805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0387"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="KEGG: bhy:BHWA1_00417 methyl-accepting chemotaxis
FT                   protein McpB; PFAM: chemotaxis sensory transducer; Cache
FT                   domain protein; histidine kinase HAMP region domain
FT                   protein; SMART: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70490"
FT                   /db_xref="GOA:D5U5Z9"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:D5U5Z9"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADG70490.1"
FT                   /translation="MKFMQTLKFRMPFTIISSVAIMLIILMIVIISSSSVFIENTALRG
FT                   FMETADGYRDLVSVWLNDQRDLTSVIAKESEFLDYFKTPNELNLTIAESELIELLGELG
FT                   DHFASFSLFDLNGKLVTSTSENTIGGDIANRGLWNRLIESGYKYSIADEIEMSPMNDEY
FT                   VITVLSGVVDYTGKPAGVLAAELKWDNFAKKYFSEITIGKTGNIYVVDEDGKRVAHKDV
FT                   QKINTVSEGSRNALAAASTERKGTLHYEDEGKKVMAFSRLDNIDWIMCVTMLESEFYSD
FT                   RNTLIKITVVLSVLLLFITSFIVVRYVHVHISKVLTKLANDLNRLGNGDLTVKAPTKFL
FT                   SSKYKNHEFGIIANGFNNTIKKLKNIVENIIDSSNNIELTSKELENGNNDLALRTQSQS
FT                   SSLEETASSMEQMASNIKNSAEKSVIGNNMMNDSKKSVEEAGLIIDSTTKSMEAVYEAS
FT                   RKITNITKLIEDIAFQTNILALNASVEAARAGEQGRGFSVVASEVRTLAQNTQTSVKDI
FT                   TSLIADSDEKIKVAAEAARKSQEIFTDIKDKIESTASIMKDISTTAVEQQSGVEQVNQA
FT                   VLKMDASTQENASLVEQSKDASITLSSEAQKLIEAVSYFKL"
FT   gene            486047..487330
FT                   /locus_tag="Bmur_0388"
FT   CDS_pept        486047..487330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0388"
FT                   /product="Galactokinase"
FT                   /EC_number="2.7.1.6"
FT                   /note="KEGG: bhy:BHWA1_00416 galactokinase; PFAM: GHMP
FT                   kinase; Galactokinase galactose-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70491"
FT                   /db_xref="GOA:D5U600"
FT                   /db_xref="InterPro:IPR000705"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D5U600"
FT                   /inference="protein motif:PRIAM:2.7.1.6"
FT                   /protein_id="ADG70491.1"
FT                   /translation="MYNISQLKELLKEKKMHEKFSLIYGGDEKSISEAYNRLEKTIKHF
FT                   ESIDKSEEIYLFSASGRTELSGNHTDHNNGCVLTASINLDKLAIVSKRNDNKIVVYTDY
FT                   SNNPDVVDINNLEIDKNEYGKSNALSRGVCAGIKKEGYNIGGCTISLNNKVLIGSGLSS
FT                   SASFESLIGEIQNALYNDDKISKVDIAKIGQYAENIYFGKPCGLMDQMGCSVGGIMSID
FT                   FKDNNNPIIEKVEYDFESNGYALMIVDAKGDHSSLTNEYAAIREEMNAIADYFGKKVCR
FT                   EITKKELIDNASKLREKIGDRAVMRAYHFIEENERVINQINALKNDDIKTYIKLMNESG
FT                   LSSFMYLQNCYSVTSSKNMGVALAICLTKDFLKGEGACRVHGGGFAGTIQALIPLEKSE
FT                   EYKKYMNNVFGEGSAVKIRVRQAPVCEI"
FT   gene            complement(487464..489200)
FT                   /locus_tag="Bmur_0389"
FT   CDS_pept        complement(487464..489200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0389"
FT                   /product="protein of unknown function DUF342"
FT                   /note="PFAM: protein of unknown function DUF342; KEGG:
FT                   bhy:BHWA1_00414 predicted polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70492"
FT                   /db_xref="InterPro:IPR005646"
FT                   /db_xref="UniProtKB/TrEMBL:D5U601"
FT                   /inference="protein motif:PFAM:PF03961"
FT                   /protein_id="ADG70492.1"
FT                   /translation="MAKEIIKPTLSIDPNNYEFYYDNTINTREIYDQIVDIDSKDQNLY
FT                   EELVKNYVHPGDAILRSISKREGIKAGKNVKFDKMTGNYRSTEHGYVFYDELKSVSIIP
FT                   VINVADKWRGVMVLPPQKQQKKQVVLEEIQTIISQIPIKLMVDYDKVAELVAYNLKYDE
FT                   GVMCVFVQGRKPIDGNVQKVILDYDFTIDTGKESEDGAIDFKERGFIHNIEANVQIAHF
FT                   MEEKPSLDGLDIYDVVMEAHYDEDPCYKLGKNVKVDEDGIIIRSSIRGILSNHNNTLSV
FT                   STVAEIDKVDLSTGNIEVNGSLIIRDNVAPGFSIKTEGDILVRGNIEDAEIECAGNLIV
FT                   SGGIIGGTNSKIYVNGKLSSQFIRNASIICKGDLLANQLVNAEILCNDRVIVLEGKGVI
FT                   IGGNVKALNGVWAKSIGSMSESKTTITVGRDAEADAEFKNIVATVKTNKEEISKIKSLL
FT                   GTEYFKNPKAFIERIPVNKREGIKDILKRITNLVKETAQLEARRDEMSAEFEKLSHSSI
FT                   TSMEGFFPGVTIYISSMRKYISKKISGTEYFYSKELRDISEKAPKLLPLEEYDFPREIK
FT                   ED"
FT   gene            complement(489234..490037)
FT                   /locus_tag="Bmur_0390"
FT   CDS_pept        complement(489234..490037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0390"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG:
FT                   bhy:BHWA1_00413 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70493"
FT                   /db_xref="GOA:D5U602"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5U602"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADG70493.1"
FT                   /translation="MAEGKECEFCGSTKSEVYIKTDLVSYNKCLNCGLIYQYPVLSQEE
FT                   INDIYSDNYFEYEVTNQDNFFGLMKLAMKDIGFDKIESKLPNKNVLDIGCATGMMLNYL
FT                   KTKGYNAQGIEICSSSAEYARKNYGVVVHEKPLLEVGFDSDYFSFIHFSHVIEHVPNPA
FT                   DTLKEIYRILAKGGYLAITTPNADGMFAKKYKGAWRAVMPQHLWLFSKTTLSNYMKNIG
FT                   FNIISDFSWGSIPIEKKPNKIIKAFFDKYVKLFNRGDVMLFLCKK"
FT   gene            complement(490103..490846)
FT                   /locus_tag="Bmur_0391"
FT   CDS_pept        complement(490103..490846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0391"
FT                   /product="PASTA domain containing protein"
FT                   /note="PFAM: PASTA domain containing protein; KEGG:
FT                   bhy:BHWA1_00412 PASTA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70494"
FT                   /db_xref="GOA:D5U603"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="UniProtKB/TrEMBL:D5U603"
FT                   /inference="protein motif:PFAM:PF03793"
FT                   /protein_id="ADG70494.1"
FT                   /translation="MSRKKNKSEVKTNTEEKAEIKIEKSEKIEVKKDNKHFGNILNKII
FT                   FYIKKFINIILPDGIVSDSKSLLVFGRLTLFALILFVLQILVVCIVVFVIVKSGGESFV
FT                   LPDVEGKEVFQAFNTLEKEGMNLNIQTHYFNNYPLGTVVSQEPKGGIKVKRGRTVYLVI
FT                   NAAEQALVKMPDVTGIKYEEALSIITNDVLSTMTNVAILPKVEINDSLYENDIVVSQIP
FT                   AAEDVVSMNTEIILTVNNKKSQNQQ"
FT   gene            complement(490868..491806)
FT                   /locus_tag="Bmur_0392"
FT   CDS_pept        complement(490868..491806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0392"
FT                   /product="formyl transferase domain protein"
FT                   /note="PFAM: formyl transferase domain protein; KEGG:
FT                   bhy:BHWA1_00411 methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70495"
FT                   /db_xref="GOA:D5U604"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/TrEMBL:D5U604"
FT                   /inference="protein motif:PFAM:PF00551"
FT                   /protein_id="ADG70495.1"
FT                   /translation="MYNVIVAGSTDFTRDCILQLMKTDNVNLSGVIAPIDTKKDRKGNI
FT                   INSPVAEAALENNLNLFQPESINKDEFYGILTDIAPDFLIVVAYGKILTKRTLALPKIM
FT                   PLNIHGSLLPILRGASPVEHALLYGFKKSGTTLQKMDAKLDEGDIILQHEVDIADNWQF
FT                   NDLYDRIKESGVYLLKEFFKDADRYLSNMIKQDDSSATYCSKIKKEDGKLDFSRDVISL
FT                   HNMTRAFVRWPTAYCFYKDISIRVFKSEYKYNTNCQSDFGKIADVNNEGIYIQALNGIY
FT                   IIKELQREGKKRQTVKEFLCGNKLNIGEYFL"
FT   gene            complement(491868..493316)
FT                   /locus_tag="Bmur_0393"
FT   CDS_pept        complement(491868..493316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0393"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00410 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70496"
FT                   /db_xref="UniProtKB/TrEMBL:D5U605"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00410"
FT                   /protein_id="ADG70496.1"
FT                   /translation="MFKAMNKYYEINFDKILELKEIIIHENIEITCVNSNGISIIVPGS
FT                   CVDILISEKNNILLRNVKYYISSFSSKFFNLNNPQTNKKTVVEGSDESEYSEYDYFYHI
FT                   YKNCMPSNEKLKSANSIFLEKIVKEKPNNRIYLLKPYADELKLESKAQKVSNEIAISIE
FT                   RILTGLGIIARLDFIRYIKYIKTSKQNSNNIINTETEVMISSIMNSIVSYLEKEYVFRD
FT                   IFDNLDLLNDSNILSHSNRVFILMVEFLYYYNNTFNKGLSNKLRQDYQDKYLEYYRVVL
FT                   NKFNISKGIEKLEKLYKLGIRKFTASEIVNYAVGAFYHDVAMLNIMDFIPTDEFIKDGD
FT                   FKDFHTLKAYYFLKYVLNQKDEAALIAGLHHECYGYGSGIMKNFIDKKANDPKHKIDFL
FT                   MTFETEDIVNADALAYFPAKMLEIADIYDSLTFMNGSRNKNPEEVVMFMRAMFIDEKIK
FT                   IDPIAFSLFSQFLSDVKGINIIEQ"
FT   gene            complement(493342..493959)
FT                   /locus_tag="Bmur_0394"
FT   CDS_pept        complement(493342..493959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0394"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00409 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70497"
FT                   /db_xref="UniProtKB/TrEMBL:D5U606"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00409"
FT                   /protein_id="ADG70497.1"
FT                   /translation="MKKIVLLLIIIFSVNLYPKINMKESTIVEKKDYGYIVYAEDYYRL
FT                   YSLPSYYGEYDLLRNVDYLERALNAPFDFVNRALTIIETEEAYTRYKDLMHMQFNYLIT
FT                   QNYIYLAGLYDKENYYFYNSQFDEDIKKSFEYAVFFYNLAKERWALTKELADKVMKNKA
FT                   KLEMDNLIDKAYKIALGEIDYNKTADRQLKHIEEILQEMENN"
FT   gene            complement(494033..495955)
FT                   /locus_tag="Bmur_0395"
FT   CDS_pept        complement(494033..495955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0395"
FT                   /product="Ankyrin"
FT                   /note="SMART: Ankyrin; KEGG: bhy:BHWA1_00408 ankyrin
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70498"
FT                   /db_xref="GOA:D5U607"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:D5U607"
FT                   /inference="protein motif:SMART:SM00248"
FT                   /protein_id="ADG70498.1"
FT                   /translation="MENFNNNDSNNNVNLNNSESNNVNNNNSIERVNKSKEAEENKKYI
FT                   FKVAVVAVAIVFVLLVGAGIIVGLFLFIKGKSDMEKMVRSYEIYSEEIYNKKYGDRVVK
FT                   EMVNNYGADVNETGNNNQTPLFYAVQNNNIKAVKFLIENKADAEIANNLGISPLVLAIS
FT                   NNNTKIAELLIKEGKANVYGSYAGKYLDHYPMYYAVSQTNKTMIKLLLDNSFDLKREPS
FT                   LLGYAIENSDESIVRYLIDNGADINYKSADGTTVLYNAVLSLNPALVDYFLSKGAKIED
FT                   AGESSVYGNIIMAAAGSKFNNTSSSPVDFVLVQQKSADSAKIMEKIITNINKGVLNRLV
FT                   NGKNALIIASGNSYIDTVKVLLTNGADVNSSDNDGWSSLMYAANNGDIELAKVLIENKA
FT                   NVNAESYEEKTPLIYAMNSPIESSRNDMIKLLIENKANINIEDSNGLSPLTIAVMNNDV
FT                   ELTKLLIVNKADLSIVTKDGESLIEYAINNDNVDLLQVLVEAGADINYAGISSYTPLMI
FT                   AAKSGAENITRILLTQKADLNAVDKYGDTALHIASEYSNLPIVRMLLEKKPNLNIQNQN
FT                   GDTPLHKAVNSGSVDIVSELVLSGADVMVRNNIGKYPIDIARDNNNSAIFEILREAEEK
FT                   QNSSL"
FT   gene            complement(496051..498657)
FT                   /locus_tag="Bmur_0396"
FT   CDS_pept        complement(496051..498657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0396"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: bhy:BHWA1_00407 solute binding protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70499"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D5U608"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ADG70499.1"
FT                   /translation="MKLNNKIFYKLSILILSIIILSCSNTKEEIEQKDIDRGGALIDKI
FT                   IYEVRTDMTIAIKDVADGRADLMASGIDGAAYLSLGESDLEKLDTYAVPSGSWSLLFNP
FT                   VPNKAPYTVTTRDGKTYFNPLAIKEVRFAMNFLIDRKKLVDEILRGAGEPSFTQATPGQ
FT                   PGTYRYNLIPSKMGMTANGNEDKAINDINKAMEKAANLPENRGKLKKENGWWKYNGETV
FT                   TIKFVIRVDDPTGRLPAGNAISDLIEKTGIKVEKLLYDRNKSTQVVYGSDPKDYEWNII
FT                   TEAWGAGATRAWWDVTLRQMYVREGNYMPGGNISEFWNYDNKEASRISDKNSNGWFLTA
FT                   DEYWNGNMRLQEIGLEDAVRIYLNSQTQFFVANKERFNRRMLYGVGDGVNDWSIRSADI
FT                   KPNRNGEKVLRVLQHSAQGSLFISPWDPVGVGGFSDAYSAIMIGPCSDAGATFESPSTA
FT                   KTEFILGEADTNSLEIGVRAGNNGIPIGTIKVPQNAKMYNPYTQKWEEGLTVKINENGE
FT                   LVYQKSDNLTAYVKCDFYPRNFKWHHGIESSLVDLMYGSVFIANVITKTNENDKYYDSA
FT                   MAGRYLSAMDGAVGSIINEDGSFTLYGNYYWPMDMDRQIAVAAVSPKIGNPNRNTVIPF
FT                   EINEAIMKIVLEGSKSGNVYTISQDQSLTSIDVKNPTCVSDIKEKLIEMRDSEYIPAGI
FT                   EDFITKEEAVKRYQAAIDFIDKYGHAYISNGPFFISKIDSKANYIELTAFKDYSYTAEY
FT                   WIERLSTKMSRIEDIEMPAIASKNNDINIDIYVSSYNYPDNSLELPDPNTTVKVLLQLQ
FT                   NGGEREYKAVLQDDVFKLTIPKEELSSLPNGNYIAVIESYIADETPYIETRSFILQ"
FT   gene            complement(498843..499796)
FT                   /locus_tag="Bmur_0397"
FT   CDS_pept        complement(498843..499796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0397"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00994 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70500"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:D5U609"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00994"
FT                   /protein_id="ADG70500.1"
FT                   /translation="MKYLDKLKQILNEPVTVDNLNRINDYFIRYLFSHAGNENIALNFI
FT                   NAVFKDLNFETFKKIEILNPFNIAENYDEKESIVDIKATTETGITVLIEIQSRGNEDFI
FT                   KRALYYWAYNYSSSLNRGSFYDELKPTVSINITNFILTDEDKVHSCYVLKELNNNKILT
FT                   DHCQLHFLELPKFNLNNISAIESLDNIHREFISWIKFFKGEDMSVLMKENTIFEEVEKK
FT                   CRTFVDDSPVMDKYKKREVDTYFFNKSIELDMKKAKEEGIKEGIEKGIEKGIKEGIEKG
FT                   IEKNKITIAKNLKKSGLDIKFISDNTGLSIEEIENL"
FT   gene            complement(499967..500461)
FT                   /locus_tag="Bmur_0398"
FT   CDS_pept        complement(499967..500461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0398"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00312 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70501"
FT                   /db_xref="UniProtKB/TrEMBL:D5U610"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00312"
FT                   /protein_id="ADG70501.1"
FT                   /translation="MIRIFISLITCAFLFAISCSNNENKKTQNNNTSESVLDYMQMDSP
FT                   NSFIPLGIKILAPENSLNAKYFIINKDIAEIDFDYMDNSYIYRASKNSNSLLSFYGDYT
FT                   NSGKNFIEDDINVEYNISSSGEKFTLWRVNDIYYILSSKAVDDTDLTNLSSIYIKFINN
FT                   K"
FT   sig_peptide     complement(500396..500461)
FT                   /locus_tag="Bmur_0398"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.936) with cleavage site probability 0.345 at
FT                   residue 22"
FT   gene            complement(500474..501874)
FT                   /locus_tag="Bmur_0399"
FT   CDS_pept        complement(500474..501874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0399"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00313 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70502"
FT                   /db_xref="UniProtKB/TrEMBL:D5U611"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00313"
FT                   /protein_id="ADG70502.1"
FT                   /translation="MKINLDNYALISLDKIRNYKDLIQKDKIEIISKNEYGIVNAVPHN
FT                   NIDFLFNEDCRNNILFDKAEYYIYKSYLEMIEFFVNPNSLNNKDYFYSIFTSCKDPIEN
FT                   VRTFQEKMLEAILSMNYFRRIENIKELILKLEIEENRDKFTCKAAEIVGEILVKLGLMQ
FT                   RINVIGNISDNELFDSNNFNINYEELLRSVAESVFVLLNKPYEKNDIFTNTMGFTGYNI
FT                   IDHSNRIFINTIEYMIFYNKNINMGILSKIRAKWKNEYMVYYDKVSKKNRFIKDTSKLD
FT                   NIFKFGIRQFDYIEIVNMSIAALLHDITLTETMNYLPIENSNNELYSHAIKSYNYLKYS
FT                   ISNNQDVNLAVGLHHEYYGYGYGFAITLCEAMRVKRPNFEYQYLITFDSKDILNFTSSV
FT                   YYPVKILEILDLYDFLKYKRDICFNEIDTDDDIINYMYDNFLKDEVKIDYILFTIFKKY
FT                   LLEMKTFD"
FT   gene            502026..502697
FT                   /locus_tag="Bmur_0400"
FT   CDS_pept        502026..502697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0400"
FT                   /product="YheO domain protein"
FT                   /note="PFAM: YheO domain protein; KEGG: bhy:BHWA1_00314
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70503"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:D5U612"
FT                   /inference="protein motif:PFAM:PF08348"
FT                   /protein_id="ADG70503.1"
FT                   /translation="MDEYRYTQEDFAILDSYRTISQSLGKYLGENAELILYSFENKQHS
FT                   IIYIVNGHLSNKKIGDYLSERDKSVLNELLDKNNDYKNNFIENVTGECSKINYTLIKNS
FT                   NKIPIGLMMINWNYDISLINTLKIFIPEHSVNNTQIKENKNSKSEEIILDAIKKVITGI
FT                   DKDEVGPSVYNKTIIRKLFNQGIFEFKESVQIVANYLNISHHTVYLHLRSIKKIKKSSG
FT                   K"
FT   gene            complement(502843..503775)
FT                   /locus_tag="Bmur_0401"
FT   CDS_pept        complement(502843..503775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0401"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; integrase domain
FT                   protein SAM domain protein; KEGG: bhy:BHWA1_00315 tyrosine
FT                   recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70504"
FT                   /db_xref="GOA:D5U613"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D5U613"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ADG70504.1"
FT                   /translation="MNMHTDYVFKDEKVYILLDEFSDYLQTLNFAAHTINSYNKDLKEY
FT                   FNFLESKNILLDNADHYSVRDYLTFLKSKSLTNSTMSRHLSSIKKFYKYLIRNGLSDKT
FT                   RIVDMKSPKREEHIAKFLSLDDIDRILAIDDDGDFTLLRDKMMALFMYAIGLRVSELAS
FT                   LRLSMIKKGDETLRICGKGSKVRDIPVLPVVYENWDIYMEKRRMIQKEYSQNNDYLFIN
FT                   RFGKPISDRSIRTSMKRLIRNANISMDFSPHTLRHTFATHLLNNDAEIRGVQELLGHET
FT                   IATTQRYTHVTNSRLFEVYNRFHPHSNNE"
FT   gene            504016..505104
FT                   /locus_tag="Bmur_0402"
FT   CDS_pept        504016..505104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0402"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00316 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70505"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:D5U614"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG70505.1"
FT                   /translation="MTDLEKKLMEFSLKLIDEKKAKIIVPVTPETGYWFGGGNMIEDKD
FT                   GNLYISGRYRNSGDSRTGLDLGDRGAELAIFKSSDKGNTWTKIKSILKKELPRGVLSIE
FT                   GTALRFNKDNEVELYISSEKSENKYPDHLKDFLKPGTGVWDIDVIISDKIENLSASNVK
FT                   ELIKGEDSRFIHLKDPFIYDSYNGEKYLLFCTHPYNWTSSNTGYMIRRGEKLNFEAPVF
FT                   YFFEKGHTWDIAMTRGTCIIDMPQVGVLKNKRISLFFYDGGECVRNLDEHEKAVKRPRG
FT                   YSCEELGGAAYIENGSFAHIERISKELPLFVSPYGTGCSRYVDVLRTKDGMYATWQQSQ
FT                   DNKSQPLVMNFLSNDEIADILQ"
FT   gene            505259..506029
FT                   /locus_tag="Bmur_0403"
FT   CDS_pept        505259..506029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0403"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bhy:BHWA1_00318 taurine ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70506"
FT                   /db_xref="GOA:D5U615"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D5U615"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADG70506.1"
FT                   /translation="MNSKPMGNKKYIFTALSIIIALLIWQFVSSSDAGAVIASPADVFK
FT                   SFIKEITNGKLLHHIAISLFRVLSGFALAFIVSIPIAFLMGWYQPIQLLIEPIIQFLRN
FT                   IPALAYIPLVVVAQGVGESAKITVIFISTFLVMIITVYQGVKEVDPTLIKAARVLGAKD
FT                   KDIFLKVVIPASVPYILVGMRLGLGASLTTLIAAELTGSNAGLGQMIQEASLYFRMDIV
FT                   MLGIILIGITGLVLNLIVSIIENKLTIWQEKKKR"
FT   sig_peptide     505259..505360
FT                   /locus_tag="Bmur_0403"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.472 at
FT                   residue 34"
FT   gene            506056..506841
FT                   /locus_tag="Bmur_0404"
FT   CDS_pept        506056..506841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0404"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bhy:BHWA1_00319 ABC transporter; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70507"
FT                   /db_xref="GOA:D5U616"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5U616"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG70507.1"
FT                   /translation="MIDKEVKVKISNVSKIYKGTNKDVHALDNVNLDIYKNEFVCVIGS
FT                   SGCGKSTLLNILAGLDTPNSGTIEIDGKAIEGTGVDRGVVFQQYALFPWLTVAKNVAFG
FT                   LELQKKSKDEINKTVDHYLKAVGLIDFKNSYPKELSGGMKQRVAIARAYAVNPNILLMD
FT                   EPFGALDAQTRAQLQTELLNTWDNEKKTCFFITHDVDEAVFLAQRVVIMSPRPGRIKAI
FT                   VEVPIPYPRVPETKLSKEFNDIKNELWQLVYQEYLETKK"
FT   gene            506904..507899
FT                   /locus_tag="Bmur_0405"
FT   CDS_pept        506904..507899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0405"
FT                   /product="aliphatic sulfonates family ABC transporter,
FT                   periplasmic ligand-binding protein"
FT                   /note="KEGG: bhy:BHWA1_00321 ABC-type
FT                   nitrate/sulfonate/bicarbonate transport system; TIGRFAM:
FT                   aliphatic sulfonates family ABC transporter, periplsmic
FT                   ligand-binding protein; PFAM: NMT1/THI5 like domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70508"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:D5U617"
FT                   /inference="protein motif:TFAM:TIGR01728"
FT                   /protein_id="ADG70508.1"
FT                   /translation="MKKIILFIFIMAFAVSCSGNKTSGENSSSADKIRVAYLADFAGTS
FT                   AAAIAQEKGFFKEENLDVELVKFLNGPSEIAAMLSKDIQFAYIGHGAHSLAIQGKVNVL
FT                   IPNALGKSEQIIVGKWANVNDVAGLKGKTVGTQLGTSGDIVLDIALRKSGITKSDVNVV
FT                   NMDVSGIVSSMVGKKVDAVSVWAPYTFEISKQLGDEVFVIASITNYLDEAVFPSSWIVT
FT                   PEYQKDNPDIVNRFTKAILKAMDYRSANMDESIEIVAKLNGTPIDSVALEEETAIWLTS
FT                   DDVKKAYSDGDAAKWYEAQQKIFINSGVVTDEVDVNNYVQIKYMNDNVLK"
FT   sig_peptide     506904..506963
FT                   /locus_tag="Bmur_0405"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.771) with cleavage site probability 0.404 at
FT                   residue 20"
FT   gene            508054..509058
FT                   /locus_tag="Bmur_0406"
FT   CDS_pept        508054..509058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0406"
FT                   /product="NMT1/THI5 like domain protein"
FT                   /note="PFAM: NMT1/THI5 like domain protein; KEGG:
FT                   bhy:BHWA1_00322 ABC-type nitrate/sulfonate/bicarbonate
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70509"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:D5U618"
FT                   /inference="protein motif:PFAM:PF09084"
FT                   /protein_id="ADG70509.1"
FT                   /translation="MYKKKIVLLLTLLTVLLISCSNGGKETEVKKTAKIRVGYMPDFSG
FT                   TSAVAIALEKGFFEEENLDVSLIRFLDGPSEIDAMLLNNLEFAYIGHGAHTLAIYGKVN
FT                   VLFPNSLSKSEQIIARAQSQINTVSDLRGKTVGTQFGTSSEILLDLALRTLGIDRAELN
FT                   IVNMDGPTIVSSISNKEIDAAAVQAPYTFNILKNLGNDVKTIATTIDYSDVGAFPSSWI
FT                   VTPEYQAKNPDIVNRFSRAILKAMNYRSNNMDEAVEIVAKQNNTDTDSVNLEKETAVWL
FT                   SGMDIQNAYLDGTASKWYKLQQNIFIYTKAITNSADINSYVQIKYMNDNIFNK"
FT   sig_peptide     508054..508125
FT                   /locus_tag="Bmur_0406"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.541 at
FT                   residue 24"
FT   gene            509151..510344
FT                   /locus_tag="Bmur_0407"
FT   CDS_pept        509151..510344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0407"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: bhy:BHWA1_00324
FT                   putative transcriptional repressor of the xylose operon"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70510"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5U619"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ADG70510.1"
FT                   /translation="MKRLKAKNLKEQNYIDIVKLLKIGNYSRADLAYNLELSKASISVL
FT                   VEDLINMGIVYEKCGGQSSSLGGKKPILLDINKNIGYFLAVHFRRELCHIAIVNLENEI
FT                   VYEYKMEAVINKDYKITFNPIIKKIKDIMSKHKDKKIFSLGISVPGKTGKKNNLLIDCM
FT                   GIPEWKNIPLKEYIEKNINIEVIIDRYACAMLTYNILEEMKKYMPIQTSSVYVYLSNWL
FT                   GVSVSNNGKILYGTHDTAANYSHTIVTDSNYICSCGKKGCWESVASIKAFMKELQNKSD
FT                   KYKDLTFDDIITNYKNDEMVIDTYKNFLAYWVSIGIYNIVNTFDPEIIFIGGEMLYLGN
FT                   DFINEIKNNIKNKFNSYNFLTEIKIIENFKKIEIHAAASIAIYDFYNNSLYKHISAK"
FT   gene            complement(510333..511262)
FT                   /locus_tag="Bmur_0408"
FT   CDS_pept        complement(510333..511262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0408"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /note="KEGG: bhy:BHWA1_00311 UDP-N-
FT                   acetylenolpyruvoylglucosamine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70511"
FT                   /db_xref="GOA:D5U620"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:D5U620"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00311"
FT                   /protein_id="ADG70511.1"
FT                   /translation="MTMQDNYKIVESFLEEKNIEYYKNHPFSKCCSFNVGGNIDLYIAV
FT                   KKIQDFLDIANFLYNKKIDYFVIGDTSKVIVSDKGYNGIIVSLEGEFEFFEFLEDGVLK
FT                   SNSSAILERLSHEARIRNLSGLEFVALVNTRIGAAIYDKLESFGISLLKFLESVKIFNK
FT                   KDCSVLELSKDEYLNLTEEDRKFIVILSAVFKLDNDLPESIDNRIDWFRYIRGSVAPME
FT                   ANIGPVFEDSNDIKAYEMVERVGGLDMKFGAMRWHKRFPNYIINEHLYNENEEPSKAED
FT                   VINLIEDTRKKIEQHYAFNPQINIILLS"
FT   gene            complement(511231..512619)
FT                   /locus_tag="Bmur_0409"
FT   CDS_pept        complement(511231..512619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0409"
FT                   /product="UDP-N-acetylmuramate/alanine ligase"
FT                   /note="KEGG: bhy:BHWA1_00310 UDP-N-acetylmuramate--alanine
FT                   ligase; TIGRFAM: UDP-N-acetylmuramate/alanine ligase; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein; Mur
FT                   ligase middle domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70512"
FT                   /db_xref="GOA:D5U621"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D5U621"
FT                   /inference="protein motif:TFAM:TIGR01082"
FT                   /protein_id="ADG70512.1"
FT                   /translation="MFTKRKEKIHFIGIGGIGMSAIASVLNAIGFTITGSDLAKTAKTE
FT                   SLEKSGIKVYYGHHASNIEDDITAVVTSSAISPANEEIVAAKAKKITVISRGEMLAELM
FT                   RLRYGIAISGSHGKTTTTSLISQIMMHAGLNPVCIIGGNHFNLKSNAVCNDLSSEYMVC
FT                   EADESDGSFLRLSPVINVVTNIDNDHLDYYGNVEALRVAFLEFINKVPFYGCSFLCFEN
FT                   DVVRDLSKSANKKYYSYGFDKSYDFHVDKDSIRVEAPITYFIAYHNKECLGEFSVPLIG
FT                   EHNILNSLASIGVAYHLGIDVPNIKEGLKTFEGVGRRLNKLYDKEITLFDDYAHHPTEI
FT                   KATLSSVRNAYKSRRIIAVFQPHRYSRTELLLNDFEYAFNDADEVIITDIYAAGEAPIA
FT                   GVNGEIICDIVKKQNKNVRYIKNIDEVLPVLESIKKDGDIIITLGAGNIVRVSNDYARQ
FT                   LQDS"
FT   gene            complement(512676..513749)
FT                   /locus_tag="Bmur_0410"
FT   CDS_pept        complement(512676..513749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0410"
FT                   /product="Undecaprenyldiphospho-muramoylpentapeptidebeta-N-acetylglucosaminyltransferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="KEGG: bhy:BHWA1_00309 N-acetylglucosaminyl
FT                   transferase; PFAM: Glycosyltransferase 28 domain; glycosyl
FT                   transferase family 28"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70513"
FT                   /db_xref="GOA:D5U622"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:D5U622"
FT                   /inference="protein motif:PRIAM:2.4.1.227"
FT                   /protein_id="ADG70513.1"
FT                   /translation="MNIILCGGGTAGHITPAISIYDYVKHQGHKPRLVVAQKDYHLIPH
FT                   NYDFNTININPPGNFWKKILFILRFIPALMKSSKIIKRHKPDCIIGMGGFVSLPMLYAA
FT                   KWNNIPIFLCEQNSIPGKVNRIFYKYAKQTYLTFSKTLEFMPKGKVFGNPVRNDFFVVN
FT                   REGARTVMKLSNDDKLLVVMGGSQGALKLNELFFECIKDIKDKVKNVRIEWLAGPKWAS
FT                   GIIEKVNNAKFDNVFVHSYYKDMATLLHAADFVISRAGSSSISEILAVNVPSLLIPFPY
FT                   ATDNHQYFNALDLLDKDMAYLIEESDLNREKLESVVVNNLNNDERLKAMREKIRSSWSS
FT                   RAVSSIVDDIMSNLKNK"
FT   gene            complement(513746..514840)
FT                   /locus_tag="Bmur_0411"
FT   CDS_pept        complement(513746..514840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0411"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein; KEGG: bhy:BHWA1_00308
FT                   putative cell cycle protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70514"
FT                   /db_xref="GOA:D5U623"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:D5U623"
FT                   /inference="protein motif:PFAM:PF01098"
FT                   /protein_id="ADG70514.1"
FT                   /translation="MIKRKLMPDRYLLIIYIALLIAGLVAIYGAQTIHEPNGGYFDNHL
FT                   KLLSLMLLATLIILILPDFFGFLDKMVPFLLLFTLLLLIWVYFFGITVAGSYAKRWLLL
FT                   PSGITIQPSEIAKITSSIYFASVLSKKGDKLFDIKKGLFPPLLILCLISGLILIEPDSG
FT                   TALLFAMVGFSIFFYGGIPFRSLLFSAVFLALIFGLFIFNVPYMRSRVNSYLDPQSQSE
FT                   EDIYQIRRAKLAFNYGGITGIPDEEIRDVSTHLPAALTDFIYASVSQRYGLVGNLIILL
FT                   LFLSFTIRGFIISSRTNDLFLKNLSFAITMFISVQAYLNIMVATLMIPTTGMPLPIISY
FT                   GRNALVVNMIMVAILLKITQRSEK"
FT   gene            complement(514867..515751)
FT                   /locus_tag="Bmur_0412"
FT   CDS_pept        complement(514867..515751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0412"
FT                   /product="toxin A"
FT                   /note="KEGG: bhy:BHWA1_00307 toxin A"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70515"
FT                   /db_xref="GOA:D5U624"
FT                   /db_xref="UniProtKB/TrEMBL:D5U624"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00307"
FT                   /protein_id="ADG70515.1"
FT                   /translation="MKKINIIIVMICLYPSLVFADITTLFNMDIYERELSVNTNTGIYS
FT                   NELFIEQTALGGFNHIKFNLETRLYYRLYMYKNATNFLFKGTKADFGVENNFSLSSDMI
FT                   GVFADIRPLSFFGVRISGYADFMFNIMNFGYAGFDSKDVSYSFDELYAMKKGNAFGYII
FT                   NIAPYFIFKFNNFVLINNLNISYVNVGDKEYYYDPRTAVLHKKSEFELINDFFLLGRIS
FT                   LFYIGGYYGLTYLINSKHLSHKLGIAAMVNFKFLKERLLFNIGASAGLHVGLPYYNNDT
FT                   FIELKMSLAYKIL"
FT   sig_peptide     complement(515689..515751)
FT                   /locus_tag="Bmur_0412"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.993 at
FT                   residue 21"
FT   gene            515900..516928
FT                   /locus_tag="Bmur_0413"
FT   CDS_pept        515900..516928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0413"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; CBS domain containing protein; KEGG:
FT                   bhy:BHWA1_00306 GGDEF domain protein; SMART: GGDEF domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70516"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D5U625"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADG70516.1"
FT                   /translation="MYRSIIKSIMENRIGVIKKDSNLLELVSIASKSSNKILAVVNDSD
FT                   KIVGVINCDNILVNVLKDISKKSSKNAVINKEVSAFMNKNLIIAHPEDDILMTFDIMKD
FT                   NKIDYLVIINSDNYPIGVVNIYDLFENVIKIKIRNISFSVNEIEKKSSIEKDKVIKKLM
FT                   KEIDTLHAQSTIDPLTGLFNVRYFNKVIEEEVDRAKRYKYSISIIFMDLDHFKDINDIY
FT                   GHDCGNLVLHEIGKLLSNASDNNIHMLRKSDVAIRYGGEEFIVICPNTKKEQAYIVAER
FT                   IRKTVEKKRFNYESTIINVTVSVGIAEHKGTSKKPIAETIKNADSAMYEAKHLGRNKVI
FT                   MH"
FT   gene            complement(517161..518168)
FT                   /locus_tag="Bmur_0414"
FT   CDS_pept        complement(517161..518168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0414"
FT                   /product="phosphate acetyltransferase"
FT                   /EC_number="2.3.1.8"
FT                   /note="TIGRFAM: phosphate acetyltransferase; KEGG:
FT                   bhy:BHWA1_00305 phosphotransacetylase; PFAM: phosphate
FT                   acetyl/butaryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70517"
FT                   /db_xref="GOA:D5U626"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:D5U626"
FT                   /inference="protein motif:TFAM:TIGR00651"
FT                   /protein_id="ADG70517.1"
FT                   /translation="MASFMDNLREKVKSNPKTIILAEGYDERHVKAAVILKKEQLVKGV
FT                   ILVGDTSKIEALAKENALELDGNFAKIFDPNKDAKTESYIEMLFKAREKKGMTKDQAKD
FT                   LIINNSVYTGAAMLASNDADGMVGGAVYATGEMLRAALFLIGLKKGIKTLSSTFFIESP
FT                   DKSLFTNGIACFADCAVIPDPTSEQLADIAESTAESYRVMTGLEPKVALLSFSTKGSAK
FT                   HESVDKVIEAKKILDSRNVKFDYDGEMQFDAAIVEKVGAQKAPNSPIKGNANVLVFPEL
FT                   NAGNIGYKIAQRVGKCTAIGPMLQGIAKPANDLSRGCSAQDIADLAVLTSLQAM"
FT   gene            complement(518343..519113)
FT                   /locus_tag="Bmur_0415"
FT   CDS_pept        complement(518343..519113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0415"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: bhy:BHWA1_01124 conserved hypothetical
FT                   protein containing a ferredoxin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70518"
FT                   /db_xref="GOA:D5U627"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D5U627"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ADG70518.1"
FT                   /translation="MKVYEIFFSPTGGTKKAADAVAEEIVNNIDSSILEKVDLTDYNFD
FT                   FSSLKIDKDDIAVIAVPAYAGRVPSTASKRILQIQGNNAKAVIICTYGNRAYDDTMIEL
FT                   YDIVSSLNFKIVSAAAAVARHSIAIKYASNRPDENDIKKLKEFAYNTIKASSFLDDNKL
FT                   NGNRPYKKMSNVPLVPKTSSKCTNCKLCAKKCPVQAIDINNPKIIDKTKCISCMRCVHI
FT                   CHCSAKSVNKFMLFLVNLALKKTCSKAKDYEFYI"
FT   gene            complement(519251..520393)
FT                   /locus_tag="Bmur_0416"
FT   CDS_pept        complement(519251..520393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0416"
FT                   /product="Glycine amidinotransferase"
FT                   /EC_number="2.1.4.1"
FT                   /note="KEGG: pac:PPA0632 glycine amidinotransferase; PFAM:
FT                   amidinotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70519"
FT                   /db_xref="GOA:D5U628"
FT                   /db_xref="InterPro:IPR033195"
FT                   /db_xref="UniProtKB/TrEMBL:D5U628"
FT                   /inference="protein motif:PRIAM:2.1.4.1"
FT                   /protein_id="ADG70519.1"
FT                   /translation="MKIVNSWNDFDPLKHVIVGRADNCCIAPSEPASKAKVPLNSPMRG
FT                   MTGPRPLDTVEKANAQLDNLCKILEQHGVKVDRPTPLQWNQAVVTPHFMTGSMFGCMPP
FT                   RDVLLTIGNDIIAAPMSFRSRYFEYLAYSPILRKYFDEDPDFRWISAPRPELGDASYDM
FT                   HYFDGDVTEEVLLERTAKLHMVTTEHEILFDAADVMRLGKDLFCQHGLTTNRKAMEWLR
FT                   RQYPDFRVHAVNFPGDPYPIHIDATFVPLRPGLIINNPTRKLPEEQRKIFEANGWEIVD
FT                   AAQPAHETPPPLCYSSVWLSMNCLVLDHKTVLVEASEVHQLEQMDKLGMNVIPVPFRDA
FT                   YPFGGGLHCATADVYREGSCEDYFPKQVEDPTLVTYKKWS"
FT   gene            complement(520713..521591)
FT                   /locus_tag="Bmur_0417"
FT   CDS_pept        complement(520713..521591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0417"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: bhy:BHWA1_00304 permease of the
FT                   drug/metabolite transporter (DMT)"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70520"
FT                   /db_xref="GOA:D5U629"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D5U629"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADG70520.1"
FT                   /translation="MANKERLGTIGIFLTALIWGYSFVAVKVVVQEIEPFYLVGFRNLA
FT                   GGIFLSLIFFKRMKKITKRDILLSIPVGAALFLGFFLQTMSSKFITASKVAFFTGSYVI
FT                   FIPFLAWALYKKRPHIAAFIAAVITVIGLYLLTSFDGLGSIKAGDLFALLCAVVFAVHL
FT                   ILIDKMLEYVDGIIMASLQLIVAGIISLSAGIITSTPFDINAVSKESMYSLIYLSIGAT
FT                   GIAYLLQTVSQKYVNPNKAGLILSLESFLGALGGIIFMKDPLTVNFVIGGICMISAIFI
FT                   CEIGSTIKKTD"
FT   gene            complement(521682..523316)
FT                   /locus_tag="Bmur_0418"
FT   CDS_pept        complement(521682..523316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0418"
FT                   /product="Ankyrin"
FT                   /note="PFAM: Ankyrin; KEGG: bhy:BHWA1_00303 ankyrin
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70521"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:D5U630"
FT                   /inference="protein motif:PFAM:PF00023"
FT                   /protein_id="ADG70521.1"
FT                   /translation="MREIEIELHEASARNNILAVEILLKNKDIDVNLSNILGLTPLTHA
FT                   CRAGYKEIVELLLDAGADVNKADQLYITPLMNACANGHRDIVNLLIKRGASVNLSNCNS
FT                   ETPLHYACSENHFDIIKILVENGADVNSKTDTNVTPLMYACQQSNFEAVKFLIDNNANV
FT                   DDSDIYEETVLSYAISSGNIDIVEYILNTNDIEIPKYSLTIAAISGNLSLVHYIHSKLG
FT                   GSKHNVFSSAFISAAYNGHLDVVRYFFDNSRKKAPKALAIAASAGHKDIVNYFLMNKVS
FT                   LDGVTDNGKSALISAIEIENKEIIDLLIKYGADVNKADDDDVTPLMYACYIGNIEIVKT
FT                   LLDNNADVDIYDSIDRNAVVHAIIAGNIDIVELLLMHGMSLNSAEGSITPLMWAVIYDN
FT                   LKSVKYLVEKGEDIEENDINGWNSFMFACAKGYIDIVKYIFQLSPDIINKKSKFDETPL
FT                   MIAADNGKLDIVEYLLKNNASVKDRNANGDTALYIASSNGYFEICEKLVEYYTINYPNN
FT                   VFEREYFIAKEKGYNTIADLFQSKLKS"
FT   gene            complement(523476..524843)
FT                   /locus_tag="Bmur_0419"
FT   CDS_pept        complement(523476..524843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0419"
FT                   /product="magnesium transporter"
FT                   /note="TIGRFAM: magnesium transporter; PFAM: MgtE integral
FT                   membrane region; MgtE intracellular region; CBS domain
FT                   containing protein; KEGG: bhy:BHWA1_00302 magnesium
FT                   transporter; SMART: CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70522"
FT                   /db_xref="GOA:D5U631"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:D5U631"
FT                   /inference="protein motif:TFAM:TIGR00400"
FT                   /protein_id="ADG70522.1"
FT                   /translation="MLKELLQPEIEDLIEEKDWEALRDILTLWQEVETANLITSLKNED
FT                   KYKVFSILPKDYYLGVFPELVPIDQQRIIENMPEADIKELLENMNPDDRTYFLESIPEE
FT                   MSENILKLLGSEEREIASWLLAYPEGSIGRLMTPEYISIKPNWTVGEAFEYIRSNIEDA
FT                   ETYTTIYVIDERRTLMGSITLRKLFFTDKNTLISEITSSCPYILVYEEQENAIEVIKKY
FT                   NLHSLAVIDDRHAMLGIVTVDDILDIAEEEYTDDFHKMAGITSSEDQFDDNLKITPITT
FT                   LYKQRILWLLILVFINIFSGGVIGIFQNTLQKHIVLVVFLPLLIGSGGNAGSQSATLVI
FT                   RSLAIGDVVLKDWFYMFSKELIVSFMLGLSMALGAYVLGIIRGGFEIAAIVGISMFSIV
FT                   FIGSIIGLCLPFILTKLNIDPAISGAPMLTSICDIIGTAIYCSIATLAFIILNNVN"
FT   gene            complement(524898..525566)
FT                   /locus_tag="Bmur_0420"
FT   CDS_pept        complement(524898..525566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0420"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00301 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70523"
FT                   /db_xref="UniProtKB/TrEMBL:D5U632"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00301"
FT                   /protein_id="ADG70523.1"
FT                   /translation="MKKIVLSLLFLTVSSFSLFAQHGGGVALFVPLTGSFAFADVRGLD
FT                   GSKLNILKTSSAFDFGVLVQPGYFYDFGGLLGFDVLADIGYYRSSYKYINTQDANVVSY
FT                   TFDSLNTGFMFRVTALVLSLGIGTGVKIPLAANIQDADYGVKLNRTEIENSFETAVIPY
FT                   LKFTIDFKYNLSSFAAVAAGLYFNYDFAMNYKNPNYSKYNIHSFDFGIQVGTYLVGTRY
FT                   "
FT   sig_peptide     complement(525504..525566)
FT                   /locus_tag="Bmur_0420"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 21"
FT   gene            525730..527889
FT                   /locus_tag="Bmur_0421"
FT   CDS_pept        525730..527889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0421"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00717 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70524"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:D5U633"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00717"
FT                   /protein_id="ADG70524.1"
FT                   /translation="MILNLNKFGKFKNKSFEISDKLTLFYGENESGKTTIFDSLMLLFS
FT                   ENKKTSAFAKQIKSRYGDDIDINIIPEIDPSKKMHPQSYNNLYSIRQSEIIFEMSDSKK
FT                   DSKDWESEIKKKLFASDIDVGKIISEVKAEYSGKSQSAIPAQLKNLKYRNEEIREELDN
FT                   LYNKANTEVSKKDKLKELHELLKESDNIIKEKVNEYNKLNSLREEKNKSKEKNAALNIL
FT                   TMINDFYKKDKFIKENLNLKNDHSKTINDMEKKIDECKNNIAYIKGKIEPLQKSTEEKK
FT                   KTDYESIRLRIDKAVKKIDVLREKNNKIPKIVFLSAVILVSSLLSLYFKNPYWFLIILP
FT                   SIPFMFIKEGKNEKFINDILDSLPELDINTDNLELSSLKDILNKELAKIEIILSNDDEE
FT                   ELNNYKKQLEETIINLENYNNELNSFFDKLNVKNKENYYEIKTNFDNVYKNTEELFAKL
FT                   ITEAKKFGLKDIPTLEANCNRILKELDDKGINPDSFNEMEMKAIENKLKELEKEINTIK
FT                   ENMNKVISNASYIKGELNSTDNIHDSIINFESELAENNEEIKNLNKRKKALELLENMLS
FT                   EINKKNDDIFNSLSNEAKVLYNHITGKSLSDNGIEMSGFDKSKIIVKDKQNESRNVELL
FT                   SSATKDAVYIAMRLSILTKIHEAGRLILLDDPFITFDNNRTKEALSFIREYTNKYNIPI
FT                   AIFTKDVFIRDIMKDYKEAVIHELS"
FT   gene            528000..529367
FT                   /locus_tag="Bmur_0422"
FT   CDS_pept        528000..529367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0422"
FT                   /product="protein of unknown function DUF88"
FT                   /note="PFAM: protein of unknown function DUF88; KEGG:
FT                   bhy:BHWA1_00718 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70525"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:D5U634"
FT                   /inference="protein motif:PFAM:PF01936"
FT                   /protein_id="ADG70525.1"
FT                   /translation="MKKIGIYIDLENIRYLDFHVNLKSMLKNILDYYKEQLKDEDIVFS
FT                   IKKAYGDSKSIKKYAKHLRDLHIDIIHSVPFKKAKNMADMKSSLDAFEDFIIYKKIDII
FT                   IFVTKDVDYSIVMDKLMRHGCIVSMVTTSDNFEKNIFQNACCHDPFKIEKYRDNAVKEN
FT                   NSEIRIDNKNKKKANENKSSEITKETITIIENNKKNKESKKRRKNNENKNEKNKYKQNE
FT                   EIIKNELQNKEIENNINNLENRDENIEQNNYNKENKVIEEKDFWQCFSDEIKDFYDKNK
FT                   NLEISKSYICNKINDKLCQKGESALKLAGYQNINEVIDFLNKNEIKTTSNNSSFTIEET
FT                   IKSFENKMNDNILNKNEINYTDEINDKNFIYVLKKVLSEDKENKAITLSSVMKKINKEF
FT                   NMASGQSAVKHTKFKNIKEIILKIGKSAELTEQGRKFIIKDKDKILETLEDIAKEL"
FT   gene            529398..530261
FT                   /locus_tag="Bmur_0423"
FT   CDS_pept        529398..530261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0423"
FT                   /product="Prephenate dehydrogenase"
FT                   /note="PFAM: Prephenate dehydrogenase; KEGG:
FT                   bhy:BHWA1_00719 prephenate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70526"
FT                   /db_xref="GOA:D5U635"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5U635"
FT                   /inference="protein motif:PFAM:PF02153"
FT                   /protein_id="ADG70526.1"
FT                   /translation="MSNITVIGMGLMGGSLIKALKASGENYNIYAIDTNKENIESALKD
FT                   GYIDKGSCNYDNIKEYIEWADIIMICTLPSIAIDIICKYKHLIDNKKILSDFCGVKTDI
FT                   FNNTKDKKYIGLHTMAGKEKGGYQNSSETLFKNSNAIIVKNDNANENDIKIIEKLAYDI
FT                   GSGKVITSTAKKHDEMIAFTSQLMHIIACGIVNHDNFLASLGFEGNSLADHTRVGTIDA
FT                   NMWSELFLYNSEYLYEELDKYIKCLEDFQNALNNKDREKLKNLMNNSNNIKNEWIIRKN
FT                   TKNNIN"
FT   gene            530529..532526
FT                   /locus_tag="Bmur_0424"
FT   CDS_pept        530529..532526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0424"
FT                   /product="VacB and RNase II family 3'-5' exoribonuclease"
FT                   /EC_number="3.1.13.1"
FT                   /note="TIGRFAM: VacB and RNase II family 3'-5'
FT                   exoribonuclease; KEGG: bhy:BHWA1_00659 VacB,
FT                   exoribonuclease R; PFAM: ribonuclease II; RNA binding S1
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70527"
FT                   /db_xref="GOA:D5U636"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D5U636"
FT                   /inference="protein motif:TFAM:TIGR00358"
FT                   /protein_id="ADG70527.1"
FT                   /translation="MKVIKLLKRINKEKELDISVYKNKYVETKKDKLRFEKMLQKSVSM
FT                   GLVMKKSNILKLTNEGKVYLEKELRRSSEKANNISENKRDRRNSKNKKSDTGNKKTSIP
FT                   KPEIKVDINNAKKDAEIIAKAYNVPTDFPKKCLEEAKLLPDSMENVELEFDRIDLRNIR
FT                   TVTIDGADSKDFDDAISIEKLNDGYKLGIHIADVSHFVVMGSALDREARKRGNSVYLID
FT                   TVYPMFPHELSNGICSLNEGVSRFTMTVFVTIDNNGNVKESTFHKSVIKSDRRLTYDYA
FT                   QDVLDGIEQDEDWLIELLKNADDVKKILLQKRIENGSIEFNLNETQIILDKGGNPKDFF
FT                   IGERKETHKIIEELMLIANCEVAKRLKNIKGSIYRVHDSPDIEKLDTFTRIAFNRGYRL
FT                   TKDADGNLDFHSFIESIMGKPDEKLLLTLLLRSMKQAIYDVNNIGHFGLGFEYYTHFTS
FT                   PIRRYTDLLTHRLLKLSLEGINNLKPTMQQFYTNSAEWCSKTERVAVECERSLAKVKAA
FT                   RFMKDKVGNEYNGIISGITNFGIFVEIEDRGIEGLIRYAVLKSRYRYDENEQAAYSEED
FT                   AKWYTLGDRIRIVVYKVDIRELFIDFIPASEFDNSFDDRDIIDSRDFIKNKKNKKEIYS
FT                   RKYNKSSKDRKRGAKDRRDRKERKKSKKRR"
FT   gene            complement(532945..533676)
FT                   /locus_tag="Bmur_0425"
FT   CDS_pept        complement(532945..533676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0425"
FT                   /product="signal peptidase I"
FT                   /note="KEGG: bhy:BHWA1_00773 putative signal peptidase I;
FT                   TIGRFAM: signal peptidase I; PFAM: Peptidase S24/S26A/S26B,
FT                   conserved region"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70528"
FT                   /db_xref="GOA:D5U637"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:D5U637"
FT                   /inference="protein motif:TFAM:TIGR02227"
FT                   /protein_id="ADG70528.1"
FT                   /translation="MNYSYDREELKKEKRNALKAILKPFIFIYYRSNSLLYRAAARLVL
FT                   GFIIAFVLFGILTLFIRFDRMKSSTMMNTIEPNEIVITSKLRYAVSLSPFVSSLTGKTV
FT                   IFSRPKRGDIVFMIDPRTKREFFLKRFASYFVYFATFGNVNISKTRYLIKRIIGLPNET
FT                   IEIKNKTVYINGEMLNEPWANIDSDSRILDKEVSTRDNFGPHIIGYNEYFVMSDNRDYG
FT                   YDSRDFGNVHFSNIDGKVISK"
FT   gene            complement(533704..534024)
FT                   /locus_tag="Bmur_0426"
FT   CDS_pept        complement(533704..534024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0426"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /note="KEGG: bhy:BHWA1_00774 putative Glu-tRNA(Gln)
FT                   amidotransferase, C subunit; TIGRFAM: glutamyl-tRNA(Gln)
FT                   amidotransferase, C subunit; PFAM: Glu-tRNAGln
FT                   amidotransferase C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70529"
FT                   /db_xref="GOA:D5U638"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:D5U638"
FT                   /inference="protein motif:TFAM:TIGR00135"
FT                   /protein_id="ADG70529.1"
FT                   /translation="MTTDREELEALLYQTRLRIEENQKDEVLDRLNKDLKFIEELFEVN
FT                   VDGIDPLYHVIDLPEYLREDVAGKTLDNEVIMNLCRSGEYGYIVVPAVPAALENSEHQA
FT                   KK"
FT   gene            complement(534142..534768)
FT                   /locus_tag="Bmur_0427"
FT   CDS_pept        complement(534142..534768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0427"
FT                   /product="sugar isomerase (SIS)"
FT                   /note="PFAM: sugar isomerase (SIS); KEGG: bhy:BHWA1_00296
FT                   phosphoheptose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70530"
FT                   /db_xref="GOA:D5U639"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:D5U639"
FT                   /inference="protein motif:PFAM:PF01380"
FT                   /protein_id="ADG70530.1"
FT                   /translation="MIEDLIKRLPKLEGIKKDIENAINETINAYERGNKVLIAGNGGSA
FT                   CDSEHIAGELLKSFLKKRPINEDIRKELLKIEDGEYIADNLESPLRAVALTSHLGLSSA
FT                   YLNDKEPYLVFAQQLLGFGDKGDIFFAISTSGNAKNIIYAAKLAKAMGIKVVSFTNENG
FT                   GKLALMADIAIKAPAKETHISQEYHEAIYHEICIRVEEHFFKENR"
FT   gene            complement(534802..535470)
FT                   /locus_tag="Bmur_0428"
FT   CDS_pept        complement(534802..535470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0428"
FT                   /product="Ankyrin"
FT                   /note="PFAM: Ankyrin; KEGG: bhy:BHWA1_00295 ankyrin
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70531"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:D5U640"
FT                   /inference="protein motif:PFAM:PF00023"
FT                   /protein_id="ADG70531.1"
FT                   /translation="MKKLFFIFLIFILIFNAAYTLTDNETSFLKSCEEGKYERVVSLIN
FT                   KKVNVNTVSEDGVTGLMLAAHHGHSAIARLLVNSNADVNIADKVGYTALIMASTGGYTD
FT                   IVKILLKAGADVNAANTYGETALHISSHKLYADIVQTLIDYKVNINAVNNDGDNALIMV
FT                   FMSADKSENMIPVARLLCDNGIDVNFRDKKGRTALTYVKENYKKADTLIAFLNEYGALE
FT                   "
FT   sig_peptide     complement(535408..535470)
FT                   /locus_tag="Bmur_0428"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.884) with cleavage site probability 0.496 at
FT                   residue 21"
FT   gene            complement(535593..536321)
FT                   /locus_tag="Bmur_0429"
FT   CDS_pept        complement(535593..536321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0429"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bhy:BHWA1_00294 3-ketoacyl-(acyl-carrier- protein)
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70532"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5U641"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADG70532.1"
FT                   /translation="MKNKSILVTGASGSIGLAISKKIISSGYDTIMCYNKNDSFIDDIK
FT                   TYSKDYDVNIRFLKIDVSNIEETKNILLKDIEENGAYYGAVLSSGITMDNAFPAMTPEE
FT                   WDKVIDVNLKSFYNIVSPIIMPMIRLKKGGRIIAISSVSGIIGNRGQVNYAASKAGLIG
FT                   AVKSLAIELGKRNITVNCIAPGIIESDMINDDIIEHAKNMIALKRIGKPEDVANAVNFL
FT                   LSEEANYITKQVISVDGGMF"
FT   gene            complement(536354..536851)
FT                   /locus_tag="Bmur_0430"
FT   CDS_pept        complement(536354..536851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0430"
FT                   /product="FabA FabZ, FabA/Z, beta-hydroxyacyl-acyl carrier
FT                   protein (ACP)-dehydratase"
FT                   /note="KEGG: bhy:BHWA1_00293 FabA FabZ, FabA/Z, beta-
FT                   hydroxyacyl-acyl carrier protein (ACP)-dehydratases"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70533"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D5U642"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00293"
FT                   /protein_id="ADG70533.1"
FT                   /translation="MENKYKLNIPHKGRMLLIDGIIDINFDDNEILTFSQIKKDNIFYD
FT                   NSENEGIDSYIFTEYAAQTAAAYNGALENSADNNRIGFLLNIKKADCYIDKVKSENKVY
FT                   IFVKETLKDGSIAYYNGDVIICNDDIKSIEEYKNIINSYNVKKVMDCSIMVMESSSENF
FT                   VF"
FT   gene            complement(536883..538055)
FT                   /locus_tag="Bmur_0431"
FT   CDS_pept        complement(536883..538055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0431"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: Beta-ketoacyl synthase; KEGG: bhy:BHWA1_00292
FT                   3-oxoacyl-(acyl carrier protein) synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70534"
FT                   /db_xref="GOA:D5U643"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:D5U643"
FT                   /inference="protein motif:PFAM:PF02801"
FT                   /protein_id="ADG70534.1"
FT                   /translation="MSNILLDFGIINCLARDKEELYNKYFIKGEYGLKENNDYNKKFFL
FT                   GKIDNDFFNFKLEDPYNNKINKMALHAVNQLKPIIDEAKKRYKKNRISVIVGTCENGSD
FT                   ETKDYILKGSVSDERRILVMQSLNICCDFLQKYFDVSGPSFTISTACTSSANAVIAADE
FT                   LIRSNIIDVAIVGGADVVTDTVVYGFDSLEVVSYNKTNSFSKNRSGINLGEGAAFTVLA
FT                   RENFIDSKDAIYLKGYNSNSDSHHMTSPDIDGSTTSKCINDSLKHASMNINNIDYINLH
FT                   GTGTLINDKMESTTLNRVNASDIWCSSSKTSFGHTVGAAGAMELGVCFITLSSMNKEKI
FT                   LPPHLYDGVYDDTLERIKLVNGKVVSDRLENCMSVSFGFGGSNTCLIVGK"
FT   gene            complement(538138..540417)
FT                   /locus_tag="Bmur_0432"
FT   CDS_pept        complement(538138..540417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0432"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00291 hypothetical hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70535"
FT                   /db_xref="GOA:D5U644"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="UniProtKB/TrEMBL:D5U644"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00291"
FT                   /protein_id="ADG70535.1"
FT                   /translation="MKRSKLLIVLWIFFHLSALILFIARYDKTAKIDTNFLSITPKFLE
FT                   DKDFQKPLEDFFLKNSSSIKIFIESDNFDNAKNSALKLEEYINNLDSNVLVNLYSRDYD
FT                   DILNIMIKYKYQLLSKEIRDYLLNDEAYIVAENSIINFYSPFFIPIADNIEDDPFFVLN
FT                   SKINEILVSENNIQSRDGIQFVNYNNKYNILINIDMPKKIDSESFFNNLTVFLNDLSVS
FT                   DDVKTYISGVPIHTYYSQKSAKKEITIISIVSLIVICMMFIFIFKSVKPYIISMCTIFI
FT                   AGAAAFLYSSVFFNSIHIFTFVFGTSLIGISIDHSIHFITEWYNEKDKKEVLKKIFPSM
FT                   LLGFLTTIISYLSLFLTSLTLLKQIALFSIFGLISSFLTVNIIYPIIFKNDKRNIKQSV
FT                   LLGSRNILNEYIKIINIKTVSIIFVIVIILSIIFIPRIKVNFSANQLYDTPDFLLESES
FT                   EVYKRLNTSLAKNIIISSGETLSEALEAEESIESYFTNNYNAISRILYSEKKQRENIKL
FT                   TEEKLMPLLREQIKELNLDESSFNKIKAEFESIKNDVLDINSIIESDSFSELKKIITTN
FT                   NNKYFIIATSDYDTNNTIKITNNNVKVFNLNEEINDALDSTAKTAVKMALIAYILIFIA
FT                   MSIFFNNKQAAAIILVQLMSVLINLSIHSIFGININIFSIFALILSIGISIDYAIFFSN
FT                   SAADKEITFLAVFLSMMTTVLSFGTLAFSSFIPVKSFGLFLFIGVLSSFLISPVLFKFN
FT                   RLIEKV"
FT   gene            complement(540404..540982)
FT                   /locus_tag="Bmur_0433"
FT   CDS_pept        complement(540404..540982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0433"
FT                   /product="outer membrane lipoprotein carrier protein LolA"
FT                   /note="PFAM: outer membrane lipoprotein carrier protein
FT                   LolA; KEGG: bhy:BHWA1_00290 outer membrane lipoprotein
FT                   carrier protein LolA"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70536"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:D5U645"
FT                   /inference="protein motif:PFAM:PF03548"
FT                   /protein_id="ADG70536.1"
FT                   /translation="MKQFCLLMILSLSSLLFGQVKDEYKNAKLLKGTYTQIVSQKGRSF
FT                   ESSGDFIVASGYGICWITKLPKESITVMGEKNVVQILPNGKKKVMADSGNAMFSQIANI
FT                   IKSIFTYDEKTILESFNQSKENNATVYTPKTEELKKIIEKIEVSFAKDGYIEKIKMYSS
FT                   NNSTTEYIMKVVSKSNTLTSEEIKYFEEE"
FT   sig_peptide     complement(540926..540982)
FT                   /locus_tag="Bmur_0433"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.966 at
FT                   residue 19"
FT   gene            complement(541064..541504)
FT                   /locus_tag="Bmur_0434"
FT   CDS_pept        complement(541064..541504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0434"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   bhy:BHWA1_00289 esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70537"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D5U646"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ADG70537.1"
FT                   /translation="MKKRTDNKKVYLENDYYIKPSFYDLDPMGVVWHGNYIKFMEQARE
FT                   AMLSIIDYDYDIMTAKGVMWPIVKLEIKYINSIKLNQRVRIHTEITEYLNGMKTEYTFY
FT                   DENDKIISKSSTLQMPIDSETRKGFLNSPKDFIERIEKLNKL"
FT   gene            complement(541508..542470)
FT                   /locus_tag="Bmur_0435"
FT   CDS_pept        complement(541508..542470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0435"
FT                   /product="lipid A biosynthesis acyltransferase"
FT                   /note="PFAM: lipid A biosynthesis acyltransferase; KEGG:
FT                   bhy:BHWA1_00288 glycosyl transferase, family 2; lipid A
FT                   biosynthesis acyltransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70538"
FT                   /db_xref="GOA:D5U647"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:D5U647"
FT                   /inference="protein motif:PFAM:PF03279"
FT                   /protein_id="ADG70538.1"
FT                   /translation="MSHWSEEKEIGTRWKVIFSAFVYKLLGRTFVIIYLIPVSIFYFFY
FT                   SKSRMKASREYLKRMSKYNKKVKSNLICSYRHLLSFVVSVSEKIAAWNGDIPIKDLIVK
FT                   TEDEYKKVIDLLNSKKGMIILFSHIGNIELLKALAVINEGNPIKNYKINIIIDSRVNKN
FT                   VNILIGEGKNNSFIDFIDASNIGPETILSIENKLDNGEIVAIAGDRTSNKTDRVNYIEF
FT                   LGEEAPFPCGAFLIPILLKYPVYYFFALRENDKILSKKYNFYIHSSKIKLDNTELKNRK
FT                   KKNETILDLTKEFASIIEKKAIEYPYQWYNFHDFWYKGN"
FT   gene            complement(542482..542826)
FT                   /locus_tag="Bmur_0436"
FT   CDS_pept        complement(542482..542826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0436"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase, FabA/FabZ"
FT                   /note="KEGG: bhy:BHWA1_00287 beta-hydroxyacyl-(acyl-
FT                   carrier-protein) dehydratase, FabA/FabZ"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70539"
FT                   /db_xref="InterPro:IPR016962"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D5U648"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00287"
FT                   /protein_id="ADG70539.1"
FT                   /translation="MDNYIGFKDYNIEEKTSDMFRVKVFIDERMPYFDGHFENLKLLPA
FT                   IAQVKIALDIYKSIFSRNFSVNKLLKLKFVNMIFPNTIITLECYYLNNTLSFKMYDEDK
FT                   KYSDGKIYLK"
FT   gene            complement(542828..544174)
FT                   /locus_tag="Bmur_0437"
FT   CDS_pept        complement(542828..544174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0437"
FT                   /product="AMP-binding enzyme"
FT                   /note="KEGG: bhy:BHWA1_00286 AMP-binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70540"
FT                   /db_xref="GOA:D5U649"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D5U649"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00286"
FT                   /protein_id="ADG70540.1"
FT                   /translation="MRKLSNTNFYSLKDSEDIFLLHKENTGSIKYKDFICDIVRALEYI
FT                   SKYKEDTITIFIEDAYRFIVITVSGFILKKRVNVLNNNSPKYVESIIGSSMVYISDNYK
FT                   SALNLDEVFESACNDKWFDILKETIIDENININFYTSGSTGYPKLIEKTLKQFEAEASK
FT                   IVNQFTDDMKDSIFIYTVPHYHSYGFVFAVLVPYMLELRFLDNRINYLETVNNFYEYEK
FT                   ITIVTTPAFLKRIDRSSLKIRAEWHLFSSTGLLDKKVNDLAKYVFGVDVTEIYGSTEAG
FT                   AMAYRRRSENDLWTRLSVVSLKTDEHGSIECCSGYTGENVWIYVGDVVNMKNENEFELI
FT                   GREDSIVKIEGKRISVQQIDRQILMDKHFKDSYTIYCKSDKREYIASFIVLSNRDRNAE
FT                   HMKKYVIEYLKGYFETVVLPKKIYFVDSIPRTEIGKIDRKALDSIMQGN"
FT   gene            complement(544191..544451)
FT                   /locus_tag="Bmur_0438"
FT   CDS_pept        complement(544191..544451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0438"
FT                   /product="phosphopantetheine-binding protein"
FT                   /note="PFAM: phosphopantetheine-binding; KEGG:
FT                   bhy:BHWA1_00285 acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70541"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:D5U650"
FT                   /inference="protein motif:PFAM:PF00550"
FT                   /protein_id="ADG70541.1"
FT                   /translation="MTIEEQIKQIVIEAANLEDMTIYDIDTDAPLFGDELGLDSIDALE
FT                   IGVAIRKKFNISFSDIEENNKKHFYSVATLAQYIRENSDNK"
FT   gene            complement(544503..545210)
FT                   /locus_tag="Bmur_0439"
FT   CDS_pept        complement(544503..545210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0439"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00284 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70542"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="UniProtKB/TrEMBL:D5U651"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00284"
FT                   /protein_id="ADG70542.1"
FT                   /translation="MSDLCFKVLDWDFFAPNIDKKFILDNINSDIKITYGEASPDLDFI
FT                   PRAQKRRLSQITKLSFESVKNILKENEQMPIFFVSKYGEIKQQYNISKKIVTEHEVSPA
FT                   LFSFSVFNTAAAQLTIFYKNHERAVAVTCYDNFVDTALIQAVSFLNNSEHSKALIIIAD
FT                   EKLPESYEAISRCVNYSFAFSCIISKEDADINMNIIESDIKKDENSIIDFIKFISADNN
FT                   ASLKLGKIELTKK"
FT   gene            545598..545987
FT                   /locus_tag="Bmur_0440"
FT   CDS_pept        545598..545987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0440"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="KEGG: bhy:BHWA1_00283 transcriptional regulator,
FT                   MerR family; PFAM: regulatory protein MerR; Transcription
FT                   regulator MerR DNA binding; SMART: regulatory protein MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70543"
FT                   /db_xref="GOA:D5U652"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D5U652"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ADG70543.1"
FT                   /translation="MTIAEVSKKTELSADTLRYYERIGIIPEIERSESGIRNYTDYDLG
FT                   WIEFSKCMRNSGMSIESIIEYIKLYNKGDATLEARKQLLVSQRDAMQEKLNELQATLDK
FT                   LNKKIENYGHQMSVHEKDMLKSKNN"
FT   gene            546000..546470
FT                   /locus_tag="Bmur_0441"
FT   CDS_pept        546000..546470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0441"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00282 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70544"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="InterPro:IPR041183"
FT                   /db_xref="UniProtKB/TrEMBL:D5U653"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00282"
FT                   /protein_id="ADG70544.1"
FT                   /translation="MKIKKYFLSLLIFYIMASIACNSVYGDNTTMENLNVLNTSVNVKI
FT                   KDKEYKLKLYDNQTAKDFLALLPLTVNMNDLNSNEKYYNLSKILTTKTENIGSIKTGDF
FT                   LLYGNNCIVLFYESFRTSYSYTRLGYIENTESLKETLGRGSVEITFSAASEN"
FT   sig_peptide     546000..546080
FT                   /locus_tag="Bmur_0441"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.971 at
FT                   residue 27"
FT   gene            546657..547502
FT                   /locus_tag="Bmur_0442"
FT   CDS_pept        546657..547502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0442"
FT                   /product="2,5-didehydrogluconate reductase"
FT                   /EC_number="1.1.1.274"
FT                   /note="KEGG: bhy:BHWA1_00281 oxidoreductase, aldo/keto
FT                   reductase family protein; PFAM: aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70545"
FT                   /db_xref="GOA:D5U6H9"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6H9"
FT                   /inference="protein motif:PRIAM:1.1.1.274"
FT                   /protein_id="ADG70545.1"
FT                   /translation="MKTVKLNNGLEMPILGFGVFQIPDYEECKKSVLNAIEAGYRLIDT
FT                   AAAYFNEKAVGDAIKESGINRKELFITTKLWITDAGYDNAKKAFELSMEKLGLDYLDLY
FT                   LIHQPFGDYYGSWRAMENLYSEGKIKSIGVCNFYPDRLLDLVMHNKIAPMINQIETHPF
FT                   FQREEDNKLMKEYGIQIESWGPFAEGRNNMFTNETITKIAKKHNKTTAQVILNWLIKRN
FT                   VVVIPKSVHKERIIENFNVFDFELDDSDMNEISKLDTKKSLFLSHTDIETVKYLCNYKI
FT                   "
FT   gene            547695..548525
FT                   /locus_tag="Bmur_0443"
FT   CDS_pept        547695..548525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0443"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: bhy:BHWA1_00280
FT                   oxidoreductase, aldo/keto reductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70546"
FT                   /db_xref="GOA:D5U6I0"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6I0"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADG70546.1"
FT                   /translation="MENNKVVFNFNTKTAKLNSGYEIPLNGIGTYSLLNDECYNSVLFA
FT                   LQNGVRLIDTAYIYRNEEEVGKAVKDSKIDRKDIFIITKLYPNQYSDAENAINEALKKL
FT                   DVEYIDMMLLHHPSGNDVEAYKAMEKAVKEGKIRSIGLSNWYIKELKEFLPKINIMPAL
FT                   VQNEIHPYYQDTDVIEYIQSLGIAVQGWYPLGGRGHQRELLNDKVLKDIAQKYKKSVAQ
FT                   IILRWNLQREVIVIPGSSNREHIIENTEIYDFELSDDDMKKIAELNRDEKHDWY"
FT   gene            548953..549930
FT                   /locus_tag="Bmur_0444"
FT   CDS_pept        548953..549930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0444"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: rfr:Rfer_2445
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70547"
FT                   /db_xref="GOA:D5U6I1"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6I1"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADG70547.1"
FT                   /translation="MQKRKLGNLEVSEIGLGCMGYGVVYDEHYDKRELISVIHEAIELG
FT                   INFFDTAEAYGPYKNEEVVGEALEKYRDKVVIATKCGIKTVNGKPVLNAKRETIIKSLE
FT                   GSLKRLKTDCIDLYYIHRVDPNTPIEEAADTMKDLIKEGKIKHWGISEAGVNTIKKADE
FT                   VCKLTAIQSEYSIMWREPEKELIPLLEKLNIGFVPFSPLGKGFLTGRFNNASDFSNNDF
FT                   RSSIPRFQKENIKDNYTLVEVLEDIARRKNVTKSQIALAWVVHQKPFIVPIFGTRKIER
FT                   LRENIASVNVEFSKEELEDINKAISSIKIYGERYPKEHLEIVGK"
FT   gene            550247..550756
FT                   /locus_tag="Bmur_0445"
FT   CDS_pept        550247..550756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0445"
FT                   /product="flavodoxin"
FT                   /note="KEGG: bhy:BHWA1_00279 flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70548"
FT                   /db_xref="GOA:D5U6I2"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6I2"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00279"
FT                   /protein_id="ADG70548.1"
FT                   /translation="MKILIAYYSHSANTKKLAEIIAKVLKSEFQNVKIDFFYTEPEKPY
FT                   SSNYNKVLEESKRDIKNNHKPKLKNNIASIDDYDVIFIGSPNWWNTMASPVGSFISSFD
FT                   FSNKIIMPFCTHGGGGAGIIRTDIEKLTKSKQVGKILSVYGNTSSINNSESEIEKWIKN
FT                   IKINVK"
FT   gene            550791..551240
FT                   /locus_tag="Bmur_0446"
FT   CDS_pept        550791..551240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0446"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   bhy:BHWA1_00278 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70549"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6I3"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ADG70549.1"
FT                   /translation="MSDYEYQKAPEKTVFIKKGEGRKFKGSKECFTGDVEVELLTDANE
FT                   DSHFSVAYVTFEAGARSAWHTHPCGQHLIVVEGIGLTQEEGGEILEFHEGEALYCPKDK
FT                   KHWHGASPDCRMKHIAITGDKDGNNVTWLEHVTDEEYNAYKNNKK"
FT   gene            551344..552813
FT                   /locus_tag="Bmur_0447"
FT   CDS_pept        551344..552813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0447"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: protein of unknown function DUF323; KEGG:
FT                   fsu:Fisuc_1693 protein of unknown function DUF323"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70550"
FT                   /db_xref="GOA:D5U6I4"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6I4"
FT                   /inference="protein motif:PFAM:PF03781"
FT                   /protein_id="ADG70550.1"
FT                   /translation="MKNKKIVSISVLIIAVIVFYALNKSENNIIQNQQVFAQEVNTQAN
FT                   NSGDEKMINDNLILLEGGSFMMGSPDTERQRDKDEVLHEVVINPFYIDPYEVTQKDYQN
FT                   IMGKNPSHFKGENLPVENVTWYDAIEYCNALSKAKGLTPAYTIEGNTVKWNRNANGYRL
FT                   LTEAEWEYAARAATRTVFNSLNHITSDNANFEGSYPYLIEENYVNPHNPDVKTSRYRGR
FT                   TLEVNSLSPNQFGLYNMHGNVSEWCFDYYGEYDTENNNNPYGNQNGSLRVSRGGSYIDF
FT                   AKHLRAAYRSACNPLSTDRNTGFRIARNAKPINDIIETAYSLNIKIPQNPKILIAYFSY
FT                   SGNTRNAAEIIKEKTGADIIEIKMKTPYRGRGNIYETSQIDLNNNVYPELTDHVQNMEE
FT                   YDIILLGYPTWWATMPMPVFSFIKEYDFSGKSVITFSSHGGTMFGESVSDLAKLIPDAY
FT                   VGLALEFNYSGGRELENRISEWLKLNSINEI"
FT   gene            552937..553605
FT                   /locus_tag="Bmur_0448"
FT   CDS_pept        552937..553605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0448"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_01747 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70551"
FT                   /db_xref="GOA:D5U6I5"
FT                   /db_xref="InterPro:IPR025517"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6I5"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_01747"
FT                   /protein_id="ADG70551.1"
FT                   /translation="MKLKKIIKIIIDILMYIIFIYLMSYRPGRGLFLHGIFGFTLFILF
FT                   ILHHLLNIKWYGSITKGKYGFIKKLFITINFLLFFDMIVMAVSSIMMSGDIFAFSPFIA
FT                   NQFARNLHVVSTSSGFVLMIFHIGLHTNNIFRSIYTKVKDTYLKYIYIVLFLVILFLGL
FT                   YSFIISGIINSMFLIPKENHSFYDLYFYFQYIMMTVGASQIVHLIFIVSYKINKKMNKH
FT                   "
FT   gene            complement(553602..554495)
FT                   /locus_tag="Bmur_0449"
FT   CDS_pept        complement(553602..554495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0449"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR substrate-
FT                   binding; KEGG: bhy:BHWA1_00647 transcriptional regulator,
FT                   LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70552"
FT                   /db_xref="GOA:D5U6I6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6I6"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ADG70552.1"
FT                   /translation="MDIKSLKYFLTSAREGSITKAANTLNLTQPNLSRQINNLEKEIGK
FT                   KLFIRSNYSIKLTSDGVLLKKRAEEIIDLMEKTKMEFKSSEDVIAGDIYIGSGETYYIK
FT                   IIADIIKELRELYPNIIYHIHSGVYSDITEKLDRGLADFGLLIGSFDDAKYDYIEMPYK
FT                   ELYGLLMRKDSHLSKKKFITKDDLLNIPIICPKRFFNNKSKSNKFYEWIGEDIDKLNIV
FT                   LTYNLIYNAAIMVEEGIGYVITMDKLINTVSESDLCFIPLKPKLYVTSSIIWKKNQVFS
FT                   KASKIFLDKIKEKLGS"
FT   gene            554653..555003
FT                   /locus_tag="Bmur_0450"
FT   CDS_pept        554653..555003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0450"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="KEGG: bhy:BHWA1_00648 regulatory protein, MerR;
FT                   PFAM: regulatory protein MerR; SMART: regulatory protein
FT                   MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70553"
FT                   /db_xref="GOA:D5U6I7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6I7"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ADG70553.1"
FT                   /translation="MTISEVSQLTGLTKDTLRYYEKIGVIPEIGRSKSGIRNYNEYNLK
FT                   CIEFSKSMRDLGISIDSIIKYIKLYKKGKNTINERKSILINERDEMQRHFNELKIKLEK
FT                   LNKKLEEKDFFN"
FT   gene            complement(555068..556261)
FT                   /locus_tag="Bmur_0451"
FT   CDS_pept        complement(555068..556261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0451"
FT                   /product="(Uracil-5)-methyltransferase"
FT                   /note="PFAM: (Uracil-5)-methyltransferase; KEGG:
FT                   bhy:BHWA1_00680 RNA methyltransferase, TrmA family"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70554"
FT                   /db_xref="GOA:D5U6I8"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6I8"
FT                   /inference="protein motif:PFAM:PF05958"
FT                   /protein_id="ADG70554.1"
FT                   /translation="MKVEIIDTAYGGYGIAKNNDGKIIFIPNSVEGDVLDINITKESKK
FT                   FSYASIEKIIEPSKYRIKPRCKYAGICGGCVFNHIDYNKQLSIKKNIVLNAVRNLEYKK
FT                   DIKIIYDKNYNYRLRVNMIASNGSIGFYRFKTNDFAAIDECVILKDSLFKRIKDFSKEN
FT                   NITGSIYAIENNSREALAFLDSDKKINIKSFEKYFNGITIKHNKTVRSFGDISMTYKTK
FT                   YGNIGIGHKTFFQSNLYLLDIFQDEAVKYITQDDNTIIELYAGSGFFTAAIESKLKSFN
FT                   KEYKFISSEISKDSVYIANKYNFNIKNEESFITLKNINYDIDALVLDPPREGIDKKTIN
FT                   EIIRIKPKKIIYVSCDPMTFSRDINLLKDYYKLSDLSIIDMFADTYHIETVSYLEKC"
FT   gene            complement(556765..558045)
FT                   /locus_tag="Bmur_0452"
FT   CDS_pept        complement(556765..558045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0452"
FT                   /product="Eis, predicted acetyltransferase-like
FT                   acetyltransferase"
FT                   /note="KEGG: bhy:BHWA1_00682 Eis, predicted
FT                   acetyltransferase-like acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70555"
FT                   /db_xref="GOA:D5U6I9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR025559"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR041380"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6I9"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00682"
FT                   /protein_id="ADG70555.1"
FT                   /translation="MSIHNKKEYSKENIIRKKKNKFIIRYLTLEDLEMFNNLLRYAFQV
FT                   SNNELITLGYEIDEIKQAKSAVLSKAKVLGWFDGEKLASQIAVYPMKMNIHGVIYKMAG
FT                   VTGVATYPEYSNLGLMNDLMIKSIEIMKKEGQTISVLYPYSIPFYRRKGWEIISDKMSF
FT                   EIKDTQLPKTITNSGRVERVSSDSNDLKELYDKFSHMRHGALIRGDLEWEEYWRWDVDD
FT                   TIVAIYYDEKDEANGFLVYVIENDIFHVKEMVYLNFEARLGLWNYISAHFSMVDKVNGY
FT                   NYTNEPMAFLLEDSEIKETIRPYIMARITDVKAFIINYPFLRKPKNKKINLIIKDNMAK
FT                   WNNGSFLIHWDEERNTICKRLSKEYKRNSKDRYIIKMNIQTLTAMLMSYKSPSYLYKIE
FT                   RIESSIKGINLLESIIPKEQVYFSDYF"
FT   gene            complement(558091..558921)
FT                   /locus_tag="Bmur_0453"
FT   CDS_pept        complement(558091..558921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0453"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00683 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70556"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6J0"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00683"
FT                   /protein_id="ADG70556.1"
FT                   /translation="MEAKKLQRFSEYSMSTYLLCPRKYRYTYIEKPFKKQKRSVNVYFI
FT                   FGNAIHLTCKEFYEQRAEERTLENLYTIFRNVWKRSGIRAFFNSREEEKELGERGLYML
FT                   SNFFNSFSNKVPYKMESYMENRVRDYILFGRIDRIDLSADGTLQIVDYKTTKYYDVGED
FT                   NDERDRKTIQLKLYACILDGLKFKVTSGSYYHFEDDKFDTVEFTPESINYLREWFDEIV
FT                   DDIRYDRAFDKKVGRHCEFCDFFKLCQGKEDNVQDLVLPSDELFMANIENSNNN"
FT   gene            complement(558956..559825)
FT                   /locus_tag="Bmur_0454"
FT   CDS_pept        complement(558956..559825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0454"
FT                   /product="Ankyrin"
FT                   /note="KEGG: bhy:BHWA1_00684 ankyrin repeat-containing
FT                   protein; PFAM: Ankyrin; SMART: Ankyrin"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70557"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6J1"
FT                   /inference="protein motif:PFAM:PF00023"
FT                   /protein_id="ADG70557.1"
FT                   /translation="MRKVYIAVSLFLLSFALYSQEITNAEIVTNYNQESTNSNNIFFYS
FT                   IENGDIAKVREMLKEGIDVNSTNAEGWSALHLAVKANKPVIVKELLSHKKIDMNPMLPA
FT                   DSVFIEGNDKWYADGQTPLLLAAYYGYSDIVTMLLSYGADILAKDSVDDAMAIHIASAK
FT                   GYYKVVEAILDSAAARNSKVDIVNVGDNTGTTPLMWAAMNNQVTVISILIKYKANVNMQ
FT                   DDDGWTPLHFAAASDSYRAVEILLNNGADADMPDIEGKKADDVTNDTDIEALLNKYMTV
FT                   DNTQTEDK"
FT   sig_peptide     complement(559766..559825)
FT                   /locus_tag="Bmur_0454"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.919 at
FT                   residue 20"
FT   gene            560082..561332
FT                   /locus_tag="Bmur_0455"
FT   CDS_pept        560082..561332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0455"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00685 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70558"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6J2"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00685"
FT                   /protein_id="ADG70558.1"
FT                   /translation="MLISIIKYNAYSQTTNTNNIKRYGQLSASLEMTAYGRMSDLIEQT
FT                   GNEDTLGVLLYGDLNYIKEYKYASIEANMNVRFYEPLSHKARFYKDMSPPVFDFSKMNI
FT                   FVNFKYVGIRVGVLEPYTKNIPMTSYFPTLFYYHTVSSNKATVLSGPRDMPIGYDTQFI
FT                   PRYDTGLMLEANFFGVFIGVGMVNGEMGLDANSSKGLMAKAAYSNDYINTGAACIITEI
FT                   GSIPIKEWGDSINAFFYFKNGRNGRFTVGVEGFWFRHGIRRNNEYSPGSENNNTHNYNG
FT                   GYYTDFSIQTFNGEKPYYGMSGFIFFEARRLWKFDITAHFGIHDNNIYSNAEDIYQLKY
FT                   RAFLRITFNITDDFKIMLSDTFTYDPVYKNNYQYYELENRNQAGVISYNEKNGHYTVDN
FT                   DFYLGLSFKFGGVWGSK"
FT   gene            561417..562562
FT                   /locus_tag="Bmur_0456"
FT   CDS_pept        561417..562562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0456"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="SMART: PUA domain containing protein; TIGRFAM:
FT                   glutamate 5-kinase; KEGG: bhy:BHWA1_00686 glutamate
FT                   5-kinase; PFAM: aspartate/glutamate/uridylate kinase; PUA
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70559"
FT                   /db_xref="GOA:D5U6J3"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6J3"
FT                   /inference="protein motif:TFAM:TIGR01027"
FT                   /protein_id="ADG70559.1"
FT                   /translation="MKKIDLNNINRIVFKFGTNVLRNDEGYISLARIYSFIEAIAKFHR
FT                   MGKEVLIVTSGAVGLGAKKINVQDLDEVALKQACAAIGQSQLMSIYEDGFSKFDIVTAQ
FT                   ILLTEEDFSNRRRYLNLHSTLNMLLKYKVVPIINENDTVSSDELKQLYDVTQISFSDND
FT                   KLSALVASELDADLLIILSDINGLYDDNPKTNPNAKFIHEVFEVTKEIESLGLDASKGG
FT                   RGGMKTKLQAAKIVTRSGCALFIANGKKPNVLNNIFESEDKTIFYPVEETNELPTKKRW
FT                   IAYATTIIGKLKVNAGAKKAVLEKESSLLPIGVTKVINSFKKGDIVSIIDEDGNEFARG
FT                   IINYSSNDVEKIIGHHSDDILKILGYKNYDAVITRDHIVIL"
FT   gene            complement(562557..563558)
FT                   /locus_tag="Bmur_0457"
FT   CDS_pept        complement(562557..563558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0457"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.12"
FT                   /note="TIGRFAM: galactose-1-phosphate uridylyltransferase;
FT                   KEGG: bhy:BHWA1_00687 galactose-1-phosphate
FT                   uridylyltransferase; PFAM: galactose-1-phosphate uridyl
FT                   transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70560"
FT                   /db_xref="GOA:D5U6J4"
FT                   /db_xref="InterPro:IPR001937"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR005850"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6J4"
FT                   /inference="protein motif:TFAM:TIGR00209"
FT                   /protein_id="ADG70560.1"
FT                   /translation="MPHIRKDPVTKQSVIISAERTGRPSDYVNSDKKHVSNSELSCPFC
FT                   RGHEMKTPDSVYTVYAEQEEIWQVRIVPNKYPIISETHKNELPKENSLFCASSSKGFHD
FT                   VIIEHPNHYFNFYHAQTEDFFYIFKAVMMRLRDLGKNEDMLYSLHFKNFGPEAGASLSH
FT                   SHSQIITTPFIPVQMLDEINGAFEYYNENNRCVYCDIILEEKKLNERVIYENDNFIAIA
FT                   PFASRSPYQIYIIPKQHSNSIIYTSSPHMLDFASILKNIFDRLYNLLGEVSFNYVLHTL
FT                   LPVFNDRYNYSSHWFLDIMPKMSKLAGYELGSGVFINSITPEDAAEQLRNAL"
FT   gene            complement(563564..563926)
FT                   /locus_tag="Bmur_0458"
FT   CDS_pept        complement(563564..563926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0458"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: bhy:BHWA1_00688 REC, signal receiver domain
FT                   protein; PFAM: response regulator receiver; SMART: response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70561"
FT                   /db_xref="GOA:D5U6J5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6J5"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADG70561.1"
FT                   /translation="MPKKTILVLDDEKSIRTLFEEEFKDEGYDVVSTDSGEEALEMLDK
FT                   GTPHIDLITLDIKMPKMDGLDFLAKVREKHRELPIIICTAYNNYRHEFSVWNADGYILK
FT                   SGNLTEIKDKIKRLIG"
FT   gene            complement(564061..564852)
FT                   /locus_tag="Bmur_0459"
FT   CDS_pept        complement(564061..564852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0459"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="TIGRFAM: pyrroline-5-carboxylate reductase; KEGG:
FT                   bhy:BHWA1_00689 pyrroline-5-carboxylate reductase; PFAM:
FT                   NADP oxidoreductase coenzyme F420-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70562"
FT                   /db_xref="GOA:D5U6J6"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6J6"
FT                   /inference="protein motif:TFAM:TIGR00112"
FT                   /protein_id="ADG70562.1"
FT                   /translation="MIIGFIGAGAMGGALIEGFIKSGIEYTNIIASVKTMEKKDYLEKN
FT                   LGIKVYTDNRKAAAEADVLFIAVKPYMVSTVAAEISSSIKVGSTIVSVAASVSKRDLSR
FT                   LFNGSRIVRIMPNTPVKTCNGFISVVEAENKVVENGVVELLKRVGMVKVIKEEQIHAYN
FT                   AMAGCSPAFMYILIEAMSDAGVLMGIDRKTSIEMAAQVFKGTGAMVLESGKHPAQLKDG
FT                   VCTPGGLTIKGVEVLEEKSMRSGLIESIIASYNKSIESEKK"
FT   gene            complement(564945..565361)
FT                   /locus_tag="Bmur_0460"
FT   CDS_pept        complement(564945..565361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0460"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   bhy:BHWA1_00013 thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70563"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6J7"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ADG70563.1"
FT                   /translation="MTNEEMFKKVEKKFNSQDFLSFVGMKLEHVEKGKVIISCENKKEF
FT                   SQYLGYMHGGMVAALADTAGGHAAASMLEEGYKTVTSELKIHYLKPVVAKKVIAVGEVL
FT                   SSGKKLIIVEAVIKDEEDNMLAKMIATMFVIDPS"
FT   gene            complement(565712..567100)
FT                   /locus_tag="Bmur_0461"
FT   CDS_pept        complement(565712..567100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0461"
FT                   /product="sodium:neurotransmitter symporter"
FT                   /note="PFAM: sodium:neurotransmitter symporter; KEGG:
FT                   bhy:BHWA1_00012 sodium/chloride-dependent transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70564"
FT                   /db_xref="GOA:D5U6J8"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6J8"
FT                   /inference="protein motif:PFAM:PF00209"
FT                   /protein_id="ADG70564.1"
FT                   /translation="MHNEKREKLSNRLGFLLVSAGCAIGLGNIWRFPYITGKYGGAAFV
FT                   VVYLICLAVIGLPILIMEFSIGRAGGRDIAGSYKVLEKEGSKWHLIGYIQMLGCLILMM
FT                   FYTSVTGWTVTYAYYMATGATLGLSPDGVGQFFGSMLSNPKIMVISLFIAVFFGTLICF
FT                   KGLQAGVEKSSKFMMSSLFVIVIILIIRSVTLKGAIEGVKFYLLPDLSKIFQGGVGNLF
FT                   EVIYAAMGQAFFTLGIGIGSMTIFGSYIGKEKSITNESIIIVILDTLIALLSGLVIFPA
FT                   CFAFNVNPGEGAGLAFVTLPNIFNSMPLPRLWGTLFFIFLTMAALTTVVTVFENLIAFT
FT                   MSEFKMHRNTASIVVGIVVFVCSLPTALGFNVLSFIHPMGANTSFLDLFDFIVSYNLVE
FT                   LGGIYIIIFCVSKYGWGWDNFITEVDSGSGIKFPVISRFYVTYILPIILFAMFIINYIY
FT                   KFFI"
FT   gene            complement(567267..568700)
FT                   /locus_tag="Bmur_0462"
FT   CDS_pept        complement(567267..568700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0462"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="TIGRFAM: pyruvate kinase; KEGG: bhy:BHWA1_00011
FT                   pyruvate kinase; PFAM: Pyruvate kinase barrel; Pyruvate
FT                   kinase alpha/beta"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70565"
FT                   /db_xref="GOA:D5U6J9"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6J9"
FT                   /inference="protein motif:TFAM:TIGR01064"
FT                   /protein_id="ADG70565.1"
FT                   /translation="MRKTKIIATLGPRWSSEDMIKKIIENGADVCRLNFSFGAYEEHLE
FT                   RINIIRKVSKELRKPVAILADMQGPKIRIGKLKEPIAVKEGDIVKLSGYKETNDDSIIP
FT                   TTHSNIAHDVKNGSMLLIADGTIQLIVESSDEASKLVVCKVITGGTILSSKGINLPGAH
FT                   VTTEVLTEKDINDALFCAKNGVNYLGMSFVRRAEDVIRLRKILDDNNFQHVAIVSKIEN
FT                   TESLENLEEIIKHSDGVMVARGDLGVEIPFGEVPVWQKKILKMANDLGKITIIATQMLE
FT                   SMTKSPVPSRAEASDVANAVLDGTDVVMMSAETASGDYPIESVKAMVSIVEAAERSMIK
FT                   ISHDNMNLLDRGLNDALADSASYLSYSLNNKVIIALSRSGRTVKNLSKKRPKTPIVFMS
FT                   ADFNLCNSLSICHNVYTILMPEDLNFSSGISHSGQIDILEDTIVKHNLANHGDTAIVVS
FT                   GSKWQGRWQENSVRVVIIH"
FT   gene            568851..569423
FT                   /locus_tag="Bmur_0463"
FT   CDS_pept        568851..569423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0463"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00010 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70566"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6K0"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00010"
FT                   /protein_id="ADG70566.1"
FT                   /translation="MIYNKTMNTKNISIIFLTILLALSIYACKPNTKTIILNNIAIDVP
FT                   EDFEENFLGGVVDTDNTIEYHNSYGVQRTTAIYTIVYKKYKAAYTGIINLEKARNDIVN
FT                   GLKNNNAVQEFQIVNEGRVEGYDNAYEILLSFYYGPNKTYHKSFSMLHDNGILQIICMY
FT                   NANSKKDDKEINNIIKSVRIIENNTNN"
FT   sig_peptide     568851..568934
FT                   /locus_tag="Bmur_0463"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.970 at
FT                   residue 28"
FT   gene            complement(569420..570268)
FT                   /locus_tag="Bmur_0464"
FT   CDS_pept        complement(569420..570268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0464"
FT                   /product="dimethyladenosine transferase"
FT                   /note="TIGRFAM: dimethyladenosine transferase; PFAM:
FT                   ribosomal RNA adenine methylase transferase; KEGG:
FT                   bhy:BHWA1_00009 putative dimethyladenosine transferase;
FT                   SMART: Ribosomal RNA adenine methylase transferase- like"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70567"
FT                   /db_xref="GOA:D5U6K1"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6K1"
FT                   /inference="protein motif:TFAM:TIGR00755"
FT                   /protein_id="ADG70567.1"
FT                   /translation="MLDNLYSKREITEYLKEKSIFPNKNRGQNFLCDRNIAYNIAYTVP
FT                   KSYSRGELALEIGGGLGALSSMLIDIYKENLTIVEYDNALYNHLKEKFNNINIIHKDIL
FT                   TFDISDSDKQYDVYGNIPYNIASPIMEWLLQKSYGKWNYAVFMVQSDFAERLTAKENTE
FT                   NYSALTLFANFMADVKLEYNVSKEVFYPIPKVTSSIISITPKETDIDMIDIFKSVSKTL
FT                   FHNRRKTIKNNFINSPYININKNCIDEILKKSDIEGNVRGETLNLDKVIKLSNILKEYI
FT                   D"
FT   gene            complement(570258..571985)
FT                   /locus_tag="Bmur_0465"
FT   CDS_pept        complement(570258..571985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0465"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00008 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70568"
FT                   /db_xref="GOA:D5U6K2"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6K2"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00008"
FT                   /protein_id="ADG70568.1"
FT                   /translation="MRKEHSITTRLILNFLIMSIIGIAVILIIYVLYSRGEGRDYSLFT
FT                   YMLISLIFYKTYMPYIISLSVYSAFFKAKYLYQENISKVIAAPITAIIVLVIFYTLYDY
FT                   SFVDSFISLVKEHNASRDTMIYYEYGLKLKNEAYEKAKTELINGNLESATYFAEEALFY
FT                   DKNDGNVLLLIKSIQEEKRKEHEKLHQLEISNINNLLRLGTREFSYSNYYEASKYFNQV
FT                   IALDRYNPLALYYINKISIANNQKPKYVSTTTEEASVYGRLSDVITLYENGRLWDAYDG
FT                   ISKLYMEAPNIAEVDNYYSIIRDSISRYDFFIREAKEIRNAYINNPDILQYTSALNHNG
FT                   INLMLDKNTLLSSSSSSVFKNSFYIFDVSLIKLDDELKIVSCDNYLYGKIADEFKSTNN
FT                   NKNIILKARFDTNKNDYIYSDTNSLIIPISISYSTLDIIKNYTSLELKYINLSDLFTLR
FT                   KEIKRFGYSDKEINLELITKNIEPITYLLLFLIIAYYSFRYRLSMSPSATFHIYNRVTG
FT                   VVGTILLALVYKVIVSYIAMLLVMVSEITLSVIIIVVSAFILILIVIFQMARIPRDVR"
FT   gene            complement(571982..572428)
FT                   /locus_tag="Bmur_0466"
FT   CDS_pept        complement(571982..572428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0466"
FT                   /product="response regulator aspartate phosphatase
FT                   containing TPR repeat domain protein"
FT                   /note="KEGG: bhy:BHWA1_00007 response regulator aspartate
FT                   phosphatase containing TPR repeat domain"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70569"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6K3"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00007"
FT                   /protein_id="ADG70569.1"
FT                   /translation="MDFLVKKSFVFLVILVFLLASCASAVKISVEEERYPKIIAEKAYT
FT                   EFGNKNYKTAIAYYQYIIDNFDRENYSKDVAWAYYEIGFCYYYQNKYEEALTYFDIVIN
FT                   NFTVLPPRILAQKVMQDIYDKKPKLKPVEIIEEEVEIIEENVDS"
FT   sig_peptide     complement(572351..572428)
FT                   /locus_tag="Bmur_0466"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.868 at
FT                   residue 26"
FT   gene            complement(572428..572733)
FT                   /locus_tag="Bmur_0467"
FT   CDS_pept        complement(572428..572733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0467"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00006 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70570"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6K4"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00006"
FT                   /protein_id="ADG70570.1"
FT                   /translation="MSEEQNEQVSETGIYCANCRYCVLFRKSSGVDGNQYLLRVKCAQE
FT                   QWRKKLGEEKMYKYFTVARRTVEKCDDYKEMGDLRSFLKALRKSLPVRDEVYTIKK"
FT   gene            572939..573601
FT                   /locus_tag="Bmur_0468"
FT   CDS_pept        572939..573601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0468"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00005 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70571"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6K5"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00005"
FT                   /protein_id="ADG70571.1"
FT                   /translation="MTYIKTALIIIILYTSTLYSQESTDINFQDLYAQMKDKYSSAYPK
FT                   HFEAYIKGKIVQRQIDTIPAKSYTKTKDDIKLKFSFTHGGKPSIILENVDSFYRNMFSV
FT                   FEGALETIGFYALVGSSSSYDSLSKKFTFESLEESKNKYEITLGAKGENLNYSVVYTVD
FT                   KEILLIEKAEYYNKKSKIYDVSISYENIENYTLPKIIKYKSSDGKVNSEIEFTDIKF"
FT   sig_peptide     572939..573001
FT                   /locus_tag="Bmur_0468"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.771) with cleavage site probability 0.736 at
FT                   residue 21"
FT   gene            573619..574365
FT                   /locus_tag="Bmur_0469"
FT   CDS_pept        573619..574365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0469"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00004 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70572"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6K6"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00004"
FT                   /protein_id="ADG70572.1"
FT                   /translation="MKKILIIITSLILTFNLYAIDVESLFNLSSNGEIVYYKSDNINNA
FT                   DYTQAEKLKNDLEKKGYNVNSIIIADVLPIEGNEFIALVSSAQGNKICIYNNEKEEFSY
FT                   STDRFGKNSAVDLENFYDRKNEIGIIKYYIINDNGQDKDIYMYMFRIDGASIKFIADIE
FT                   FYREINSMKSSVITQMDNIFEDIDGDGIYEMLVESREKISGRNDRVEYQIYKLSKSKGR
FT                   YECIMSSWLEDTPVDLSRYFQKSIRK"
FT   sig_peptide     573619..573678
FT                   /locus_tag="Bmur_0469"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.789) with cleavage site probability 0.789 at
FT                   residue 20"
FT   gene            complement(574379..575233)
FT                   /locus_tag="Bmur_0470"
FT   CDS_pept        complement(574379..575233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0470"
FT                   /product="RarD protein, DMT superfamily transporter"
FT                   /note="KEGG: bhy:BHWA1_00003 permease; TIGRFAM: RarD
FT                   protein, DMT superfamily transporter; PFAM: protein of
FT                   unknown function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70573"
FT                   /db_xref="GOA:D5U6K7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6K7"
FT                   /inference="protein motif:TFAM:TIGR00688"
FT                   /protein_id="ADG70573.1"
FT                   /translation="MSKNKSILIAASAYIIWGLLPVYWKAVQNFDSAFVLGIRVITTFI
FT                   FTLIIIIYKRASLYRGIKPLISIIIAGIFLGINWYLYIYTVNSGHVLEAGLAYYIAPIL
FT                   SILTGIIFFKEKKTLLEYAAIILMFIGMIYQTITLGRPPIMAFFIGLTFSIYGVFKKIT
FT                   VYSGWESLFLETAAILIPSIILSKMYFPSSPQSVSSWVTLMFAGIATGIPLYLYAKAAK
FT                   GLDVSTLGFLQFLLPLIATLLAIFVYKEEVNVNRAVTLIIIIIAAVLYTISIFKNSSNK
FT                   DKI"
FT   gene            complement(575346..576095)
FT                   /locus_tag="Bmur_0471"
FT   CDS_pept        complement(575346..576095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0471"
FT                   /product="Ankyrin"
FT                   /note="KEGG: bhy:BHWA1_00208 ankyrin repeat-containing
FT                   protein; PFAM: Ankyrin; SMART: Ankyrin"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70574"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6K8"
FT                   /inference="protein motif:PFAM:PF00023"
FT                   /protein_id="ADG70574.1"
FT                   /translation="MKCLLIVTALFIGIYFNIFSFTQNENDLLIAAETSDTVSVRNILN
FT                   RKDVDVNVRDKYGVTPLMHSVFNKNIYILELLLKNNADTDIKNDSGKTALIYACKLGDF
FT                   DIIQMLIWYKADINITDNYKSTALMYAANSSTNIITLLAESGVDINAQNLDGKTALMYN
FT                   ILNSADVNMINLFISLGADINIQDIHGYSALMYASILDYRNIVEILIENGADVNKRNNY
FT                   NKTALTMAEENKNYKMAEILIKYGAVR"
FT   gene            complement(576260..577294)
FT                   /locus_tag="Bmur_0472"
FT   CDS_pept        complement(576260..577294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0472"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   bhy:BHWA1_00250 DH:flavin oxidoreductase/DH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70575"
FT                   /db_xref="GOA:D5U6K9"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6K9"
FT                   /inference="protein motif:PFAM:PF00724"
FT                   /protein_id="ADG70575.1"
FT                   /translation="MKPEKSNLFTPLKIGNLEIKNRVVMPPMCMYSAEDGYVNDWHIQH
FT                   YSTRAIGGTGLIIVEATGVFSTASYITDNDLGIWDDKYIDGLSKLVKAIKDNGATAAIQ
FT                   INHAGRKCDSLKVDKIYAPSAIAFSDQFKTPVEMTKDDINEVVDAFVKAFVRAKKAGFD
FT                   MVEVHAAHGYLVSTFLSPLSNKRTDEYGKNRAKILEEILRKGKEAVGKDYPIQIRISSY
FT                   DWKEGGNTVKDFVDMLKPLEEQGLFDSINVSTGAVTADGKIIPYEGYQIPFCRELKQYM
FT                   KVPCIGGGLLTDAKMANMIVRNGAADAVYIGREILRNPYWALQAARTLGIDVPFPKQYE
FT                   MAKR"
FT   gene            complement(577529..577888)
FT                   /locus_tag="Bmur_0473"
FT   CDS_pept        complement(577529..577888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0473"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00179 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70576"
FT                   /db_xref="GOA:D5U6L0"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6L0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG70576.1"
FT                   /translation="MLEYKKILIYENGELMKTIYKNMIKYSYIGMCIFFFLIFAKKEDI
FT                   TGTVRMVGTSMFPDIVISTEERDYYFDKKFFDEYAKYVGQNITVTAKVKKDTIWLADRS
FT                   KSFDRYTIKWVEKKE"
FT   gene            complement(577967..580573)
FT                   /locus_tag="Bmur_0474"
FT   CDS_pept        complement(577967..580573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0474"
FT                   /product="Ankyrin"
FT                   /note="SMART: Ankyrin; KEGG: bhy:BHWA1_00249 ankyrin
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70577"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6L1"
FT                   /inference="protein motif:SMART:SM00248"
FT                   /protein_id="ADG70577.1"
FT                   /translation="MIKNGFLFIILLFTISFNIFALTQKEEEFFNAVKENKYESQLKNL
FT                   LRYKIDLNATNEMGLTPLLYAIECGNERAVRVLLEYSEVNIEYKLPDDFADYPYINRYE
FT                   GDSFNIGGATPLMFAIFKGNSRIVKQLIDKNANVKAKDNEGTSVFLYACGFGDGNIIRM
FT                   LLVKDRTLVNDKTLNSNINGLHYAASLNNLETINFLIKNVDMNINDRDLNGCTALYYAA
FT                   YHGKREAYNLLIKLGANKDIGDNYGVKPEYILSGGSSAVDLGTDNNEENNNSFTNTYEE
FT                   NMYIIRTIQESDTNALRNIMMYSNFNMNSVIIAYETPLTYAIHLGKDDMVNELLKYRID
FT                   NTNIINIETSFIPRDDLYFNESRAEFTGYVYLYNASPLQYSIFKGNTNIINTLLKLGAD
FT                   INRKDSLGNNALMYAASYGSAEVIDTLLNYSSNSYRVVDIYGDTPLHNAALLGNTNTLT
FT                   ALMNRTPININVQNIDGNTPLHLAVKNHNTNTYRFLLLKGADYTIKNYDGKTASDLLYG
FT                   DGVESIESIISNNINTNNISTNNVYYSNFYTNEKLNDAKSNNDLYGNTNLNNIDNTNNN
FT                   ILTNSYNNMPYNNTFDEVKAVPANIFSDDLIYEYSDDKTIDDKNDDDYVEPDADDDYSH
FT                   IYEASKPLFDAIYNGNIEDMLKAISNGIDINSRNEEGFTPLLYAINYDKLEAIKALLSY
FT                   SNIIDIEMPLNNYTNIYSVKGKNFSGEVLFNGTTPLQYAVYKGNTNAVNLLIENGADTK
FT                   KKDYNGYCSLFYASAFSDANMIHFLLTKDPSLTREKSLSGRTVMHFSALYGNDEAISYY
FT                   LSNTFLSINAKDNEGNTPLHCACEKGYSSTINLLVQRGAKTDMRNNEGLTPADIAG"
FT   gene            complement(580671..582041)
FT                   /locus_tag="Bmur_0475"
FT   CDS_pept        complement(580671..582041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0475"
FT                   /product="ankyrin repeat-containing protein"
FT                   /note="KEGG: bhy:BHWA1_00248 ankyrin repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70578"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6L2"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00248"
FT                   /protein_id="ADG70578.1"
FT                   /translation="MKNILIILFVFSIFIYGQDIDNIKDYEVLNTIEYDNLYDAIDNND
FT                   LEYIKTIISNNADINTRLPDNYEDNLGGATPLLYSIYKNNRYITEFLIENGADLCVKDF
FT                   KTWNSIMYAAAFSDLYTLSLLAEKDSTLLDTKTEFNVTPLHAASGYNNLEAIMYLCTNS
FT                   NIDINARDIDGWTPLYYAAHSKSIEAYNLLIILGADSTIADNNNILPETVLTRTIEEEN
FT                   NELRDIDIELFKAIEIDDYRTIRTLINRGANINAKDGYGLSALHLAIKNNSIDSVNTLI
FT                   ANRNINLESKLPEGYFTHLGDNSNDAVYIGKATPLIYAIFKSNGSSKIVNALIRKGADV
FT                   NAVDEEGWSTFLYAAAFGNTSILRSIVSKNKNLVNSRTKNNVTALHMAVVYDNLENINY
FT                   LVSRLKVDINAKDDDGWTALYYAAANNKKDAYNLLLRLGADKNIANNEGLKPADVLQ"
FT   gene            complement(582093..585017)
FT                   /locus_tag="Bmur_0476"
FT   CDS_pept        complement(582093..585017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0476"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00247 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70579"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6L3"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00247"
FT                   /protein_id="ADG70579.1"
FT                   /translation="MRILLLLLFTFIFNVCLYAQDTNNQDTANNVNNNNVGESAIMQIN
FT                   KFDAKKNPISFINLVNFTPYYVLQEYARVNNIEIYPYDTESTLRARIIERQVNIKQEVI
FT                   RDKDQIREVARNTINRGGAQVELIGADFAERYEIEEADEELISLYGNVTMRMYNNTLTA
FT                   DKVVYSLKTGEVFAAGNLKVESGETTLNGEWFMLNRENKKGVLFGGGTKFMSFTVDGRI
FT                   IKFNDQDFFAENSSVSFSRLTPVAHDFLTSRVYLWDSKKMMVFNSVYRVGRQPVFYFPL
FT                   FLQNYMGTGIISSFGESLREGVYIQNYKIFDLYGVQHKIRFDAYQKLGFLIGDEIRYTS
FT                   QYQDLSLDAMFALGRQYYLLDSYITSSIGYGTRYVNYFASGEGGKFVPRYKFQYDHTIQ
FT                   LYSSQNINSYITGKLNLNSDLYFKSDFYNQRGQFDILTFFTSVTGDLQDIGDSYPEYYT
FT                   ENSVYVNNNIYGVNLKVGAEWDLQAVRNISVDVNTNFDYYMPKPYKLILPSVEASYSSV
FT                   FGDETSYYFPGLNLNYSLRGSYNHTIDYKTSEGIAFYNNPMLDEQLNDKLAERNNLNLY
FT                   GSLSRNFTNDFIRFVPSFNMEYSYQNSIDPTAEDLIYDKDNTYFGLGTGMNFSMFLPYS
FT                   ILPYNFTHYFEPTVRWDTTYSLNYRFKEKYIDTDAIGSQVGEFDNHNFTTKFTLGGTGY
FT                   SLFFIPDLNLNLESSIRTGYDFIPTYNSETRTYQVEFSTNKMLTTEVGASARLLYNQSY
FT                   ISYDISRNLLGTNLTVNRINSYFHFPIPLGKITDWILIKNNKKPFFDGIINDFNLYFGF
FT                   AFTHDFINYRYNTAAFTFGIELQILDQWRFRIATTSANEKAYRYIKSYAEKENETWVNP
FT                   FWDIINSFNFSDSQKRTESLFKLKSIEASIWHELDGWQILATFAVRPSTLPSDITSGSV
FT                   KGIYWDKEFWIEFTLTDFPNVGLPRKEYNLNSTITDLQDSAAAQ"
FT   gene            complement(585045..586235)
FT                   /locus_tag="Bmur_0477"
FT   CDS_pept        complement(585045..586235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0477"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="TIGRFAM: tyrosyl-tRNA synthetase; KEGG:
FT                   bhy:BHWA1_00246 tyrosyl-tRNA synthetase; PFAM:
FT                   aminoacyl-tRNA synthetase class Ib"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70580"
FT                   /db_xref="GOA:D5U6L4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6L4"
FT                   /inference="protein motif:TFAM:TIGR00234"
FT                   /protein_id="ADG70580.1"
FT                   /translation="MEKYTVEESIELITRGISEVIGLEEIKEKLKSGKQLTVKAGFDPT
FT                   APDIHLGHTVLLRKMRHFQLLGHKVVFLIGDFTGRIGDPSGKTKTRPRLTLEDVLKNAE
FT                   TYKQQVFKILDPEKTIVEFNSKWLEKMSFADVLGLTSRYTVAQMIERDDFSKRYKNGQP
FT                   ISIMEFLYPLAQGYDSVALECDVELGGNDQKFNLLVGRTLMKEYGLSPQAVITVPLLEG
FT                   LDGVEKMSKSLGNYIGIYDSAKDMYGKAMSIPDNLISKYMELLTDIPIEDIKNYTKSME
FT                   NGENPRNIKGILAKEIVKIYHGEEEANNAEEEFKRIFSSKGLPDEIDEVSINKDDNILN
FT                   ILSVCMPSESKSNLKRLVSQGSVSLDNEKINDINTLISKEGILKVGKRNFFKIKFS"
FT   gene            complement(586394..587473)
FT                   /locus_tag="Bmur_0478"
FT   CDS_pept        complement(586394..587473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0478"
FT                   /product="peptidase M24"
FT                   /note="PFAM: peptidase M24; creatinase; KEGG:
FT                   bhy:BHWA1_00720 Xaa-Pro aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70581"
FT                   /db_xref="GOA:D5U6L5"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6L5"
FT                   /inference="protein motif:PFAM:PF00557"
FT                   /protein_id="ADG70581.1"
FT                   /translation="MNINRLKRVINSMKEKNIYQFVITDRMSIYYLTNINIHSGERFLG
FT                   LYINQDNEVHLINNQLFPLNNNDIDILYYSDAESAVKKLSKFVRKDKNIGIDKVMTSNF
FT                   LLEMMELNIAESYLNASSCIDYVRMQKDEEEIKKMIKASEINDKSMNDIINFIKSGIKE
FT                   IDVLEELKLIYKRNGADDAGFSFEPIIAFGANAANPHYSTGDTIIGDNGCLVIDMGCIY
FT                   DGYCSDMTRTIFFGEPNEEAKKIYNIVKTANEMAIDKVKEGLKFSDIDNEARSYITEKG
FT                   YGEYFTHRTGHCIGMDVHEYGDVSSIHHANLKEGMIFSIEPGIYCKDENIGVRIEDLIL
FT                   VTKDGHRSLNSFTKEMIIK"
FT   gene            587705..588145
FT                   /locus_tag="Bmur_0479"
FT   CDS_pept        587705..588145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0479"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /EC_number="4.2.1.10"
FT                   /note="KEGG: bhy:BHWA1_00617 3-dehydroquinate dehydratase,
FT                   type II; PFAM: dehydroquinase class II"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70582"
FT                   /db_xref="GOA:D5U6L6"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6L6"
FT                   /inference="protein motif:PRIAM:4.2.1.10"
FT                   /protein_id="ADG70582.1"
FT                   /translation="MNILVINGPNTNMLGAAQTEIFGNTTLGNIEKKIKEAALGSAKVS
FT                   FFQSNHEGAIIDRIHRAYDESTDYIIINAGAYANTSIAIRDAFLATNIPFVEVSMRNIY
FT                   AAENYRAKSYLSDIALGVITGFGDNSYILALAHLLSIQKRNN"
FT   gene            588164..589279
FT                   /locus_tag="Bmur_0480"
FT   CDS_pept        588164..589279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0480"
FT                   /product="peptidase M24"
FT                   /note="PFAM: peptidase M24; creatinase; KEGG:
FT                   bhy:BHWA1_00618 PepP, Xaa-Pro aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70583"
FT                   /db_xref="GOA:D5U6L7"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6L7"
FT                   /inference="protein motif:PFAM:PF00557"
FT                   /protein_id="ADG70583.1"
FT                   /translation="MCKLTLNESGENKKFDYDSRLNRLLKLTKENLLITKNENIFYLTG
FT                   FKGTAGWLLISGGKKYLFVDSRYSEHATKVTHKTTVILVATTYADALAEFCKENNIKEV
FT                   YAAKSGLYLAEYEAIVSAMVNSSIKIGISKIDADVIRQVKEKAEIKIIKDNLNRAEKAM
FT                   TKMLAFVKEGVTENELAAELEYQMRKEGGDKTAFDTILLFGDRTSLPHGVPSDRKLKLG
FT                   DNILMDFGLSKDGYKSDITRTFFFGKGEHFEEMSKIYNIVRTAHLKAIEAVHSGVLGKE
FT                   VDKAAREIIKSNGYGQYFGHGLGHSVGLEIHESPRLSPLVDHILDGGSIVTIEPGIYVP
FT                   NLGGVRIENMVIVTKEGGVSMNNTPTDLIVL"
FT   gene            589376..589969
FT                   /locus_tag="Bmur_0481"
FT   CDS_pept        589376..589969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0481"
FT                   /product="Domain of unknown function DUF1994"
FT                   /note="PFAM: Domain of unknown function DUF1994; KEGG:
FT                   bhy:BHWA1_00733 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70584"
FT                   /db_xref="GOA:D5U6L8"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6L8"
FT                   /inference="protein motif:PFAM:PF09352"
FT                   /protein_id="ADG70584.1"
FT                   /translation="MARRKKKSSPILIILAIIIASIYYYYNKTNTEKSQKQTVTRYNRD
FT                   DWGDWIDEDRDGLNTRHEVLARESLINPLISNNKVISGKWYDKFTGKYFTNARDLDIDH
FT                   LVPLKNAYESGASNWSKEKKNEYYNYMKNENHLIAVSKEANRSKGDKSPVEWLPPNEEY
FT                   QCEYVREWYKIKTDWGLTIEEGFDEVSNRVCRGK"
FT   gene            complement(589973..590302)
FT                   /locus_tag="Bmur_0482"
FT   CDS_pept        complement(589973..590302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0482"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00024 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70585"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6L9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG70585.1"
FT                   /translation="MGYVHKDLANGRWKTFTLAQQMGNIGSEVYRAISFKKKNNVEYSK
FT                   NAAYRALELIDLTIEAQYKKHSIKEFTRLREVICDYLLGDNEFHTDESIMKYFDSFAYM
FT                   ANKDK"
FT   gene            complement(590312..590602)
FT                   /locus_tag="Bmur_0483"
FT   CDS_pept        complement(590312..590602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0483"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00023 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70586"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6M0"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00023"
FT                   /protein_id="ADG70586.1"
FT                   /translation="MLGNFFPEMVKGVVDIEKKYLALDAELHSDLEALLIENGSSQRDL
FT                   WGINIYPELEDFIEFDSLINIRPIYNNKTRYVEDENIRNDIINIINNIVKR"
FT   gene            complement(590647..591654)
FT                   /locus_tag="Bmur_0484"
FT   CDS_pept        complement(590647..591654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0484"
FT                   /product="aminodeoxychorismate lyase"
FT                   /note="PFAM: aminodeoxychorismate lyase; KEGG:
FT                   bhy:BHWA1_00450 aminodeoxychorismate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70587"
FT                   /db_xref="GOA:D5U6M1"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6M1"
FT                   /inference="protein motif:PFAM:PF02618"
FT                   /protein_id="ADG70587.1"
FT                   /translation="MKKLLIILIILAAIVSASSVAFIQYMISPVGGDSEKVYFEIKQGE
FT                   GASTIAKKLELQGLIRNSKIFVAFAKYLKYDRKLLSGYYQVDRSMSMIDIMKHLNSGKQ
FT                   AMVRLTIAEGKNIYEIGAYLEAQGFTTKKEFLEVCHDKEILQKYNIPSDSVEGYIFPST
FT                   YYIVKGNPTKVLVTYMIDSLFKQFPDLEDRAKKIGRSVHEVLTMASIVEKEMGPLDDPK
FT                   LISSVYYNRLNIDKRLEADPTTIYAMTLVKGDYIEKPNLKYADLRMEHPYNTYKNTGLP
FT                   PGPICSAGAKAIEAALNPADTDYIFFVADGTGKHAFSVTYEEHVENINRYIFKR"
FT   sig_peptide     complement(591589..591654)
FT                   /locus_tag="Bmur_0484"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.970 at
FT                   residue 22"
FT   gene            complement(591728..592975)
FT                   /locus_tag="Bmur_0485"
FT   CDS_pept        complement(591728..592975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0485"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="TIGRFAM: histidyl-tRNA synthetase; KEGG:
FT                   bhy:BHWA1_00451 histidyl-tRNA synthetase, class IIa; PFAM:
FT                   tRNA synthetase class II (G H P and S); Anticodon-binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70588"
FT                   /db_xref="GOA:D5U6M2"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6M2"
FT                   /inference="protein motif:TFAM:TIGR00442"
FT                   /protein_id="ADG70588.1"
FT                   /translation="MLDIKKPRGTNDFFYDSSKRLEFIESKIKDIVKLYGYGRIRTPLF
FT                   EYTDLFTRGIGEGTDIVGKEMFTFEDRGGRSLTLRPEGTASVARAYVENSMQNEFAINK
FT                   LFYLGTMYRAERPQKGRYREFNQFGVECIGGTSPLIDAEIILLNINVLKEFGIDNVNLL
FT                   INTVGCSKCKPSYNNALKEAIGSRKDELCETCQKRYEGNILRILDCKNEKCKETIKDIP
FT                   KFYDYVCDECKEHFDKLCDELTRIGQNFTVDHMLVRGLDYYTKTAFEVQTNALGAQSAI
FT                   LGGGRYDNLIGLFNNGKDVPAVGSAMGIERLLLVLESQNNIITDRLDVFIVAFKETENN
FT                   VLKVMQTLRANNISCDYDFACKSVKSQFKSANKRNAKYALVLGEDELKREMCKLKNMDT
FT                   GEEKEVSLNDIHSNIK"
FT   gene            complement(592993..595110)
FT                   /locus_tag="Bmur_0486"
FT   CDS_pept        complement(592993..595110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0486"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00452 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70589"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6M3"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00452"
FT                   /protein_id="ADG70589.1"
FT                   /translation="MKKFISIALALLFSLPLFSQNSITFPEYIEDLQEKSPRKSIEWFK
FT                   KNGYSYEYGVNRYVFDFYRGVSRYLSFVKFKAARTEVNRAASDFRQALELPNDPVYSYN
FT                   DRAFLYIGGILTILPGDKELPARIFKYYADNCKTSNPNYATAIYWSMYLSYITPMVYSS
FT                   YYETLNILSRNPENTIYDYFTGDNKSISEMMKNLKSPENMTQRVYEWTTSNMDIYTLIK
FT                   NSIPILPEEEGLSAFTSEKFAVFERYSPAKEIEDIEKEIEEKDEEDLPQETIAPEEKEE
FT                   LDELQNIAKKEKTPENASNRRIPAIEEEILDEIVIEDPEVVEYKTNVLRGTNTAGKIEV
FT                   IPSEEAEILLEDDNITNSYDGKILYPLTILIDKNPNNGNIGVDIEDYSFNTDISTNFVI
FT                   EVSEGIYDAYISFGDKLYTNSVKVEKDKYNLFSIIIEDHYTNENTNISEENKENAEETL
FT                   TNSNEVSETLEEENVKENTEDVSLTVGKENTPANKYDGNAENTRNIIREVLSRPAKVAT
FT                   EWFNTNPYNEYMGISVEEYTYYRGVAYYSRFLNEGRRSAEFAAQAKSDLTFAYNKKDNS
FT                   NLLMRTRLYLGAVNLFAYNDLYEADKMFAEVGSSLSEDHRYYPTVIYWRARIGVIDETQ
FT                   RNNFINILASKPKDTQILDYSSTMFKDLSVMPSYEDKITGIRAVKSSKPLYEPPKNISK
FT                   AGSSKTQEILN"
FT   sig_peptide     complement(595051..595110)
FT                   /locus_tag="Bmur_0486"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.961) with cleavage site probability 0.907 at
FT                   residue 20"
FT   gene            complement(595244..597061)
FT                   /locus_tag="Bmur_0487"
FT   CDS_pept        complement(595244..597061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0487"
FT                   /product="selenocysteine-specific translation elongation
FT                   factor"
FT                   /note="KEGG: bhy:BHWA1_00362 selenocysteine-specific
FT                   translation elongation factor; TIGRFAM:
FT                   selenocysteine-specific translation elongation factor;
FT                   PFAM: protein synthesis factor GTP-binding; Elongation
FT                   factor SelB winged helix 3; elongation factor Tu domain 2
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70590"
FT                   /db_xref="GOA:D5U6M4"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004535"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015191"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6M4"
FT                   /inference="protein motif:TFAM:TIGR00475"
FT                   /protein_id="ADG70590.1"
FT                   /translation="MNRIIGTAGHVDHGKSELIKALTGIAMMRLPEEKKREMTIDLGFG
FT                   FFKPNDDITIGVIDVPGHERFIRNMVAGMWSLDLVMLVVCASEGWMNMTEEHAKVALSL
FT                   GIRNVICVMNKIDLVNEDKLKESEEDIKKNLYRIFNKDIEIVKVSALNGTNIDLLKERV
FT                   TDILISEKYEEDIKRHIYVDRVFSIKGAGLTITGSIRGGSIKRDDTLIHYPSRKEVAIR
FT                   NIQSYHEDREIVYSASRIAINLKNIKKEEIRRGHLLCDKTETVFLTDEIILELLHNSDV
FT                   EYLKKIKNAEFAIGTECAVAQIIPMYKRAVYNDSDKKIKTDVDIREIDDRFIRLKFDEP
FT                   IAVFWKERGILISHGGSNIIGTGDVFWGSKTTPHIRKSIMDNAHDFLGKVKRDKYTDLV
FT                   MSVNGYSIAGGNIPEYAVSISNYFVKKDYLNNLLEETKKLIASKKDGFAFEDIRNHLNI
FT                   DNAFTKPFIDYLVQNKIIMPFNNIYKKYTQSVDLTNSQKLLLERLKKEDLNGLDEKAIK
FT                   VFPNGMKDIKVLSASKQAMYLEDGIYYHIDVYSRVKNLIMKNAKPKDIITIAFVKEKTG
FT                   LSRKYVIPLLNALEREKLLKRQGNDRVVI"
FT   gene            complement(597434..598789)
FT                   /locus_tag="Bmur_0488"
FT   CDS_pept        complement(597434..598789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0488"
FT                   /product="L-seryl-tRNA selenium transferase"
FT                   /EC_number="2.9.1.1"
FT                   /note="TIGRFAM: L-seryl-tRNA selenium transferase; KEGG:
FT                   bhy:BHWA1_00360 selenocysteine synthase; PFAM: Pyridoxal
FT                   phosphate-dependent transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70591"
FT                   /db_xref="GOA:D5U6M5"
FT                   /db_xref="InterPro:IPR004534"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018319"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6M5"
FT                   /inference="protein motif:TFAM:TIGR00474"
FT                   /protein_id="ADG70591.1"
FT                   /translation="MNNKFNLVQTNTVLEHESIKPYHDTLSRPIIADIIRDTLEKLRIE
FT                   LKNNPNFSPSKDEIIKLCEKKIKQKSNLPIKRVINATGTIMHTNLGRSPIDAEVWDKVK
FT                   TLNICSNNLEYNINNEGRGIRGEFLYSLLSKLTGAEDALVVNNNAAAVFLILKTLAEGK
FT                   EVIVSRGEQVQIGGGFRIPDILREAGAKLVEIGTTNIVTLKDYEEAITENTAMILKVHA
FT                   SNFKIRGFVKHPSFKKIRDAIPNNIPLVYDEGAGIFDESMSEEEHIKSALKSGVDLVCF
FT                   SGDKMFSSVQAGIIVGKKEYIERIYKHPLMRAFRCGKTVLSILEKSVIKRLNSQGQFKG
FT                   YCETLLAIKPEIIKQKALKIIENIEGFEVIEELVETGGGAMADTFYQSYAISFKPKDIK
FT                   AVIKFMHNLDIPIIPKVKKDSVLIYVITINDEDIEYIKEVLIKIKNGNFLAV"
FT   gene            599635..600216
FT                   /locus_tag="Bmur_0489"
FT   CDS_pept        599635..600216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0489"
FT                   /product="nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /note="TIGRFAM: nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase; cytidyltransferase-related domain
FT                   protein; KEGG: bhy:BHWA1_00605 nicotinic acid
FT                   mononucleotide adenylyltransferase; PFAM:
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70592"
FT                   /db_xref="GOA:D5U6M6"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6M6"
FT                   /inference="protein motif:TFAM:TIGR00482"
FT                   /protein_id="ADG70592.1"
FT                   /translation="MKIAILGGSFDPPHIGHLILADTVMTNCNYDKVIFIPAKTPPHKN
FT                   ISGKVSNDDRLNMLKLSIENDERFLLDEYELNNEGISYTINTLNYLYKNYDIERKIGLI
FT                   IGADLVRDFDKWREPQKIAEISDITVVNREDDKNLYKEHIDKYNIKVIMAPRIDISSSL
FT                   IRNRIKEKKGFRYFVTDKVYDYIVSKKLYL"
FT   gene            600244..601143
FT                   /locus_tag="Bmur_0490"
FT   CDS_pept        600244..601143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0490"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, periplasmic component"
FT                   /note="KEGG: bhy:BHWA1_00604 ABC-type
FT                   nitrate/sulfonate/bicarbonate transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70593"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027024"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6M7"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00604"
FT                   /protein_id="ADG70593.1"
FT                   /translation="MKNLKLILIILFVFINSLYSQKMYLLNGPTSIGGLKMMKEYNKIT
FT                   INTVNAPNNMLSLIVKGEADIAAIPANMAAIIFNRQLDYKVIAVISETKLFIVSANNKI
FT                   QTINDIKNSTVYCGTKLAAPDLMLQYLISKEKIPNVNINYSLSNPDLSKAVASKNVDIA
FT                   ILPEPFLSSAMLENKDVHIVVEMSKYIDNYPVAVLIAKNYFINHNKMLVKEILDEYKKS
FT                   TDYIINSKEEIKNLLKERNMIINAEAAYYGLNRMGLVFYDGEKMKFALNSYYNFLFNFD
FT                   KKSIGGKIPNDNFYYIEK"
FT   gene            601181..602332
FT                   /locus_tag="Bmur_0491"
FT   CDS_pept        601181..602332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0491"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00261 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70594"
FT                   /db_xref="GOA:D5U6M8"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6M8"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00261"
FT                   /protein_id="ADG70594.1"
FT                   /translation="MENIDKNNINTNAYKNIIKNFNIVIGISFILLISSIYIIPIFSIN
FT                   IPKINSDTNLALLETVLSENFIFYIKIFFSFLIPLTFFIFTFLFVLNPISVKSILISFV
FT                   LIFLTAIYLYNLQYEVLLNPLENIKSIINLIVHIIAANFIMLFISALSYIKYNIKKLNN
FT                   LYDFYTMIAEIIIWSFLIFFIILLIIGTVFTLLYFNDKIDIKILIKYLLKNNLKNLKIL
FT                   LSIFTIITTLVIYFSFIIYNKMPNTKLSINISRTLSSFISAASILIIIYNLSNNHNILL
FT                   YACIIFQALSIINMFLFRIDKEYKLITQIIYIISNAVGIIFSVFCLKNYVSVFSDIFVI
FT                   IFNIIIIVNYIHNIIAAIIKKYRNFIFTYNYIYVIFFIIILFN"
FT   gene            602379..603083
FT                   /locus_tag="Bmur_0492"
FT   CDS_pept        602379..603083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0492"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00262 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70595"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6M9"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00262"
FT                   /protein_id="ADG70595.1"
FT                   /translation="MGVYILKKSLLFASFFILLAFTYNLNALNLAIGLVSQFGISGANT
FT                   NSSKIFPSSFRDFDSGLSFSIGINKDLSSSMSLSLLLDLGYCHDAYDFKYTIEGKRATE
FT                   NYQFESFLIGGYGRFNFSFISLGAGGGVKIPVYATYKLESYNKYRRYRFRFGDLNDIFE
FT                   RAVIPYVKVSLDFTIFNYLLVGIYANYDFPLYFQYNNYIEDTIINKDSISAFDIGVQFG
FT                   YLFNLSLDRDYY"
FT   sig_peptide     602379..602462
FT                   /locus_tag="Bmur_0492"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.767) with cleavage site probability 0.557 at
FT                   residue 28"
FT   gene            603094..603780
FT                   /locus_tag="Bmur_0493"
FT   CDS_pept        603094..603780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0493"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00263 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70596"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6N0"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00263"
FT                   /protein_id="ADG70596.1"
FT                   /translation="MKKLIACLFGIIFLLPLNNIYAADFVAGFVGRFGASSATTDRSKI
FT                   FTADFRDFETSFSFQPGVFWGYDDFLSSALLLDIGYNKDKYELKYTVNGGRLLENYDFN
FT                   SISFGLFPRLNISFVSIGVGGGIKIPLSLKYSKEGDAYSYNKYSLDFGDIKDSFETFYI
FT                   PYVKVSLDFLIKTKGKFMMSLGVYANYDFPININRNGLLKDISIDKESIAAFDIGFQIG
FT                   AYLVNR"
FT   sig_peptide     603094..603162
FT                   /locus_tag="Bmur_0493"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.987 at
FT                   residue 23"
FT   gene            complement(603996..604349)
FT                   /locus_tag="Bmur_0494"
FT   CDS_pept        complement(603996..604349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0494"
FT                   /product="preprotein translocase, SecG subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecG subunit; KEGG:
FT                   bhy:BHWA1_02635 putative preprotein translocase subunit
FT                   SecG"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70597"
FT                   /db_xref="GOA:D5U6N1"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6N1"
FT                   /inference="protein motif:TFAM:TIGR00810"
FT                   /protein_id="ADG70597.1"
FT                   /translation="MNALLTLGIVVYSIICVLLILIIIIQGGKAEGLFSSAQANVLGSQ
FT                   RGNALTKATTFLSTIFIVGALLISVAISTQKTAFESVTDTNPATTTNQQQNAPLSAPTN
FT                   TETLPNNTASSNQ"
FT   gene            604551..606149
FT                   /locus_tag="Bmur_0495"
FT   CDS_pept        604551..606149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0495"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_02634 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70598"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6N2"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_02634"
FT                   /protein_id="ADG70598.1"
FT                   /translation="MAVKKTDTKKNTAKKTSAVSKTTKSSKPVKKAVSEEKVSGRISYK
FT                   ELSEELKLKLKESEEKIAELNQKYKKVVDIQKKKIENKYKKIIEDLESKKSIPAKTQSS
FT                   NAEINKLQKRLEKLEKTNQKLEEEKRKIELKNEELKQKAKEAIKSKTETASKTAKTDKE
FT                   TLKEIKALREQLIESEQEKKELKAKLKEAVSELKNAKKNTNKLSKEDKEQYKENLKILK
FT                   QIEKESKALDKKRELLKKEEEKLKEIRGDIKSSAKDIASTMKKSYLADDEEHNEENGNL
FT                   LSNMDAKTEEGITKLATLLCAAMDDYREQKEKERVEIEKESSEPIMSEGEERLNKASEE
FT                   LENLVENRLEDSDSSKDENLSKRPFTIIDKIENSRVEINEGYTPPSGGQTIVAAPQDAA
FT                   QAPQTPAQQPNITVKVEAPKESAKLAKPETQLKPASETPTMRMKLLDDIDDYEKKLVIT
FT                   YGFDNMPENTYYSKYKRILRNAARISLFGNLQEGLEMFKLIRDQNIPDEYKQMIDKNIQ
FT                   DITYYLRGLHRVRME"
FT   gene            606183..608936
FT                   /locus_tag="Bmur_0496"
FT   CDS_pept        606183..608936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0496"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_02633 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70599"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6N3"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_02633"
FT                   /protein_id="ADG70599.1"
FT                   /translation="MKKIIKIVLIILIIPIIFSCSKKKIYDREIEALYDKSDNSYTISY
FT                   PEYNKQYPKYISLKYGKSVKIQNGIILTYNIDTDNIPIQLNIEVNENNIKKTFNIENPL
FT                   VNRNINLTIYATNFNPPLEKDKIDELSVSIKSIGNTDTKDTVKIAIAENEDKRVSRENI
FT                   ALILPESGHIAKSNPPFIMVNKRTTFTRISVSKELSFSSRYEYTLRNNSFFSMTNQLEN
FT                   GKWYIAFDENGDTNLRRIYHFFIDDSSTKIIPITNKTFNIKRPFVFIDKQTFDVLYNLL
FT                   YRQNRLQASTLLRNINAFKLYTSASMGKWSVNNISYTNTDDTNKLNFEDLPSHAMLMSL
FT                   KAAFEPNNNLLKYEIKQMIRDIVNIDEANIPNYKETDAVTILANSLLMPFDLMYDEFSP
FT                   EEIVLMKQEFIKYGEILYNYIIENPSEYRKKDTIKYASALGLIAINMLNENVNQDQIRN
FT                   WHYFAMNYINGMIFSMFEKDGSFKSSISEAFDTILPILTYALSLKNVGIFDAFSLESFQ
FT                   NIGKYLSIVGYPSGYTLPIGYTAIDNRSRLRFDTGARSAVMELLSKMYANPLYKNYAVF
FT                   AQSEAVNLRYLPYVLMWNNYYLRDNVPSNPEFQYETLLLKKIQTAIYNENIKTFNSPYL
FT                   AVYAKGRNADSSFGLDHNDRMSFVYYNYGDSIIDELGYNFDTNNYELFKDADFHNGISI
FT                   DNEKIEENTGSYSYIESMTNYYKMFYAHAKANQQYTYSINLKNYNRRFYYLKPNILIIK
FT                   EDIEALPDITREYHVYGYKYKWAFNSKLPMVLENNKFIIEGNYSSTYVEVLSQNELEYK
FT                   VIQTNIGNNILYRAEVSTKENIKRFEPWVIVSTMPKNNVPIAMRRNILNTNITVNSFTS
FT                   TNLNFKAGYKDYNINIENYKNTSDNTNKINNIVYTENRESVIISSY"
FT   gene            608951..609724
FT                   /locus_tag="Bmur_0497"
FT   CDS_pept        608951..609724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0497"
FT                   /product="glucosamine/galactosamine-6-phosphate isomerase"
FT                   /note="PFAM: glucosamine/galactosamine-6-phosphate
FT                   isomerase; KEGG: bhy:BHWA1_02632 putative glucosamine-6-
FT                   phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70600"
FT                   /db_xref="GOA:D5U6N4"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6N4"
FT                   /inference="protein motif:PFAM:PF01182"
FT                   /protein_id="ADG70600.1"
FT                   /translation="MNIYIANSYKDYIDFTAKHILHFLEKKQEKKEKLYISVSSEYDTK
FT                   DIYKSIIENIKFYKINFKNIFIFQQSEYIGLSPTDKNSKAYFLKENLISKLNIPEENVF
FT                   LFDGKGDESQMYKQLEIIKKIGRFDVIWYSLTADSTSAGNERMSSLSSLFRIKTLSEHS
FT                   ISEIKKRFPEDKEVPTTVFSMGMGFIDIVDTVLLTSSGIEKSCSLRDCLEYGISNSSPL
FT                   SKLQKHSDVTVIADYESSLRLSSQTVFMKIEKNIK"
FT   gene            609738..611702
FT                   /locus_tag="Bmur_0498"
FT   CDS_pept        609738..611702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0498"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /note="KEGG: bhy:BHWA1_02631 putative N-acetylglucosamine-
FT                   6-phosphate deacetylase; TIGRFAM:
FT                   N-acetylglucosamine-6-phosphate deacetylase; PFAM:
FT                   glucosamine/galactosamine-6-phosphate isomerase;
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70601"
FT                   /db_xref="GOA:D5U6N5"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6N5"
FT                   /inference="protein motif:TFAM:TIGR00221"
FT                   /protein_id="ADG70601.1"
FT                   /translation="MRIIITNESVYEWAAYYTVKCILDYSETDKPFVLSFPLRYVNKAY
FT                   YQKLLSFYNDNIVSFKNIHIVSSGEYIDSDISQKYLEDNFLKFIDIPKENVHLFDSNVA
FT                   NRKEEAKRMANLIKELGNITLLIDTLAEDGSFLLNTPSSSLEGSVRDKKISEIIRSYES
FT                   KKFNMPIEMFPREGFTLGFEEAFNAKYVLVMASGYEVSDALAHCVEGAITQFYPTSVLQ
FT                   EHKKLIIVADEESSSDLKVKTYKYAKSLESKSLHPKELIKGLYKSYYALTNIKIFDGEK
FT                   FIDGHCIVIENNVIKSVEKEIDVDAVITRIDLGGKIVAPGYIDLQVNGIGGYDINASPT
FT                   VETLKNMNEVCQRYGCTSYLPTVITNSDEYMIKIIDLFNNIEDLSVMGVLGIHFEGPYI
FT                   SHEKRGIHNEKFIREPNIDMIKKINASKCVMVTVAPEMVNGEVIEAFAMGGKVVSVGHT
FT                   NGTYNEIKEKIPYGITFATHLFNAMRPWGSREPGAVGAVLETKDMYAGLICDGVHCDFA
FT                   SVELAYKLKTGHICIVTDAIAPAAAPEIKEYIWAGKKIHRDGNRLIDDNGTLGGSSITM
FT                   SQSVRNVVNHVGAAVEEALKMASLYPAKVMGIDDKYGRIKEGYIADLVILDENLIVKGV
FT                   VFKGNYKEYNYDHEWVTHA"
FT   gene            complement(611770..614913)
FT                   /locus_tag="Bmur_0499"
FT   CDS_pept        complement(611770..614913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0499"
FT                   /product="D12 class N6 adenine-specific DNA
FT                   methyltransferase, putative"
FT                   /note="KEGG: cjr:CJE0310 D12 class N6 adenine-specific DNA
FT                   methyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70602"
FT                   /db_xref="GOA:D5U6N6"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041635"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6N6"
FT                   /inference="similar to AA sequence:KEGG:CJE0310"
FT                   /protein_id="ADG70602.1"
FT                   /translation="MIKELYLYLESIKDITTEDKEHSYRASLESLLNAIKNNLNFNKIN
FT                   IKHEPNNDKEGRGAPDFLVTIDSLVLGYIENKRVNANLDEIIKSEQIKKYLLLSDNIII
FT                   TDYLRFILIDENLNIIDEVRICELSEIKNYKKIKLEEVSKKLSDIFKIFFSREPKPINT
FT                   ALEFADALAMRTRILRDDLYELENNNHIERLYNIFKSTIYSQIGFADFCDNFAQTLTYS
FT                   LFLARLNTNEKIDLYNVTKFIPKSFPLIRAMSKFLQDLEELNINDLKTIEWLLNEIINI
FT                   TNHINIVSIVEELNKYDNTVSQKDPYMHFYETFLYKYNPELRELRGVYYTPQSVVNFII
FT                   DSIDIVLKEYFNKNKGLGDALEKETNITLLDFAAGTGTFLLDSFRKALSYYQKNSVKYN
FT                   PKELINKFYGFEFMIAPYTIAHLKISQTLKEEFNYNLEDDERLNIFLTNTLENIDLDES
FT                   KGKNNIFEELNEEMNLAQKTKEKEILIITGNPPYSGASANKGIFEEEVRKEYKDGLESP
FT                   PLAITRNGKVEKEKNPKWLLDDYVKFIRFAQQKIDNQKAGGIFGFISNNSFLDNPTFRG
FT                   MRYSLLKSFDEIYIVNLHGNTRKKEVCPDGSKDENVFDIMQGVSINIFVKHSQKIKDKR
FT                   VEDSKLNPSYYKHGSDYANVYYYDLYGKREYKYNFLLDNNIKSIEWHKLEYKEPFFLFV
FT                   KQDEELREEYDNFYSVKDMFRLYNVGIVTSKDSVLIGLNKEKLEEQVKNYYNEFNSSFI
FT                   ETINYRPFDKRFVYYDTDKIERARKDIMEHFSKDYDNIGIVFKRGFSFLDSGQGFITNK
FT                   IIDFRSWSSPGMQGGDFLAPLYLYNTPSAKKAIQAENYNVGDLFEQYEENPFENSYKIE
FT                   NFTVNFRNFIDKKYDYNFSPEDILGYIYAVLFHKTYRTKYIDFLKIDFPKIPFTDSKDI
FT                   FIKLSSLGTKLYNLHLMKDNDLNADIGEGLYKDDKNNKIEKPLYNEKENRLFINKSLYF
FT                   DNVSKEVWLYKIGGYQVLDKYLKSHKGEDIDYSYFQKIIQVLHKSLIIESEISAIDFL"
FT   gene            615075..615160
FT                   /locus_tag="Bmur_R0008"
FT                   /note="tRNA-Ser1"
FT   tRNA            615075..615160
FT                   /locus_tag="Bmur_R0008"
FT                   /product="tRNA-Ser"
FT   gene            615174..615848
FT                   /locus_tag="Bmur_0500"
FT   CDS_pept        615174..615848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0500"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_02629 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70603"
FT                   /db_xref="GOA:D5U6N7"
FT                   /db_xref="InterPro:IPR022781"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6N7"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_02629"
FT                   /protein_id="ADG70603.1"
FT                   /translation="MIKKISIIFLAVFIAAFSQETNTQTNQIINTNENIQNTETNFFNT
FT                   PLNNTNNINEPAILQDIRNIENRAQVSNGWMFFKAIIGFIVTLVGIYLVFMYMKNKSKK
FT                   VSGSSEIIKVLATTPLAPNRYVSIIEIVDDMYLVSISDHNINMLSKIEDKETKDQIKMM
FT                   YINSKNNIVDDSFKNILNQTLSVFKQPKMKEKDPLKTTSEIRERLHDLNSNNPTNKEDS
FT                   QK"
FT   sig_peptide     615174..615230
FT                   /locus_tag="Bmur_0500"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.520 at
FT                   residue 19"
FT   gene            616268..617335
FT                   /locus_tag="Bmur_0501"
FT   CDS_pept        616268..617335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0501"
FT                   /product="Glutamyl aminopeptidase"
FT                   /EC_number="3.4.11.7"
FT                   /note="KEGG: bhy:BHWA1_00620 FrvX, cellulase M-like
FT                   protein; PFAM: peptidase M42 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70604"
FT                   /db_xref="GOA:D5U6N8"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6N8"
FT                   /inference="protein motif:PRIAM:3.4.11.7"
FT                   /protein_id="ADG70604.1"
FT                   /translation="MNDILNLMKNLTNAFGPSGFEDDVIEVIKNNTSFIDNERDSINNL
FT                   YLGLNKIDKNKPIVGLDCHIDELGFMAEHINDNGTISFIPLGGWHIPNIVSNSVVIKSS
FT                   SGEYVKGVIGSKPPHFMTEEDKRKLPSLKDMYIDVGTRSKKETEEIFGIQIGDPIAPDV
FT                   DFRYDDRTKSICAKAIDNRVGALCVIETLRALKDEKLDVNLVGIMTAQEEVGARGAAVA
FT                   SNKVKPDLVIVFEGSPADDTFYYGDRAHGAIGRGSQLRVIDGGMITNPRLNKYTIDIAK
FT                   KNNIAHQVIVREKGSTNGAVYHKTNLGAPSVVLGVATRYAHSHYCYASYDDIIASIDIA
FT                   KELIKTLNKEKIKEF"
FT   gene            complement(617407..617835)
FT                   /locus_tag="Bmur_0502"
FT   CDS_pept        complement(617407..617835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0502"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00621 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70605"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6N9"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00621"
FT                   /protein_id="ADG70605.1"
FT                   /translation="MDDKDIMDPNVYQIKKNDWEVLEDDNYYIYKLLAYKLSSWSEDTY
FT                   LIVKLNKVNNSKEIIIDWNSKDFVFAQHKTFFRFDNDLPDNLECKASEDKLSSIVLKPD
FT                   YVYDNLLDADMLIVRASLEKSKTTRMFDVSKFKDIVRK"
FT   gene            complement(617901..619025)
FT                   /locus_tag="Bmur_0503"
FT   CDS_pept        complement(617901..619025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0503"
FT                   /product="sialidase"
FT                   /note="KEGG: bhy:BHWA1_00622 sialidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70606"
FT                   /db_xref="InterPro:IPR011040"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6P0"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00622"
FT                   /protein_id="ADG70606.1"
FT                   /translation="MKINILYETIIFEDKNLYPAFPSVVKLDNNRYLVSFRLAPKIKKH
FT                   YSHLHSLSKSMLAIINKNMVEKVFEFAQDDEAAKQDAQLFRIDDKTIMAYYFRYTFHPI
FT                   NEKELFKDYTFIEYDSTIALLDGIGVCMSYDNGKTFSTPHIIKINNDNTIMKNFAIRGS
FT                   MCKLNNSEVLAPIYAYKKNINKNNSKYQCYIISSKDLINWKLKTFLSETDYKKINGKNS
FT                   KIEYVEPSLLNYKNNIIAFIRTHINNEYGLTSISYSKDKGKTFSRPIFTNIKGYPLNPL
FT                   FLSNGKLLLTYGYRLKPYGIRAILLDNADDIFDIEKINYKASNEEIIIDSSMKSTDCGY
FT                   PWCAEDNGIISCVYYGYKDKNKIRKIYMKRFTFN"
FT   gene            complement(619120..619896)
FT                   /locus_tag="Bmur_0504"
FT   CDS_pept        complement(619120..619896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0504"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00623 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70607"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6P1"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00623"
FT                   /protein_id="ADG70607.1"
FT                   /translation="MKTKNIIAITMLILSLSSVSAFSQNIGEPTGNAFLDYMHGRSLFG
FT                   INFGHTLYAGLFDIGVGIMEPTVQSMIDNMTGGMANNYIDTKLKHYAFGLGFSYDFAPL
FT                   DFMTVGLDVGFSVGELKIDKYKIGFSTVPWSLNVKFFFGRNAPFGFFISPRIGGTALSI
FT                   SGNALTEAGLSDIYSHGGFYLSFELGWRIQLFPKTGANWPVQVGLDISLFDIGYYAAPW
FT                   ASPLFEIQYLEQFKQYGVFANIRALFLPRIGITLRF"
FT   sig_peptide     complement(619825..619896)
FT                   /locus_tag="Bmur_0504"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.943 at
FT                   residue 24"
FT   gene            620089..620190
FT                   /locus_tag="Bmur_0505"
FT   CDS_pept        620089..620190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70608"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6P2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG70608.1"
FT                   /translation="MKNNKINQRYRNIRRQNINKKRQYNKKNIIQKV"
FT   gene            620733..621359
FT                   /locus_tag="Bmur_0506"
FT   CDS_pept        620733..621359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0506"
FT                   /product="TPR repeat-containing protein"
FT                   /note="KEGG: bhy:BHWA1_00624 TPR domain-containing protein;
FT                   PFAM: TPR repeat-containing protein; SMART:
FT                   Tetratricopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70609"
FT                   /db_xref="GOA:D5U6P3"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6P3"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ADG70609.1"
FT                   /translation="MDNYNIRLQTSLNETVKSSNNLINFWFAFLTVIIIVFTLITLIIN
FT                   NNILKKSKRKIKVFNNNYNKKLKEIKIHIKNFEKLKKENDKTIEINTLYNLANTLFDLK
FT                   DYNNSIYYYDKVLELYNNFIYGIYNKAVSYYYINDYDKCADSFIYLYNKEISIKDLVLK
FT                   NIIELANKNIEKAIQFCRNENIDYKSLQQKEEKISIFDRIRNILY"
FT   gene            complement(621520..622197)
FT                   /locus_tag="Bmur_0507"
FT   CDS_pept        complement(621520..622197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0507"
FT                   /product="DNA-(apurinic or apyrimidinic site) lyase"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: bhy:BHWA1_00625 N-glycosylase/DNA lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70610"
FT                   /db_xref="GOA:D5U6P4"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6P4"
FT                   /inference="protein motif:PRIAM:4.2.99.18"
FT                   /protein_id="ADG70610.1"
FT                   /translation="MDKEYAKHLMGIYKDKVLHERMKRRLEYFERVFKRDNDKRLFAEL
FT                   AFCICTPQTKARSGAAAIIDLYNNNLLFKGSAEKVANILIKHVRFHNMKAENIVLARKI
FT                   YFPNEKFVLKDRINEALKNDTMVELRNELAKEVKGYGLKEASHFLRNIGFGQKIAILDR
FT                   HIMRVMDKLSILPEGMTPKTSLTKNNYLSCESNLVEYSKSEKIPMEYLDFVFWYDATND
FT                   IFK"
FT   gene            complement(622277..624001)
FT                   /locus_tag="Bmur_0508"
FT   CDS_pept        complement(622277..624001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0508"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: apob; apolipoprotein B"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70611"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6P5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG70611.1"
FT                   /translation="MKNHFINKKIYFLLLLLILIIVMIISCKKINILSPTHIPPPTDFT
FT                   LPEDTIPSHVDVNPVPAKDGEVFGSFRRKFKYQGKWYILADYMYDYDTKSKALNKKAED
FT                   IILQIDESGNIVVYDKDSKGYDDLLRMNVIEENRVLYEDSYYGKYSYSSSSFTTKDCKG
FT                   EEGYHSFRTGITFNNEVRTSSDLINWTTEGSDDNVYKTFPSVSTDPNASFQGRFGAKYY
FT                   KIVEFKDYIYLIGLEEDFDEQNPSGCRNESQGPFKTSKNIYYRIYKNKDTSIGANWEKI
FT                   NTPWGQRSYLGVRYDKDKIYVTKGERSYWEWISPPYWTSQKESFENDSTIWSSSDGVIW
FT                   NIEPNSSAYDNANSVYSYDQYVGGDLPPIQKKIRTPEEPNWVRLDNGRYYKSDNSPYST
FT                   YTINNKTYYVPIPPYEEIRAAYDSGQEYFTITEAHIKSAGLNQFLTKDKEPNKDEDWTV
FT                   ITPIDYTDKLMVWQSGGENVMLNINNKAVQLVDYKQIEYMYNTIKDYSIVINDLRKTAK
FT                   ELRDGTYFDPFVNNYVKNVRAGMEYDARADMLELLMNNREYIMPDEAVTHYTVEFKY"
FT   gene            624530..625597
FT                   /locus_tag="Bmur_0509"
FT   CDS_pept        624530..625597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0509"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: bhy:BHWA1_00716
FT                   putative exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70612"
FT                   /db_xref="GOA:D5U6P6"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6P6"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ADG70612.1"
FT                   /translation="MPKLLISSDLHLSLQEKEYSLSVLDEILEQAENYDALLLLGDTFN
FT                   TFEDLQELKDTFSKKIENYNKNVYLLKGNHENLKSKGITLNKLKFPDNLIVIEDISFFN
FT                   IDNLDIVALPYSEKYIIDNELNKKIENLNADNRIVIAHGIVEGTLWAIEENEEAASIPI
FT                   DIIKKIEPNIAVVGHIHKQMEVNIENIEIIYTGSARVWRRTKSEMGERRCLAIDIQNNS
FT                   INKSFINIKNAGEYRVYESNIYNISNLEQKASEWNINDIIDINIYGIAEDENELEEKIN
FT                   SIKNKYSKYVRDINIKTKELFLLENAHNESIIKEFLAIAEEHEFATNNEEDLEIVEIAK
FT                   RIGIEKIYSALQNKR"
FT   gene            complement(625606..626643)
FT                   /locus_tag="Bmur_0510"
FT   CDS_pept        complement(625606..626643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0510"
FT                   /product="glycosyl transferase family 9"
FT                   /note="PFAM: glycosyl transferase family 9; KEGG:
FT                   bhy:BHWA1_00299 lipopolysaccharide heptosyltransferase II"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70613"
FT                   /db_xref="GOA:D5U6P7"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6P7"
FT                   /inference="protein motif:PFAM:PF01075"
FT                   /protein_id="ADG70613.1"
FT                   /translation="MKILLIKQTSLGDVLHMTPVIRALKKWKADCQIDVVTDKRALGIL
FT                   ENNPYINKLYVLDIYRYEKEIFKSPLLFFSTIREFISHISEVRKESYDIAMDLQGLERS
FT                   IIFLYLCHAKKKYAKGKWIGVKSNYYKDINAIEGLISFLKFIDCPNDGTDLDYFLPDTI
FT                   EADFNKKIEHIKYSINSNFNIDKEYIVFSPFSRWDTKDLSVNKSREIIKEIQKLKDIQI
FT                   ILSATSDYDKECLEIVKGFDNVLNSSGLFNLPELAYLIKKSKGMVTVDSFPMHTGCAFQ
FT                   KPLIAVFGPTSEVRVGPIAKNSETIRVENLECARCYKRKNCPNNHICIENIDAKLLAER
FT                   LIKKI"
FT   gene            626824..627813
FT                   /locus_tag="Bmur_0511"
FT   CDS_pept        626824..627813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0511"
FT                   /product="protein of unknown function DUF534"
FT                   /note="PFAM: protein of unknown function DUF534; KEGG:
FT                   bhy:BHWA1_00396 ABC-type uncharacterized transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70614"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6P8"
FT                   /inference="protein motif:PFAM:PF04392"
FT                   /protein_id="ADG70614.1"
FT                   /translation="MKKNHIIIFILIAVFVLVGAFGISRHENDKKTNASNDKVVKIGIS
FT                   QMIEHDALDLIYKGIEDELNKYYNNRSKKIVIDYKNAQGEQANCNTIAQKFVNDKSDII
FT                   IAIGTPAAQSAVNLTKDIPIIASGIGDPIGAKLVTNLNKPNVNVTGTINLPPIEKQIEL
FT                   MHTLLPNAKKIGLLYCSSEINSLYQIKLAKEKLDSLGLEYIDLTVANANEIQQMMISAA
FT                   DKVDAIFSPTDNIIANSMANVAMIEESEKLPVICADAGMTKIGGTVTYSVDYYDMGVLT
FT                   AKKAIEVLEGIKDIKNIPLETVDSYNFVVNTNMINRLGLTIPNDIYMN"
FT   gene            complement(627897..629357)
FT                   /locus_tag="Bmur_0512"
FT   CDS_pept        complement(627897..629357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0512"
FT                   /product="Radical SAM domain protein"
FT                   /note="KEGG: bhy:BHWA1_00782 Fe-S oxidoreductase; PFAM:
FT                   Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70615"
FT                   /db_xref="GOA:D5U6P9"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6P9"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADG70615.1"
FT                   /translation="MSNKINNIYIGYPPFESDRGVALLSQNRQFQWFKSPTYIYPVVPA
FT                   TAATMIKNAGYEVDFVDAIARNMTIEQWYKYLDEKTPDLLFFEVKTPVIYKAWKIVNDL
FT                   KAKYPNMIVVIAGDHVTAMPEETMNNCKVDYLLTGGDYDFLLLNLIEYLNGKAQLEKGI
FT                   YYRENNNIKNTGFFELRHDLKSLPFIDRDLTQWQRYAYDNGNFKRIPGTYIMAGRDCWH
FT                   HRCTFCSWTGIYTNFRARTAENVVDEVEFLYNKYNIREIMDDTGCFPVKKWLNDFCNFM
FT                   IDKKLNKKVNIDCNMRFGACNEDEYRLMKKAGFRFLLFGLESASQNTLDRLKKGNKVEE
FT                   ILPSCKAASDAGLSPHVTVMLGYPWETEEDIEKTYELTKKLLLKGYAKTMQATIIIPYP
FT                   GTELFNQCKKENWLTTENWEDYDMRKAIMKTDVGEDKIKEWVQKLYNLSFTPQFLMHKV
FT                   LSIRDLDDIKYYLRAFKKVSSGHLKDFA"
FT   gene            complement(629452..630255)
FT                   /locus_tag="Bmur_0513"
FT   CDS_pept        complement(629452..630255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0513"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bhy:BHWA1_00910 DP-dependent 7-alpha- hydroxysteroid
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70616"
FT                   /db_xref="GOA:D5U6Q0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6Q0"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADG70616.1"
FT                   /translation="MKLLNKKIALVTSATRGIGLACSKKLAENGAKVYLAVRRLDAGKK
FT                   IADEIIKNGGEADTVYFDASKEETFTSMIEETVKKENRIDILVNNFGTTDTNKDFDLIN
FT                   GDTEAFFNIVNENLKSVYLPSKAAVKHMINTGGGSIINISSVGGIFPDMSRLAYGISKS
FT                   AINFLTKNIAVQYARQNIRCNAVLPGFVATDAAMENMSEDFFKLFLKNVPLNRPAEPED
FT                   IANAVLFFASDYSSFITGETMPVAGGFGLPSPMYSQYMDMGGKKG"
FT   gene            complement(630334..631647)
FT                   /locus_tag="Bmur_0514"
FT   CDS_pept        complement(630334..631647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0514"
FT                   /product="multi antimicrobial extrusion protein MatE"
FT                   /note="PFAM: multi antimicrobial extrusion protein MatE;
FT                   KEGG: bhy:BHWA1_00911 NorM, Na+-driven multidrug efflux
FT                   pump"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70617"
FT                   /db_xref="GOA:D5U6Q1"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6Q1"
FT                   /inference="protein motif:PFAM:PF01554"
FT                   /protein_id="ADG70617.1"
FT                   /translation="MDILKTDVKKIFFKYLYASFGSALIAAIYSIVDVAMVGQYEGDNG
FT                   AAALAVFAPIWNIIYSIGMLFGIGGSVLFSKARGSGDYKKSNIFFTSSFIALSIVIFIV
FT                   WILSIVFEDNILYFFGADDVLLRLAKIYFLPIKIILPLFSFSQFFAAYLRNDNAPMKAT
FT                   IAVMAGGIFNIFGDYFFVFVCDMGIFGAGLATAIGQVITASILISHLFTKKNTLKFVKV
FT                   NKLFSLSKNTVSIGFSTFFIDIAMGILALMFNNQIMKYFNSSALAVYSVIININILVQS
FT                   SAYAIGQASQPIISANLGAGNMNRIKSAVKYGIFTALILAIISTLFTYFNTDFLMKAFM
FT                   KPSDEALSMSKNIMRAYFISFLILPFNIYATYYFQAIMKPTASFIIAVLRGLIISGILI
FT                   FVMPLIFVRESIWYVMPITEVLTFIVTAVFFIRYRTLK"
FT   gene            631947..632663
FT                   /locus_tag="Bmur_0515"
FT   CDS_pept        631947..632663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0515"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00913 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70618"
FT                   /db_xref="GOA:D5U6Q2"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6Q2"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00913"
FT                   /protein_id="ADG70618.1"
FT                   /translation="MSVLSALAYSFPYKMYTGMTGALRLGGTIYVNNDRIGTKKYTLSS
FT                   PIMINFGIFRNFDIFARVLPMTYLPELGVGVEGEPQFSIMPRFQFFNGFIGAVEVLFPG
FT                   SSKQKFGLNPQIHYLIGLGDFLTMYANLEVPMYFNDPRGVVESLRLKMALGVYPGALFG
FT                   FSLAGIYLEYHIAYDFYNSAFLYLNHLGLGLYLVLNSDASLSLNFTPYLEQLASGFYFG
FT                   IGVSLSYTFDFNKLRR"
FT   gene            632729..633238
FT                   /locus_tag="Bmur_0516"
FT   CDS_pept        632729..633238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0516"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00914 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70619"
FT                   /db_xref="GOA:D5U6Q3"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6Q3"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00914"
FT                   /protein_id="ADG70619.1"
FT                   /translation="MIITNVLLYPIVIVEDKVNKKSMYEWENIEYSLLYTGDAGKFKPS
FT                   GINENAISDFEVINKEIEMETIHKDNEVPTMNYKITYTLKPIRKGKLKIPELEAAYYNV
FT                   ERGNSLVPHEQLIKEYNIRVFSSWFILIMIGQWAVIILIAFLIFKFIKEQHNFNKKAFE
FT                   NKKTIK"
FT   gene            633248..634237
FT                   /locus_tag="Bmur_0517"
FT   CDS_pept        633248..634237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0517"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="KEGG: bhy:BHWA1_00915 MoxR-like ATPase; PFAM: ATPase
FT                   associated with various cellular activities AAA_3; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70620"
FT                   /db_xref="GOA:D5U6Q4"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6Q4"
FT                   /inference="protein motif:PFAM:PF07726"
FT                   /protein_id="ADG70620.1"
FT                   /translation="MTENNSLQAISEASKMALDVVQAIKSEIKKVIIGQENMIDKLLLG
FT                   IICDGHVLLEGVPGLAKTLTVKSLASTIDASYKRIQFTPDLLPADIVGTEIYDIKNSAF
FT                   VPKQGPIFSNIILADEINRSPAKVQSALLEAMGEHQVTIGDTTYQLPDVFLVLATQNPI
FT                   EQEGTYPLPEAQVDRFMLKVIVKYPTKSEEKTIIKNMSSSKPEELKSITTIETIEKLRK
FT                   LANQIHIEERLIDYIVNIIDATRNPKEYKLQSEYIEYGASPRAGIYLTKAAKANAMMQG
FT                   RGFVMPEDIRAVAYEILRHRISITYEAQAENINSDMIIENLLANINVP"
FT   gene            634863..636314
FT                   /locus_tag="Bmur_0518"
FT   CDS_pept        634863..636314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0518"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="KEGG: bhy:BHWA1_00919 catalase; PFAM: Catalase
FT                   related subgroup; Catalase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70621"
FT                   /db_xref="GOA:D5U6Q5"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR040333"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6Q5"
FT                   /inference="protein motif:PRIAM:1.11.1.6"
FT                   /protein_id="ADG70621.1"
FT                   /translation="MSDKKLTTEFGAPVENNQNSITAGPRGPMLLQDVWFMEKMAHFDR
FT                   EVIPERRMHAKGSGAYGTFTVTHDITQYTKAKIFSEIGKKTDLFVRFSTVAGERGAADA
FT                   ERDIRGFAIKFYTEEGNWDLVGNNTPVFYFRDPLKFPDLNHAVKRDPKTNMRSAQNKWD
FT                   FLTSLPEAIHQITIDMSDRGIPYSYRYMHGFSSHAYSFINKDNKRFWVKFHFKTQQGIK
FT                   NLTDEEAAAIIAKDRESSQKDLFEAIERGDYPRWNMKIQIMTEEQANASKRNPFDLTKT
FT                   WSQKEYPLIDVGVLELNKNPENYFAEVEQSAFSPSTIIPGIGFSPDRMLQGRLFSYTDT
FT                   QRYRLGVNYASIPVNAPRCPFHSFHKDGYMRVDTNNGAKTPYEPNSNGEWKEQKEYAEP
FT                   PLKLYGDAFRYDHREDDDDYYTDARALFNLMSDEQKKVLFENTARDMNGVTKEVKLRHI
FT                   KNCMNVDKAYGLGVLKALGIDEKDI"
FT   gene            complement(636500..637696)
FT                   /locus_tag="Bmur_0519"
FT   CDS_pept        complement(636500..637696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0519"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   bhy:BHWA1_00947 aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70622"
FT                   /db_xref="GOA:D5U6Q6"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6Q6"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADG70622.1"
FT                   /translation="MDISKRIQRLKVSPVRKLNPYAEDAVKRGIKIYHLNIGQPDIETP
FT                   KIFFEAISKYNGTTLRYEHSRGLALLIDRIQKYYEKLGIHYDVEDIVITSGGSEAISFA
FT                   MLAIFDEGDEILVSEPLYANYKSFYDVFDIKYNAVRTYAEDGFHLPSREEIEKHITPKT
FT                   KAFMLANPSNPTGVVYTKREMDDIAYIVKKYDLFLISDEVYREFVYGDRTAISFGTYKD
FT                   IEENVVIIDSISKRFSACGARIGCLISKNKKLMTAVFRECQARLSLPTLDMLGAVALYE
FT                   LPDHYFDAALKEYDYRRRIIFEELNKMEGVVAREPEGAFYVLAKLPVKNAEDFIIWLLK
FT                   DFNINGETVMFAPAEGFYATEGLGKDEVRISYALDSNDLKKAMNILKEALIKYKEVEK"
FT   gene            638120..639763
FT                   /locus_tag="Bmur_0520"
FT   CDS_pept        638120..639763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0520"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00948 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70623"
FT                   /db_xref="GOA:D5U6Q7"
FT                   /db_xref="InterPro:IPR013229"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6Q7"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00948"
FT                   /protein_id="ADG70623.1"
FT                   /translation="MFFNIELIIKIKTEYMYRKKIIKLLLILLFSSLSLYPFGGKPIRI
FT                   EEVRPYYTSTETAKIDIYIYTNIGDNTNYNYITFAVADAIANQLEYNKTIRLQSETNYT
FT                   ITPIDFERAYDYKVFQFTNITYTSRQEGTNITIVTNYEYTTYTNWGDVRSNVKLITPET
FT                   KGFILQTNEMIFDYNGTNVILKGTNDFIQKVDIGKNYYEYFGDDIKKYVFTRNSDIAIF
FT                   GTVEYKRPNINIVTYVAYIKDRKINSYSMTVPEARIDEQVPNYALEIANRISYLDKTGI
FT                   IAIDVSPPDSFVYVDDIFVGKSGDTLYVPALTTNNHRFTIKKESYETIDTMLSFENPNE
FT                   NILLQFKLDELTNAARVQINIPGEEASSVVINGVKETPTNVINRYFGFGTYSLKITNKN
FT                   YIDYYGTFTVNSTNSLNLTPNMKKFKEPTLADKIFKNYERNTKIFFGLTIASAIFSIGT
FT                   YVYAGEILDSTMVKYYNQYQNALNRPEVDLRNYNTAMNIYIAGMVLTGAFALTTGIYYM
FT                   LWINESNFAVEELSFNAGYSGANIMYSWRW"
FT   gene            639867..640424
FT                   /locus_tag="Bmur_0521"
FT   CDS_pept        639867..640424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0521"
FT                   /product="adenylate kinase"
FT                   /note="KEGG: bhy:BHWA1_00949 adenylate kinase; TIGRFAM:
FT                   adenylate kinase; PFAM: adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70624"
FT                   /db_xref="GOA:D5U6Q8"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6Q8"
FT                   /inference="protein motif:TFAM:TIGR01351"
FT                   /protein_id="ADG70624.1"
FT                   /translation="MLNIIFIGAPGVGKGTQSALIEKDYSIAHIATGDMLRENISNGTE
FT                   LGKTAKSYMDKGELVPDSLVIDMLKARITKDDCKNGFMLDGFPRTMEQAKELSSILDSL
FT                   NYKISAVIDIFASEEIIIDRLLKRGRADDNEETIKNRLKVFESQSKPVLDYYNGKAKII
FT                   KIESVGTPEEVYARIKKELDSL"
FT   gene            640720..641184
FT                   /locus_tag="Bmur_0522"
FT   CDS_pept        640720..641184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0522"
FT                   /product="NusB antitermination factor"
FT                   /note="KEGG: bhy:BHWA1_00950 transcription antitermination
FT                   protein NusB; TIGRFAM: transcription antitermination factor
FT                   NusB; PFAM: NusB/RsmB/TIM44"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70625"
FT                   /db_xref="GOA:D5U6Q9"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6Q9"
FT                   /inference="protein motif:TFAM:TIGR01951"
FT                   /protein_id="ADG70625.1"
FT                   /translation="MIVKSKNKENIKDLDLSAYGARRQARIYAVMSLYSYEINERKISI
FT                   NNILDFDYDKKIPENIFAFTRNLVEGTIKNLERIDSLIEKYSNNWDIKRIQYVDKSIIR
FT                   MSIYSLIFLKDIPKSVVIDEAVEIAKIFSDKDSYKFVNGILDGIQEEDIQ"
FT   gene            641156..643051
FT                   /locus_tag="Bmur_0523"
FT   CDS_pept        641156..643051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0523"
FT                   /product="TPR repeat-containing protein"
FT                   /note="KEGG: bhy:BHWA1_00951 TPR domain-containing protein;
FT                   PFAM: TPR repeat-containing protein; SMART:
FT                   Tetratricopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70626"
FT                   /db_xref="GOA:D5U6R0"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6R0"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ADG70626.1"
FT                   /translation="MVYRKKTYNRRLAKYKNLQMVVFILCIGALGFIAIISLNVAIMQG
FT                   KVRLNYQSADDYTLAKEYYKNKDYNKAKSILKKEISTTIDPKKQYEANILLGQIYNETE
FT                   DYDNAIKIFNTMTNSLYLDEKLKHNLGISYLEKEMYDEALTSLETSLSINSNYIPSLLT
FT                   LGRFYMERNLPRLAKGYYERVLSLEESDEALFYVGLIALNEGFQSVAYDTLSKLVRRSK
FT                   GEYADKAATILGDIYVISGDTDSAIEMYLKSLVNSDTKPDSIRRLVKIYEQVEDYDGIK
FT                   KVYEQILEQNPNDIDTILALGELYEKENAYDRAIKYYLKLTKMKDYTNTYEAIGLLANS
FT                   YYKGSMLKEAEANYKKILMADNKDDLYKTALERLGDITYRQKDFMPSLKYYQEIYKIET
FT                   NNAIFMPRLGELELYYGNSDRGIKLLKDSIAEDVGNAFPSRTLAIYYESIGNINEALNY
FT                   YNYTLSKYPKDRESIYRAGMLYYKTKNYEKSKESLLIAANDENNTTLVRENAWVTLAAM
FT                   MEEIRSYNDAAAYYRQLVEMSPSVENFMLYGAFSYRRLQYNDAIYAYNEALNLASSKRD
FT                   LFDINLALGKCYYRMNELDNAEESYRNALSYNGGDSQAKDGLRQVLTKKELMYNN"
FT   gene            complement(643362..645242)
FT                   /locus_tag="Bmur_0524"
FT   CDS_pept        complement(643362..645242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0524"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dol:Dole_1466 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70627"
FT                   /db_xref="GOA:D5U6R1"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6R1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG70627.1"
FT                   /translation="MIILFYLITILFIVSFVYIIKSDKDIFNIALNSKKEKFILILFCL
FT                   ASSISQIILLNSNYPYIGHDYSQIEARAMSMFLYYQNNGLDIEWASPLFGGGLLSYANP
FT                   NWHQYSPLYFLTLIMPFWYSYNVLTFLFSIIGFISVYILLKKDFNFNFISSLTGAVFFS
FT                   CTGYYIYHLKVGHWTFIYHPLTAFIVFIFFSNTISKLKFSFIIRVFSGAFVFSAMIFGG
FT                   AIHTIFFYTCFVLLGAAVIFFKLDFDFVKKCIAVILSVLLSFVLSLSRLIPIFILASKI
FT                   DRGRLMVDNVPFYKVFEVIYYNLILSVVGFIEKLFSLNLFFNIQYRGIWERDISLPFMM
FT                   LPIIIAIIIINRKDIKEYIINLSKFDKLKIILFIIWFYLVFDIHYDNGIINSLFPFLKK
FT                   MNLRLRICSVLILPFSIFLSYLLNKYKLFDKRKFAAVMLLLNIYTIFFFVYKHADNFYY
FT                   GEPFRNVDLKIGMEVWNKINDLGSNNNYKITEISEEGEGKILEQFLSNDYNLHSSRFPY
FT                   EPIYGYGLETFESKEEGSIYKTNNNYYNFTHPNSLIFFDDNYKQFTGFSLEQKDDLEKF
FT                   ASFKKVDWKLPKIFYTANDVSFYSYIAVSVLLAVIIVINFIYYLIHRKKN"
FT   gene            complement(645313..646884)
FT                   /locus_tag="Bmur_0525"
FT   CDS_pept        complement(645313..646884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0525"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_02536 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70628"
FT                   /db_xref="GOA:D5U6R2"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6R2"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_02536"
FT                   /protein_id="ADG70628.1"
FT                   /translation="MKKNIILYSAFIIPIILTIIIHIYGFPRAKADFDQFKQYDDMVTL
FT                   YNMNSIPVLGTKMWNADADYTPRMPGGFYYILYTFIYRITNDNFFISRIVFMFLCFVVL
FT                   FVFLLWLYKRFGKYITAVFTALLLCNAYLFFASIDIYNPNPMIYLSFILLILFCEYVSD
FT                   GKYSYVSALFMFPIIALMAQCHFAVFFSIVPSLIVYHIIRFKTLTKKYIVPLLISVFIS
FT                   FLLYLPYLISEINNGFSNTLSMLSFREGGKLVGLPQIYCMLIYPTTEMSIFYGRTNAIL
FT                   YFWFKDNPFLVFMALMLLLTAAFSITAFVFSAKKVFTKNNQSLDVRDIMLRESMILYLI
FT                   YIPTTLLVFFIAKSKPGTFHYIYNAFALSFVPILILTKYIEEGRFMKLKTFLPIFAIFV
FT                   SIALSLHIFRTINLYTKQYSYDNHKALMQSIINDSNGEDFDLNTIRTISTIKEMYKFAS
FT                   IMYGISDEWNMNEEAKLTYFIFNRDMYFFTGKWTDVKEGKNKPIPEDAVKIWGDDVLAV
FT                   YRYMKD"
FT   gene            complement(646902..647831)
FT                   /locus_tag="Bmur_0526"
FT   CDS_pept        complement(646902..647831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0526"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   dae:Dtox_4133 glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70629"
FT                   /db_xref="GOA:D5U6R3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6R3"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADG70629.1"
FT                   /translation="MKISIIIPCYNEEEVLNTLYERINNVSKKLSDYECEFIFVNDGSK
FT                   DKTEQIIEELNKKDSRVKLFSFSRNFGHQAAVSCGIHNSKGDIAVIIDADLQDPPEIIP
FT                   DMIKEYEKTKTPIIYGKRVSRKGESIFKKLTASLFYRLINLLSEVKFPVDTGDFRLIDK
FT                   NVIEAYKSFSENPKYIRGLISWTGFEQRAFEYERDARAAGHTKYTFKKMLKLALTGILS
FT                   FSVKPLRISLFLGILAIFIALAFSIRVFYLYLFNPETLVKGWASIIITILFMGGFQLIS
FT                   LSVISEYLANIFNEIKKRPEYIIKKTIE"
FT   gene            complement(647879..648064)
FT                   /locus_tag="Bmur_0527"
FT   CDS_pept        complement(647879..648064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0527"
FT                   /product="Av71 muscle cell intermediate filament, putative"
FT                   /note="KEGG: Av71 muscle cell intermediate filament,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70630"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6R4"
FT                   /inference="similar to AA sequence:KEGG:AaeL_AAEL011208"
FT                   /protein_id="ADG70630.1"
FT                   /translation="MKSEIRNQKSEIRNQKSEIRNQKSEIRNQKSEIRNQKSEIRNQKS
FT                   EIRNQKSEIRNQYINK"
FT   gene            648223..648780
FT                   /locus_tag="Bmur_0528"
FT   CDS_pept        648223..648780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0528"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00783 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70631"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6R5"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00783"
FT                   /protein_id="ADG70631.1"
FT                   /translation="MARVKFMEYEEAQGKVKEAFDYQLKKSGNVTNMKKALLNDYATYE
FT                   AFMGWYTSFDRLVEVVGKRAAMILAHSVSTTNGCMLCSLFFIRDLKAIGEDPKNLKLDE
FT                   KEQLLSQLGMQMVKDPNAVSDELINNLKKHFNDSEIVTIVGFAAQMMATNNFNAVLKID
FT                   LDESLVPIQGEFEKETWRAKNN"
FT   gene            complement(648868..650628)
FT                   /locus_tag="Bmur_0529"
FT   CDS_pept        complement(648868..650628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0529"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70632"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6R6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG70632.1"
FT                   /translation="MKNKVYLIICLISTAFIISCEKINLLRPSHIPPPTEFLVSDEMPD
FT                   YILPSPIPPENIEESYIEIKPEVVADGTVFGGYGRRFKYKNEWYVLATNEYQYDINTKN
FT                   LTPSGKGALLKINNDGSTITKIYSLSLAGDLENTEYWKNLNSKQLVIESDKVTIPSSKA
FT                   MQKTINFPKYPRRLDRANFYTTNPPPYYDFACYGNLIIYSIYRESQSLINWSDSSDEIE
FT                   KANYSIPMPNDYDPSIQGVYGMETLDFSALFYIKGKLFITGQKSFADDNPNGYRSYQSS
FT                   EYTDDSKDYYAVDITKDILNNDNWVKYEFPFPEKRQQFIIKYDRNKLDKIYIYGGISSH
FT                   YEYKGGYWTWTKDREFTDKDGVWSTEDGINWKEENNIDISKLDNYYYNANQEKIDVVGG
FT                   YEVKEDGTPLEPSYTELNGKYYRALKNTYPIPPIKEILEAADRFETNFTITEEHIKNSG
FT                   SYQLQVSSVSPDKALESDWANIVPNNEITSAIAWGSGGADLFTLNSKIVRLADYDRQFK
FT                   LDSQYETALNLSEKYYNLLLKSSMSDFKKYDYYFLYYKTMADMLKMIKDKGNDYFLPDR
FT                   AVTHYTFDIN"
FT   gene            complement(650743..651300)
FT                   /locus_tag="Bmur_0530"
FT   CDS_pept        complement(650743..651300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0530"
FT                   /product="flavodoxin/nitric oxide synthase"
FT                   /note="PFAM: flavodoxin/nitric oxide synthase; KEGG:
FT                   bhy:BHWA1_00251 flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70633"
FT                   /db_xref="GOA:D5U6R7"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6R7"
FT                   /inference="protein motif:PFAM:PF00258"
FT                   /protein_id="ADG70633.1"
FT                   /translation="MSTNIAVLYKSKYGTTRTYAKWIADKVHGDLYGIDNVTIENLNNY
FT                   DFIVFAGALYAGKLSSAKRIKQFFNKLKGDKHLYCVIVGLGDTNDKELYNNAVNQNFKS
FT                   DIKDHMKFYFLRGGVDFDKLKLHHALMMHMLRRIISAKAVKTEDEKLLLENYGKKIDFI
FT                   NKSAVEEIVLDIKNKSKELQNK"
FT   gene            complement(651600..651839)
FT                   /locus_tag="Bmur_0531"
FT   CDS_pept        complement(651600..651839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0531"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00073 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70634"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6R8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG70634.1"
FT                   /translation="MKEINRLNDLFVRYLIGTESDGDILENIVNAVLNDAGFEYVGNLK
FT                   IINPYNLAENENLKESIPPKVMLKQKLKMLKSTC"
FT   gene            651967..652431
FT                   /locus_tag="Bmur_0532"
FT   CDS_pept        651967..652431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0532"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /note="KEGG: bhy:BHWA1_00558 large-conductance
FT                   mechanosensitive channel; TIGRFAM: large conductance
FT                   mechanosensitive channel protein; PFAM: large-conductance
FT                   mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70635"
FT                   /db_xref="GOA:D5U6R9"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6R9"
FT                   /inference="protein motif:TFAM:TIGR00220"
FT                   /protein_id="ADG70635.1"
FT                   /translation="MIEEFKKFIMRGNILDMAIGIVIGASFTKIVNSFVEDILMPPIGL
FT                   ILSGIDFSNIFIVIKKGISDAGPYTSIEAAKQAGAVVIGFGVFINTIISFFITALAIFM
FT                   IIKIFNKMREKMVKKEKEDKEAEEKICPYCCSSVNIKAVKCPHCTSDLDK"
FT   gene            complement(652454..653227)
FT                   /locus_tag="Bmur_0533"
FT   CDS_pept        complement(652454..653227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0533"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bhy:BHWA1_00535 iron compound ABC transporter,
FT                   ATP-binding protein; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70636"
FT                   /db_xref="GOA:D5U6S0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6S0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG70636.1"
FT                   /translation="MNKTVMVKAENVSLYYKNNINKKEVLKNISFEVSQNESLCIIGPN
FT                   GCGKSTLLKSLCRIIDFEGNIFINNKDIRKIDTYKAIAIMSQMSSIYFGYTSYDTIMMG
FT                   RYANYKDKLLSMPSKEDKDFVIHYMEKLKLMHLKDKLITELSGGELQRVFLARTLVQNP
FT                   SIILMDEPTNHLDLNSQIELIYNLKEWVKNGDRCIIAVLHDINAALNFADKLLVLKEGG
FT                   SKYFGSTNNFDVSLLNYIYDIDVFEYMHNSFLRWS"
FT   gene            complement(653229..654233)
FT                   /locus_tag="Bmur_0534"
FT   CDS_pept        complement(653229..654233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0534"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   bhy:BHWA1_00536 ferric ion ABC transpoter"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70637"
FT                   /db_xref="GOA:D5U6S1"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6S1"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ADG70637.1"
FT                   /translation="MIKKIIIILILVFISSILSVCIGSVFISPKEIICILIYKVSSIEL
FT                   IHINKINSDIINIRLQHSVLSLFVGASLSMTGVVIQSILRNPLASAYNLGVSSGAGLGA
FT                   SLLIVMNISFNQYFFIGVSMIFAFITILFILFISKKIDKYMSSNSIILAGIVISLFLSS
FT                   VMSFLSYMFPKYSNKIILWQLGSLFVRNKIDILIIISMTLLFLLILIKYSSVLDIITFG
FT                   DETSLSLGVDVKKMRIFFILISSFITAVLVAFTGVIGFVDLVSPHIARKIFGAKHIIVF
FT                   PASALIGGLLLNVSDIFSRIIVQGSNIPIGIVTAVIGAPFFLYIFISNKNNGM"
FT   gene            complement(654241..655185)
FT                   /locus_tag="Bmur_0535"
FT   CDS_pept        complement(654241..655185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0535"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   bhy:BHWA1_00537 iron compound ABC transporter, periplasmic
FT                   iron compound-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70638"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6S2"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ADG70638.1"
FT                   /translation="MFIFMKKIKIILLIIFNIFLLSCNASNTFDNTLKDRAGNSIILPD
FT                   SINTIASLSPAVTDIIIALGFSEKIIASDAASKEILQTNNIDISNISVFDMMNPDSEKM
FT                   ISINPDILFVNNFSVFSGKNSIDSINASGICTAVIPNSDTIKSIEDDIYFIGHVLNKNY
FT                   EASNIVNIMDLNVEKIKSIGNTITNNKKVYFEIAALPNLYSFGTNVYLDDMINIIGAEN
FT                   IFKDRNSWIAVSEENVLFSNPDIIFTSVDYVDNPEEEILSRQSWQNINALKNKDVYYIS
FT                   SSSLPTHNIIYALLDMAKYIYPNEYKDVQIIRN"
FT   sig_peptide     complement(655099..655185)
FT                   /locus_tag="Bmur_0535"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.923) with cleavage site probability 0.544 at
FT                   residue 29"
FT   gene            complement(655326..655955)
FT                   /locus_tag="Bmur_0536"
FT   CDS_pept        complement(655326..655955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0536"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   bhy:BHWA1_00538 biopolymer transport protein ExbB"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70639"
FT                   /db_xref="GOA:D5U6S3"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6S3"
FT                   /inference="protein motif:PFAM:PF01618"
FT                   /protein_id="ADG70639.1"
FT                   /translation="MDNIFGSESLLNSAMTVCWIGLLISSVLALTIIVDRFIYFTRIKS
FT                   EDNSLAPKLISLVKEKEIKAAIALCEASKSPLSNIIMSGLKNINAPKEFMQSASNKELP
FT                   RLERFISALSTISTIAPLLGLLGTILGMIQSFAVISVVGSGKPTALASGIANALLTTAA
FT                   GLIIAIPAVIFYNYFVNTINARILFMENLSNEISDYIISQNNEIDK"
FT   gene            656290..657348
FT                   /locus_tag="Bmur_0537"
FT   CDS_pept        656290..657348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0537"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="SMART: Semialdehyde dehydrogenase NAD - binding;
FT                   TIGRFAM: N-acetyl-gamma-glutamyl-phosphate reductase; KEGG:
FT                   bhy:BHWA1_00539 N-acetyl-gamma-glutamyl- phosphate
FT                   reductase; PFAM: Semialdehyde dehydrogenase NAD - binding;
FT                   Semialdehyde dehydrogenase dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70640"
FT                   /db_xref="GOA:D5U6S4"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6S4"
FT                   /inference="protein motif:TFAM:TIGR01850"
FT                   /protein_id="ADG70640.1"
FT                   /translation="MIKVSVIGATGYAGIELIRLLLSHSKVELKNLSSKSFVGKNINEI
FT                   YANLNKNCDKILADENEIFEDTDVVFASLPAGLSDDIANKCFEKNILFIDLGADFRLDN
FT                   EEDYKKWYGKEYKYKNIHKEAIYSIPEIIKYDSVYNKKDLKKAKIIGNPGCYPTSIGLA
FT                   LAPALVKKIILKDDIIIDSKSGATGAGRELKLNTHFTECNEAFSPYKVAEHRHTPEIEQ
FT                   TLSNIYGEDIKVTFVPHLLPLNRGIISTIYAKLENKNDTLENIHSIYKEFYKDSKFVRV
FT                   LNIGETANLKYVKYSNYCDISLHMDSRTNKLIIVSAIDNMVKGAAGQAIQNMNIALGLK
FT                   EDEGLNIIPPAF"
FT   gene            657806..659038
FT                   /locus_tag="Bmur_0538"
FT   CDS_pept        657806..659038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0538"
FT                   /product="arginine biosynthesis bifunctional protein ArgJ"
FT                   /EC_number="2.3.1.1"
FT                   /note="TIGRFAM: arginine biosynthesis bifunctional protein
FT                   ArgJ; KEGG: bhy:BHWA1_00540 arginine biosynthesis
FT                   bifunctional protein ArgJ; PFAM: arginine biosynthesis
FT                   protein ArgJ"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70641"
FT                   /db_xref="GOA:D5U6S5"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6S5"
FT                   /inference="protein motif:TFAM:TIGR00120"
FT                   /protein_id="ADG70641.1"
FT                   /translation="MYSFKQIEGGVCAAKGFKANGVHAGIKKNSEKKDLAIIYSESLCS
FT                   VGAVYTQNKACGANITVSKEHLKDGKAKAVICNSGNANTCNRDGVEKAKEMCKLAAEVL
FT                   GIDEKDVAVASTGVIGVPLNIEPIQKNIKTLIDNLGNSKEHAQNAAAAIMTTDTFMKEI
FT                   AYEFEIDGKIVHIGGMSKGSGMIHPNMATMLAFVTTDCNITSEMLQKALSEDVKSTYNM
FT                   VSVDGDTSTNDMCVVLANGEAKNNIIDKEDDNYKIFCKALNMVNTYLSKQMAKDGEGAT
FT                   KLIECEVINASDIKLARKIAKSVITSNLVKAAMFGCDMNWGRISCAIGYTEDADFDINK
FT                   VSINVGSKYGEMNVYKDGYGVEFSEEEALKILKEDEIKITIDMNSGTSKAVAWGCDLTY
FT                   DYVKINGSYRS"
FT   gene            659077..659943
FT                   /locus_tag="Bmur_0539"
FT   CDS_pept        659077..659943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0539"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="TIGRFAM: acetylglutamate kinase; KEGG:
FT                   bhy:BHWA1_00541 acetylglutamate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70642"
FT                   /db_xref="GOA:D5U6S6"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6S6"
FT                   /inference="protein motif:TFAM:TIGR00761"
FT                   /protein_id="ADG70642.1"
FT                   /translation="MENISNRDKAFILNQALPYMQRYTGKTVVIKYGGSAMENPELKKK
FT                   VMSDVALISTLGIRVIVVHGGGKDITAMLNKIGKESKFVNGLRYTDKETAEVVKMVLAG
FT                   KVNKDLAASLENCGGKCLGICGIDGGMFKVSKYKGDDDLGFVGDVDSVDTDLLNTIITN
FT                   KYIPIVATVGCDSEGNVYNINADTAAAKIAESLKAETLIYMTDTPGLLKDKDNENSLIS
FT                   QINIKDIDNLIKDGTISGGMIPKVKHCIEAVENGVSRVFIIDGRLCHSLLIEMFTDEGI
FT                   GTMFYKD"
FT   gene            659981..661219
FT                   /locus_tag="Bmur_0540"
FT   CDS_pept        659981..661219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0540"
FT                   /product="acetylornithine and succinylornithine
FT                   aminotransferase"
FT                   /note="KEGG: bhy:BHWA1_00542 ArgD,
FT                   ornithine/acetylornithine aminotransferase; TIGRFAM:
FT                   acetylornithine and succinylornithine aminotransferase;
FT                   PFAM: aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70643"
FT                   /db_xref="GOA:D5U6S7"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6S7"
FT                   /inference="protein motif:TFAM:TIGR00707"
FT                   /protein_id="ADG70643.1"
FT                   /translation="MPCKKTNKQNTENNDKSKLKKEYINNSKKYVANTYARFDLVLESG
FT                   NGAKLKDIEGKEYIDLGSGIGVNSIGYGNKSWINAVNSQAKTLQHTSNLYYTKPYIDLA
FT                   KKLCSITKYDKVFFCNSGAEANEAAIKCARKYSFDKYANDDKEYKRNKIVTLKNSFHGR
FT                   TMATLSATGQEVFHNYFFPFLEGFSFAEANNYEDTVSKLEDNACAVMMELIQGEGGVIP
FT                   LDKEYVQKIKKYCEENDILFIADEVQTGVGRTGKFLCSEHFGIKPDITTLAKGLGGGLP
FT                   IGAMLMNKTCSNVFNNGDHGSTFGANPIAASGALEVLNIIDKDLLKEVSKKSKYIKDKL
FT                   MKLDNVESVDGIGLMLGIKLKEGLNAKEIVEKCISKGAIPLTAKTKIRLLPPLTITDKE
FT                   LEKAVSILCECIG"
FT   gene            661645..662856
FT                   /locus_tag="Bmur_0541"
FT   CDS_pept        661645..662856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0541"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   bhy:BHWA1_00837 GltP, Na+/H+-dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70644"
FT                   /db_xref="GOA:D5U6S8"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6S8"
FT                   /inference="protein motif:PFAM:PF00375"
FT                   /protein_id="ADG70644.1"
FT                   /translation="MNILKNYRFSFILIFAIILGAVIGAVFGEKAAVLQPIADVFLNLL
FT                   YCCVVPMIFVSLVYSISNMENTNKLGKVLSVMIIIFLLAEIIASIYMLVITIIFNPAEG
FT                   ANIVMNETISNIKSNSNILAMFTVSDFNLLWSRQNLMALIVFAMFVGIAAVKSGEAGKP
FT                   VIKLFGSLTAIISKVVSYVMYLAPIGLGAFFAVLVGQNGAALSGPLSRALIIYFIAAIV
FT                   FYFLSNTIFAYLGAGIKGIKLFWKYIIPPSLVSLGTCSSAATIPTNLIAGRNIGIPDDI
FT                   NDLTIPMGCNLHKSGAALITVLKITFMCSMFNVNILEPQNIITAILVSVLAASVMGAIP
FT                   AGGYVGEIFIISAFNFPQEAIPIMVLIGTITDAPATTINATNDVGVGMLMARIFKGKNW
FT                   LKQN"
FT   sig_peptide     661645..661731
FT                   /locus_tag="Bmur_0541"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.874) with cleavage site probability 0.707 at
FT                   residue 29"
FT   gene            662838..663359
FT                   /locus_tag="Bmur_0542"
FT   CDS_pept        662838..663359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0542"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bhy:BHWA1_00975 GCN5-related N- acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70645"
FT                   /db_xref="GOA:D5U6S9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6S9"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADG70645.1"
FT                   /translation="MAKTKLNKLKGTKMEIIKYEKKYLKEALNIWNEIIKEGIYFPQIE
FT                   TLTNEEEAHKYFSSQDYTGIAYEDNKIYGVYILHPNNIGRCGHISNASYAVSKDARGKG
FT                   IGEALVRDSIKKGAELGYKILQFNAVVISNNAAHKLYEKIGFNKIGIVKNGYLNKNNEY
FT                   EDIVLYYIDL"
FT   gene            663377..663592
FT                   /pseudo
FT                   /locus_tag="Bmur_0543"
FT   gene            663589..663789
FT                   /pseudo
FT                   /locus_tag="Bmur_0544"
FT   gene            663816..664163
FT                   /locus_tag="Bmur_0545"
FT   CDS_pept        663816..664163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0545"
FT                   /product="nitrogen regulatory protein PII"
FT                   /note="KEGG: bhy:BHWA1_00836 nitrogen regulatory protein
FT                   PII"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70646"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6T0"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00836"
FT                   /protein_id="ADG70646.1"
FT                   /translation="MDLKKVKIEIYIPEEYTDKLREALNSIGALGVGNYDNVMSVTKIT
FT                   GYWRPLEGANPFDGEVDKISKAPEDKVEFSTDIKNVENIIKVMKEVHPYEEPVMNIIPL
FT                   INDRFNIVLNY"
FT   gene            complement(664240..665079)
FT                   /locus_tag="Bmur_0546"
FT   CDS_pept        complement(664240..665079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0546"
FT                   /product="electron transport complex, RnfABCDGE type, B
FT                   subunit"
FT                   /note="KEGG: bhy:BHWA1_00976 ferredoxin; TIGRFAM: electron
FT                   transport complex, RnfABCDGE type, B subunit; PFAM: Fe-S
FT                   cluster domain protein; 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70647"
FT                   /db_xref="GOA:D5U6T1"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR010207"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6T1"
FT                   /inference="protein motif:TFAM:TIGR01944"
FT                   /protein_id="ADG70647.1"
FT                   /translation="MMTSVLVASISSGLIALILAVLLIFSSKIFKVEVDERVTQLTEML
FT                   PGANCGGCGFPGCAQFAKALVDDKAPVDGCSVGGADTASKVADFLGKVAPAQKERTRAY
FT                   IFCHGHNGIAKSDKVYNGADTCVSAVMAGGNKNCSYGCVGFYDCMKACEFGAIIKDEKT
FT                   GMPVIVEDKCVSCNACVKACPQKLIEIHPVSQEFHVYCKSKDKGPIAKKACDRACIGCS
FT                   ICVKATKEGGMKIDNYLAIVNYDDYSITNESIAKCPTKAITNERVNAVKDLSEVKQA"
FT   sig_peptide     complement(664984..665079)
FT                   /locus_tag="Bmur_0546"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.743) with cleavage site probability 0.695 at
FT                   residue 32"
FT   gene            complement(665121..665702)
FT                   /locus_tag="Bmur_0547"
FT   CDS_pept        complement(665121..665702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0547"
FT                   /product="electron transport complex, RnfABCDGE type, A
FT                   subunit"
FT                   /note="KEGG: bhy:BHWA1_00977 RnfA, predicted DH:ubiquinone
FT                   oxidoreductase, subunit RnfA; TIGRFAM: electron transport
FT                   complex, RnfABCDGE type, A subunit; PFAM: RnfA-Nqr electron
FT                   transport subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70648"
FT                   /db_xref="GOA:D5U6T2"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR011293"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6T2"
FT                   /inference="protein motif:TFAM:TIGR01943"
FT                   /protein_id="ADG70648.1"
FT                   /translation="MVNLILLFVATVLVNNFVLTKFLGICPFLGVSNKLDSAISMGIAV
FT                   TFVLVLTAAVSWMIQYYILVPFKIEFLQTILFIIVIAALVQFVEMVVRKTSESLYLSLG
FT                   IYLPLITTNCCVLGLALFGVLYKYNFIQNIVFALGAGVGFTLALVIMASIRERLMTADI
FT                   PEAFKGPAMPFITAGILALIFYGFSGIIKI"
FT   gene            complement(665695..666354)
FT                   /locus_tag="Bmur_0548"
FT   CDS_pept        complement(665695..666354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0548"
FT                   /product="electron transport complex, RnfABCDGE type, E
FT                   subunit"
FT                   /note="KEGG: bhy:BHWA1_00978 SoxR-reducing system protein
FT                   RsxE; TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   E subunit; PFAM: RnfA-Nqr electron transport subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70649"
FT                   /db_xref="GOA:D5U6T3"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR010968"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6T3"
FT                   /inference="protein motif:TFAM:TIGR01948"
FT                   /protein_id="ADG70649.1"
FT                   /translation="MKNSQVFMEGVWKNNPTFVQVLGMCPSLAVTSSVMNAIGMSAATI
FT                   FVLVCSSALISLIKKIYANEVRIMGYIVVIAAFVTLTDIVMKAKFYTLSLALGPYIPLI
FT                   VVNCIILGRAEAFANKNGIIPSIFDALGNGVGFFIALTLLASIREILGNGTWLGFDIVG
FT                   SIRGFVESAMPFALNAYNEITTPWVVMIMAPGAFFTLGTLIAIKRAIDARGGKANG"
FT   gene            complement(666475..668388)
FT                   /locus_tag="Bmur_0549"
FT   CDS_pept        complement(666475..668388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0549"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="KEGG: bhy:BHWA1_00979 methyl-accepting chemotaxis
FT                   protein McpA; PFAM: chemotaxis sensory transducer; Cache
FT                   domain protein; histidine kinase HAMP region domain
FT                   protein; SMART: chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70650"
FT                   /db_xref="GOA:D5U6T4"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6T4"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADG70650.1"
FT                   /translation="MKINNLSFRIPFIISITFILCMFVIVLIITIVSSKSIEDTAIKGL
FT                   RVAAKSYSDMIDLYFSEKRLVMDLYSKDPNLARYLVNPTEENRLAAEASLKEFTREVAD
FT                   TEVFYNYSLVNFNANIILDSIGGKLLHINYGANSSDWTRFKETGYDFAGRDLIQPSSAN
FT                   PLNAICVIWKGIKDENGNVVGVLNSSINWMKFIADYITPSQLGRTGSIAIIDKNKNIIA
FT                   HNDTNKLYIYESNIIGTSAYERKPETIREREDKFFQYVLDNKEGILEYVDDNNVSEISL
FT                   FNPINNTPCYLIVSYSQDEIYGDKNRLTKIVIVIALIMSIIICLIGRLIAKSIIKPLNM
FT                   VVKEANDISNGYILISNDVTCSTRKDEIGNLMCSFYNMKGALTNAVNTVNAISSEAKNR
FT                   AEEISSKNDKLHSETENNFDKMHTAFDITNNIGNSVSETSNYANELIDIMKEANAYIDM
FT                   ADSSISEAADNSNSVSEVSNKIKDITKVIEHIAFQTNILALNASVEAARAGENGRGFSV
FT                   VANEVRNLAQNTSGSVKDISSLIEESQKRIELAADSVNKSKELFSDMKDKIEKTYSLLS
FT                   NFTEALKLQKEGIDSISMHISDIEKSSKNNTKLAEDVSEISKELEELSINLEEAVSFFK
FT                   LK"
FT   gene            complement(668942..669646)
FT                   /locus_tag="Bmur_0550"
FT   CDS_pept        complement(668942..669646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0550"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00922 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70651"
FT                   /db_xref="GOA:D5U6T5"
FT                   /db_xref="InterPro:IPR038750"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6T5"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00922"
FT                   /protein_id="ADG70651.1"
FT                   /translation="MTAAENDISFHKQNRNFIISGELALIIVVIINSFSVVLMLYSGSG
FT                   ISAISSVPYAFSEVITNISLGTFTYIFQGILVLVLMLLRKKFVAEYLFSFAVGFCFGKF
FT                   IDIHELWISHLPLTVTYRIIYFIISYFLLCFGIALSNRCKLPIIPTDLFPRELSNIINV
FT                   PYSKVKIIFDVTCLLTTGVITFVFLGHIKGLGIGTVLAAFTMGKVIGVIGQHIDRRIEF
FT                   VSLIKQKFNIDK"
FT   gene            complement(669922..671013)
FT                   /locus_tag="Bmur_0551"
FT   CDS_pept        complement(669922..671013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0551"
FT                   /product="ribosome small subunit-dependent GTPase A"
FT                   /note="KEGG: bhy:BHWA1_01064 ribosome-associated GTPase;
FT                   TIGRFAM: ribosome small subunit-dependent GTPase A; PFAM:
FT                   GTPase EngC"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70652"
FT                   /db_xref="GOA:D5U6T6"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6T6"
FT                   /inference="protein motif:TFAM:TIGR00157"
FT                   /protein_id="ADG70652.1"
FT                   /translation="MKIKDIGFDEYFENLALEALKVNSLEEINNEELVPARVIRINKRY
FT                   YTLFSDEGEFLARIKGKIRYNSEIQSELPVVGDWVLMKKSDNNAFIDTILTRKNILYRK
FT                   ANIKKNDIQAIVSNIDYAFIIVGIDNEMPMSAIARYLSVVHTSGIKPIIAISKIDLYED
FT                   EEYKELLAAIKETYPNETAFAYSSKTAKNTNTFLKYIKKDTSSVFIGASGAGKSTIINY
FT                   LLKDERMKTQEVREYDFKGMHTTTHRELLVLDSGGVVIDTPGLRNLGLWEDDKGIKKTF
FT                   EDLEEYAKRCKFKDCTHQHEPDCYILELLENDEIPYERYDAYITLLNENRELQKSSIEI
FT                   RKDRKIALKKITKYGNRNKKNNK"
FT   gene            complement(671164..673101)
FT                   /locus_tag="Bmur_0552"
FT   CDS_pept        complement(671164..673101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0552"
FT                   /product="cadmium-translocating P-type ATPase"
FT                   /note="KEGG: bhy:BHWA1_01068 cadmium-translocating P-type
FT                   ATPase; TIGRFAM: cadmium-translocating P-type ATPase;
FT                   ATPase, P-type (transporting), HAD superfamily, subfamily
FT                   IC; heavy metal translocating P-type ATPase; PFAM: E1-E2
FT                   ATPase-associated domain protein; Haloacid dehalogenase
FT                   domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70653"
FT                   /db_xref="GOA:D5U6T7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6T7"
FT                   /inference="protein motif:TFAM:TIGR01512"
FT                   /protein_id="ADG70653.1"
FT                   /translation="MLKNKERLLFLLEIFLGLIVLVLLYALHDKIHGITEYIIFFVPYL
FT                   ILGREVFKNAALDFIKGKFMRESFLMSIATVGAIILHQLPEALAVLMFYRVGDYFEDMA
FT                   VDKSKRTIAALMAIRPDSANIIRENGNIEKADISEVHIGDNIIINPFEKVPLDSVIYEG
FT                   ESWIDTKALTGESMPRSVKVNDEILAGTINGDNTIKAKVVRAYAESSIAKILKLVQDSQ
FT                   NRKANIEQFISKFAGVYTPIVVFGAIFLTVIPTLIYGKEVFANWFQRSLTLLVVSCPCA
FT                   FMVGIPLTYFASIGRASKLGVMVKGGVFLDLLAKTDKVIFDKTGTLTKGEFAIKEIYNT
FT                   GVYDDEAMIKYAAYAETGSSHPIAVSIVEHYKKHHNGTINDSLISSHKDISGKGASAVV
FT                   ENKNILVGGINLLKQNNIDTSNYKENINVHIAIDSKYAGGFLIDDSVKDDTKEAISLLN
FT                   SMNIKTALISGDNVNRVEEFAKEMNIQSFKGGCLPEDKVNVLEDMMKDSKASIFVGDGI
FT                   NDAPSLARADIGIAMGGLGSDAAIENADVVIMDDKPSKVASVIKLAKKNNIVVWQNILL
FT                   ALVIKFGAIILGALGLASMWLAIFADTGVTVIVVLNALRLLYPLGEKTENINADTKVCD
FT                   IKVTDCDCGH"
FT   gene            complement(673088..673456)
FT                   /locus_tag="Bmur_0553"
FT   CDS_pept        complement(673088..673456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0553"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="KEGG: bhy:BHWA1_01069 transcriptional regulator,
FT                   ArsR family; PFAM: regulatory protein ArsR; SMART:
FT                   regulatory protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70654"
FT                   /db_xref="GOA:D5U6T8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6T8"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADG70654.1"
FT                   /translation="MRKENITNNDDDCEVTTADENISSLIPKLPNDEEFSLLAGFFSVF
FT                   SDPTRLKIISALSEKELCVHELSSLLEMKQPSVSQHLKMLWQARVVKKRKVGLHVFYRL
FT                   DDEHIEKIYTWGYEHVKE"
FT   gene            674081..674686
FT                   /locus_tag="Bmur_0554"
FT   CDS_pept        674081..674686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0554"
FT                   /product="SmpB outer membrane protein"
FT                   /note="KEGG: bhy:BHWA1_01070 SmpB outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70655"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6T9"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_01070"
FT                   /protein_id="ADG70655.1"
FT                   /translation="MNKKILTLFLVVAASAILAVSCNNKTTNPVKDNTGSTTTTTPTGQ
FT                   EPTTTTPAGGAEEAQKTAIKTDEIQKVLVALNEKKDNDSTTKAIMKFAKSSVSEDGKVS
FT                   GVTATGKSDEAKGPSIEGVKKIIATLNTSTLKIAGVKEIKVADAGITSSKDNNAKSFTL
FT                   TLTADDKYEFANKKNELVLTVSIDPKKGNADEAVAWED"
FT   sig_peptide     674081..674155
FT                   /locus_tag="Bmur_0554"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.571 at
FT                   residue 25"
FT   gene            675148..677130
FT                   /locus_tag="Bmur_0555"
FT   CDS_pept        675148..677130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0555"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_01071 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70656"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR032533"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6U0"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_01071"
FT                   /protein_id="ADG70656.1"
FT                   /translation="MYIFKKQDNDFRNLTNEEINFLKSQGCSSQSWEKILIKNVDLSRI
FT                   KDVQFHGRVKINALNGNVRYHKKLKVPASINRATLIDVFINGNVYINNIGRFIANYKIE
FT                   KGVIIENAGSIYMEGKSSFGNGVETSPIMEGDGRSVKIFNRLNSHIAYLVAIHRHKKLM
FT                   REKINTIIDEYANQKTRKFGKIKKYAKIINARLIKNSLIDPYTTIENTDEINNTTVIST
FT                   KECPSYIGTSVILKDSIVLKGADITDSTVIKKAFIGEGVRLARQFSCEDSLLFANCEGE
FT                   HGEMFSIFAGPYTVTHHKATLLIASHFSFFNAGSGTNQSNHMYKLGPYHHGFMERGCKT
FT                   GSNSYILWPSYIGAFSTVIGAHYDNVDTSDFPFSYITEHGYHQTRLIPALNLFGVGLSR
FT                   DENKWKDRDRRKGDKKDLIIFDVFSPYTVSRMIKSEEILKNIKKENNHDDKNFLTYKNM
FT                   IIKKSSLDKYSKRYSIAIDLYLHNKILSYIKSSKNIDEIISNLEYDKNNVFDNWSDIGG
FT                   LICAKDRVDNIIKDLENDKINDIKTLTEAFEKLYNIYSEDEKSWVMNCIKSRYNIESIN
FT                   KDNIKKLLDEHKILLEKAYDIFYKDVEKEYDIAKMVSAGIDDKTMMEKDFEAVRGTVNE
FT                   NTFVVKYKKDMENKINDINNLINIL"
FT   gene            677156..678025
FT                   /locus_tag="Bmur_0556"
FT   CDS_pept        677156..678025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0556"
FT                   /product="ribosomal L11 methyltransferase"
FT                   /note="PFAM: ribosomal L11 methyltransferase; KEGG:
FT                   bhy:BHWA1_01072 putative ribosomal protein L11
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70657"
FT                   /db_xref="GOA:D5U6U1"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6U1"
FT                   /inference="protein motif:PFAM:PF06325"
FT                   /protein_id="ADG70657.1"
FT                   /translation="MLIYSLSIKLERGFEDIIEAVIESGQLNILGFNIEFPVEDSNSSI
FT                   VNIYNESESILKNNLSIIEENIKDIANYTLTTKQLKSEEYLTSYIEFLKPFDIGNITIV
FT                   PNLKDFHNEESANPLYIAKQYAFGTGTHETTSLALEMINEYANNNDIAPKSIADIGCGS
FT                   GILSLFAYKLGARNITSIDIDNDAVNCTLDNASYNDIKIDNVILGNAKDLINMNLKFDL
FT                   VIANIETDILIEILPDLKSLLKQDSDLILSGILLEKESFMKNAIRENKLNIILRKSKND
FT                   WVSLMLKQ"
FT   gene            678067..679365
FT                   /locus_tag="Bmur_0557"
FT   CDS_pept        678067..679365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0557"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /EC_number="1.2.1.41"
FT                   /note="KEGG: bhy:BHWA1_01073 gamma-glutamyl phosphate
FT                   reductase; TIGRFAM: gamma-glutamyl phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70658"
FT                   /db_xref="GOA:D5U6U2"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6U2"
FT                   /inference="protein motif:TFAM:TIGR00407"
FT                   /protein_id="ADG70658.1"
FT                   /translation="MELIDLVKNAKEAAYILQSLDTDIKNKALLEIAKKIEENKDKIFE
FT                   ANKKDLEYAQKLLYENKISKSMFNRLKLDENKLIDVVSGIRDVVKLEDPINKVLLETEL
FT                   DDNLILKKISCPIGLIAVIFEARPDVISQISSLCIKSSNAVILKGGSEGENTNKAIFNI
FT                   IEETLNNIKEFPKHSVNLVFTREDIKELLSMDKYIDLIIPRGGNSLVQYIKSNTNIPVL
FT                   GHADGICHLYIDESANQEKALKICLDSKAQYPSACNAVETILVNKNIASEYLPKLYNLF
FT                   KENEIKMNGDEEVKKILNQSDVGEVKEWHLEYGDKEVSLKIVEDTEEAYNHINKYGSHH
FT                   TDSIISEDKNNIEKFMTFVDSANVYSNASTRFSDGFRYGFGAEVGISTNKTHARGPVGL
FT                   EGLTIYKYKIFGSYQIVNDYVNHKSSFKHKRIK"
FT   gene            complement(679437..679838)
FT                   /locus_tag="Bmur_0558"
FT   CDS_pept        complement(679437..679838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0558"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_01077 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70659"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6U3"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_01077"
FT                   /protein_id="ADG70659.1"
FT                   /translation="MINKKRIVKFILLMLLLSLTSLFLTSCSSLFNSASKFRPYDLRGT
FT                   WRNNDNYRQRFTISSYGILTFYNDDGSYSTHYIDNWDNEKYNEKSYYELVIPNLPILGN
FT                   ITFYFTSDRECEISYGSVSGITYYFEKVS"
FT   sig_peptide     complement(679740..679838)
FT                   /locus_tag="Bmur_0558"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.511 at
FT                   residue 33"
FT   gene            680039..680236
FT                   /locus_tag="Bmur_0559"
FT   CDS_pept        680039..680236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0559"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00853 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70660"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6U4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG70660.1"
FT                   /translation="MKDLEKLKYILNEPITVNNLNRINDYFIRYLFSHSRNENIVLNFI
FT                   NELTGWYKRNRRTIISIKRQ"
FT   gene            complement(680406..680741)
FT                   /locus_tag="Bmur_0560"
FT   CDS_pept        complement(680406..680741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0560"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00216 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70661"
FT                   /db_xref="GOA:D5U6U5"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6U5"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_00216"
FT                   /protein_id="ADG70661.1"
FT                   /translation="MSDYDNTNNTNNNDKPAQSGVVPWIPLILAGIYMVSPVDLVPDVL
FT                   PVLGWFEDALFLLAGGLNGIQNGVVEANSSIRKIIKFIKWGLLIVGVIGILIVVLLVVL
FT                   VFKVAAN"
FT   gene            680965..681729
FT                   /locus_tag="Bmur_0561"
FT   CDS_pept        680965..681729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0561"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   bhy:BHWA1_01078 sporulation initiation inhibitor protein
FT                   Soj"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70662"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6U6"
FT                   /inference="protein motif:PFAM:PF01656"
FT                   /protein_id="ADG70662.1"
FT                   /translation="MSKVIAIVNQKGGVGKTTTAVNLSASIAKMGHKTLLIDIDPQANA
FT                   CLGIGITRDKMKKSVYDLLIGEASTKEVIMPTYQENLFLIPADSDLVGAQIELVNEIAR
FT                   EYKLKKAIETVKNDYEYIIIDCPPTLGILTLNALTAADSVLIPIQCEFYALDGVAELNN
FT                   TIALVKENLNKELKIEGVLLTMYDARTKLASDVVKEVVNFFKEKTYKTMIPRNVRLSEA
FT                   PSYGKAISDYDKDCVGARSYREFAKEFIEKSK"
FT   gene            681832..682770
FT                   /locus_tag="Bmur_0562"
FT   CDS_pept        681832..682770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0562"
FT                   /product="parB-like partition protein"
FT                   /note="TIGRFAM: parB-like partition protein; PFAM: ParB
FT                   domain protein nuclease; KEGG: bhy:BHWA1_01079 stage 0
FT                   sporulation protein J; SMART: ParB domain protein nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70663"
FT                   /db_xref="GOA:D5U6U7"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6U7"
FT                   /inference="protein motif:TFAM:TIGR00180"
FT                   /protein_id="ADG70663.1"
FT                   /translation="MSRKGGLGGQGMNALIKSADSEIRKAAEEAEKRGVLEVNISLIDV
FT                   NPDQPRKIFNEEEIQGLAESIRENGLINPITLREKDGQYQIISGERRFRAFKFLNRDKV
FT                   PALVLENIDDSKMLELTLVENIQRADLNAIEIARSYKKLIYDLNIKQEELANRVGKSRS
FT                   TISNSMRILDLSENIQNLILESKITEGHARAILSLTDENEREAFAKEIVENGYSVRECE
FT                   KIAKERKNENNQQENNQKDTKKEIKKDPNIRQLENDLEKIFSTKVNVIDKNGKEGKIVI
FT                   EYYSSDDLSRIMDMLDKIHERENSTIPTLEY"
FT   gene            682780..684000
FT                   /locus_tag="Bmur_0563"
FT   CDS_pept        682780..684000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0563"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_01080 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70664"
FT                   /db_xref="InterPro:IPR025493"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6U8"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_01080"
FT                   /protein_id="ADG70664.1"
FT                   /translation="MKSKFFLLYIFLTSLLITSSLYSRERMPIATIDLDHSLRANEPLR
FT                   KEIVRTINRFAYLKQKNSISVDREKKKLFSTNELTLEQGLTVASNLNIKAAIIMDSEKV
FT                   LKNTNNSMSNNMTINSTMLSNYNITNNMVSNDIVITNGLTLTNEIKDLGDLIEYGIGKK
FT                   TEGTDKAADEKSDEELYDIKYNFKVIDVETMETLKEYELKTSSETISVIQEICTYLEFY
FT                   FSNYIFSSFEPPINGINLTLRIDRISLENKTNSIYESGEIIEGESFTLNFRSNTEGYIY
FT                   IFAFQNDGTVILMHPNDFNNYIDNQYHNKIEARKNYIIPPKNSIFKIVSRPPLGKDSFY
FT                   CIYTKKEQKWITGVYFSGDGFKICSKNKTAEFTAKLKSTLKYMNKDNWQISSIYLKSIA
FT                   EIQETEK"
FT   sig_peptide     682780..682851
FT                   /locus_tag="Bmur_0563"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.682) with cleavage site probability 0.636 at
FT                   residue 24"
FT   gene            complement(684249..684938)
FT                   /locus_tag="Bmur_0564"
FT   CDS_pept        complement(684249..684938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0564"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_01081 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70665"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6U9"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_01081"
FT                   /protein_id="ADG70665.1"
FT                   /translation="MKRIFFYIAIIFINSLLLFSKETVERPASDNPNFSSSKFKDWLLV
FT                   ATFDKNNIPSFKFIDKTEDKYWELNNADTKEYMYSGKNSKAGIFFISSMKYYQYRGYNP
FT                   LYTVKRNRDNADAMKRFYFYRFTGKGGGIISLDNTLVAVDIYTKYVYIYGIPVEEDTVF
FT                   GVEVPLRWGPSDTVVYKGSLLPFYEYDPVGHVNEDGTVVLYPSYQNSFLDKVNRYQPFY
FT                   NSKYIYR"
FT   gene            complement(685164..686204)
FT                   /locus_tag="Bmur_0565"
FT   CDS_pept        complement(685164..686204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0565"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_01082 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70666"
FT                   /db_xref="GOA:D5U6V0"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6V0"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_01082"
FT                   /protein_id="ADG70666.1"
FT                   /translation="MENDNSPKIFLRHFFIFYIKVAVIHTLTYIVFGLLFSNLFDYTSV
FT                   YNDPIIINFMRGFESPLTVIGSFLQPIRAIFIAIALFPIRRIIASKFGWLIVWLIFICI
FT                   GIISSPVSAPSSIEGIIYTQLPIKFHIISLPEALMQTLSFSLILWVAEIIPHSEKEFSN
FT                   REFLVKIFLSVIYTMFGIFLTSVCAIIIMNFLELNYQDAKLDRGTISYLSTISILTIII
FT                   SYSFANKVYKNKWWLLLTIPLILIIYIAFPYGYNYIFNTVYNNNMALIPYSLSAVLMVI
FT                   IYCLIFVLFYGKLKNRCKKTDDINTENNDYNEIKVIEINPDDDKIEEGDIKVIELTPEN
FT                   DDSDKK"
FT   gene            complement(686232..687047)
FT                   /locus_tag="Bmur_0566"
FT   CDS_pept        complement(686232..687047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0566"
FT                   /product="metallo-dependent phosphatase"
FT                   /note="KEGG: bhy:BHWA1_01083 metallo-dependent phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70667"
FT                   /db_xref="GOA:D5U6V1"
FT                   /db_xref="InterPro:IPR005235"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6V1"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_01083"
FT                   /protein_id="ADG70667.1"
FT                   /translation="MSIKNILCLGDVIGVTGRYAVRRHLEEIKLENNIDFVIANGENAA
FT                   NGIGITRDTAAELFDSGVDVLTSGNHIWNNRDVFALIGNEHRLLRPYNYPNDAPGLGYY
FT                   IYEMLDCKIGVLNLMGRTFMDPLDCPFKKANLAIKHMKERTNLIFVDFHAEATAEKIAF
FT                   SYYLEGLVSCVFGTHTHVQTADEKILSSHTAYISDIGMCGSYYSVIGMKKDAAIARFVT
FT                   KMPHRFEVETVSPMINGIIVQVDSITGKALSIKRINSVYHNDIVERQEK"
FT   gene            complement(687073..688602)
FT                   /locus_tag="Bmur_0567"
FT   CDS_pept        complement(687073..688602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0567"
FT                   /product="metal dependent phosphohydrolase"
FT                   /EC_number="3.1.4.16"
FT                   /note="SMART: metal-dependent phosphohydrolase HD region;
FT                   KH domain protein; TIGRFAM: YmdA/YtgF protein; metal
FT                   dependent phophohydrolase; KEGG: bhy:BHWA1_01084
FT                   metal-dependent phosphohydrolase; PFAM: metal-dependent
FT                   phosphohydrolase HD sub domain; K Homology, type 1,
FT                   subgroup"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70668"
FT                   /db_xref="GOA:D5U6V2"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR017705"
FT                   /db_xref="InterPro:IPR022711"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6V2"
FT                   /inference="protein motif:TFAM:TIGR03319"
FT                   /protein_id="ADG70668.1"
FT                   /translation="MNIPLIITFVVVAFVFGYITRFVIAKIKLNSTEIITHKLLQSARE
FT                   QAENERKTILSEANSEIQKERSRLENENRDRKAEIQKLENRVLQREANLDKKSQYLENK
FT                   EHNIENKMKKIKEQEERLSSVIEEAEKELEKIAGLTREEAKTNLIKDIEEDAKKSATKI
FT                   VDNIEKNAIETGERKAREIIVQTIQRLSSEVAQETSVTSVSLPSEEMKGRIIGREGRNI
FT                   RMLETLTGVDIIIDDTPEAVVISCFDPVRKHIAKVSLEKLILDGRIHPARIEEVVERTR
FT                   REVEDSIMEAGENAITDLNLTTMHHELIRHMGRLQYRTSYGQNMLLHSKEVANIAAMIA
FT                   AEIGANVDLAKRSAFLHDIGKAIETEGEGSHAMSGADLAKRCGEKEEVVNAIRAHHNDV
FT                   DTQTVEAVIVKAADAISAARPGARRESFESYIKRLDNLEKIADSIEGVEKSFAIQAGRE
FT                   LRVMAKSDMVDDVQAKQIARDIAKRIEDELKYPGIIRVTVIRETRAVEVAR"
FT   gene            complement(688724..689263)
FT                   /locus_tag="Bmur_0568"
FT   CDS_pept        complement(688724..689263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0568"
FT                   /product="Rubrerythrin"
FT                   /note="PFAM: Rubrerythrin; KEGG: bhy:BHWA1_01085
FT                   rubrerythrin fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70669"
FT                   /db_xref="GOA:D5U6V3"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D5U6V3"
FT                   /inference="protein motif:PFAM:PF02915"
FT                   /protein_id="ADG70669.1"
FT                   /translation="MAAKTLEEVLYSIFQGESNAANRYSSFGKASSNKAVQKVFSTTSL
FT                   AEKIHAEKMRKLALRSGLDMSKFVPELNPVAPASDRENLEAGIKGEVYESTILYPQLAQ
FT                   VAVEQKNKLVSETVNSLGKVETEHAKLFQDIIDNFLNKDADVTFYLCPSCGNIYRDKAP
FT                   ETCETCGGSGKMFQKY"
FT   gene            689483..690097
FT                   /locus_tag="Bmur_0569"
FT   CDS_pept        689483..690097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0569"
FT                   /product="cytidylate kinase"
FT                   /note="KEGG: bhy:BHWA1_01086 cytidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70670"
FT                   /db_xref="GOA:D5U782"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5U782"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_01086"
FT                   /protein_id="ADG70670.1"
FT                   /translation="MNNIITISRQYGSGGRNIGEMISKKLNFNFYDKELIEIVAKRTGI
FT                   NKQYLESKEEKFTNDNLFFSAFHKEIFSSPFASKTRDSTLDKIFEIQREVIINIANKGN
FT                   CVIIGRCASFILKDCHKCFNIFVHAPNERRIQRITDEYGIKMENAETQLKNTDKYRANY
FT                   YKYYTGADWGDMTNYNLTIDSGYFNDEDICSIIINAVKKTI"
FT   gene            690174..690674
FT                   /locus_tag="Bmur_0570"
FT   CDS_pept        690174..690674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0570"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_01087 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70671"
FT                   /db_xref="InterPro:IPR019260"
FT                   /db_xref="UniProtKB/TrEMBL:D5U783"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_01087"
FT                   /protein_id="ADG70671.1"
FT                   /translation="MKNKDIKDFYENDYFSYESDCDLWNDEKISLLIDFGEEADKSKML
FT                   MKYLHKINEILKWIDEHKKDVSDFLINKQCLALAEEWVITGEQIDENAYKNQSGEIINI
FT                   PIKDEDFFDAMYIDTILIDFDEDETRPDTTLHILFEPDYFKHHSLIVYIDGERKIEYGD
FT                   IAG"
FT   gene            690761..691381
FT                   /locus_tag="Bmur_0571"
FT   CDS_pept        690761..691381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0571"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: smu:SMU.31 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70672"
FT                   /db_xref="InterPro:IPR014825"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:D5U784"
FT                   /inference="similar to AA sequence:KEGG:SMU.31"
FT                   /protein_id="ADG70672.1"
FT                   /translation="MKDYIKNLEKEFSKITNGFKQIEKKALYDLKSNNNSYIKELAYTA
FT                   YKSDLYQVRMYSVFLFGYLSEKKEILNFMKDVVSKDNNWRVQEILAKSFDEHCKMLGYE
FT                   KSTSIIDEWLNNSNPNTRRAVTEGLRIWTNKPYFKENPSEAIKRLSNLKHDNSEYVRKS
FT                   AGNALRDISKKYPKLIEEELNSWNLEIKEIKQVYKLANKFIKQ"
FT   gene            691916..692686
FT                   /locus_tag="Bmur_0572"
FT   CDS_pept        691916..692686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0572"
FT                   /product="HAD-superfamily hydrolase, subfamily IIA"
FT                   /note="KEGG: cvi:CV_3244 N-acetylglucosamine metabolism
FT                   protein; TIGRFAM: HAD-superfamily hydrolase, subfamily IIA;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70673"
FT                   /db_xref="GOA:D5U785"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D5U785"
FT                   /inference="protein motif:TFAM:TIGR01460"
FT                   /protein_id="ADG70673.1"
FT                   /translation="MISIISDMDGVIYRGNNLIDGAEDFIRMLLYKNVPFLFLTNNAEQ
FT                   TPRDLKRKLESLGVNGLEEKHFFTAAQATAIFLQRQLENGTAYVIGTGGLVSELYNVGY
FT                   SINDVNPDYVVVGKTSAFNFDMLQKAVHLINKGARFIGCNPDIVDPAPNGELIPAVGPI
FT                   LAAIETATGKKPYIVGKPNPIMMSIAKNQINAHSENTLMVGDRMDTDILGGLGAGMKTA
FT                   LVLSGVTNREMIEGFPYRPNYIFNSVADINIDKF"
FT   gene            692807..693934
FT                   /locus_tag="Bmur_0573"
FT   CDS_pept        692807..693934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0573"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bhy:BHWA1_00257 major facilitator superfamily MFS 1"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70674"
FT                   /db_xref="GOA:D5U786"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5U786"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG70674.1"
FT                   /translation="MSNLLFIIMTLLWLSLYVYIPYQVTYLSSINVNTSMIGIIIGVYG
FT                   AAQMFLKFPFGLLNDYIGKCRSLIILAGFLTSLGGVIRLLNTNQYGFLIGGTLCGISAS
FT                   IWTVFMVLYASYFDKNEEYKATSKALVASVLGMFIAFLIAAISYNKLGIKFILLVSAVS
FT                   GALVSLLGLFLKDSKHNKKMSFNDLFSVIKNKRLIVFSLLAAVMQGVQMSAVISFTLNR
FT                   IKELGGSDNNVGMASIISMFFAIVGAFVPSKIKNENNIKKYIPISFIMMALYCIIVISV
FT                   NNVLIVTASQILGGFSSGILASLLTSESVKEIDIDKKSSAMGFFQSIYSLGIFIFPIIT
FT                   GKLIELYSINLAYIVLAVIAFLSSVISISYYITSE"
FT   gene            694039..694962
FT                   /locus_tag="Bmur_0574"
FT   CDS_pept        694039..694962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0574"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: bhy:BHWA1_00256 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70675"
FT                   /db_xref="GOA:D5U787"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D5U787"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADG70675.1"
FT                   /translation="MSENKTSNSNNAGYILAILAVIIWSGNFVAARFLTHLTPIEISFY
FT                   RWIVTFIVLTPFCMKKLIKNIKYIKGRWIKVIIISILGVTVFNTFVYLAAHTSNATNMS
FT                   LLATLSPIIMAIISRIVWKTKLTINQKLGLLIVIIGVVILITKGSIDVLMNLKFAVGDL
FT                   YMLFAVILFAVYTLTLKVRPKEISQSAFFYLMVIIGLIPLIAAMIFKYASNNAHTLDTK
FT                   SALILIYVGVFPSALGFILWNMAIAKIGAIKGGIIYDAIPFFSSLEAVILLHENLLISQ
FT                   VIGGILILAGIIYSTIGDKIKKQNDI"
FT   gene            complement(695052..695558)
FT                   /locus_tag="Bmur_0575"
FT   CDS_pept        complement(695052..695558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0575"
FT                   /product="Protein of unknown function DUF2147"
FT                   /note="PFAM: Protein of unknown function DUF2147; KEGG:
FT                   bhy:BHWA1_00255 signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70676"
FT                   /db_xref="InterPro:IPR019223"
FT                   /db_xref="UniProtKB/TrEMBL:D5U788"
FT                   /inference="protein motif:PFAM:PF09917"
FT                   /protein_id="ADG70676.1"
FT                   /translation="MKRKIFILLVLLVFSNLLLLAQSADDVVGLWYSEKDSQGLIPVVE
FT                   IYKENGKYYGYFFDYKGGYNGPEKKDVKNPNKELRELPLKGLVYLMGLSFENGEWKGGK
FT                   IYNPYDGKTYNGKMSLSEDKKTLTVRGSLDKAGVFGKSMKWTKVPDSEKSQYKPLNRSD
FT                   LRKFN"
FT   sig_peptide     complement(695493..695558)
FT                   /locus_tag="Bmur_0575"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.740 at
FT                   residue 22"
FT   gene            complement(695824..696324)
FT                   /locus_tag="Bmur_0576"
FT   CDS_pept        complement(695824..696324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0576"
FT                   /product="Protein of unknown function DUF2147"
FT                   /note="PFAM: Protein of unknown function DUF2147; KEGG:
FT                   bhy:BHWA1_00253 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70677"
FT                   /db_xref="InterPro:IPR019223"
FT                   /db_xref="UniProtKB/TrEMBL:D5U789"
FT                   /inference="protein motif:PFAM:PF09917"
FT                   /protein_id="ADG70677.1"
FT                   /translation="MKNKIITILIFTFLFNVLAFAQNADDITGLWYSQADSQNRVSVVE
FT                   IYKENNKYYAYSFAYKNSNDIVNDVNNPKKELRNLPLKGLVYLYDLEFVNGEWKNGKIY
FT                   NPDDGKTYHAKVTLSDNGTEIKIRASADGAGIFGKTITWKKLSSSDAAKYKPLNKGELR
FT                   KLN"
FT   sig_peptide     complement(696259..696324)
FT                   /locus_tag="Bmur_0576"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.939 at
FT                   residue 22"
FT   gene            complement(696405..698033)
FT                   /locus_tag="Bmur_0577"
FT   CDS_pept        complement(696405..698033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0577"
FT                   /product="All-trans-retinol 13,14-reductase"
FT                   /EC_number="1.3.99.23"
FT                   /note="KEGG: bhy:BHWA1_00252 phytoene dehydrogenase-like
FT                   protein; PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70678"
FT                   /db_xref="GOA:D5U790"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5U790"
FT                   /inference="protein motif:PRIAM:1.3.99.23"
FT                   /protein_id="ADG70678.1"
FT                   /translation="MTNNKYDIVIIGSGLGGLTSGAYLAKQGKKVLVLESHNIVGGCAT
FT                   GYKRKNVKFEVGLHELDMAKKNREMKHVIFSKLGLYDRVDLVQLPQTWRIKTESTDLVI
FT                   PEGYENAINTLEKEFPEEKEGIKKYFSGLSRMMYMIRRVPYDLKFWDYFFFPVTTLPMI
FT                   LYQLFKQKNTGDVLDSIIKSDKLKRILNINITYYHQNPYEFTWYYHACAQGAYYNSAYF
FT                   IKGGSQNLSNALADIIKENGGEIKVSSEVKKINVKGNIAEGVTYYDKRAKEEITVNADY
FT                   VIANAAPQIVYDELLPKGYEDKRIKKLKNSVSLYTVYIIFKKKFSELYPNNAYSTFITT
FT                   EKTLNTNFKEDGKGQRHIPVEDRNFVFVDYSAIDSGLVEEGDNRSFAVLTGPSFLDEWK
FT                   DLSDEEYKARKKEMAEKLIDRAEQHYPGFRDNIEYYEVATPKTIKRYIKTPDGTPYGFV
FT                   QDTYLKKSRCVRVSPTVKNLHFASAWNFPGGGFTGALLSGYLAARNILFPLKPYIVLRF
FT                   LLCGVVGAAIGTAYQWIPALINLFK"
FT   gene            698567..700549
FT                   /locus_tag="Bmur_0578"
FT   CDS_pept        698567..700549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bmur_0578"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_01021 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bmur_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADG70679"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:D5U791"
FT                   /inference="similar to AA sequence:KEGG:BHWA1_01021"
FT                   /protein_id="