(data stored in ACNUC1104 zone)

EMBL: CP001966

ID   CP001966; SV 1; circular; genomic DNA; STD; PRO; 4379918 BP.
XX
AC   CP001966; ABVA01000000-ABVA01000008;
XX
PR   Project:PRJNA29399;
XX
DT   19-MAY-2010 (Rel. 104, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Tsukamurella paurometabola DSM 20162, complete genome.
XX
KW   .
XX
OS   Tsukamurella paurometabola DSM 20162
OC   Bacteria; Actinobacteria; Corynebacteriales; Tsukamurellaceae;
OC   Tsukamurella.
XX
RN   [1]
RP   1-4379918
RX   PUBMED; 21886861.
RA   Munk A.C., Lapidus A., Lucas S., Nolan M., Tice H., Cheng J.F.,
RA   Del Rio T.G., Goodwin L., Pitluck S., Liolios K., Huntemann M., Ivanova N.,
RA   Mavromatis K., Mikhailova N., Pati A., Chen A., Palaniappan K., Tapia R.,
RA   Han C., Land M., Hauser L., Chang Y.J., Jeffries C.D., Brettin T.,
RA   Yasawong M., Brambilla E.M., Rohde M., Sikorski J., Goker M., Detter J.C.,
RA   Woyke T., Bristow J., Eisen J.A., Markowitz V., Hugenholtz P.,
RA   Kyrpides N.C., Klenk H.P.;
RT   "Complete genome sequence of Tsukamurella paurometabola type strain (no.
RT   33)";
RL   Stand Genomic Sci 4(3):342-351(2011).
XX
RN   [2]
RP   1-4379918
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Mikhailova N., Munk A.C., Brettin T., Detter J.C., Tapia R., Han C.,
RA   Larimer F., Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P.,
RA   Woyke T., Wu D., Jando M., Brambilla E., Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (04-MAR-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 13801e97a50dfcebc415ded63efb5c17.
DR   BioSample; SAMN00002597.
DR   CABRI; DSM 20162.
DR   EnsemblGenomes-Gn; EBG00001237900.
DR   EnsemblGenomes-Gn; EBG00001237901.
DR   EnsemblGenomes-Gn; EBG00001237902.
DR   EnsemblGenomes-Gn; EBG00001237903.
DR   EnsemblGenomes-Gn; EBG00001237904.
DR   EnsemblGenomes-Gn; EBG00001237905.
DR   EnsemblGenomes-Gn; EBG00001237906.
DR   EnsemblGenomes-Gn; EBG00001237907.
DR   EnsemblGenomes-Gn; EBG00001237908.
DR   EnsemblGenomes-Gn; EBG00001237909.
DR   EnsemblGenomes-Gn; EBG00001237910.
DR   EnsemblGenomes-Gn; EBG00001237911.
DR   EnsemblGenomes-Gn; EBG00001237912.
DR   EnsemblGenomes-Gn; EBG00001237913.
DR   EnsemblGenomes-Gn; EBG00001237914.
DR   EnsemblGenomes-Gn; EBG00001237915.
DR   EnsemblGenomes-Gn; EBG00001237916.
DR   EnsemblGenomes-Gn; EBG00001237917.
DR   EnsemblGenomes-Gn; EBG00001237918.
DR   EnsemblGenomes-Gn; EBG00001237919.
DR   EnsemblGenomes-Gn; EBG00001237920.
DR   EnsemblGenomes-Gn; EBG00001237921.
DR   EnsemblGenomes-Gn; EBG00001237922.
DR   EnsemblGenomes-Gn; EBG00001237923.
DR   EnsemblGenomes-Gn; EBG00001237924.
DR   EnsemblGenomes-Gn; EBG00001237925.
DR   EnsemblGenomes-Gn; EBG00001237926.
DR   EnsemblGenomes-Gn; EBG00001237927.
DR   EnsemblGenomes-Gn; EBG00001237928.
DR   EnsemblGenomes-Gn; EBG00001237929.
DR   EnsemblGenomes-Gn; EBG00001237930.
DR   EnsemblGenomes-Gn; EBG00001237931.
DR   EnsemblGenomes-Gn; EBG00001237932.
DR   EnsemblGenomes-Gn; EBG00001237933.
DR   EnsemblGenomes-Gn; EBG00001237934.
DR   EnsemblGenomes-Gn; EBG00001237935.
DR   EnsemblGenomes-Gn; EBG00001237936.
DR   EnsemblGenomes-Gn; EBG00001237937.
DR   EnsemblGenomes-Gn; EBG00001237938.
DR   EnsemblGenomes-Gn; EBG00001237939.
DR   EnsemblGenomes-Gn; EBG00001237940.
DR   EnsemblGenomes-Gn; EBG00001237941.
DR   EnsemblGenomes-Gn; EBG00001237942.
DR   EnsemblGenomes-Gn; EBG00001237943.
DR   EnsemblGenomes-Gn; EBG00001237944.
DR   EnsemblGenomes-Gn; EBG00001237945.
DR   EnsemblGenomes-Gn; EBG00001237946.
DR   EnsemblGenomes-Gn; EBG00001237947.
DR   EnsemblGenomes-Gn; EBG00001237948.
DR   EnsemblGenomes-Gn; EBG00001237949.
DR   EnsemblGenomes-Gn; EBG00001237950.
DR   EnsemblGenomes-Gn; EBG00001237951.
DR   EnsemblGenomes-Gn; EBG00001237952.
DR   EnsemblGenomes-Gn; EBG00001237953.
DR   EnsemblGenomes-Gn; EBG00001237954.
DR   EnsemblGenomes-Gn; EBG00001237955.
DR   EnsemblGenomes-Gn; EBG00001237956.
DR   EnsemblGenomes-Gn; EBG00001237957.
DR   EnsemblGenomes-Gn; EBG00001237958.
DR   EnsemblGenomes-Gn; EBG00001237959.
DR   EnsemblGenomes-Gn; EBG00001237960.
DR   EnsemblGenomes-Gn; EBG00001237961.
DR   EnsemblGenomes-Gn; EBG00001237962.
DR   EnsemblGenomes-Gn; Tpau_R0001.
DR   EnsemblGenomes-Gn; Tpau_R0002.
DR   EnsemblGenomes-Gn; Tpau_R0003.
DR   EnsemblGenomes-Gn; Tpau_R0004.
DR   EnsemblGenomes-Gn; Tpau_R0005.
DR   EnsemblGenomes-Gn; Tpau_R0006.
DR   EnsemblGenomes-Gn; Tpau_R0007.
DR   EnsemblGenomes-Gn; Tpau_R0008.
DR   EnsemblGenomes-Gn; Tpau_R0009.
DR   EnsemblGenomes-Gn; Tpau_R0010.
DR   EnsemblGenomes-Gn; Tpau_R0011.
DR   EnsemblGenomes-Gn; Tpau_R0012.
DR   EnsemblGenomes-Gn; Tpau_R0013.
DR   EnsemblGenomes-Gn; Tpau_R0014.
DR   EnsemblGenomes-Gn; Tpau_R0015.
DR   EnsemblGenomes-Gn; Tpau_R0016.
DR   EnsemblGenomes-Gn; Tpau_R0017.
DR   EnsemblGenomes-Gn; Tpau_R0018.
DR   EnsemblGenomes-Gn; Tpau_R0019.
DR   EnsemblGenomes-Gn; Tpau_R0020.
DR   EnsemblGenomes-Gn; Tpau_R0021.
DR   EnsemblGenomes-Gn; Tpau_R0022.
DR   EnsemblGenomes-Gn; Tpau_R0023.
DR   EnsemblGenomes-Gn; Tpau_R0024.
DR   EnsemblGenomes-Gn; Tpau_R0025.
DR   EnsemblGenomes-Gn; Tpau_R0026.
DR   EnsemblGenomes-Gn; Tpau_R0027.
DR   EnsemblGenomes-Gn; Tpau_R0028.
DR   EnsemblGenomes-Gn; Tpau_R0029.
DR   EnsemblGenomes-Gn; Tpau_R0030.
DR   EnsemblGenomes-Gn; Tpau_R0031.
DR   EnsemblGenomes-Gn; Tpau_R0032.
DR   EnsemblGenomes-Gn; Tpau_R0033.
DR   EnsemblGenomes-Gn; Tpau_R0034.
DR   EnsemblGenomes-Gn; Tpau_R0035.
DR   EnsemblGenomes-Gn; Tpau_R0036.
DR   EnsemblGenomes-Gn; Tpau_R0037.
DR   EnsemblGenomes-Gn; Tpau_R0038.
DR   EnsemblGenomes-Gn; Tpau_R0039.
DR   EnsemblGenomes-Gn; Tpau_R0040.
DR   EnsemblGenomes-Gn; Tpau_R0041.
DR   EnsemblGenomes-Gn; Tpau_R0042.
DR   EnsemblGenomes-Gn; Tpau_R0043.
DR   EnsemblGenomes-Gn; Tpau_R0044.
DR   EnsemblGenomes-Gn; Tpau_R0045.
DR   EnsemblGenomes-Gn; Tpau_R0046.
DR   EnsemblGenomes-Gn; Tpau_R0047.
DR   EnsemblGenomes-Gn; Tpau_R0048.
DR   EnsemblGenomes-Gn; Tpau_R0049.
DR   EnsemblGenomes-Gn; Tpau_R0050.
DR   EnsemblGenomes-Gn; Tpau_R0051.
DR   EnsemblGenomes-Gn; Tpau_R0052.
DR   EnsemblGenomes-Gn; Tpau_R0053.
DR   EnsemblGenomes-Gn; Tpau_R0054.
DR   EnsemblGenomes-Gn; Tpau_R0055.
DR   EnsemblGenomes-Gn; Tpau_R0056.
DR   EnsemblGenomes-Gn; Tpau_R0057.
DR   EnsemblGenomes-Tr; EBT00001583351.
DR   EnsemblGenomes-Tr; EBT00001583352.
DR   EnsemblGenomes-Tr; EBT00001583353.
DR   EnsemblGenomes-Tr; EBT00001583355.
DR   EnsemblGenomes-Tr; EBT00001583356.
DR   EnsemblGenomes-Tr; EBT00001583359.
DR   EnsemblGenomes-Tr; EBT00001583360.
DR   EnsemblGenomes-Tr; EBT00001583362.
DR   EnsemblGenomes-Tr; EBT00001583364.
DR   EnsemblGenomes-Tr; EBT00001583366.
DR   EnsemblGenomes-Tr; EBT00001583368.
DR   EnsemblGenomes-Tr; EBT00001583370.
DR   EnsemblGenomes-Tr; EBT00001583372.
DR   EnsemblGenomes-Tr; EBT00001583373.
DR   EnsemblGenomes-Tr; EBT00001583375.
DR   EnsemblGenomes-Tr; EBT00001583377.
DR   EnsemblGenomes-Tr; EBT00001583379.
DR   EnsemblGenomes-Tr; EBT00001583381.
DR   EnsemblGenomes-Tr; EBT00001583383.
DR   EnsemblGenomes-Tr; EBT00001583385.
DR   EnsemblGenomes-Tr; EBT00001583387.
DR   EnsemblGenomes-Tr; EBT00001583389.
DR   EnsemblGenomes-Tr; EBT00001583390.
DR   EnsemblGenomes-Tr; EBT00001583392.
DR   EnsemblGenomes-Tr; EBT00001583393.
DR   EnsemblGenomes-Tr; EBT00001583396.
DR   EnsemblGenomes-Tr; EBT00001583398.
DR   EnsemblGenomes-Tr; EBT00001583400.
DR   EnsemblGenomes-Tr; EBT00001583401.
DR   EnsemblGenomes-Tr; EBT00001583403.
DR   EnsemblGenomes-Tr; EBT00001583406.
DR   EnsemblGenomes-Tr; EBT00001583409.
DR   EnsemblGenomes-Tr; EBT00001583411.
DR   EnsemblGenomes-Tr; EBT00001583413.
DR   EnsemblGenomes-Tr; EBT00001583416.
DR   EnsemblGenomes-Tr; EBT00001583418.
DR   EnsemblGenomes-Tr; EBT00001583420.
DR   EnsemblGenomes-Tr; EBT00001583422.
DR   EnsemblGenomes-Tr; EBT00001583424.
DR   EnsemblGenomes-Tr; EBT00001583426.
DR   EnsemblGenomes-Tr; EBT00001583428.
DR   EnsemblGenomes-Tr; EBT00001583430.
DR   EnsemblGenomes-Tr; EBT00001583432.
DR   EnsemblGenomes-Tr; EBT00001583433.
DR   EnsemblGenomes-Tr; EBT00001583436.
DR   EnsemblGenomes-Tr; EBT00001583438.
DR   EnsemblGenomes-Tr; EBT00001583439.
DR   EnsemblGenomes-Tr; EBT00001583441.
DR   EnsemblGenomes-Tr; EBT00001583444.
DR   EnsemblGenomes-Tr; EBT00001583445.
DR   EnsemblGenomes-Tr; EBT00001583447.
DR   EnsemblGenomes-Tr; EBT00001583450.
DR   EnsemblGenomes-Tr; EBT00001583451.
DR   EnsemblGenomes-Tr; EBT00001583454.
DR   EnsemblGenomes-Tr; EBT00001583455.
DR   EnsemblGenomes-Tr; EBT00001583456.
DR   EnsemblGenomes-Tr; EBT00001583457.
DR   EnsemblGenomes-Tr; EBT00001583458.
DR   EnsemblGenomes-Tr; EBT00001583459.
DR   EnsemblGenomes-Tr; EBT00001583460.
DR   EnsemblGenomes-Tr; EBT00001583461.
DR   EnsemblGenomes-Tr; EBT00001583462.
DR   EnsemblGenomes-Tr; EBT00001583463.
DR   EnsemblGenomes-Tr; Tpau_R0001-1.
DR   EnsemblGenomes-Tr; Tpau_R0002-1.
DR   EnsemblGenomes-Tr; Tpau_R0003-1.
DR   EnsemblGenomes-Tr; Tpau_R0004-1.
DR   EnsemblGenomes-Tr; Tpau_R0005-1.
DR   EnsemblGenomes-Tr; Tpau_R0006-1.
DR   EnsemblGenomes-Tr; Tpau_R0007-1.
DR   EnsemblGenomes-Tr; Tpau_R0008-1.
DR   EnsemblGenomes-Tr; Tpau_R0009-1.
DR   EnsemblGenomes-Tr; Tpau_R0010-1.
DR   EnsemblGenomes-Tr; Tpau_R0011-1.
DR   EnsemblGenomes-Tr; Tpau_R0012-1.
DR   EnsemblGenomes-Tr; Tpau_R0013-1.
DR   EnsemblGenomes-Tr; Tpau_R0014-1.
DR   EnsemblGenomes-Tr; Tpau_R0015-1.
DR   EnsemblGenomes-Tr; Tpau_R0016-1.
DR   EnsemblGenomes-Tr; Tpau_R0017-1.
DR   EnsemblGenomes-Tr; Tpau_R0018-1.
DR   EnsemblGenomes-Tr; Tpau_R0019-1.
DR   EnsemblGenomes-Tr; Tpau_R0020-1.
DR   EnsemblGenomes-Tr; Tpau_R0021-1.
DR   EnsemblGenomes-Tr; Tpau_R0022-1.
DR   EnsemblGenomes-Tr; Tpau_R0023-1.
DR   EnsemblGenomes-Tr; Tpau_R0024-1.
DR   EnsemblGenomes-Tr; Tpau_R0025-1.
DR   EnsemblGenomes-Tr; Tpau_R0026-1.
DR   EnsemblGenomes-Tr; Tpau_R0027-1.
DR   EnsemblGenomes-Tr; Tpau_R0028-1.
DR   EnsemblGenomes-Tr; Tpau_R0029-1.
DR   EnsemblGenomes-Tr; Tpau_R0030-1.
DR   EnsemblGenomes-Tr; Tpau_R0031-1.
DR   EnsemblGenomes-Tr; Tpau_R0032-1.
DR   EnsemblGenomes-Tr; Tpau_R0033-1.
DR   EnsemblGenomes-Tr; Tpau_R0034-1.
DR   EnsemblGenomes-Tr; Tpau_R0035-1.
DR   EnsemblGenomes-Tr; Tpau_R0036-1.
DR   EnsemblGenomes-Tr; Tpau_R0037-1.
DR   EnsemblGenomes-Tr; Tpau_R0038-1.
DR   EnsemblGenomes-Tr; Tpau_R0039-1.
DR   EnsemblGenomes-Tr; Tpau_R0040-1.
DR   EnsemblGenomes-Tr; Tpau_R0041-1.
DR   EnsemblGenomes-Tr; Tpau_R0042-1.
DR   EnsemblGenomes-Tr; Tpau_R0043-1.
DR   EnsemblGenomes-Tr; Tpau_R0044-1.
DR   EnsemblGenomes-Tr; Tpau_R0045-1.
DR   EnsemblGenomes-Tr; Tpau_R0046-1.
DR   EnsemblGenomes-Tr; Tpau_R0047-1.
DR   EnsemblGenomes-Tr; Tpau_R0048-1.
DR   EnsemblGenomes-Tr; Tpau_R0049-1.
DR   EnsemblGenomes-Tr; Tpau_R0050-1.
DR   EnsemblGenomes-Tr; Tpau_R0051-1.
DR   EnsemblGenomes-Tr; Tpau_R0052-1.
DR   EnsemblGenomes-Tr; Tpau_R0053-1.
DR   EnsemblGenomes-Tr; Tpau_R0054-1.
DR   EnsemblGenomes-Tr; Tpau_R0055-1.
DR   EnsemblGenomes-Tr; Tpau_R0056-1.
DR   EnsemblGenomes-Tr; Tpau_R0057-1.
DR   EuropePMC; PMC4222082; 24266988.
DR   EuropePMC; PMC4298536; 25520439.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01746; mraW.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01763; ykkC-III.
DR   RFAM; RF01781; ASdes.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001966.
DR   SILVA-SSU; CP001966.
DR   StrainInfo; 94720; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4083016
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Tsukamurella paurometabola DSM 20162
CC   Culture Collection ID :: DSM 20162, ATCC 8368
CC   GOLD Stamp ID         :: Gi02254
CC   Funding Program       :: DOE-GEBA 2007
CC   Sequencing Depth      :: 8.25x Sanger; 37.9x pyrosequence
CC   Gene Calling Method   :: Prodigal, GenePRIMP
CC   Isolation Site        :: Cases of systemic infection, usually in
CC                            association with other diseases
CC   Host Name             :: Homo sapiens
CC   Oxygen Requirement    :: Aerobe
CC   Cell Shape            :: Rod-shaped
CC   Motility              :: Nonmotile
CC   Sporulation           :: Nonsporulating
CC   Temperature Range     :: Mesophile
CC   Gram Staining         :: gram+
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Sludge, Soil
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4379918
FT                   /organism="Tsukamurella paurometabola DSM 20162"
FT                   /strain="DSM 20162"
FT                   /mol_type="genomic DNA"
FT                   /note="type strain of Tsukamurella paurometabola"
FT                   /db_xref="taxon:521096"
FT   gene            190..1662
FT                   /locus_tag="Tpau_0001"
FT   CDS_pept        190..1662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; KEGG:
FT                   mpa:MAP0001 chromosomal replication initiation protein;
FT                   SMART: Chromosomal replication initiator DnaA domain; AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76655"
FT                   /db_xref="GOA:D5UPA3"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPA3"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ADG76655.1"
FT                   /translation="MTVDPLIETWTAVVDDLCGESTDRTLTMQEKAWLRLVQPLTLTEG
FT                   FALVAVPSQLMKDVIDRSLRDPIIDALSMRLGQDVELGVRISPDATPPVTVAAEPDPPA
FT                   GPSTADLPVPNLPPAAAPLEAPSVTLPPPMTGPSSKSNGSSGSSGSSLNQKYTFETFVI
FT                   GASNRFAHAAAFAVAEAPARAYNPLFIWGESGLGKTHLLHAAGHYAQRLFPGMRVKYVS
FT                   TEEFTNDFINSLKDDRQVQFKQRYRDVDILLVDDIQFLEGKLGIQEEFFHTFNTLHNAN
FT                   KQIVVSSDRPPKQLATLEDRLRTRFEWGLITDVQPPELEIRMAILLKKAQMERIHVPHD
FT                   VLELIATRIDRNIRELEGALIRVTAFASLTQTDVTYELAEMVLRDLVPDTTTIEISSST
FT                   ILSVVAEYFEITVADLKGTERARAVTHARQIAMYLCRELTELSLPKIGQIFDRDHTTVM
FT                   YAERKIRKEMPERRRVYDQVQELTTRIKRRSQ"
FT   gene            complement(1699..2532)
FT                   /locus_tag="Tpau_0002"
FT   CDS_pept        complement(1699..2532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0002"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: msm:MSMEG_4720 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76656"
FT                   /db_xref="GOA:D5UPA4"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPA4"
FT                   /inference="similar to AA sequence:KEGG:MSMEG_4720"
FT                   /protein_id="ADG76656.1"
FT                   /translation="MGYPDPQQNPGQHPGGQNYPPQPAGPNPPAGPYPPVQPGGPYPPQ
FT                   PGGYQPTREMGRDEAASGTGGYELGYTQGAYGPYDGQQPPQGPPPVPGDPYGPGGGSGD
FT                   DGGGNGNKKAIWIAVAAVVFVLVLAGVVVGIATSGGGSKDTAATPTPTTAPTTTRTTTG
FT                   GMTMPSGIPSISVPPIFGGGSTTGPNARQWTVEVTGSGSAQLVTIGIPDTSLFGSQPLP
FT                   WSKSFTSDAPLVTITVIGYTGDASCTIKRNGTVVSEQKSSAETSGGGPLICTSGR"
FT   gene            2938..4128
FT                   /locus_tag="Tpau_0003"
FT   CDS_pept        2938..4128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0003"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: rha:RHA1_ro03667 DNA
FT                   polymerase III subunit beta; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76657"
FT                   /db_xref="GOA:D5UPA5"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPA5"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADG76657.1"
FT                   /translation="MSLPKGSVGMKFRVPHEEFAESVAWVARSLPSRPPVPVLGGVLLT
FT                   AGDDGLTVSGFDYEVSAQVRVGAEVADEGQVLVSGRLLADITKALPNKPVDVELDVTRV
FT                   AISCGSAKFSLPTMPVEDYPQLPELPQQTGAIERSMFAEAISQVAIAAGKDDTLPMLTG
FT                   IRVEIEGQRVVLAATDRFRLAVREFDWQPQSGDVKAAVLVPAKTLSEAAKTFAGDSEVG
FT                   IALGAGSAVGADGLLGVVGPDRRTTTRLLDADFPKFRQLLPASHTAIATMEIAPLLEAI
FT                   KRVALVADRGAQVRMEFGDGTLRLSAGGDDAGKAEEELPADFQGEPLTIAFNPGYLQDG
FT                   LAAIHTDSVTFGFTTPSRPAVLRPTVENAFQPDDSGAFPAPQSAYTYLLMPVRLPG"
FT   gene            4169..5053
FT                   /locus_tag="Tpau_0004"
FT   CDS_pept        4169..5053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0004"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /note="KEGG: mab:MAB_0003 6-phosphogluconate dehydrogenase-
FT                   like protein; TIGRFAM: 6-phosphogluconate dehydrogenase,
FT                   decarboxylating; PFAM: 6-phosphogluconate dehydrogenase
FT                   NAD-binding; 6-phosphogluconate dehydrogenase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76658"
FT                   /db_xref="GOA:D5UPA6"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPA6"
FT                   /inference="protein motif:TFAM:TIGR00872"
FT                   /protein_id="ADG76658.1"
FT                   /translation="MQLGLIGLGKMGANMRQRVRAGGHEVVGYDPRPEVTDVPTLEALV
FT                   EALEAPRVVWVMVPAGEPTRETVRKLADLLGEGDLVIDGGNSKYTDDQPNADLLAEKGV
FT                   GYLDCGVSGGVWGLENGYGLMVGGSDADVERAMPIFDALRPEGDRADGFAHSGPVGAGH
FT                   YAKMIHNGIEYGLMQAYGEGYDLLEAEPLIENVAGTLRAWSKGTVVRSWLLDLLVKALE
FT                   EDPGLQEITGYTEDSGEGRWTVEEAIRHSVPAPVIAAALFARFQSRQDDSDTMKAVSAL
FT                   RNQFGGHAVRRAD"
FT   gene            5069..6274
FT                   /locus_tag="Tpau_0005"
FT   CDS_pept        5069..6274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0005"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: rer:RER_00040 DNA
FT                   replication and repair protein RecF; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76659"
FT                   /db_xref="GOA:D5UPA7"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPA7"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ADG76659.1"
FT                   /translation="MYVRRLRLHDFRSWDDVDIELGPGVTVFVGRNGFGKTNLIEALNY
FT                   LATLGSHRVSTDQPLIRVGTESATVLATVHNAGRELTAEVDIVAGRANKARINTAPSRR
FT                   PRDLLGILQSVLFAPEDLSLVRGDPGGRRRFLDELAILRTPRIAAEKADYDRVLKQRTA
FT                   LLKTAYAAARRGGPDAESMLATLDVWDVQLARFGAEMLAARLEVVAALQPHLTVAYGAL
FT                   APHSRAATMEYTSGLFDDEFGGDPATATVAELEEAMLAGLQRARSREIDRGVCLVGPHR
FT                   DDLDLRLGNEPAKGFASHGESWSYALALRLASLELLRAGGSDPVLLLDDVFAELDTKRR
FT                   TALADVAAETEQVIVTAAVPEDLPPTLRARTFEVTVEGPADARISRLRSAPDDDRPDET
FT                   AS"
FT   gene            6380..7675
FT                   /locus_tag="Tpau_0006"
FT   CDS_pept        6380..7675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0006"
FT                   /product="glycosyl transferase family 28"
FT                   /note="PFAM: glycosyl transferase family 28; KEGG:
FT                   fre:Franean1_0073 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76660"
FT                   /db_xref="GOA:D5UPA8"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPA8"
FT                   /inference="protein motif:PFAM:PF03033"
FT                   /protein_id="ADG76660.1"
FT                   /translation="MRIAIACMGSRGDISPLLAVGRVFADRGDTVTIGCTVESRDFVRS
FT                   HGFEPRILTTLNLKEFLQSPLGQEKFFGTGTATQLRAVGKLADSHADEFDEHLAQLCAD
FT                   VDCVISTRIIEERAALVTHRNGTPLVMLEYFPGDAHSTVPNPLLGPRLQDITATIPVLL
FT                   PLTYRIFDIGWALSIAKKTLHLAKRVGYPRRIINPRSVLNGRDILRVEAFGTALVPPRT
FT                   RSDARQPRIGFIRIEGRPADRAARDRAVEAWIDSDDRPFVYLGFGSMPIVDFDGVVTEL
FT                   AATLAGEGLRLIAVPGWSARTGDEVVETPDLLVLPDIDHDAVFPRCAAIVHHGGAGTTA
FT                   IAAASGRPSLVCSQAFDQHFWGRRIEAAGAGALLSRRRMSARTIAEAVLSLVRDDAVVA
FT                   GARRLGEVAAEDLRGRDQFIEAFDAFVAETGR"
FT   gene            7677..9272
FT                   /locus_tag="Tpau_0007"
FT   CDS_pept        7677..9272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0007"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="KEGG: nfa:nfa51130 putative transporter; TIGRFAM:
FT                   drug resistance transporter, EmrB/QacA subfamily; PFAM:
FT                   major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76661"
FT                   /db_xref="GOA:D5UPA9"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPA9"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ADG76661.1"
FT                   /translation="MSASSGALSAPKRWISLATVCIAVLMTGMDNSIVTIALPTLSNEF
FT                   GGGMSALQWIVDSYTLVFAGLLLATGYFGDRIGRRKVLVAGLVCFIVISVLATRSTSLA
FT                   QLITARAALGAAAALIFPATLAIISVLFPEKQERTKAIAVWSAAAGASIAIGPVVGGYL
FT                   VEHFAWSSVFWINVPISVIAIIGCLTLVPESFGSERPSFDLFGVLLSISGITLLVWALI
FT                   EAPNFGWGSAPVVGALVAAAVFLVTFVVYERRQANPVLDVTLFRSRGFAMGSFAICAGF
FT                   FCLLGFVFITIMYFQAVLGYGPLETAVRVIPFALVAVAVTPLAALANTERRMRFAISTG
FT                   LAIMAAGFVFTSRLTESADYLTQILPSMSVIAVGLGLLQGPATTSVMTSVPSGEAGAGS
FT                   AVNDTTREVGGALGVAILGSVVAHLYSARVAEDVARLPVAPGIRAEAESSVIGGVRAIG
FT                   AAPPELQAALGHTVQQAFVSAMQSANLVAAGVGAVACVVVAVFLRTRPEARHRRSTSQT
FT                   QVSVHDLVGRRAGE"
FT   gene            9357..9899
FT                   /locus_tag="Tpau_0008"
FT   CDS_pept        9357..9899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0008"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   rer:RER_00050 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76662"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="InterPro:IPR023007"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPB0"
FT                   /inference="protein motif:PFAM:PF05258"
FT                   /protein_id="ADG76662.1"
FT                   /translation="MTGPNNDGQLHGSDIARRALEEARAAAKAAGKSVGRGNSAPMTGG
FT                   VRRLRQGSKRWSGPAPDGRDPQRFGALIGGIAKARGWDKKVSEGTVLGCWDTVVGADVA
FT                   AHAQAVSLREKVLYVSAESTAWATQLRLMQPQLLAKINAAVGQGVVTSLTITGPSAPSW
FT                   RKGPLHVPGRGPRDTYG"
FT   gene            10151..12217
FT                   /locus_tag="Tpau_0009"
FT   CDS_pept        10151..12217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0009"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA topoisomerase II; ATP-binding region
FT                   ATPase domain protein; TIGRFAM: DNA gyrase, B subunit;
FT                   KEGG: nfa:nfa60 DNA gyrase subunit B; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   DNA gyrase subunit B domain protein; TOPRIM domain protein;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76663"
FT                   /db_xref="GOA:D5UPB1"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPB1"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ADG76663.1"
FT                   /translation="MAADNNAGKSGSGNYGADSIKQLEGLEAVRKRPGMYIGTTGPRGL
FT                   HHMIWEVVDNSVDEAMAGHATRVDVKLRADGGVEVIDDGRGIPVAMHAKGIPTVQLVLT
FT                   SLHAGGKFDSDAYAVSGGLHGVGISVVNALSSRVEVEIDVDGFHWQQNFHWDDAKRDSV
FT                   AEDLIKGEPTTRTGTTVRFWADPKVFTETTHYDFETVSRRLQEMAFLNKGLTITLTDER
FT                   PVAIEVPDEDITEEAPSAHEEDVAAALAEVAPKKRERIFHYPDGLVDYVKHINARTSKS
FT                   PIHASIISFEGKEKGHEIEIAMQWNSGYSESVHTFANTINTHEGGTHEEGFRTALTGVV
FT                   KAYAKDKKLVKEKDGELSGDDIREGLAAVISVKVAEPQFEGQTKTKLGNTEVKSFVQKV
FT                   CREQLQFWFDSNPADAKTIVQKAAASAQARLAARKARELVRRKSATDIGGLPGKLADCR
FT                   SNDPDKCEVYIVEGDSAGGSAKSGRDSMYQAILPIRGKIINVEKARIDKVLKNTEVQSI
FT                   ITAFGTGIHDEFDIAKLRYKKIVLMADADVDGQHISTLLLTLLFRFMRPLVEHGHVYLA
FT                   QPPLYKLKWQKGAEPEFAYSDAERDALLAEGLKSGKKINKDDGIQRYKGLGEMNAKELW
FT                   ETTMDPTVRVLKQVTLDDAAAADELFSILMGEDVVARRSFIARNAKDVRFLDV"
FT   gene            12278..14791
FT                   /locus_tag="Tpau_0010"
FT   CDS_pept        12278..14791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0010"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA gyrase/topoisomerase IV subunit A;
FT                   TIGRFAM: DNA gyrase, A subunit; KEGG: rop:ROP_34970 DNA
FT                   gyrase subunit A; PFAM: DNA gyrase/topoisomerase IV subunit
FT                   A; DNA gyrase repeat beta-propeller"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76664"
FT                   /db_xref="GOA:D5UPB2"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPB2"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ADG76664.1"
FT                   /translation="MTDTTPPTETGGHDRIEPVDIQQEMQRSYIDYAMSVIVGRALPEV
FT                   RDGMKPVQRRILYASYDAGYRPDRSYVKSAKPVAETMGNYHPHGDSAIYDALVRLAQPW
FT                   SMRYPLIDGQGNFGSPGNDPAAAMRYTEARLTPLAMEMLRGIDQETVDFAPNYDGKTQE
FT                   PTVLPARVPNLLMNGSGGIAVGMATNIPPHNLREIAEAVFWCLENYDADSEATLEACME
FT                   RVKGPDFPTHGLIVGGQGIKDAYSTGRGSIRMRGVVEVEEDSKGATELVITELPYQVNP
FT                   DNLVLSIAEQVRDGKIAGISKIEDQSSDRVGMRIVVRLKRDAVAKVVLNNLYKHSQLQT
FT                   SFGANMLSIVDGVPRTLRLDQMIRYYVAHQLDVIVRRTKFLLRKAEERAHILRGLVKAL
FT                   DALDEVIALIRASQTTEIARTGLMELLDVDELQANAILDMQLRKLAALERQKIIDELAE
FT                   IEREIADLKDILDKPERQRAIVRDELGEIVEKFGDDRRTKIIAADGDVTDEDLIAREDV
FT                   VVTITETGYAKRTKTDLYRSQKRGGKGVKGADLKQDDIVRHFFVCSTHDWILFFTTKGR
FT                   VYRAKAYELPEQSRTARGQHVANLLAFQPEERIAQVIQIKGYDDAPYLVLATKNGLVKK
FT                   SRLEDFDSNRSGGIVAINLRDEDELVGAALVSSEDDLLLVSKNAQSIRFSATDEALRPM
FT                   GRATSGVQGMRFNGDDQLLALNVVQEDTYLLVATSGGYAKRTAMDDYPVQGRGGKGVLT
FT                   IQFDPKRGDLVGALIVNDETELYAITSGGGVIRTAARQVRKAGRQTKGVRLMNLGEGTT
FT                   LLAIARNADETDETSDETEQATTEE"
FT   gene            14819..15517
FT                   /locus_tag="Tpau_0011"
FT   CDS_pept        14819..15517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0011"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rop:ROP_34980 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76665"
FT                   /db_xref="GOA:D5UPB3"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPB3"
FT                   /inference="similar to AA sequence:KEGG:ROP_34980"
FT                   /protein_id="ADG76665.1"
FT                   /translation="MSTPGTGPGQPSEPGPEQAGRQPVRIPRRDTDLGRVIDAPTEGVE
FT                   RDELPKDLPDLDKIHHVTPADAPTTPVATTPPPAATAPAEPEPEAAPSNLHTVGSTPAR
FT                   AAGVKTQAATGPVRAAMQLRSIDPWTTFKLAGVVSVVLFFVWMIAVGALYVILNGMGVW
FT                   SKINDSFQTLVNEQAGSSILTAGDVFLYSGLVGLANVVLLTALATVGAFIYNLCADLVG
FT                   GVEVTLADRD"
FT   gene            15571..15647
FT                   /locus_tag="Tpau_R0001"
FT                   /note="tRNA-Ile1"
FT   tRNA            15571..15647
FT                   /locus_tag="Tpau_R0001"
FT                   /product="tRNA-Ile"
FT   gene            15659..15734
FT                   /locus_tag="Tpau_R0002"
FT                   /note="tRNA-Ala1"
FT   tRNA            15659..15734
FT                   /locus_tag="Tpau_R0002"
FT                   /product="tRNA-Ala"
FT   gene            complement(15745..16197)
FT                   /locus_tag="Tpau_0012"
FT   CDS_pept        complement(15745..16197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76666"
FT                   /db_xref="GOA:D5UPB4"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPB4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76666.1"
FT                   /translation="MGKHSSTRESPDVSAWLLVANPLCLLFGLYAVWTGAVIITGPATC
FT                   DMKTMTAADVCATGRKLLDEQLLVDAAPTPPTDGKYRTYAQQQSFNRVAGPGRVIVGLV
FT                   VVAGSLWLGLAQARGLQTRRELRRRQVRGAAAGQDNKGGLADTRPP"
FT   gene            16298..16852
FT                   /locus_tag="Tpau_0013"
FT   CDS_pept        16298..16852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0013"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mbt:JTY_1130 putative membrane glycine and
FT                   proline rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76667"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPB5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76667.1"
FT                   /translation="MIALKTRTALAAVVAGASVATMTAAPAVADPARVVAGPLSIDRGT
FT                   LAGWEITAPDAEGTVVAGVKLAGKNWGSQIEFGPSLVKGASTDAVARTIVTRSLESDGY
FT                   KGLKGRVVGVQVTPTSVSGVPATRATAEVQFDGAPVRADRLRVVVVDTTPQTYFLSAVP
FT                   VEAPDRLGQADAAERSLVAAR"
FT   gene            16946..17272
FT                   /locus_tag="Tpau_0014"
FT   CDS_pept        16946..17272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76668"
FT                   /db_xref="GOA:D5UPB6"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPB6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76668.1"
FT                   /translation="MSTWDIARAVVAAGCALLAFRQFGIGFRAACECDEVFGDEYRALR
FT                   RTYWRSGGYLVLWAGAAGLVGFNPAIGAGFALMMGPLLVANAFQMTDFLQPVEIHEAKR
FT                   PKDD"
FT   gene            17428..18780
FT                   /locus_tag="Tpau_0015"
FT   CDS_pept        17428..18780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0015"
FT                   /product="protein of unknown function DUF21"
FT                   /note="KEGG: mgi:Mflv_2683 CBS domain-containing protein;
FT                   PFAM: protein of unknown function DUF21; CBS domain
FT                   containing protein; transporter-associated region; SMART:
FT                   CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76669"
FT                   /db_xref="GOA:D5UPB7"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPB7"
FT                   /inference="protein motif:PFAM:PF01595"
FT                   /protein_id="ADG76669.1"
FT                   /translation="MLAVLSILAGIVVVLLITAFTGYFVAQEFAYMAVDRSRLKARAET
FT                   GDPAANRALSVTKRTSFMLSGAQLGITVTGLLVGYVAEPLIGQGLGTLLGGVGVPSAVG
FT                   IAIGAIAAVGLSTVAQMVFGELFPKNLAISRPEPVALQLSLSTTIYLKVFGWLIRFFDA
FT                   ASNVLLRAVRIEPVHDVEHSATPRDLEHIVAASRDAGELPAELSTLLDRILDFPTHTAE
FT                   HAMIPRSRVDVVPAGEPAGAVLDRMADGHTRYPVVGATSDDLIGVITLHDLLTDTSGTA
FT                   ATRCRPAVVVPASLPLPAVVAQLADARQEMALVIDEYGGFDGVVTVEDIAEELVGEIDD
FT                   EHDPGAADPAVPEGEGWLVRGDLHIDELERLLDLDLEPGDYETIGGAVITRLAALPRPG
FT                   DTVDLPVVPEPPNLLDDAPPQRFLRAEVRTVERRVPDRVHLTVRTEEAGDG"
FT   gene            18773..19777
FT                   /locus_tag="Tpau_0016"
FT   CDS_pept        18773..19777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0016"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: protein of unknown function DUF21; CBS domain
FT                   containing protein; KEGG: rha:RHA1_ro03326 CBS
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76670"
FT                   /db_xref="GOA:D5UPB8"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPB8"
FT                   /inference="protein motif:PFAM:PF01595"
FT                   /protein_id="ADG76670.1"
FT                   /translation="MDNPWVIVAITVALIGASAFFVAVEFSLIAVRRNRLEDNAGSSRS
FT                   ARAALRSSQELSLLLAGSQLGITVCTLALGAITKPAVDTWLTPVLESTGMPPWTADVGA
FT                   FLLALFIVTFLHLVVGEMAPKSWAIAHPERSAVMLALPMRGFMTVTRPLLVVLNNTANA
FT                   CLRKVGVTPVNEVESGQDPAALRQLVQHSATVGALNEQYSGHLTSALELEALTLGDIAR
FT                   WDVPPSAVAPSATPERIRAVADSTGHLRLLVGDGAVALGMVHVRDSLHAPDDATAAELM
FT                   RPVLFLAADEPAYAALGFMRESRTHLVVVRRQDGDTAVVTLSDLLGRLMPAAS"
FT   gene            complement(19774..21666)
FT                   /locus_tag="Tpau_0017"
FT   CDS_pept        complement(19774..21666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0017"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: msm:MSMEG_2737 PPE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76671"
FT                   /db_xref="GOA:D5UPB9"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPB9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76671.1"
FT                   /translation="MKVRPERMARLRRRGTFRPSFVIAKLKGALVRNLPRHRSSMIGLA
FT                   AAAAALLSLGSVAPATAATGPDPTIDLLVLYTPEVLKARGSEAKVRAAVEEGIASMNDT
FT                   LRRSNIAGRIRVVGVEQTSAPGSTVGRGKPAIDWLAGNTQSLRNTYDADLVSVVVAGGA
FT                   GIASNPTMPFTTVSGNEAWSVVGNDWLAPDLKRGEAGVFAHELGHNLGALHDWGTTPAT
FT                   RGANPERHGYVNPAGLVDVMAYNNSSLCAPNSCSRRPYYSNPDVTVGGLPFGQRGGTRP
FT                   SDIASVFAKTMPVVAGYRTATMVQFQYNEDGAARPSLVEPLAALNRLIAQRTLPGAYRS
FT                   ARIENAPSAARAGYSPAEVAAAVKAAKDSCSPTTNCELRDGTRYVTLPAKILPIMLPLL
FT                   DFGAATGTIAFVRPLIDLTSPFVRVLLDPARTATGNPLGPIDVFARLSNAVGEGVRAAV
FT                   TGTGDASRYLAPSTPGADTQRSTSTGSPAPVVSAAAARGPALTGAVARADSGRAGAEAL
FT                   TTDGAATAAAVPTPSVSAPDDAAASTPERATPGRTTPERSTPADTIARPSDSSATTGSN
FT                   ADSPQSPSGGTGVTSSAASSPSGTGESAGSGASPASTGSAASSASSDRASTAGS"
FT   gene            21868..22077
FT                   /locus_tag="Tpau_0018"
FT   CDS_pept        21868..22077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0018"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmi:MMAR_5098 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76672"
FT                   /db_xref="GOA:D5UPC0"
FT                   /db_xref="InterPro:IPR012667"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPC0"
FT                   /inference="similar to AA sequence:KEGG:MMAR_5098"
FT                   /protein_id="ADG76672.1"
FT                   /translation="MANLSTAHAGDLSLGISRRAVWLTVATLLAVLAYYFIGIDQGAVS
FT                   VFGNDTHIHEFFHDARHFLGFPCH"
FT   gene            22086..22838
FT                   /locus_tag="Tpau_0019"
FT   CDS_pept        22086..22838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0019"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cai:Caci_5841 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76673"
FT                   /db_xref="GOA:D5UPC1"
FT                   /db_xref="InterPro:IPR012666"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPC1"
FT                   /inference="similar to AA sequence:KEGG:Caci_5841"
FT                   /protein_id="ADG76673.1"
FT                   /translation="MEKLVIARGAAAGALSGLLAFLFARFLVEPIIERAIARQDAADAA
FT                   QHASMPGMDMDSAEVYSRAVQQNFGLGAGIIVFGLVLGTLFAVAYCVAAPKFPRWSPRA
FT                   LALAVAGSLFAGFYVIPYLKYPPNPPGVGDPDSIGERTGTYLLMVAIGLALVAVAWVVA
FT                   LALTPRYGGWGAALIGGAIVVAGSVLAYLVLPAPLSAKDFPADDLYWFRTYSFLAQVIL
FT                   WGGIGLIGGESIHRLTLSRGRAAESVSV"
FT   gene            22874..23047
FT                   /locus_tag="Tpau_0020"
FT   CDS_pept        22874..23047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76674"
FT                   /db_xref="GOA:D5UPC2"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPC2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76674.1"
FT                   /translation="MTRRCVLCWVVAVFFLIVAGVALYRGGPGGIDGLFLVIALAWVLL
FT                   AIQAHHPVGWRG"
FT   gene            complement(23079..23600)
FT                   /locus_tag="Tpau_0021"
FT   CDS_pept        complement(23079..23600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0021"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mjl:Mjls_0009 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76675"
FT                   /db_xref="GOA:D5UPC3"
FT                   /db_xref="InterPro:IPR024245"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPC3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76675.1"
FT                   /translation="MATPLLDDVQPADETSQAPSNAQRVATGFGQSFTGPLNIARGLTG
FT                   IGLSIASHVLHTFFNLTRKTIALALAKKVVHTVRSSDPAAPADDAAPSLPVKGGGVRKP
FT                   LLITLVVALVLAVGGTAFKLLRTPKAPPVAPEPPRVRPASGATGDSAPAASDEETAAVV
FT                   ADEDPRKIGE"
FT   gene            23704..24237
FT                   /locus_tag="Tpau_0022"
FT   CDS_pept        23704..24237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0022"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="KEGG: msm:MSMEG_0024 peptidyl-prolyl cis-trans
FT                   isomerase B; PFAM: peptidyl-prolyl cis-trans isomerase
FT                   cyclophilin type"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76676"
FT                   /db_xref="GOA:D5UPC4"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPC4"
FT                   /inference="protein motif:PRIAM:5.2.1.8"
FT                   /protein_id="ADG76676.1"
FT                   /translation="MTNSNATAHATLHTSEGDIRIALFGNHAPVTVANFVGLAQGTKEY
FT                   TTTNASGGTSGPFYDGSIFHRVIDGFMIQGGDPTGTGTGGPGYDFVDEFHPELKFDRPY
FT                   LLAMANIGRPATNGSQFFVTVGKTPHLNNRHTIFGEVEDEDSKRVIDAIGQAPTDRADR
FT                   PIKEVTINSITIEP"
FT   gene            24555..25049
FT                   /locus_tag="Tpau_0023"
FT   CDS_pept        24555..25049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0023"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: rop:ROP_08530 NlpC/P60
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76677"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPC5"
FT                   /inference="protein motif:PFAM:PF00877"
FT                   /protein_id="ADG76677.1"
FT                   /translation="MTSDSTKTTSRTRAAFGASVAVIGLVASPAVALAAPAPQLPAPQA
FT                   PAPQAAAAPDRGAVVQAALTRVGMPYQYGASGPSSFDCSGLVSWAMNQAGLSVPRSSYS
FT                   LMSAGVPVSRGELRPGDVVITNGGGHAALYVGNGQVVEAVTYGTPVRVSDIRGFVTARR
FT                   F"
FT   gene            complement(25056..25457)
FT                   /locus_tag="Tpau_0024"
FT   CDS_pept        complement(25056..25457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0024"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sen:SACE_0036 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76678"
FT                   /db_xref="GOA:D5UPC6"
FT                   /db_xref="InterPro:IPR019692"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPC6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76678.1"
FT                   /translation="MDNWSAPRSVGVVLLIAGIALGAATALGVIDDPVGIVLVGVGAVL
FT                   LCYLGASVLVLRPRLAADAAGVTYRGAFGRKHFPWDGLEIKRTSTKHWGRESVLLELTR
FT                   GDDLLFLGRWELGEAPTLVAQQLEELRPR"
FT   gene            complement(25511..25804)
FT                   /locus_tag="Tpau_0025"
FT   CDS_pept        complement(25511..25804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0025"
FT                   /product="protein of unknown function UPF0233"
FT                   /note="PFAM: protein of unknown function UPF0233; KEGG:
FT                   nfa:nfa760 putative septation inhibitor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76679"
FT                   /db_xref="GOA:D5UPC7"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPC7"
FT                   /inference="protein motif:PFAM:PF06781"
FT                   /protein_id="ADG76679.1"
FT                   /translation="MPKSKVRKKTDYTINASTDSRTPVKVSAPSGRWFVALFLGFMLAG
FT                   LAWLLVYYLGADESGMGAPGKALNWMVELGPWNFAIGFGLMIVGLLMTMWWK"
FT   gene            25886..26527
FT                   /locus_tag="Tpau_0026"
FT   CDS_pept        25886..26527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0026"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="KEGG: rop:ROP_35100 anthranilate synthase component
FT                   II; TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76680"
FT                   /db_xref="GOA:D5UPC8"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPC8"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ADG76680.1"
FT                   /translation="MRILVVDNYDSFVFNLVQYLGQLGVEADVWRNDDPRLDDPAAAAA
FT                   QYDGVLLSPGPGTPHRAGQTMPMVTAARAAGSPLLGVCLGHQAIGAVFGATVDRAPELL
FT                   HGKTSLVYHNGHGVLAGLPDPFTATRYHSLTVLEPTIPDELEITGRTESGVVMAFAHRE
FT                   LPIHGVQFHPESVLTEGGHRMLANWLAVCGFEVPEARVAELEQEVAAALA"
FT   gene            complement(26548..28542)
FT                   /locus_tag="Tpau_0027"
FT   CDS_pept        complement(26548..28542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0027"
FT                   /product="serine/threonine protein kinase with PASTA
FT                   sensor(s)"
FT                   /note="KEGG: rer:RER_00280 serine/threonine protein kinase
FT                   PknB; PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; PASTA domain containing protein;
FT                   SMART: serine/threonine protein kinase; tyrosine protein
FT                   kinase; PASTA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76681"
FT                   /db_xref="GOA:D5UPC9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPC9"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADG76681.1"
FT                   /translation="MTTPPRRINDRYDLGETLGFGGMSEVHLARDTRLSRDVAIKILRA
FT                   DLARDPSFYERFRREAQNAASLNHPTIVQVYDTGEADTPGGPLPYIVMEYVDGETLRDV
FT                   LRRDGTIAPQAAMTWMADVCAALDFSHRNGIVHRDMKPANVMLTRTGEIKVMDFGIARA
FT                   MSDPSAGMTQTAAVIGTAQYLSPEQARGESVDARSDVYAAGCVLFELLTGQPPFQGDSP
FT                   VSVAYQHVREDPPTPSSILDTVPPELDSITLKALSKNPANRYQTAGEMRQDLIRVLAGR
FT                   KPEAPMVLSDEERDALLTEPTKPRRAAKAAPAAAAAAAAVPAAAAGTPGEPTGDDDRPT
FT                   EAVATVPAASGRAKHSTASGGRSRLVLWISAAIIAIILVGGTTAYLLAGPDEAKQVTVP
FT                   SQIGQNASDAQVALQKLGFNVQIKRVPDNTVPAEQVISTIPGPDSQATEGSTVIVEVSS
FT                   GPKIAAVPDVVNRSEKDARDILTKAGFTVAKDPKKEASPTVKAGDVVSTNPAVGANTPQ
FT                   NTPIVLTVSTGKEQVRVPDVSNTALSQAEANLKGLGFTTKVQEVDDPAPAGTVLRTTPA
FT                   GGTTADKGSDITIVVSKAKAVVMPNLVGQDPSAAKAALIAMGFSESNIQVMATAPSNLP
FT                   WDKNKVWKTTPDAGARVDTSASITIEVRR"
FT   gene            complement(28563..29957)
FT                   /locus_tag="Tpau_0028"
FT   CDS_pept        complement(28563..29957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0028"
FT                   /product="serine/threonine protein kinase"
FT                   /note="KEGG: nfa:nfa810 putative serine/threonine protein
FT                   kinase; PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76682"
FT                   /db_xref="GOA:D5UPD0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPD0"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADG76682.1"
FT                   /translation="MSLQTGSIIADRYELLRLIATGGMGQVWEAMDTRLDRRVAIKVLK
FT                   AEFSEDQEFLARFRNEARTTAALNHPGIAGVYDYGETQDQAGGAPLAYLVMELVNGEPL
FT                   NAVLSRLGHLSEAQALDLLEQTGRALQVAHSAGLVHRDVKPGNIMITPTGQVKITDFGI
FT                   AKAVDAAPVTKTGMVMGTAQYISPEQASGEDATAASDVYSLGVVGYECLAGKRPFSGDG
FT                   AITVAMKHIRDQPDPLPPDLPAPVRELITLTLVKDPRQRYANGGEFADAVATVKAGQRP
FT                   PMPRGWTGGATAASREAATAATTVVPPQPRPGPQPVTGNRNSSPTPRAAAAATPTQYDS
FT                   DGWTRSQKTILGVSVLLLLAAAAIIGGYLLISGGGDDPAPTTPTEPTLTAPPPTGAATS
FT                   ARQTTQAPPPPTRTVTETSTASPPPPPPTTTPPPTTTSDPPITGGEPTTTPTCTGILGI
FT                   PLPCRN"
FT   gene            complement(29957..31471)
FT                   /locus_tag="Tpau_0029"
FT   CDS_pept        complement(29957..31471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0029"
FT                   /product="penicillin-binding protein transpeptidase"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   KEGG: rha:RHA1_ro03698 peptidoglycan glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76683"
FT                   /db_xref="GOA:D5UPD1"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPD1"
FT                   /inference="protein motif:PFAM:PF00905"
FT                   /protein_id="ADG76683.1"
FT                   /translation="MNTPIRRVSVVVVLLVVALLANATYVQVFKADELRSDPRNERVLL
FT                   DEYSRQRGSILAGGQVMAQSVPTDDRYKYLRTYPKDLAPAYAPVTGYYSMVYSAGALEH
FT                   AEGSILNGSDDRLFGRRIVDTLSGRDPRGGNVVTTINPVMQRIAYERLISACGAKGPCH
FT                   GSVVAMEPQTGKILAMVSTPSYDPNPLSSHDPSVVSAAWQNLTKDPDQPMLNRATSQLY
FT                   PPGSTFKVITTAAALSQGRGIDLNTRLTADKQITLPGGGGTTLQNYAGMTCPDSSGGTV
FT                   SLLQAFQYSCNTAFVDLSTQKMQDGGEAIKQMANNFGVNSSPEPIPLPVSQSVTGPLSY
FT                   PAQVGQSAIGQLDVALTPLQNAVIAATLANGGIRMQPYLVDSLQSPDLSTIATTSPKRQ
FT                   GQALSPEVAAQMRELMVASERNTKGSGGSVSIASKTGTAEHSEGQKGGEAPHAWYIGYG
FT                   PVNDPKVAVSVIIENGGNQGEQATGGSLAAPIGRAVIGAAVNGQGN"
FT   gene            complement(31468..32895)
FT                   /locus_tag="Tpau_0030"
FT   CDS_pept        complement(31468..32895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0030"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein; KEGG: nfa:nfa830 putative
FT                   cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76684"
FT                   /db_xref="GOA:D5UPD2"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPD2"
FT                   /inference="protein motif:PFAM:PF01098"
FT                   /protein_id="ADG76684.1"
FT                   /translation="MTSATATNTPGSGLALDPNRGSRSRELVLLGAATVITGASLAIVE
FT                   WAQKQTISWDLAKYVVAFVVLYAAAHVAVRRFAPYADPLILPVVALLNGLGLVLIHRLD
FT                   LGRAHGENGRIQEINEANQQILWTLMGVAVLVAILALLRDHRTLAKYAYTIGLVGLILL
FT                   ALPALLPASLSEINGSKNWIKTPLFSIQPSEISKILLIIFTAAFLVSKRDLFTTAGRRV
FT                   LGIDLPRPRDLAPLLLVWIVALAVLGYANDLGTPLLIFFTVLAMVYIATERVGWVVVGL
FT                   ALAVVGAVAAYFLFSHLRVRVEVWLHPFDHYEDIGFQPAQSLFSLATGGLAGTGLGSGR
FT                   PTMVPFASTDFIISAIGEELGLIGLAAVLMLFLILIFRAFRISLTVRDSFGKLLAAGLA
FT                   STVAIQLFVVVGGVTKLIPLTGLTTPFVSYGGSSLLTNYALIALLLRISNAAREPKVTR
FT                   KPGAPVPDRPTEIVKRV"
FT   gene            complement(32892..34325)
FT                   /locus_tag="Tpau_0031"
FT   CDS_pept        complement(32892..34325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0031"
FT                   /product="protein serine/threonine phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /note="PFAM: Protein phosphatase 2C-like; KEGG:
FT                   rha:RHA1_ro03700 phosphoprotein phosphatase; SMART: protein
FT                   phosphatase 2C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76685"
FT                   /db_xref="GOA:D5UPR7"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPR7"
FT                   /inference="protein motif:PRIAM:3.1.3.16"
FT                   /protein_id="ADG76685.1"
FT                   /translation="MSLILRYAARSDRGLVRSNNEDSVYAGPRLLALADGMGGHAAGEV
FT                   ASQLMITALAPLDDDEPGGDLLGTLEEAMVAGNETIADQVAEDPELDGMGTTLTAILFA
FT                   GSKLGLIHVGDSRGYLLRDGQLTRITKDDTFVQTLVDEGRITAEQAHTHPQRSLIMKAL
FT                   TGHEVEPTLTLREAKAGDVYLLCSDGLSDVVSDETIGDTLELAVEDCSAAADKLIELAL
FT                   RSGGPDNVTVVVARVEDTSFGQSRPIVGGAANEDDEDYVPPSNTAAGRAAALRPPRKAP
FT                   RRVVAQEVDDEPERGPRRKWIALGVLLVLLIGGAVGVIATRSVVNSNYYVGATDNGTIA
FT                   IYRGVKVSLLGKSLHDQQEVVCLADSPGGDGTAGAASMGCTPLTTKDLTPRGRANLDGL
FT                   PYASSIDDARNQARALTEKDNLIPRCRVSTEIIPVPAPPPAATPPPPGGETLTPPPPPE
FT                   TKVVTQTSTPDEPCRGGPS"
FT   gene            complement(34322..34786)
FT                   /locus_tag="Tpau_0032"
FT   CDS_pept        complement(34322..34786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0032"
FT                   /product="FHA domain containing protein"
FT                   /note="KEGG: nfa:nfa850 hypothetical protein; PFAM:
FT                   Forkhead-associated protein; SMART: Forkhead-associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76686"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPR8"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ADG76686.1"
FT                   /translation="MQGLVLQLTRAGFLLLLWLCVWLVINALRSDARLASGLRPKQKEA
FT                   KPPRGSLFQRGSKTAKYLVVTHGPLANTRITLGQQPVLIGRADDSTLVLNDDYASTRHA
FT                   RLARDGDDWYVEDLGSTNGTYLARNKVTTPTRVPLGTPVRVGKTVIELRP"
FT   gene            complement(34883..36169)
FT                   /locus_tag="Tpau_0033"
FT   CDS_pept        complement(34883..36169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0033"
FT                   /product="FHA domain containing protein"
FT                   /note="KEGG: rer:RER_00340 hypothetical protein; PFAM:
FT                   Forkhead-associated protein; SMART: Forkhead-associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76687"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPR9"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ADG76687.1"
FT                   /translation="MGILQRFERKLEGAVGDGFARVFGGKVVPQEVEAALQREAEDALQ
FT                   PLGDGAYLVPNKYVIAVSPTDQQTFEADRDLAIRAFSKHLDEYIHDNGWQTYGDVVVHF
FT                   EQSPQLHTGQFRARGTVDPDAVPQNLVPQRPPAESGADSMTNNPGYDQGRHGGQQYDDQ
FT                   GGYQQQGYDQQGYGQQPPQGGYDQNYAQQGYDQNYGQGGYQQPAYDQGGYQQQPAYDQG
FT                   GYQQQPGYDQGYQQPGYDQGYQQPAYDQGGYQQQPGYDQGYQQPAYDQNYGQNYAQPGY
FT                   DQGYQQQPGYDQGYQQPAYDQGGYQQQPGYDQNYAQPGYDQGGYGQQGGYQQPQSVTLY
FT                   LEDGSNRTFALREGANVIGRGQDAQFRLPDTGVSRRHVEIRWDGYAAVLNDLGSTNGTS
FT                   VNDVPVSNWELADGDRIRVGHSDIVVRFQ"
FT   gene            36381..36466
FT                   /locus_tag="Tpau_R0003"
FT                   /note="tRNA-Leu1"
FT   tRNA            36381..36466
FT                   /locus_tag="Tpau_R0003"
FT                   /product="tRNA-Leu"
FT   gene            36682..38145
FT                   /locus_tag="Tpau_0034"
FT   CDS_pept        36682..38145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0034"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: mag:amb0722 acyl-CoA transferase/carnitine
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76688"
FT                   /db_xref="GOA:D5UPS0"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPS0"
FT                   /inference="protein motif:PFAM:PF02515"
FT                   /protein_id="ADG76688.1"
FT                   /translation="MTPNRLTAPPDIHTDFAALLAGVGLNAADTGGRVSFTGADPIVPS
FT                   RHRLGAIMAMGMMAPAVATQILYRMRGGSAQDLSVDLRQAVAHINPMYNFTPTAGGYPY
FT                   YSPVATIGKALGFGIYPTKDDRWYLPTAVYPHMFRDWVALLQTGVDAESVARAISGWNA
FT                   QDLEDAAAERGMVGTMIRTPEEWLAHPHGAYLSDVPLIEIIKIGDSAPELPLLADPARP
FT                   LSGIKVATMTHVIAGPVAARTLAEQGAQVLDLARPDPEIDLILLDTHLGFRSTYSDLRQ
FT                   QRYLDQTRRLIDDADVVIENYRGRKIADFGLSAEAIAQSRPGIVYASVRGFGWDGPWSD
FT                   RGGFDMDANCCTGYATLEGGDGPPKLPPTVILNDYLAGYLTALGVLAALKLRAERGGSY
FT                   HVRTSLSRFSMWYSQLGVFDQSYVDEMTQHPDHQPVPPQTYDFTGAYGRQHRLAPGITY
FT                   ATTPGGWRIPDHPVVVPLGASEPTWLPPY"
FT   gene            complement(38180..38713)
FT                   /locus_tag="Tpau_0035"
FT   CDS_pept        complement(38180..38713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0035"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV_4901 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76689"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPS1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76689.1"
FT                   /translation="MTAPQIRSETVDWDIWYPDAYEISAEGVRGFARAVRDPHVPFGAR
FT                   GILATDTPVPITLLAGPMFDAAAILVSRAIPNCNLSRIVHAAQQFTTVRPLRIGQRISF
FT                   GARLTSHIVKANTDVIAIEVTAYADDAAHLAALITIAHSATAGPGVDLDAVADQIMLTG
FT                   TGPSDSDAYTATAG"
FT   gene            38890..39852
FT                   /locus_tag="Tpau_0036"
FT   CDS_pept        38890..39852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0036"
FT                   /product="Cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /note="KEGG: mpa:MAP0135 CmaA1; PFAM:
FT                   Cyclopropane-fatty-acyl-phospholipid synthase;
FT                   Methyltransferase type 11; Methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76690"
FT                   /db_xref="GOA:D5UPS2"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPS2"
FT                   /inference="protein motif:PRIAM:2.1.1.79"
FT                   /protein_id="ADG76690.1"
FT                   /translation="MPNLDPHFDDVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDMTLE
FT                   EAQLAKVDLSLGKLDLKPGMTLLDVGCGWGTTLIRALEKYDVNVIGLTLSKNQYEAVSR
FT                   RLGEVQSERSAEVRLQGWEEFDGAVDAIVSIGAFEHFTHERHLAFFDRAFDILPAGGRA
FT                   MIHTIMTFGMDTFRGESRVTRADFDFFRFIRTEIFPGGELPITKYFPLLAEMGGFDVTR
FT                   IQSLQPHYAKTLDIWAANLEAAREQALHIHPQSVYDTYIKYLTGCADAFRRGLIDVRQH
FT                   TLVKPEHDARHRTLDEVLAMHPEVDAAAGTTAARFIPSR"
FT   gene            complement(39836..41014)
FT                   /locus_tag="Tpau_0037"
FT   CDS_pept        complement(39836..41014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0037"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; General
FT                   substrate transporter; KEGG: car:cauri_2115 permease of the
FT                   major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76691"
FT                   /db_xref="GOA:D5UPS3"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPS3"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG76691.1"
FT                   /translation="MVARIALIVALGSFTFGYDLGSTATALGHLARQWNLTATEFGFTT
FT                   AALPAAATVSALVAGELSDRVTPITALTVSNLALITGSVASACAPNYQVMIGARLLLGA
FT                   GIGAMAALTPLFLRLLAPPGATGRYTALHQAMIAAGYAGATAATIAFGADATVIVLLLG
FT                   SIAPAIVLFNAKAIAARIPTRPVGVPTGRGGTIRWPAVAIAVLQQLTGISVLVYYAPTV
FT                   LQQVGASETTATALLLGISMVSIASCVAAGHLADRYGRVPLLQAGAISLAVSMTAIGLA
FT                   FQFQSLASLAAATAVVLIVFPATWGALAWTAITDLAPPERPGRTIGAATTANWVATAVL
FT                   SWAAPLLISGRSPVPTVAFVSFGSMSVCAGLWVRRALASVPGPGAAAPSARG"
FT   gene            complement(40993..41511)
FT                   /locus_tag="Tpau_0038"
FT   CDS_pept        complement(40993..41511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0038"
FT                   /product="flavoprotein"
FT                   /note="PFAM: flavoprotein; KEGG: fra:Francci3_1816
FT                   flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76692"
FT                   /db_xref="GOA:D5UPS4"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPS4"
FT                   /inference="protein motif:PFAM:PF02441"
FT                   /protein_id="ADG76692.1"
FT                   /translation="MSRPTLYLIGCASPPVLQMHEWVDRAQEAGWAACVILSEAAATWL
FT                   TSDQLRHLEESTGHPVRSGPRSPFEPDPLPPAHAAVGVPVTFATLNKIATGVTDTIPVG
FT                   KVCELAGSGLPVALVPRFHEANMTHPQLPLSMTALSTMGIRVAPTGDADDETFDREFDK
FT                   ALAWLRESL"
FT   gene            complement(41508..42641)
FT                   /locus_tag="Tpau_0039"
FT   CDS_pept        complement(41508..42641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0039"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: saq:Sare_3599 XRE family transcriptional
FT                   regulator; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76693"
FT                   /db_xref="GOA:D5UPS5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPS5"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADG76693.1"
FT                   /translation="MTVDTLGERIKAWRLRRGMSQQDLADRMSRSKSWIQKLEGSERHS
FT                   DPRLSVLREVSEALGVPLSILIRNDQEPDRSAGRNLEQIEESIACAPLSTPEDSDVTPI
FT                   RKQLRWSHHAYANAQYVQLADALPGLIRDVHRTSGASALKSEVYRLVTYTAFKHGAIHL
FT                   AGRAADRSLESATDRHSQLLAVEAYALAFSRIPESAAAAATLVTTVSEQWRDLDSSSVY
FT                   GAALLQGAVAAAAAADGDRALSLLARADATAQRLPRDDTAGTGFCTANVGLHYMDVYSR
FT                   LGRYGKSRDLAQRLLDSPALGELSRERQAHFRLDLALLVANEQPAAACSHLIEVSRIAP
FT                   AQLLHPDAQALMRTLMNGGSVPADFERLCRNLLGSLT"
FT   gene            complement(42899..43486)
FT                   /locus_tag="Tpau_0040"
FT   CDS_pept        complement(42899..43486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0040"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sen:SACE_5722
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76694"
FT                   /db_xref="GOA:D5UPS6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPS6"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG76694.1"
FT                   /translation="METTTGRPGRPPRLNRDKIVATAIEIVTREGYTKLSMRRLADRLG
FT                   TSPMGIYYYFESKNELLGFIASEHDSVAAYLQGAPSNDPYERTVQTSEAMVRFLCAHAW
FT                   ALSGILDGHIRVEEFMANHLDGLARSIGELGFDEEGTAETVRWIWRIVVGEAMTRSRAA
FT                   PTGGLTDTIESYLAGRLVRVRPRRVGREIGSE"
FT   gene            43676..44668
FT                   /locus_tag="Tpau_0041"
FT   CDS_pept        43676..44668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0041"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   cmi:CMM_0578 putative quinone reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76695"
FT                   /db_xref="GOA:D5UPS7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPS7"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ADG76695.1"
FT                   /translation="MGDEMRAIVVDEPGPPEVLRLRRRAVPVPAAGEVLIQVEAFGLNR
FT                   SEVHFRSGVATSGSFPRIPGIEAAGIVVLAPGGEFAVGTQVVTMMGGMGREFDGGYAEY
FT                   VCVPAGQVIAFVSDLPWEQIGAVPEMVQTAYGSLHTGVRARPGQSLLVRGGTSSVGMAL
FT                   IVLAKTEGMTVYATTRRAGARELLLDIGADEVFVDDGEVAPAVRHVAVDGVDGAVELVG
FT                   VNVLKDTLRAVKSGGTVCFTGMVSGRWTIPDFYPMDWLPNGVRLTSYSGESSDLPPSIL
FT                   QDFLAAAETGAVRIPVGKVYRLEDIVQAHRDMEAGVIGGKAVVRVDRSD"
FT   gene            44811..45920
FT                   /locus_tag="Tpau_0042"
FT   CDS_pept        44811..45920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0042"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpl:BURPS1106A_A1951 membrane-anchored cell
FT                   surface protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76696"
FT                   /db_xref="GOA:D5UPS8"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPS8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76696.1"
FT                   /translation="MRTAVAATVGAAWAVSGTALIAVLIAIAAGGATYALTAPSPAPAA
FT                   APATTTGTSNDENVRVALKAADDSRTIFGLLSNAVTSSSSGLSAAMSGVPQIFDSVDTA
FT                   RAGAEQVAAGLEETATTQNALNEVSQSAGAWANTLDQVEGISGLSVAVRSSSVQLRKQL
FT                   IDNPTPGSEDTVAQLDQVLAATDGLKTLESVDQLKGSLRSLTSLSDRSATALESARSSA
FT                   RQLRDGLTTISRARPNAESAVGNLSTGMKQLGIALKSIDDQLALIQTRLRDETRDQVEP
FT                   VAAAAPAMDGSARIGWALFAAGIAGVLAYLLALVVHQRVRRVPAAQSPAPLADLARAIS
FT                   EIPTPSHGFPRPDTHNTDPWLPVQFAREK"
FT   gene            complement(45949..47412)
FT                   /locus_tag="Tpau_0043"
FT   CDS_pept        complement(45949..47412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0043"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; FAD dependent oxidoreductase; KEGG:
FT                   mab:MAB_1527 monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76697"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPS9"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADG76697.1"
FT                   /translation="MTEPRVVIIGAGVAGISTAYVLQQQGFTDWVVLEKGADVGGVWYW
FT                   NHYPGLTCDVPSQIYQFAFAPKPDWERIWATGPDIQRYHRDVVDELGLADRIRCDTEVL
FT                   AAEFDDASHTWTLTLNTGETLVADFVVCATGVLQNPAIPDLPGLAKFDGPVVHTARWDD
FT                   ALVTDGKRIAVIGTGSTGVQVVSALHSGARSVTHFVRSPQWVLWAPMRIPQFSAVTTLF
FT                   ERVPGLLDSVHRGLLWGSGILADIVTTPSWRRRAVQAYARASLRLQVRDKQLRTRLTPD
FT                   YEPLCKRQVVSGSYYRALQSDTVELVTDDIAEITAEGLRTADGTLHEADVLVLATGFRA
FT                   HDYMRPMQVTGREGIKLDDAWADGPRAYRMTAIPGFPNLFTVLGPNSPTGSISLQFSAE
FT                   LTARYIAQWLERFRRGELTAVEVTEEATAAFTEKVAAAMGPTVWNTGCNSWYFTDGGTI
FT                   DLWPFDRKTMVDMLSAPDDRDFVVTAPRR"
FT   gene            complement(47409..48338)
FT                   /locus_tag="Tpau_0044"
FT   CDS_pept        complement(47409..48338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0044"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: rer:RER_48540 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76698"
FT                   /db_xref="GOA:D5UPT0"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPT0"
FT                   /inference="protein motif:PFAM:PF01734"
FT                   /protein_id="ADG76698.1"
FT                   /translation="MSRALVIGCGGTIGGAWTMAALAALADQLDWDPREAAVLQGTSAG
FT                   AEIVTLLSGGYSPHELVSMQEERSADPVLTRHLAATPGSLPRIPISLPSQPSTLWSRTG
FT                   GHAPLTGVAPRGRGDARWLQELADSVLGVSAPVPERARLVAYEPATGERVAFGAAGAPS
FT                   ATAGEALRASWAIPAWMPPVTISGRTFVDGGAASTASLDLIAPDDADEIYAIVSMASAP
FT                   GVRGPGIGGLMEQALLRRPMSSVFWREVAVARARGQKVTVIAPDAADLAGLGANFMARG
FT                   KRAAAFAAAQRTAPQTVRRALSGEAVPR"
FT   gene            complement(48335..49228)
FT                   /locus_tag="Tpau_0045"
FT   CDS_pept        complement(48335..49228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0045"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: mab:MAB_1526 short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76699"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPT1"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADG76699.1"
FT                   /translation="MTLLDRLLPIGGRRRPDLNGAVVVVTGGARGIGAATARLFAQQGA
FT                   RVWIGDIDPDVAHTTAQTIPGARAGYLDVTDRASWDTLLTEVTAAAGPVDVLVNNAGVM
FT                   PLGHFESEAEATTDLILDVNVRGMLNGMRATIPAMVHRGHGHVVNVASMAGMIPLPGMV
FT                   TYNASKFAALGASLGARREYDGTGVAVCAILPAAVRTELSSGAELGGALPTVDPEDVAA
FT                   AVVDTMRTRAARTSVPKWVAPGWSLVDAFVPEPVERLARRLAGDRRGLDLDADARRAYT
FT                   DRLDRHASAHAEGVAQ"
FT   gene            49326..49955
FT                   /locus_tag="Tpau_0046"
FT   CDS_pept        49326..49955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0046"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: rop:ROP_15500
FT                   putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76700"
FT                   /db_xref="GOA:D5UPT2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPT2"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG76700.1"
FT                   /translation="MARLTRAEQRAQTRADLLIAARERFLAVGYAAASLDDIADRAGYS
FT                   KGAVYSNFVDKPNLCREVLHALHADKMAEMAALITGPGELQDRIDGLAEWVERTVGDVG
FT                   WTMLELEFVIVSRTDPKLREMVVELRTAAHCTVVDMLRGLLGVDGDDADVAAAEAELYE
FT                   LESTADLLLSAGIGLGIQRAVDPTISAEPVIDTMRSTLTLLAVGAR"
FT   gene            complement(49962..50105)
FT                   /locus_tag="Tpau_0047"
FT   CDS_pept        complement(49962..50105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76701"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPT3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76701.1"
FT                   /translation="MTPGDRVQLRDEALSYGTVLRTDEEAVSVKLDDGRAVAVAREDLL
FT                   LL"
FT   gene            50270..51568
FT                   /locus_tag="Tpau_0048"
FT   CDS_pept        50270..51568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0048"
FT                   /product="Triacylglycerol lipase"
FT                   /EC_number="3.1.1.3"
FT                   /note="KEGG: nfa:nfa54830 putative lipase; PFAM: secretory
FT                   lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76702"
FT                   /db_xref="GOA:D5UPT4"
FT                   /db_xref="InterPro:IPR005152"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPT4"
FT                   /inference="protein motif:PRIAM:3.1.1.3"
FT                   /protein_id="ADG76702.1"
FT                   /translation="MTAVTTRLETAEQWPAPAEPQQVGIDPFFDAPEGFADVPAGTVLR
FT                   YRDVTVGFLGRIKQRVRATQLLYRTVNMHGDPEVTTTTVLRPRRGAKPGAPLVSYQCAI
FT                   DSLHPKTFPSYVLQHGVRTEDASFPQIEYLFIAAAVAKGWTVSVPDHGGQTGRWGIPRE
FT                   PGHMVLDGLRACLAHAPFDLAPDTRIGVWGYSGGGLATVWAAETAPSYAPELNLIAGAV
FT                   GAPVSDPGNVFVYLNNTLFTGLPTLVIAALAREYPTLREVLAEHVDDKGRKLFYEDALE
FT                   WSPERAIRKMAHKDFGYYCDLPFEEIARLPKLLEIFDDIRPGQSAPAVPMLVVQSTKDQ
FT                   ISPADDATAHVQRYAAGGTHVEYRTDQWSDHFSMHFMSAPMLLGWLTDRLDGKPVGAAG
FT                   HRHSRSIMASPRQIGRTLRLVGTAARVAAGGRF"
FT   gene            51608..52165
FT                   /locus_tag="Tpau_0049"
FT   CDS_pept        51608..52165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0049"
FT                   /product="protein of unknown function DUF218"
FT                   /note="PFAM: protein of unknown function DUF218; KEGG:
FT                   rop:ROP_55140 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76703"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPT5"
FT                   /inference="protein motif:PFAM:PF02698"
FT                   /protein_id="ADG76703.1"
FT                   /translation="MSKVKIAIWSTAVLVVVFLGAVAAVGYPVFGQAKQDPLERVDAVV
FT                   VLGGEHDGREQYGLQLAKEGYAPTLVLSNPYEPDDHVMAPLCDRRVDGIEVLCEVPDPS
FT                   TTRGEALFTERLARERGWKKVIVVSWRYHLPRSRYIFGNCFAGETVMRAVPREYAFGPA
FT                   DWELIYLYQSFAMAKAMVQGGC"
FT   gene            complement(52162..52539)
FT                   /locus_tag="Tpau_0050"
FT   CDS_pept        complement(52162..52539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0050"
FT                   /product="camphor resistance CrcB protein"
FT                   /note="KEGG: rha:RHA1_ro06412 camphor resistance CrcB
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76704"
FT                   /db_xref="GOA:D5UPT6"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPT6"
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro06412"
FT                   /protein_id="ADG76704.1"
FT                   /translation="MINPLLAALGGAFGAAIGYRTARLAPENRATALLLVTAAASLVLG
FT                   AIARAGAIAHGSPAGAFLIGLCGTAVSFAALAWCLVRAERPVRAVLAVAIIVGMSVAAA
FT                   MLGYLASDLLGLASVKLPKVG"
FT   gene            complement(52536..52976)
FT                   /locus_tag="Tpau_0051"
FT   CDS_pept        complement(52536..52976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0051"
FT                   /product="camphor resistance protein CrcB"
FT                   /note="KEGG: nca:Noca_2957 camphor resistance protein CrcB"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76705"
FT                   /db_xref="GOA:D5UPT7"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPT7"
FT                   /inference="similar to AA sequence:KEGG:Noca_2957"
FT                   /protein_id="ADG76705.1"
FT                   /translation="MSATHSTGPTRPELTAVAVGGAVGAAVTYSVQLHGDDTGAGAAAV
FT                   PLLTIVLAGVGCLLMGALLGGVGDLLPRTVRALLIGTAGGITPLATYAAVGLTVRSGTA
FT                   SAVFLIGTPLVALVAGTGGYFAASLVTRRGAAQHSEPGETPA"
FT   gene            complement(52982..54580)
FT                   /locus_tag="Tpau_0052"
FT   CDS_pept        complement(52982..54580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0052"
FT                   /product="exopolysaccharide biosynthesis polyprenyl
FT                   glycosylphosphotransferase"
FT                   /EC_number="2.7.8.6"
FT                   /note="TIGRFAM: exopolysaccharide biosynthesis polyprenyl
FT                   glycosylphosphotransferase; KEGG: rer:RER_13170
FT                   glycosyltransferase; PFAM: sugar transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76706"
FT                   /db_xref="GOA:D5UPT8"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPT8"
FT                   /inference="protein motif:TFAM:TIGR03025"
FT                   /protein_id="ADG76706.1"
FT                   /translation="MTELSSETSGPHAHRGVTTHPTLPPHPPRTSPTAPASDVPAAPPV
FT                   SPDTASLADTGAAPEPPATTGSRSVPRGAVLTDDIVVATVAAASGSVAAIAAGVPAATA
FT                   VAVIIAIHAVWVGALSSSRTLAVPLLRLGSAEFRHVLRATAVVFGITGIVEAYLHVPLL
FT                   QAVIRASLPVALGGVLLCRMLWGRRVRTQTDQEFRTPTLVVGSFFATRATAAALLREGR
FT                   SGAEVVGACLPEGESELYESIPLDDGTAIPVVGSDQTLLAAIDRTGARAVALTPTDTLG
FT                   PGDLRKLIWELDEKQVELVLVPGVVDVAGHRVVYQSVSGMPMLSIARPQHRRADSMAKR
FT                   TFDIVFATIALLFTFPVTLAVAIAVKIDSRGPLFYSAERVGAGGKTFHMVKFRSMVDGA
FT                   DSYRDALADKDIGAGVLFKIPDDPRVTRIGRIVRRYSIDELPQFINVLKGEMSVVGPRP
FT                   ALPAEVAQYPPVMRRRHLVKPGITGAWQVSGRSDLSWDESVRLDVGYVENWSLFTDLSI
FT                   VARTVGTVVGSSGAY"
FT   gene            complement(54737..55291)
FT                   /locus_tag="Tpau_0053"
FT   CDS_pept        complement(54737..55291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0053"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="TIGRFAM: dTDP-4-dehydrorhamnose 3,5-epimerase; KEGG:
FT                   msm:MSMEG_5977 dTDP-4-dehydrorhamnose 3,5- epimerase; PFAM:
FT                   dTDP-4-dehydrorhamnose 35-epimerase related"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76707"
FT                   /db_xref="GOA:D5UPT9"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPT9"
FT                   /inference="protein motif:TFAM:TIGR01221"
FT                   /protein_id="ADG76707.1"
FT                   /translation="MRIEATDLSDVVLLVPEPHRDQRGLFTRTFDAEEFDAHLGVPGAS
FT                   ASFVQDSQSRSHGGVVRGLHGRSGRGEAKLVRCAHGAVLDVLVDIRPDSPTFGRHASFR
FT                   LDDENFHHLYVPPGFLHGFQALTPVADVCYRIDRPHDPNEDLGVVYNDPDLAISWPLPV
FT                   TVVSSREAAAGSWSELQHGLR"
FT   gene            55306..56325
FT                   /locus_tag="Tpau_0054"
FT   CDS_pept        55306..56325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0054"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   bbt:BBta_7048 putative O-antigen export system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76708"
FT                   /db_xref="GOA:D5UPU0"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPU0"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADG76708.1"
FT                   /translation="MTASSPGDTVYRIVADSWYAPHLRGAVALDDLLPRPVRSAAARSG
FT                   LLRGLLLAAAGLRADAVVTTNPSPGAAICLALYGLLGRRRVVLLEYIVHPPSGRFGRLR
FT                   FTVLRKLLLRRALLRAQVLTDAEVPAYAALHGVGPDRFEVVRWPARFDETPAPALRAGR
FT                   VVVASGRRTDWDTFLRAADGADWDVRVVCTGADLAAVQSLAPPSATVLHDISADENQAV
FT                   VNQATVYVIPVPETGASIGQIRVMNAGQAGVPVVASDVSGFAGYLDQEVAVLVPPGDPA
FT                   ALRAAVDALLDDPARREGLRSAARARGGTMDEYLTRIDELAHRGAGPEPVTDGVERIS"
FT   gene            56326..57198
FT                   /locus_tag="Tpau_0055"
FT   CDS_pept        56326..57198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0055"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /note="KEGG: aau:AAur_3159 glucose-1-phosphate
FT                   thymidylyltransferase; TIGRFAM: glucose-1-phosphate
FT                   thymidylyltransferase; PFAM: Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76709"
FT                   /db_xref="GOA:D5UPU1"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPU1"
FT                   /inference="protein motif:TFAM:TIGR01207"
FT                   /protein_id="ADG76709.1"
FT                   /translation="MRGIILAGGTGSRLHPITLGVSKQLVPVYDKPMIYYPLSTLILAG
FT                   ISDVLVITTPHDREAFSRLLGDGSQFGIAISYAVQPEPDGLASAFRIGRQHIGGDRAAL
FT                   VLGDNIFYGPGLGSQLQRFSEIDGGAVFAYRVSDPERYGVIEFDAAGKALSLVEKPERP
FT                   RSNYAVPGLYFYDNDVVEIAAGLRPSARGELEITDVNLEYLRRGTLQVQVLPRGTAWLD
FT                   TGTVDSLLDAGTYVRTIEQRQGLRIGVPEEVAWRRGFLTDEELRTRAEPLVKSGYGAYL
FT                   LNLLAAERG"
FT   gene            complement(57143..57829)
FT                   /locus_tag="Tpau_0056"
FT   CDS_pept        complement(57143..57829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0056"
FT                   /product="protein of unknown function DUF1361"
FT                   /note="PFAM: protein of unknown function DUF1361; KEGG:
FT                   msm:MSMEG_0492 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76710"
FT                   /db_xref="GOA:D5UPU2"
FT                   /db_xref="InterPro:IPR009793"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPU2"
FT                   /inference="protein motif:PFAM:PF07099"
FT                   /protein_id="ADG76710.1"
FT                   /translation="MTTARGVLLVASLLATTALTVALGVTDAQAPMSYPTRFLVWNLFL
FT                   AWIPMLCALGFATVRARGALVPLGVGWLAFLPNSPYLVTDLVHLGEGANMWRHVLQYGF
FT                   AAWTGILLGVVSLLLVHRRLEREFGARWGWLAVAVSVGLCAIGVVIGRFQRWNSWDLVT
FT                   RPDDVVAATLGWIGSPFSHVESTGVALAVAAFYGLAYLTVWSLTPAVISPVPRPEDSAD
FT                   TPRTRI"
FT   gene            57964..58539
FT                   /locus_tag="Tpau_0057"
FT   CDS_pept        57964..58539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0057"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="KEGG: rop:ROP_39590 dTDP-6-deoxy-D-xylo-4-hexulose
FT                   3,5-epimerase; PFAM: dTDP-4-dehydrorhamnose 35-epimerase
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76711"
FT                   /db_xref="GOA:D5UPU3"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPU3"
FT                   /inference="protein motif:PRIAM:5.1.3.13"
FT                   /protein_id="ADG76711.1"
FT                   /translation="MAMRARGLTVPGAFEFTPQQFGDDRGRFLEWFKASEFEEATGAPM
FT                   PELQQANCSVSAAGVLRGVHYTLTPPGQAKYVTCVRGAFLDVVVDLRRDSPTFGTWDTV
FT                   LLDDVDRRAVYLPAGLGHAILSLEDRSTVMYLCSVEYAPDVDRELDAFDPDLAIDWPTE
FT                   GRDGTPLTYVRSAKDEAAPSLREVFGGR"
FT   gene            58574..59674
FT                   /locus_tag="Tpau_0058"
FT   CDS_pept        58574..59674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0058"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   mmi:MMAR_4514 glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76712"
FT                   /db_xref="GOA:D5UPU4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPU4"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADG76712.1"
FT                   /translation="MIVSEPLRVLLVGPAPPGPHSRGGMATVMGHMAAHPHAAITVVPT
FT                   FVDAGPVERIRVGVVGMLRAAVLVLAGRVDVLHVHLSHGGSVIRKALPLWAARLRGVPA
FT                   VIHGHSFDFGGWLAGLPAPARAVVRAALPADRWLVLSTGLAAEYRAALHLPADRVQVLH
FT                   NPVPAAATAAPDPAETTVLQVVSLGRLGERKGTYGLVSALAALPPDTLNRLHLTLAGDG
FT                   EVDEVRAAVAAAGLGEAVTVTGWIDAAGRDRLLAASHVFALPSHHEGLPMALLEAMAAG
FT                   LAPLTTPVGGIPDAVSDGIDGLLVPPGDPAALAAALTALVDDRAATAALATAARERAQE
FT                   FDLEIWYWRLESVWSELAGVRSVRRG"
FT   gene            complement(59652..60677)
FT                   /locus_tag="Tpau_0059"
FT   CDS_pept        complement(59652..60677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0059"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP0961c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76713"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPU5"
FT                   /inference="similar to AA sequence:KEGG:MAP0961c"
FT                   /protein_id="ADG76713.1"
FT                   /translation="MSGRRLLWLSPWMRPLARVYCEALEDRGWEVVLVTSDQHPESDAA
FT                   RPYEWVLNPRPKTPSTWAPFARRLRDARRFAPHVVVTELVRDPRWIALAGSAPRVRLVH
FT                   DDRPHDAAEEVPRWERALFDRWNGSAAATVAFSEYVRAEIGADALAPLTSDLAEMLVPP
FT                   MVPATERRDFVAVGRLNGYKNLDVTLDAWERHATGPGWRGDELVLIGDGDAPLRAAPHV
FT                   RRVPGAYSYADVIGPLAAAKGSVAHYRRATQSGVQVLAMQLGVTPIVSDRGALPEFQPP
FT                   GEAAIGVDDVAGLAAAFDALADPEAAARRGAVARAHYLARYGADESAARLEEMLSRVAR
FT                   I"
FT   gene            complement(60674..62644)
FT                   /locus_tag="Tpau_0060"
FT   CDS_pept        complement(60674..62644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0060"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; glycosyl
FT                   transferase family 2; KEGG: mul:MUL_4676
FT                   glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76714"
FT                   /db_xref="GOA:D5UPU6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPU6"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADG76714.1"
FT                   /translation="MTRDAERAYLPGGLQSGPPPAAPTPRTPAVLIVAYRNPADLRACL
FT                   RSVGEHLPDLPVLVWDNSVPAEPEMASLAAEFPDVRWYSTGENLGFAAGVNRLAEAAPD
FT                   HDLLLLNPDAVLRDDLARTRAALGTAGVAAAAPGVRDPDDHDGLRRPWDVAHRPRGLVR
FT                   SLVSHAGYAERLRGTPLSDLYSTRPDSVSGYLTGACLAISRDAWNALGPFDEEYFLYGE
FT                   ESDWQTRATDAGWRLVLTEDPGVDHTGHGTVRNDRSASRRSADLLRANVALNLEHAAGP
FT                   RVAGAFLVGHSALDRVQRSKRRPRTRATTPSIVITTNRLVFGGAERQHVVLASELARRG
FT                   HDVTIACMQRFGPLVREIPHGVRVVRQPWWAPALELPAGPQILISGDTNTETGFATLWR
FT                   AAGRNRKWLVAAHIPPALDGPTYSTGLAAAMRRADGFIALSDRHWTEATAHQDLGSRHF
FT                   TAPNGVASAASLGGVPPRPAVGDPPRLAMLSRIVEHKNPHLLVEALAGLREMPWELSIY
FT                   GDGPDRARLEELTPDDLRDRVHWRGWSPGPDHALAEADLLCVPSRSEAFPLVILEAMAR
FT                   KVPVVASSVCAVPDMLDHGRAGALVDDVSVTGWRDALAALLERPEEWAALGENGFDRMR
FT                   ERYTIEAMADAYEAAFAGVAP"
FT   gene            complement(62641..64212)
FT                   /locus_tag="Tpau_0061"
FT   CDS_pept        complement(62641..64212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0061"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; virulence
FT                   factor MVIN family protein; multi antimicrobial extrusion
FT                   protein MatE; KEGG: mpa:MAP0963c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76715"
FT                   /db_xref="GOA:D5UPU7"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPU7"
FT                   /inference="protein motif:PFAM:PF01943"
FT                   /protein_id="ADG76715.1"
FT                   /translation="MPDYSIATEVSGSESGTAQGRASSGRIARAFGVQMVARVVGLMAS
FT                   IVTMALTSRHLGLTSYGHLQAAIAFVGLWTSFTELGIGAVIVRRVTSGLADLSQLVRVS
FT                   VGLSIAYCVPLGALTLFMGWGIYSSQGSEVVAMIAIVAVSLILTTLSSCFQPIFMTNVQ
FT                   FGAVAASDVVGRVLSLAGTVWLISIDAPLVWFAAVQIVPPLVALVIQAIAARRLVEISP
FT                   VFSVGESWHLIRESLPQTGVLIIAALYWRSDAFLLSILSTPQQLGAYSLAYGIAFNATV
FT                   ISATYLASALSTMTNLWATDRDEFARFTVRSMQAMLFLGTPMVAIGLTLAPGIIHLISD
FT                   SEFVEIGSVALGLLFIAVALRFVNAVLSQALFAAHDQVFLLRLNVVNLIGNIVLNVILI
FT                   PPFGAAGAGIALIASETVGLLVATWRLTRRSPYRTPWRFCLHLLVPLGATVGVCLALDD
FT                   VLPVLVTAMIAGVVFLAVNLALGPVHASAIRELLARGGEPDARDDESSKAPPTSSEPTS
FT                   SEGNTR"
FT   gene            64248..65309
FT                   /locus_tag="Tpau_0062"
FT   CDS_pept        64248..65309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0062"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   fre:Franean1_0751 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76716"
FT                   /db_xref="GOA:D5UPU8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPU8"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADG76716.1"
FT                   /translation="MRVTVPLAGGLSEQDWARRHAAGEVPDRSPYGLHRLDRHDMSVRF
FT                   ASADFGAGRVGRAAARVARSVRHRTGGYEFVEAFTSGGRIGEADAVLAYDERTAVPALL
FT                   TGRTPVAAGIGWLNRRAVAGGVHGALAARALPRAGAVWAQCSAVLPVIGAEWGVPASRL
FT                   QFVPLGIDTEFYGEQPLPETPGLVMSAGEDRFRDHATLIGAVAAVRRNRPETRLELASA
FT                   LPFDAPDGLVTVHTERLNGRIRELYRRASVVAVALHPTVTGSGLTVVLEAMASGRPIVV
FT                   TDNPGVDDYVEHGVTGLTVPAGDCAAMAGAIESLLSDDGMRIEMGRAAAKRAREQFTSA
FT                   IMVDHLARMLRRM"
FT   gene            complement(65269..66063)
FT                   /locus_tag="Tpau_0063"
FT   CDS_pept        complement(65269..66063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0063"
FT                   /product="glycosyl transferase, WecB/TagA/CpsF family"
FT                   /note="KEGG: mmi:MMAR_4502 teichoic acid biosynthesis
FT                   protein; TIGRFAM: glycosyl transferase, WecB/TagA/CpsF
FT                   family; PFAM: glycosyl transferase WecB/TagA/CpsF"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76717"
FT                   /db_xref="GOA:D5UPU9"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPU9"
FT                   /inference="protein motif:TFAM:TIGR00696"
FT                   /protein_id="ADG76717.1"
FT                   /translation="MTALTQRMLVAGTVITRLSHAEALDLVERRAAAPGRRPLGLCSAN
FT                   LDHFHHFRPGRNHLGSAVDWVTLADGAPVVRRGERLTGERWPRVTGADLLPDVIAVCAE
FT                   HGFRIGFVGGTPEAHRALDATLRSTHPGLAIAGYWAPERDELEDPAANARLVAELRTAG
FT                   VTVLVVGLGKPRQEQWIDTWGAETGAGVLLPFGAAADFIAGTVDRAPEAWQRADLEWLY
FT                   RLKQEPRRLARRYLIQGPPALLRLRGARLVTSDATSARGDRP"
FT   gene            66371..67345
FT                   /locus_tag="Tpau_0064"
FT   CDS_pept        66371..67345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0064"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ace:Acel_1928 lipopolysaccharide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76718"
FT                   /db_xref="GOA:D5UPV0"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPV0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76718.1"
FT                   /translation="MNVAGFVRTVLLKPVVLILLLVVGTGAGVVGWNSATTHYESTGSV
FT                   LVIPPGAGATDPGKNPFANLGEGIAQLANVVALAAQAPEAQERVAATGAQTGYTVSTMA
FT                   GDSSRSTQLSPQITFVVSGPDAETAQRGARELITVMRDKLRRLQVDAGVTVPGTFADLR
FT                   VSVEPPLGAEIPAASARDAASYAMGAMGLVTVLILVAVSAKQLIRRRPAHGEVAPVPVS
FT                   TSGPQDGDSVGENAVADEEAGAQATFPITEAPPRPPRPRQIAPTERPLRPQRALSEDWA
FT                   TAEEPLPEPPGDDRTPVRSSRRVPPQVRWARPANRDDPARPRA"
FT   gene            67342..68091
FT                   /locus_tag="Tpau_0065"
FT   CDS_pept        67342..68091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0065"
FT                   /product="lipopolysaccharide biosynthesis protein"
FT                   /note="PFAM: lipopolysaccharide biosynthesis protein; KEGG:
FT                   ace:Acel_1928 lipopolysaccharide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76719"
FT                   /db_xref="GOA:D5UPV1"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPV1"
FT                   /inference="protein motif:PFAM:PF02706"
FT                   /protein_id="ADG76719.1"
FT                   /translation="MTAATQDRPGAVRDHGAAFENESRAPSGRRRVLLRRWLTLILFVV
FT                   VAVVGAMIGSKTTTQQYETSGTVLVIPPGAGSPVPRDNPFYRINDTAQFANVLASIALG
FT                   PEGRAVVAKAGASPEYAVRGFMGATEQSTKLSAQITLSVRAPNKWVAREAAMGLIALMR
FT                   ERLVSLQRDAGLRDRTYADLRVVVEPDPGVPVFGNAFRAALGYAIAAMLGVAAILALHA
FT                   SRADTRARRTAGGNGSLRDAVHERTAA"
FT   gene            68178..69494
FT                   /locus_tag="Tpau_0066"
FT   CDS_pept        68178..69494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0066"
FT                   /product="O-antigen polymerase"
FT                   /note="KEGG: art:Arth_4126 O-antigen polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76720"
FT                   /db_xref="GOA:D5UPV2"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPV2"
FT                   /inference="similar to AA sequence:KEGG:Arth_4126"
FT                   /protein_id="ADG76720.1"
FT                   /translation="MERLGLNRIAAPGALFLGVAGFFLLSMRQVLTVPGTFGYSLAQTL
FT                   FMGGALLWFATVLTGHTRLVRDWAVIAAVLGYVCASFISYAAAAARGILPISQSAVDRY
FT                   VLTDLMLAGTVLLTLTVLRTQHALRVMLGGLVLGGTVSALFALLDSSTGIDIAAQFRIP
FT                   GLTKGSDYVLIESLDRAGVTRPQGSAGHPLELGAVLTVLAPLALALYFNAKRRAADPRV
FT                   VRLWLACTVIILTADLATVSRSAVAGGLAAIAVMCWRWPVQRLAAILGTATAVVVVGVV
FT                   GQLTLVTALIETFAGSSKDPSLQSREVGRNFVAENLADNFWLGQGVGAYPTLKQPVLDN
FT                   QYLSRLMEAGIFGLLSLCMALVVTLYLAVRASQSKDDALAELAGGISGSAAALIVICLI
FT                   LDTSGFGQIWYLTWILLALAGVVYRLSRVREGELAAPPP"
FT   gene            69641..70882
FT                   /locus_tag="Tpau_0067"
FT   CDS_pept        69641..70882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0067"
FT                   /product="C-methyltransferase"
FT                   /note="PFAM: C-methyltransferase; Methyltransferase domain
FT                   protein; Methyltransferase type 12; Methyltransferase type
FT                   11; KEGG: msm:MSMEG_5980 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76721"
FT                   /db_xref="GOA:D5UPV3"
FT                   /db_xref="InterPro:IPR013630"
FT                   /db_xref="InterPro:IPR013691"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038576"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPV3"
FT                   /inference="protein motif:PFAM:PF08484"
FT                   /protein_id="ADG76721.1"
FT                   /translation="MTCSVCGSDRLRSVVDLGATPPCEKFLQADELDLPEPTYPLHLRL
FT                   CEDCLLLQIPALILPEETFSEYAYFSSFSDSWVAHAKRFVDEAADRLELGPDSFLVEVA
FT                   SNDGYLLQHAVARGIPCLGIEPSVNVGAAARDKGVPTLTAFLNEETAAQVVAEHGRADL
FT                   IAANNVYAHVPDVLGFTRSLRTLLADDGWLSIEVHHALNLVQLGQFDTIYHEHFSYYTV
FT                   YSAQRALATAGLDVVDVELIPTHGGSIRVWARPVEAGATPSPRVAEVLALEAEAGLHEV
FT                   SGYTGLQARADATRQDLLRFLLDRKAEGKRVVGYGAPGKGNTLLNYCGVRADLLEYTVD
FT                   RNPYKHGRYTPGSRIPIHAPERIDEDRPDVIVVLPWNLEAEITAQLAHVAEWGAELVYP
FT                   LPTLHSADLPARVG"
FT   gene            70896..71678
FT                   /locus_tag="Tpau_0068"
FT   CDS_pept        70896..71678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0068"
FT                   /product="Glucose-1-phosphate cytidylyltransferase"
FT                   /EC_number="2.7.7.33"
FT                   /note="KEGG: sco:SCO0393 transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76722"
FT                   /db_xref="GOA:D5UPV4"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPV4"
FT                   /inference="protein motif:PRIAM:2.7.7.33"
FT                   /protein_id="ADG76722.1"
FT                   /translation="MKVVLFCGGYGMRMRGGADDTVPKPMQMVGPRPLIWHVMRYYAHF
FT                   GHTEFILCLGYGAGHIKDYFLNYRETASNDFVIRGGEVELLSTDLSDWTINFVDTGLES
FT                   AIGERLRRARPFLDGDEYFLANYADVLSDAPMNTIIDKVKAEGAAASMLLVPPQSSFHC
FT                   VDVDGDDKVTGITPVSEFPIWENGGYFVLTQEVFDHLPEGGDLVADACGALLKENRLIG
FT                   YRHRGFWKPADTFKERAELDAGYAQGHRPWMLWENGHS"
FT   gene            71675..72328
FT                   /locus_tag="Tpau_0069"
FT   CDS_pept        71675..72328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0069"
FT                   /product="LmbE family protein"
FT                   /note="PFAM: LmbE family protein; KEGG: msm:MSMEG_5978
FT                   GlcNAc-PI de-N-acetylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76723"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPV5"
FT                   /inference="protein motif:PFAM:PF02585"
FT                   /protein_id="ADG76723.1"
FT                   /translation="MIGLSPGAVREVAVLGAHCDDIAIGMGGTLLQIAEANPGVRVRAF
FT                   VGSGGGTPREAEERAALAAFAPGADLRITVLDLPDGRSPAYWEREKQALSEFRRSTDPD
FT                   VVFAPHRGDAHQDHRQLAEMVPTEFRDHLTLGYEILKWETDTPRPTVFNPLTVYAAMTK
FT                   ARLLTECYPSQTAHDWFDDESFLGLARLRGIQCRAPYAEGFMLEKAIVEFGGFR"
FT   gene            72325..73341
FT                   /locus_tag="Tpau_0070"
FT   CDS_pept        72325..73341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0070"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; dTDP-4-
FT                   dehydrorhamnose reductase; KEGG: msm:MSMEG_5976
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76724"
FT                   /db_xref="GOA:D5UPV6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPV6"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADG76724.1"
FT                   /translation="MKVLVTGHQGYLGTVMVPLLQAEGHDVVGLDSGLFADCTLGATPP
FT                   EPPDIAVDLRDVTEEQLAGFDAVIHLAALSNDPLGALDPQITYDINHHASSRLARLAKQ
FT                   AGVARFLYASTCSVYGAAGDGLVDEDAPLRPLTPYAESKVRVEDDAAAIADSGFAPVFL
FT                   RNATAFGFSPRLRADIVLNNLVGYATLTGEVKVLSDGTPWRPLVHAQDIARAFATCLTA
FT                   PVEKISCQAYNIGTEVNNVTVAEIAQSVIDAVPGSTLNITGESGADPRSYRVDFSRARD
FT                   GLGFEAQWTVADGAAELYREYTARGLTSEAFFERYTRLAHLKSRQEAGTLDDTMRPV"
FT   gene            73344..75797
FT                   /locus_tag="Tpau_0071"
FT   CDS_pept        73344..75797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0071"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; C-
FT                   methyltransferase; KEGG: rha:RHA1_ro05728
FT                   glutamate-1-semialdehyde 2,1- aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76725"
FT                   /db_xref="GOA:D5UPV7"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR013630"
FT                   /db_xref="InterPro:IPR013691"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038576"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPV7"
FT                   /inference="protein motif:PFAM:PF00202"
FT                   /protein_id="ADG76725.1"
FT                   /translation="MACRGCGSGDLHRVLDLGAVPAADHFPPAESPVTQEESAHPLAMD
FT                   LCGACGLAQLAADDTVTDEPRGVEPQALKDQAADAVARAASAGWLNGKTVREFGSPHGG
FT                   TWLPLLAERGLQPTEGPADVVVDCFGVMHEPDQKAAFARRAAALAPGGVLLLQYHALGA
FT                   IVAGEQWNALRHGHFAYYSLHALSGLLAGAGLSVAGAWEFDLYGGTVMLAVVEGSVAPD
FT                   DTVFRLLDEEERAGLRDPAVVGTLGRAALRQAAALRAWAHDETAAGRRPAAYGAASRAV
FT                   ALFALAGLNRAVLSAVADASPGKQGRRMPGTDIPIVAPEVVAAGTGPVLLTLPDLRDEL
FT                   VAGYPALSDRLVVDPSTVVTSPVALEPDDGPPPRDFTESNRLQARLHQLVPGGAHTYAR
FT                   ASDQYPENMAPILTGGLGARVQDVDGNEYVEYGMGLRAVTLGHAHPRVVAAVTDAIAHG
FT                   TNFSRPTALEVDAAEDFLALVPGADMVKFAKNGSDATTAAVRLARAATGRDLVAACDHP
FT                   FFSVDDWFIGTTAMNAGIPAEVPAKTLRFQYNDPGSLQRLFDENPGRIACVFLEAATAT
FT                   AEPVDGFLERVRTLCDRNGALLVFDEMITGFRWSEHGAQGLYGVIPDLSCWGKAMGNGL
FT                   PMAALAGRREYMELGGLNTDRDRVFLLSTTHGPETAGLAAFRAVVAEYAESDPIGAMEA
FT                   AGRRLERAATEVIAGAGLADYVQVIGRPSCQVFVTRDAEGAPSQAYRTLFLQGLLENGV
FT                   LAQSLVNSAAHTEADVDHTVDAIEEALVAYGRAVVDGTVEGHLRGRPVAPALRRSAAPR
FT                   RLPDA"
FT   gene            75862..76335
FT                   /locus_tag="Tpau_0072"
FT   CDS_pept        75862..76335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0072"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rop:ROP_23330 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76726"
FT                   /db_xref="GOA:D5UPV8"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPV8"
FT                   /inference="similar to AA sequence:KEGG:ROP_23330"
FT                   /protein_id="ADG76726.1"
FT                   /translation="MNHAPADATTSSRSLRIWGWVGAAVALATSLVHLPMLGDKSWVVS
FT                   IIVAAMLIGCAHCSVCLFRNPTVSAWVRTAAMGVIMIALHPVLMSAMGHGSGMSMDHAM
FT                   AGMDMGGMEMGGMASMEPWMTLMIVFAAAEIVVAVAALGVIALRNRGTSRAAG"
FT   gene            76388..77113
FT                   /locus_tag="Tpau_0073"
FT   CDS_pept        76388..77113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0073"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nfa:nfa11270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76727"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPV9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76727.1"
FT                   /translation="MNATTDFHKPAVRRAAAVAATGALIVGLTGGIAAAEPDAQTTPTT
FT                   PASELLLEQKDFPGGYWVVPSPQQRLANELGADPLTLVASAKVNPPECKNVLTAAKNGG
FT                   GTDANTVAGVHDQDRKSLSESLVPKAADVDTLKVGLLKLCSDVTIEANDPKGGVVKVRA
FT                   KTKEVASDKQKATFEIVIDGTRTKGTDSFPVQQKVLFGVASLRGYTVAVQGTKLGGDPD
FT                   RGEFDSFFSKSVNKVKDAK"
FT   gene            77116..78957
FT                   /locus_tag="Tpau_0074"
FT   CDS_pept        77116..78957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0074"
FT                   /product="Cytochrome c oxidase caa3-type, assembly factor
FT                   CtaG-related protein"
FT                   /note="PFAM: Cytochrome c oxidase caa3-type, assembly
FT                   factor CtaG-related; KEGG: mbt:JTY_0106 putative integral
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76728"
FT                   /db_xref="GOA:D5UPW0"
FT                   /db_xref="InterPro:IPR019108"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPW0"
FT                   /inference="protein motif:PFAM:PF09678"
FT                   /protein_id="ADG76728.1"
FT                   /translation="MAEAVAPERPSPTPSDRPGHTPRTGAVALGVGAAVALAVVLWLVT
FT                   SEGEIRYDINGDSYPGALTAYGASIGRLAGTVAAALTFGALGYAVFRTKPQDGGELGLR
FT                   GYVTQLHARRYAAVWAVVSAPMILLAASDSAGQDLVATYRVGGLFALVSASEAAKGWIV
FT                   SLICAVIVIIAMRNCLTWVAHLWILLPAGIGLLATVVTANEAQGPKHDYSTAALITIAL
FT                   AGALWLGGLWSSVRLPERPEKRWTAPAFATLVLANGAVLAVVYAPGSDLWVTWYGWLYI
FT                   ATAVLIAAAALAQYLRARAPAAGLLTASIGTALAASLLTPPPFLRKRFTVGEVFMGYDL
FT                   PDPPNALRLATLWRFDLNFVLIVAAFAVGYLLLVRRTTSWPWYRTACFLFGCFALLVLT
FT                   SSGVSTYSKAMFSVHMVSHMLMTSLVPVFLLLGAPITLLRDTLTGAPKRWLELFLESKS
FT                   FVVLMRPAVQLLMFALMLYGLYFTPLFDRIGRYHWGHLGINLALLFTGFLFYWRVFQID
FT                   PVPKELPFIGRIGMLLAMMPISMVFALIVMTMDGLVGSRLYYYLDLSWMTDLQRDQFVG
FT                   GVAAWAVDEAAIALVTLGLVLHWAWQNRGEDSEPELL"
FT   gene            complement(79012..80133)
FT                   /locus_tag="Tpau_0075"
FT   CDS_pept        complement(79012..80133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0075"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: swi:Swit_0389 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76729"
FT                   /db_xref="GOA:D5UPW1"
FT                   /db_xref="InterPro:IPR014550"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPW1"
FT                   /inference="protein motif:COG:COG4645"
FT                   /protein_id="ADG76729.1"
FT                   /translation="MTKRLTAVDAARGLAVFSMITGHFDEGAFLSWPTHEIPYFDGASA
FT                   FVLLSGLILGVVHRRWVDRDGGCSTSRERLARRITVIYVCQVLLSGLAAIVSLVWPPAT
FT                   HLGLRPIHETSHPVLDIVTLRYLPAGGDVLALYFVLMCAALILIPVLRKGWWKPILVFS
FT                   LALYIWAMLQPPAWFLLPNENAAGATADWCAWQALFVPALVVGWKWHDWRVSEVMVKSR
FT                   VVVVLLLGTAAVFVGGRAVSRTPAADMLGAKIEFGPARVIAAWVVLPAVIAVVTLLLRY
FT                   PWFRRASHPFVVVGTRSLDSYVLQALLLMTLPVVVIQPWGPGPATGITLAVLVLCWAWA
FT                   EFRTWAGWAKLHRIPSRFAHRSRRHRSLVGFER"
FT   gene            80455..82071
FT                   /locus_tag="Tpau_0076"
FT   CDS_pept        80455..82071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0076"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: jan:Jann_4243 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76730"
FT                   /db_xref="GOA:D5UPW2"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPW2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76730.1"
FT                   /translation="MHKLWIAIPLAALAFLDSMTLARSHSEAEDAAQYILNVTNGDDLF
FT                   HSNHLLYGPVNWVNFRLWEALGYAGDAVVPMQVLSVSASLVSVWLVYRIALRVGASLPL
FT                   SLAATGWVAFSFGFWVYSLEADTYLLPIPFLLWSVMLMLDVIAADASSRSRTFARLSGL
FT                   GAVAAMAALLHQQYVFLLPVIAITFVIVWRRSSERTSARLLFGLGVFLASSWLLIAVTY
FT                   CVVGRLAIGLSSPVDIVSWARGHASNGMWEAISAKTPLMMLVGFGRAVFAMNFLFRSPR
FT                   SSDLMSRVFAGKSLVEERHLAEHGINTVAFLAILLAMAAALAAMAWLLVRLVRRSARRD
FT                   GEEKFAAKTTFMIFAAVYLLVNVIVIMIWEPGNLEFWIAVMPALAIALAVLLSERTRAV
FT                   AASFVLVGALFVANLLGAVVPYSQTSNDYWAMQNGGFRGLVAEGDVIVTDCPYLCRGDL
FT                   ALLTDVPPIDASSDDVDELTAALGTPGTDVFVSSWTFDPPPQAEAPTGNGTVRKQLDER
FT                   RSQLVEVGRSGDQIIYRLERG"
FT   gene            82495..83697
FT                   /locus_tag="Tpau_0077"
FT   CDS_pept        82495..83697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0077"
FT                   /product="glycoside hydrolase family 5"
FT                   /note="PFAM: glycoside hydrolase family 5; KEGG:
FT                   psa:PST_2494 endoglucanase precursor(endo-1,4-
FT                   beta-glucanase)protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76731"
FT                   /db_xref="GOA:D5UPW3"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPW3"
FT                   /inference="protein motif:PFAM:PF00150"
FT                   /protein_id="ADG76731.1"
FT                   /translation="MSRIFRRLIPLFVVIVLVVTSAALPTRRAVDDSTDGQRGINVTTL
FT                   LSQAITISGYPDLTDTGEPQASYDALAAVGHRLIRLPIDWNFLQPNLDKGDERFYSAYW
FT                   RAIKAEIGKIKKAGLKAVLDLHNGCEWTKPGSSEPPLVCGAGLSLDVTTGVWRTISEEF
FT                   KNEPAVVAYDLFNEPTKFTPPSIPNEAGKQAYSVYQAHVNAIVAALRAQGDRKEIWVES
FT                   LCCSIGLDINNTDPDGGWVVDPIKRIVYSLHMYPVGFDADAGLGEEFNPAKLDPNYEEP
FT                   KGKPWSNRGYVRGFLRRLDGFGSWCKRTGEQCSIGEVGWYSRGQAKDSVSRWNELGDEW
FT                   YNIADYYGLAVTYYGASSASVSPLWVYDAPGPSSWFPARGMTQKQSQASVIEKQSHLSK
FT                   P"
FT   gene            complement(83839..85104)
FT                   /locus_tag="Tpau_0078"
FT   CDS_pept        complement(83839..85104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0078"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xop:PXO_03299 endoglucanase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76732"
FT                   /db_xref="GOA:D5UPW4"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPW4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76732.1"
FT                   /translation="METIMKARFAAFAASFVIAASLLSAPPSASANGSYGFGQRGVNTN
FT                   MLFVQSQTAYDWPDESPSKFGEPQSTYDYLAAKGHKYVRIGFNWDVMQRGITATNTGAP
FT                   LDAKYVAKVSSEIAKAKKASLKVVLVLGNPCTWEDRTGATNWEEPTPSRVLLCGKGLTD
FT                   AHLANLWRRISTLYKSEPAVAVYDLVNEPVSYQHPIRTDMQDPGTWPAPYSAYKSAINA
FT                   SIKAIRDNGDDKYVWVQSLCCTLNHDFASTDPNGPWAVDPLNRIEYSQHMYPVSDPNTA
FT                   SKFEEKKLDPNYDSAPGQFWSDRGYTTGFLWRLDTFGGWCSQFSVKCSIGEVGWHNEIS
FT                   EPETAARWNDLGDEFYNKANYYGFDVLSFGVTTGLQGALSTHGTNPVGQPPNLQGWQFP
FT                   APGITRSFSQATVIEKPQHLSK"
FT   gene            complement(85384..86559)
FT                   /locus_tag="Tpau_0079"
FT   CDS_pept        complement(85384..86559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0079"
FT                   /product="glycoside hydrolase family 5"
FT                   /note="PFAM: glycoside hydrolase family 5; KEGG:
FT                   xop:PXO_03301 endoglucanase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76733"
FT                   /db_xref="GOA:D5UPW5"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPW5"
FT                   /inference="protein motif:PFAM:PF00150"
FT                   /protein_id="ADG76733.1"
FT                   /translation="MVFVVAVLVAAMSAIAIGPARAAVPVGDGQRGINVTTMEIQAVTI
FT                   FDHPTITNTGEPQSSYNYLASLGHKLIRLPISWNFLQPNLDTGNRTFHAAYWTAIKAEV
FT                   AKIKAAGLKTVLDLHNGCEWTKPKTTAPVKVCGAGLTLADTNDVWLQLSNQFKNEPSVV
FT                   AYDLFNEPVRFNHPTRSELQNAADQPYTSYKAAVNSIVAALRANNDSKKIWVESLCCHR
FT                   EHDLASTDPNGGWVIDPLNKIVYSQHMYPVSDSSKGEVFDMAKIDPNYEQPQGDFWADW
FT                   GYVRGFLSRLDRFAGWCDRSNVQCSIGEVGWYGDGQSPDSAALWNQLGDEWYNKANYHG
FT                   FAVTYYGASSTSPGSLWAYDSATPAWHPAPGFSRKQPQALILEKPSHLSRP"
FT   gene            86828..87277
FT                   /locus_tag="Tpau_0080"
FT   CDS_pept        86828..87277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0080"
FT                   /product="surface-exposed protein"
FT                   /note="KEGG: bgl:bglu_1g24300 surface-exposed protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76734"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPW6"
FT                   /inference="similar to AA sequence:KEGG:bglu_1g24300"
FT                   /protein_id="ADG76734.1"
FT                   /translation="MKVSVRTWSCSVFALTLIAVPMGPAVAGADPTPAPLCVIPFTSGY
FT                   TGTFNNSSATATASGDTGVSSVAIDVVIQKSWQRMMLRVVWKNLDTGASGAVSDGYDAT
FT                   GPAPTRKTFGALATGTGRVEFQIGLNLPEGNHMTSWQTCTAEATL"
FT   gene            complement(87293..89548)
FT                   /locus_tag="Tpau_0081"
FT   CDS_pept        complement(87293..89548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0081"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="KEGG: mmi:MMAR_0264 cation transporter p-type ATPase
FT                   A CtpA; TIGRFAM: heavy metal translocating P-type ATPase;
FT                   copper-translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase-associated domain protein; Heavy metal
FT                   transport/detoxification protein; Haloacid dehalogenase
FT                   domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76735"
FT                   /db_xref="GOA:D5UPW7"
FT                   /db_xref="InterPro:IPR000579"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPW7"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ADG76735.1"
FT                   /translation="MTDLQSAAPPASADESADATAEAQRTFLDVGGMTCAACVGRVERK
FT                   LNKLDGVRAVVNLATRTATVEHAPTVTVEQLTGTVEAAGYTAAPKSPNPRRAMLAEERE
FT                   RRDVLRRLVVSLVLFVPAADLSIVLAIIPSTRFPGWQWVLLALSLPVVTWGAWPLHKKA
FT                   WQGARHGAATMDTLVSVGIISATAWSVVTVLTPGRQRPDPHGLWNAIVQSDPIYLEVAM
FT                   GVTVFVLAGRYFEASARAKAASALRDLSTRGARDVSVLVRDGSELRIPIGELREDQVFV
FT                   VRPGETIATDGVVESGSAFVDNSAMTGESRPVPAGPGDRVVGGTVCQDGRLTVRAIAVG
FT                   EDTTFAAMLRLVEDAQATKARMQRLADRVSAVFVPCVFAIAALTFAGWMLFGGSIDDAV
FT                   KAAIAVLVIACPCALGLATPVAFMVASGRGAQLGVYVRGHQALEATESIDTVVFDKTGT
FT                   VTTGLLEVAAIAVADGFTEAQVLRLAGAVETASEHAVARAVVARAGADLPAVEDFRAVP
FT                   GLGATGTVDGRTVRVGNPRFVSPGVLAPAVDAAAEAGRTVAVVEVDGAVAAVMEIADTI
FT                   KPDARAAITRLHEAGITTVLLTGDNAAAAAKVAAAVGIDDIRSDVLPEGKVAEIRALQA
FT                   EGRRVAMVGDGVNDGPALAAADLGLAMGTGTDVAQGAADVVLMREELSAVPDALGLARA
FT                   TLKTIKTNLVWAFGYNVAAIPIAAAGLLNPLISAAAMSFSSFFVVWNSLRLRRFGSR"
FT   gene            complement(89785..90867)
FT                   /locus_tag="Tpau_0082"
FT   CDS_pept        complement(89785..90867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0082"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: ami:Amir_0226 alpha/beta hydrolase fold-3 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76736"
FT                   /db_xref="GOA:D5UPW8"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033140"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPW8"
FT                   /inference="protein motif:PFAM:PF07859"
FT                   /protein_id="ADG76736.1"
FT                   /translation="MALRDLVQKVALAVPSPVVAGGARALFGLPVHLKRRIVGPAPRVD
FT                   GNEMDVDSQLTLLLLKAQGITGIGGTDVATARVRMRRLGQAVGAGTAPDVATRGLLVDG
FT                   AAGTLPARLYTPKDLPAGSPLVVFFHGGGFVLGDLESHDAPCRYIADRVGARVLSVDYR
FT                   LAPEAVFPAAADDAVAATAWAIEHADQLGADPVRVAVSGDSAGGNLAAVACRELSLRGG
FT                   PQPRVALLFYPVTGADPGNRSRDTFATGYFLTKADIEWTRERYLPEPGQDEDPKFHVLH
FT                   ADNLGGVGRTHVVVAGFDPLRDEGAAYAQRLREAGVDATTQLAPGALHGFLNSVGVSAD
FT                   ARVDVDTALDVLRNELVAKS"
FT   gene            complement(90889..91491)
FT                   /locus_tag="Tpau_0083"
FT   CDS_pept        complement(90889..91491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0083"
FT                   /product="FMN-binding negative transcriptional regulator"
FT                   /note="PFAM: Negative transcriptional regulator; KEGG:
FT                   pmy:Pmen_0131 FMN-binding negative transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76737"
FT                   /db_xref="GOA:D5UPW9"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPW9"
FT                   /inference="protein motif:PFAM:PF04299"
FT                   /protein_id="ADG76737.1"
FT                   /translation="MYVAAPDRSDDERARAMVAAAGIGTVFSASGGLHASTLPLLWEGD
FT                   TVIAHLATANRHWRGLDGAEVLIVVTGPDAYVSPGWYPSKAAHGRAVPTWNYSEVQLRG
FT                   RASIHEDAAACRAIVARLTARHERNRPEPWGLDDAPPAYIEQQLKAIVGLTVEVTAVAA
FT                   KQKWSRGRSAEDIAGVQTALDSADPRAGAEMRRARGL"
FT   gene            complement(91502..91891)
FT                   /locus_tag="Tpau_0084"
FT   CDS_pept        complement(91502..91891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0084"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: msm:MSMEG_2697 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76738"
FT                   /db_xref="GOA:D5UPX0"
FT                   /db_xref="InterPro:IPR035197"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPX0"
FT                   /inference="similar to AA sequence:KEGG:MSMEG_2697"
FT                   /protein_id="ADG76738.1"
FT                   /translation="MTESPTKPNPVQYLLYSYGKTLPASMRDWVAHDLAGAGAGARTVI
FT                   RFSIPCVLMLVPFWFVDADFLVKATMTLPIFIPFVYFSIALNKIYRRARLRWHGLDPDL
FT                   VDQRARIREADLHREYLEKYGPRDR"
FT   gene            92044..92703
FT                   /locus_tag="Tpau_0085"
FT   CDS_pept        92044..92703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0085"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sen:SACE_3479
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76739"
FT                   /db_xref="GOA:D5UPX1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPX1"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG76739.1"
FT                   /translation="MNVSGATTSLESDVVSPGRNDQTAQSILSAAVASIGSVGISRTTM
FT                   EHVANLAGIGVATVYRRFNRKDNLVQQAIRYEAEQLLKTIEQQIAGLPTVEEALTEGFV
FT                   AFLREAHRRPLIRGIGDGNVVVGLPMIAQGGAMLIEIGRTFAANIIEGFQDKGDLPEFD
FT                   PKPIAEIFARVGHSVLLAPDGLISFDDPYAAGRVVRECLMPAIAAQTAAAATEGAS"
FT   gene            92700..93197
FT                   /locus_tag="Tpau_0086"
FT   CDS_pept        92700..93197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0086"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   tfu:Tfu_0561 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76740"
FT                   /db_xref="GOA:D5UPX2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPX2"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADG76740.1"
FT                   /translation="MIRPATPADVPELLKMISELAAYNKAPDAAVATEDQLHEALFGEH
FT                   PAVFAHLATEPGEDGAEVAVGMAVFFRTFSTWTGGYGIWLEDLYVRSTSRGGGHGKQLI
FT                   ASLAKLCQDRGYPRLEWTVVEWNTPAIGFYRALGAVPMEDWTTQRLTGDALGTLASQFD
FT                   GS"
FT   gene            93197..93838
FT                   /locus_tag="Tpau_0087"
FT   CDS_pept        93197..93838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0087"
FT                   /product="cob(II)yrinic acid a,c-diamide reductase"
FT                   /note="KEGG: rer:RER_23360 oxidoreductase; TIGRFAM:
FT                   cob(II)yrinic acid a,c-diamide reductase; PFAM:
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76741"
FT                   /db_xref="GOA:D5UPX3"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR012825"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPX3"
FT                   /inference="protein motif:TFAM:TIGR02476"
FT                   /protein_id="ADG76741.1"
FT                   /translation="MDVFEAIRARRDVRNEFSGELIDEERLTRLLRAAHSAPSVGNTQP
FT                   WDFVVVQDPATLAAFADHVGRCREDFARSLPADRRETFNPIVIEGIESSRTGVVVTYDP
FT                   TRGGKNILGRHTIDETGHLSVALAIQNLWLAATSEGVGVGWVSFYQESALRDLVAVPEH
FT                   VHIVAWLCVGPVTCFQEVPDLERFGWRDRRPLSEAVHRERFRTEVVTEDR"
FT   gene            93866..95221
FT                   /locus_tag="Tpau_0088"
FT   CDS_pept        93866..95221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0088"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   rha:RHA1_ro08338 ErfK/YbiS/YcfS/YnhG family lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76742"
FT                   /db_xref="GOA:D5UPX4"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="InterPro:IPR041280"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPX4"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ADG76742.1"
FT                   /translation="MTRFKRARSGGQRLVGRRTVLIGAAAAVPLVAGACTIGDTGGKGA
FT                   APSTPPKDPAEVTVTPADGAKDVSPIAPVSVSIAKATLGSVTLTDDKGAVVEGTLSTDM
FT                   LSWKPAAPLAYNGVYTLVAKYQTLGQQREHKTTFSTVVVDETNKTLPYFENTGGNSLND
FT                   GAVYGVGQVAVVHFDEPIKDRAMAQKLLTVTTTPPVEGAWSWTTDKTVAWRPKDYYPSG
FT                   TKVAIEAKVFGKQVSPGLWGEKDIAITFSIGESHVSIADDNTKQVQVFVGGQMVRSMPT
FT                   SMGQGGTEVVNGTTLHFWTQRGIYTVLDKANPVVMDSSTYGLPINSRLGYKQTIGWATR
FT                   ISNDGIYLHALDNIAAQGVRNESHGCLNLSPANAQWFFGISQPGDVVEVRNTGGAPLEQ
FT                   WQNGDWSVPWATWVAGGAQVDEPAPGPGATTQAPDPAQPPASGPPQSPAPGN"
FT   gene            complement(95218..96444)
FT                   /locus_tag="Tpau_0089"
FT   CDS_pept        complement(95218..96444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0089"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   nfa:nfa38830 putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76743"
FT                   /db_xref="GOA:D5UPX5"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPX5"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG76743.1"
FT                   /translation="MSITEQPRTTTARPHPQAWSFALLLTLLALALGVSGLPSPLYPLY
FT                   QQQWHLSALSTTLVFAVYAIGALGAALTVGPVSDAIGRKPVLLVAVATILVGLVIFLFA
FT                   GAEWQLILARFLHGAAIGSITVVAGAALLDVRPTEGARNGMLSGVFLNVGIAATALGAA
FT                   AVAQYAPSPLRTPFIAMGVVVLAVLAGVISLVEPHAARTGGRVRFSRPRVPGEITSDFW
FT                   FSGIGIVTAWSVLGVFLSLYPALVQHVTGHRSVLFTGMLVAVMAVASAIAQYLGGRYPA
FT                   RPTAIVGDLGLVLSLGVAVLALRSGATWLILADTVALGATFGLAFGGSLRHLASVAPAH
FT                   ARGQVMSAYYLLGYLAMGVPTVIAGYLATEYGTAAIFPWFAAAVAAGCLIAAAIGVRSG
FT                   RAAAPAPAA"
FT   gene            96544..96873
FT                   /locus_tag="Tpau_0090"
FT   CDS_pept        96544..96873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0090"
FT                   /product="putative transcriptional regulator, ArsR family"
FT                   /note="SMART: regulatory protein ArsR; KEGG: mjl:Mjls_5113
FT                   ArsR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76744"
FT                   /db_xref="GOA:D5UPX6"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPX6"
FT                   /inference="protein motif:SMART:SM00418"
FT                   /protein_id="ADG76744.1"
FT                   /translation="MMPDTPVAPLQTVLAALADPVRLEMVRRLHREQRPLACAELYDGV
FT                   TKATASHHFKVLREAGVTRRADEGAQVRQQLRLDDVELVYPGLLSSVLDAADRAVQNVS
FT                   PPAGR"
FT   gene            complement(96809..97504)
FT                   /locus_tag="Tpau_0091"
FT   CDS_pept        complement(96809..97504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0091"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro03732 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76745"
FT                   /db_xref="GOA:D5UPX7"
FT                   /db_xref="InterPro:IPR009339"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPX7"
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro03732"
FT                   /protein_id="ADG76745.1"
FT                   /translation="MQRARLVIIAGAIFYSAWIFAPTMGSRLNGLRSYVSEVAATGQPY
FT                   AHFFRGTDLLAGTCFVVGAALWWRAARPSSRFAWGWMAGMIMLGVGTISDALLPLSCTP
FT                   TSDAACAFREANGEVPFTHLAHAYSSGIAGTGGAVAVLAWAAWLLRGGNDGALRTARPL
FT                   TVAAFGAGMTYLITTVWTLAAMAITDPELYLGLAQRLQIAGITSWLVLIALPVGKRSAP
FT                   PDPPRPAPS"
FT   gene            complement(97515..98438)
FT                   /locus_tag="Tpau_0092"
FT   CDS_pept        complement(97515..98438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0092"
FT                   /product="Cytochrome c oxidase caa3-type, assembly factor
FT                   CtaG-related protein"
FT                   /note="PFAM: Cytochrome c oxidase caa3-type, assembly
FT                   factor CtaG-related; KEGG: mva:Mvan_3709 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76746"
FT                   /db_xref="GOA:D5UPX8"
FT                   /db_xref="InterPro:IPR019108"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPX8"
FT                   /inference="protein motif:PFAM:PF09678"
FT                   /protein_id="ADG76746.1"
FT                   /translation="MPPPPAAPPTILGMLGWQPPSLPLLPLVAAIAVVVYLIGVKRVRA
FT                   QGRHWPVARVISFLLGCLALAAVTGLKIEAYSWHLFSAFMFQQLTLSILIPPLLVGGAP
FT                   GVLLLRATPHRGLGKVVLGAALGLLRSRAPRILLHSGFTIPLFLISYYGVYLTGIIDAV
FT                   GGNWFGHTGLQVFFLGAGLLFILPIMSVGPLPGRDSWLMRFFDIFIEMPLHVFIGVTLM
FT                   MATTPMITMFAFPPPEWGIDPVRDQTIAGALAWSYGEPVAMVTVCIFALRWRRAEKQDS
FT                   ERAGADVREDDERAAYNAYLEQLRGR"
FT   gene            98459..99157
FT                   /locus_tag="Tpau_0093"
FT   CDS_pept        98459..99157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0093"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: nca:Noca_0312 response regulator receiver;
FT                   PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76747"
FT                   /db_xref="GOA:D5UPX9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPX9"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADG76747.1"
FT                   /translation="MNDMNTESVLVIEDEPALGRLVRDYLTREGFDVTVAMDGERGLQL
FT                   ARELDPAVIILDIGLPRIDGLEVCRSLRRFSDAYVLMLTARGDETDKIVGLSVGADDYL
FT                   VKPFSPREVVARVRAMLRRPRRMPDGAGTDRTYGDLAIDLLGREVRIGEKEIDLTATEF
FT                   DVLAVLARSPNVAFSRSQLIEAVWGAGWVGDERLVDVHVGRVRRKLGDDAGDPRYVRTV
FT                   RGVGYRMGQG"
FT   gene            99157..100284
FT                   /locus_tag="Tpau_0094"
FT   CDS_pept        99157..100284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0094"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: mgi:Mflv_3888 integral membrane sensor signal
FT                   transduction histidine kinase; PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; histidine kinase HAMP region domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76748"
FT                   /db_xref="GOA:D5UPY0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPY0"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADG76748.1"
FT                   /translation="MLLDSLVEPIRERLARQGIGTRMAGLLVLVSLVTLAVTALVDFVL
FT                   WPMVLEGHFAGIRLPDPQQHTRDSWTPANLLAVVLGFGSAVVVSIGLSLVIARRLNRSV
FT                   ERLATAAQQVADGRPDVRVAPVSLGPEAGELVSAFNEMATKLESTDRSRRRLLTDLAHE
FT                   IRTPVSVLDGYLEGMQDGVVSADEETVTMLREQTNRLARLTEDVLAVSHADEGALDLRP
FT                   SEVDVRELVESSVAAARKAYADKDVALSSRVRLGRTMIRADRQRLQQVLANLLANALRH
FT                   SPPGTSVEVVAEVASHRRVKISVIDHGDGIDAEHLPWVFERFYRTDVARDRDSGGSGVG
FT                   LTICRSIVAAHDGHLWAESAGVGSGATFAMTLPAR"
FT   gene            100379..102559
FT                   /locus_tag="Tpau_0095"
FT   CDS_pept        100379..102559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0095"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="KEGG: nfa:pnf1540 putative transporter; PFAM:
FT                   sulphate transporter; carbonic anhydrase;
FT                   Xanthine/uracil/vitamin C permease"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76749"
FT                   /db_xref="GOA:D5UPY1"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPY1"
FT                   /inference="protein motif:PRIAM:4.2.1.1"
FT                   /protein_id="ADG76749.1"
FT                   /translation="MNSSIREGVVVQEKLREVVRFDVPASIVVFLVALPLSLGIALASG
FT                   APLMAGLIAGVIGGIVGGLMGGSPLLVSGPAAGLTVVVAELINKFGWKVTAAITVAAGL
FT                   VQIGLGMSRIARAALAISPVVVHAMLAGIGVTIVIQQTHVLFGGTSRSSVLQNLIDLPA
FT                   RIGSMHWPDFAVGAIVIAVMLLWPKLPPKWRRVPGALVAIVAATVFSLVVPMNVERIKL
FT                   NGSIIDAIGLPQLPTGQWAAVALGVLTVALIASVESLLSAVAVDKMHDGAKSNLDRELI
FT                   GQGAANSLSGLLGGLPVTGVIVRSATNVTSGARTRWSAVLHGVWLLLFSVALSGLVEKI
FT                   PTSALAGLLIVIGVQLVKTAHIRTARRTGDIAVYAVTILGVLFLNLLEGVLAGLVVAIL
FT                   LVLWRVARASIEASQDSAGRWHVAIDGSLSFFSLPRLSRVLASVPPGGDVAIELTVDFL
FT                   DHASAEEITEWVRRYRAGGGTVTIDDLGVAQIHAAGDTSPRRTTERSAERGLLPWRAHA
FT                   RGGLADGIARYHRRHASLLSDDFDGLIDGQRPEALFLTCADSRVVPNVITASGPGDLFT
FT                   VRNVGNLVPAGGVDGSLEAALTYAVDNLDVNQVIVCGHSGCGAMGVALDRPAVPPSIEQ
FT                   WIEHADASVEAYREGHPVRRAAEAAGFGPVDQLAVVNIAVQLENLRNHPLLREAVAEGR
FT                   IDVVGLFFDIGTGRVLRVTDTAVVEADTLTHV"
FT   gene            102709..103356
FT                   /locus_tag="Tpau_0096"
FT   CDS_pept        102709..103356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0096"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rer:RER_19470 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76750"
FT                   /db_xref="GOA:D5UPY2"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPY2"
FT                   /inference="similar to AA sequence:KEGG:RER_19470"
FT                   /protein_id="ADG76750.1"
FT                   /translation="MLMNPRLWAAASVAAGSFLALAALYLVLVGTATGQYVDHEVMLRV
FT                   SAAFGVEFPTSGWFGDMQMPLLLVGFATTAVLVAASRSVRTAVEAAAVLLLTLGGAYVL
FT                   KALLERPSFGVGPMINSFPSNTVAVFAALAAVAFITAPSALRSIVLSYALGVGAVASVT
FT                   VIALQWHRPGDVLGAWLVAACAAGAVRAYGAAWSAETILRRPVGGRTAAHRG"
FT   gene            103328..104035
FT                   /locus_tag="Tpau_0097"
FT   CDS_pept        103328..104035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0097"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: rer:RER_19460 OmpR family two-component
FT                   response regulator; PFAM: response regulator receiver;
FT                   transcriptional regulator domain protein; SMART: response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76751"
FT                   /db_xref="GOA:D5UPY3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPY3"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADG76751.1"
FT                   /translation="MVALLLIEDDPAIVDALTLSLQRLDYQVAHLPSAPDDLDDHVSAA
FT                   DAVILDVGLPGEDGFAVCRRIRRTSQVPILMLTARADDIDTVAGLESGADDYVVKPVSP
FT                   RVLDARIKAALRRSAPAGAAPETVVAEPAVPAVAVPGTGLVVDRAAAEVLRDGAPLPLT
FT                   PTEKRLMYVFADHPGQVLSREQLLTLVWNQDFLGDSRLVDNAILRLRPKVDPPGEPSCI
FT                   ETVRGFGYRFRAG"
FT   gene            104035..105387
FT                   /locus_tag="Tpau_0098"
FT   CDS_pept        104035..105387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0098"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: rer:RER_19450 two-component histidine kinase;
FT                   PFAM: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein; histidine kinase HAMP region
FT                   domain protein; SMART: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; histidine
FT                   kinase HAMP region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76752"
FT                   /db_xref="GOA:D5UPY4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPY4"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADG76752.1"
FT                   /translation="MAGSLRARLLVIIVLVTSFTAAVTGASVAYVVRDWVYEDAQQAVL
FT                   TAFRHDMERFDDQPTMENLLGDYLVTTSDGGVVQPGTVPPGTVPSSMSADLRATPSIYR
FT                   FQRLADGRLLVGHSSSKHPYLIYSVQPLEGVQQRLRQLMTFVALATLGGALLGGLAGVL
FT                   VARAVTRPLRRVQDVASAVAAGDSTARLPETSLAELRELSVNFNGMLDRQNESLDVLRR
FT                   QDERSRRFASDVSHELRSPLAALVPAAEVLREEADAMAAESSGHPDLARAARMVASEVD
FT                   GLAQLLDDLLEITRLDAGVAQVRAEEFDLVATVREALDARGWSGVRIDGPGELWVNADR
FT                   RRVVAVVTNLVGNALRHGAPPVTVSMHRWAQQGDGGAVVEVRDHGGGVPEGHEDLIFDR
FT                   LHKAQAARSRGAGGGAGLGLAIARDNARLLGGDVDYRRDGATTVFRAWFRG"
FT   gene            105399..106196
FT                   /locus_tag="Tpau_0099"
FT   CDS_pept        105399..106196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0099"
FT                   /product="Glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="KEGG: sgr:SGR_6566 putative glutamate racemase;
FT                   PFAM: Asp/Glu/hydantoin racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76753"
FT                   /db_xref="GOA:D5UPY5"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPY5"
FT                   /inference="protein motif:PRIAM:5.1.1.3"
FT                   /protein_id="ADG76753.1"
FT                   /translation="MRVAVIDSGFGMVNYADALSRLRPDTELVLARDPDNMPYGLLPPE
FT                   RISECIVAMAGAAARYRVDAIVVACNTGSMYALEAARARFEPAVPVIGVVPAIRPAGAT
FT                   GRPFAVWATAAATVSDYQTSLIDAFADPSLAHRIPCYGLAEAIDSGDLDRVADAVAAAA
FT                   DATPPDIESVVLGCTHYGLVREQIVAALRARTGVDLTVFDSPEPVARQVLRRLGVDPGG
FT                   PQRLGAVVAVLESGRPGAMPPVLAAYPAGRDLLDRCDRGEIKA"
FT   gene            complement(106398..107978)
FT                   /locus_tag="Tpau_0100"
FT   CDS_pept        complement(106398..107978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0100"
FT                   /product="anibiotic ABC transporter efflux pump"
FT                   /note="KEGG: rha:RHA1_ro02954 anibiotic ABC transporter
FT                   efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76754"
FT                   /db_xref="GOA:D5UPY6"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPY6"
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro02954"
FT                   /protein_id="ADG76754.1"
FT                   /translation="MTGLGATLRLVVRRDRVQLVVWLLLYVAMAASAYSTAKVNYGDQA
FT                   ALESAARAASENPSLVAMFGPVYSATVGAVGMIKMVVMMAAALGLLTGLLVIRHTRADE
FT                   ESGRREMLGASAIDRIAPPLAALIESVGLSLAIGAVSALVLIGMGADAPGSVAFGALWA
FT                   LTGIVFAGFALLCAQLTEGARAARGLFAVGLGGAYLLRAVGDVSVLRIDGTLPAEPGWE
FT                   SWLSPLGWSQQIRPFADDRWWPALPLVVLTVVFAAAALRIAARRDLGAGLIPVGRGRSH
FT                   AGPLLGSVEALTWRLHRGQVIGWTVGMLAVGAAFGGMGSAIDSLAGNEGTREMLERLGG
FT                   SGSNLLDIFFGAEFSVMGMATAALGISIVNTACSEELSGRAEYLLSAPVLRLRWYVSHL
FT                   TVAVIATFVATLALGIGVSLTAGRELIGPALGALPAVWVITAIAALAGAIHAQWSAVGW
FT                   VALALCVVMMVADVLRLPDWVSTLSPFTHVATQPGAALVTGATVTLVAISAVGLIAAAT
FT                   AESRRDLAA"
FT   gene            complement(107975..108874)
FT                   /locus_tag="Tpau_0101"
FT   CDS_pept        complement(107975..108874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0101"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: nfa:nfa24770 putative ABC transporter ATP-
FT                   binding protein; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76755"
FT                   /db_xref="GOA:D5UPY7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPY7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG76755.1"
FT                   /translation="MTNEVIRAEGLTKVFGSAHALTALDLHVLPGQVHAFLGPNGAGKS
FT                   TTIRILLGLLKKTSGTVELLGGDPWRQAPELHRRLAYVPGDVTLWPNLSGGEIIDLLGR
FT                   LRGGIDEVRRDELLERFALDPGKKARTYSKGNRQKVALVSAFAARAELLILDEPTSGLD
FT                   PLMEEVFTQCLEEEKARGASILLSSHILSEVDRVADAVTIIKDGATVETGTLASLRHLS
FT                   RTRVEATVSRPTDLSATAGVHDLRTDGDRLSFSVDTADLGRVLGELAAASPTSLTSRPP
FT                   TLEELFLRHYDTAERGTR"
FT   gene            108915..109400
FT                   /locus_tag="Tpau_0102"
FT   CDS_pept        108915..109400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0102"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO3632 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76756"
FT                   /db_xref="GOA:D5UPY8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPY8"
FT                   /inference="similar to AA sequence:KEGG:SCO3632"
FT                   /protein_id="ADG76756.1"
FT                   /translation="MKTVYPVCVDAPNFVENMAAALVEAGMQRMAARVFSAVLASPDGA
FT                   LTPSQIAKQLRVSAGAVSGAVGYLEQAGMIRKSHVPGSRHSLIELGDDIWYEALTSRNP
FT                   ILERWLTVADEGLEELPDGGPAAERVAVMRDFFAFVLTELPDLMERWRLTRLERHGH"
FT   gene            109597..110211
FT                   /locus_tag="Tpau_0103"
FT   CDS_pept        109597..110211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0103"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76757"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPY9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76757.1"
FT                   /translation="MNTQVTKSVAALVGVAATIALGFSGAATASASPKPYPSGGANSVD
FT                   LVEVTAQASAIGKDNGFTIRNVADRADPNAGQAQRAQVLPAGTQFVLSSNNFGNVALGD
FT                   TEGYSVTLLTANGRDKVITLKNDIQPGGSIPVTLGKIQVSVGTTFNLKLADYSVQPFRT
FT                   KGALDWTERANPNQTQYLANNSAGVFCLAAVAPVLSFCSPA"
FT   gene            complement(110276..110866)
FT                   /locus_tag="Tpau_0104"
FT   CDS_pept        complement(110276..110866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0104"
FT                   /product="peptidase M15B and M15C DD-carboxypeptidase
FT                   VanY/endolysin"
FT                   /note="PFAM: peptidase M15B and M15C DD-carboxypeptidase
FT                   VanY/endolysin; KEGG: bcv:Bcav_2708 peptidase M15B and M15C
FT                   dd- carboxypeptidase VanY/endolysin"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76758"
FT                   /db_xref="GOA:D5UPZ0"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPZ0"
FT                   /inference="protein motif:PFAM:PF02557"
FT                   /protein_id="ADG76758.1"
FT                   /translation="MSNHRKARTAAAAIAALAALALLSACSPSLPGSAAPGDPTPSGRP
FT                   TAAPSGPIGAADGALTEGVPVTTDTPAITNLSPALRQALQGAARAAKAERDIDVLVTSG
FT                   WRTARYQQSLFDDAVRRYGSTAEAERVVAGTTSEHVAGDAVDIGPTDAADWMTRFGEDY
FT                   GLCRVYANEMWHFEAKSGAQCAPMVSDASRRSR"
FT   gene            complement(110968..112128)
FT                   /locus_tag="Tpau_0105"
FT   CDS_pept        complement(110968..112128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0105"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: mab:MAB_4743c putative
FT                   dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76759"
FT                   /db_xref="GOA:D5UPZ1"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPZ1"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADG76759.1"
FT                   /translation="MGNKRIVIAGAGIGGLSVIKELRESGVALDGVEITLIDENFEHYL
FT                   GFTLPWVMRGWRTADSIPIRPSEAALKDIRAVRATIAGVDGPGKTVLLDNGDRVGFDAL
FT                   VMALGARNATNRVPGLQEAADTGVAVHYYATADAARAHRALTDFPGGRLVFLVAAMPFR
FT                   CPVAPYEGAFLAADLLAERGVREETEIAVYTPEPQPMPSAGPHVGLELAERVRAAGIAL
FT                   HPLHQVERVDPATKIVHFADGASVPFDLLVFVPPHEAAVPLDGPGWIPVDRESMSTGQD
FT                   GIWAIGDLSAVTSPTDRPLPKAAIFAKNGAAAVARNLLQYLGLESAGAHLSGRGYCYID
FT                   TGAHESARGSGDFFAEPHPDVTLTPASAALHQDKVQEERDWRAYWE"
FT   gene            complement(112155..112748)
FT                   /locus_tag="Tpau_0106"
FT   CDS_pept        complement(112155..112748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0106"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_4744c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76760"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPZ2"
FT                   /inference="similar to AA sequence:KEGG:MAB_4744c"
FT                   /protein_id="ADG76760.1"
FT                   /translation="MEHRTPITIWLDPVCPYSWQTAAWLRETVDDPDALRWELMSLALL
FT                   NEGRDLPERARARMRDSGAAGRLFAALGTELDDAARWRALAAFSAWYHHDAPALDAAPV
FT                   ARLLTDLGLPTRYADALADASWDVAVRAEHARSQEAAGGSAGSPLVRIGEATFHGPVLT
FT                   TVPEPEAAAALLAGLRSLAAVDAFTSVQRLRPDQ"
FT   gene            113146..117753
FT                   /locus_tag="Tpau_0107"
FT   CDS_pept        113146..117753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0107"
FT                   /product="Glutamate synthase (ferredoxin)"
FT                   /EC_number="1.4.7.1"
FT                   /note="KEGG: rop:ROP_35350 glutamate synthase large
FT                   subunit; PFAM: ferredoxin-dependent glutamate synthase;
FT                   glutamate synthase alpha subunit domain protein; glutamate
FT                   synthase; glutamine amidotransferase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76761"
FT                   /db_xref="GOA:D5UPZ3"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPZ3"
FT                   /inference="protein motif:PRIAM:1.4.7.1"
FT                   /protein_id="ADG76761.1"
FT                   /translation="MSRFVPPGPQGLYHPANEHDACGVAFVVDMHGRKSRDIVDKAITA
FT                   LVNLEHRGAAGAEPNTGDGAGILIQVPDRFFREVVDFDLPHQGAYATGIAFLPQAAAEA
FT                   GKAAEGVERIVAEEGMTVLGWRDQPTDDGSLGALARDAMPTMRQVFIAGTDAEGAPLSG
FT                   LDLERRCFVIRKRVERELGTDGAGAGSQGEESVYFPSLSGQTFVYKGMLTTPQLRGFFV
FT                   DLQDERVESALGLVHSRFSTNTFPSWPLAHPYRRVAHNGEINTVGGNENWMRAREALLD
FT                   PSVFGADAENKIFPICTQGGSDTARFDEVLELLHLGGRSLPHAVLMMIPEAWERHQDMD
FT                   PARRAFYEYHSSLMEPWDGPASVCFTDGTVIGAVLDRNGLRPSRIWVTKDGLVVLGSEV
FT                   GVLDIPHSDVVFKTRLQPGRMFLVDTAQGRIVSDKEIKDELAAAEPYQEWLDEGLLRLS
FT                   ELPDRPHPVMPHDRVTQRQQMFGYTTEELNLLLTPMAKTGAEAIGSMGTDTPVAVLSLR
FT                   PRLLFDYFQQLFAQVTNPPLDAIREEIVTSLGGTIGGESDLLNPSPVSCRQIHLDQPIL
FT                   NNDELIKLVKVNDDGTLPEFRSVVIPGLYAVAEGGKGLREALDTVRTQVSEAIAGGARL
FT                   IILSDRNSDRLLAPIPSLLLTAAVHHHLVRERSRTKVGLIVESGDAREVHHMAALIGCG
FT                   AAAVNPYMAFATIEDMHLRGELNGLPLEKLNANYVKAAGKGVLKVMSKMGISTLASYTG
FT                   AQLFQVIGIAQDVVDEFFSGLQSQLDGIGLDEIADDVAARHKRAMNDRPEELAHRELEV
FT                   GGEYQWRREGEYHLFNPDTVFKLQHATRTGQYKVFKEYTKLVDDQSARLASLRGLFTFV
FT                   PDREPIPLDEVEPASEIVKRFSTGAMSYGSISAEAHETLAIAMNRLGGRSNSGEGGEDP
FT                   ARFTPDENGDLRRSAIKQVASGRFGVTSHYLSNCTDIQIKMAQGAKPGEGGQLPPHKVY
FT                   PWVAEVRGSTPGVGLISPPPHHDIYSIEDLAQLIHDLKNANPSARIHVKLVSELGVGTV
FT                   AAGVSKAHADVVLISGHDGGTGATPLTSVKHAGAPWEIGLAETQQTLLLNGLRDRIVVQ
FT                   VDGQLKTGRDVIVAALLGGEEFGFATAPLVVSGCIMMRVCHLDTCPVGVATQNPVLRRR
FT                   FTGKPEFVENFFLYIAEEVRELLAELGFRTLQEAVGQSHVLDTQAAQQHWSGAKAGKLD
FT                   LAPILAQVDSPFMNQDPYCSQTQEHGLEKALDQQLITQARVAIDTGAPVSIQSAISNVN
FT                   RTVGTMLGHEVTKVHGADGLPDDTIDITFRGSAGNSFGAFVPKGITLRLEGDANDFVGK
FT                   GLSGGRIVVRPAQDAPEGFIAEENIIAGNVILFGATAGEVFLRGKAGERFAVRNSGAIA
FT                   VVEGVGDHGCEYMTGGRVIVLGDTGRNFGAGMSGGIAYVYNADGQFERDLNTELVELES
FT                   LDESDIEFVRATVTKHYEATDSAIAERILANWARERQLFAKVMPRDFKRVLTAIKRAEL
FT                   DGRNIDDAVMEAARG"
FT   gene            117746..119212
FT                   /locus_tag="Tpau_0108"
FT   CDS_pept        117746..119212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0108"
FT                   /product="glutamate synthase, NADH/NADPH, small subunit"
FT                   /note="KEGG: nfa:nfa970 glutamate synthase subunit beta;
FT                   TIGRFAM: glutamate synthase, NADH/NADPH, small subunit;
FT                   PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76762"
FT                   /db_xref="GOA:D5UPZ4"
FT                   /db_xref="InterPro:IPR006005"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPZ4"
FT                   /inference="protein motif:TFAM:TIGR01317"
FT                   /protein_id="ADG76762.1"
FT                   /translation="MADPQGFLKNNSRELPVRRPVPLRLLDWNEVYKPFDGGTLRKQAS
FT                   RCMDCGIPFCHNGCPLGNLIPEWNDLVYKDRWRDGIDRLHATNNFPEFTGRLCPAPCEA
FT                   SCVLGINQDPVTIKQVEVELIDHAFDEGWVSPEHPTKLTGKKVAVVGSGPAGLAAAQQL
FT                   TRGGHTVTVYERADRIGGLLRYGIPEFKMEKRHIDRRLAQMNAEGTIFKTGVNVGVDVT
FT                   VEQLREDYDAVVLANGATLWRDLPIPGRDLDGIHQAMEFLPWANRAAVGDDVVDADGLP
FT                   PLHAKGKKVVIIGGGDTGADCLGTSLRQGAETVHQFEIMPIPPRERAESTPWPTYPLMY
FT                   RISSAHEEGGERVFSVSTEEFLGHDGTVTGLKAYEVKMEGGRFEKVEGTDFTLEADLVL
FT                   LAMGFVGPERGDLLDKLGVEYSERGNVARGDDFQSTVPGVFVAGDAGRGQSLIVWAIAE
FT                   GRSAAAAVDRFLMGESALPAPIVPTAAPQR"
FT   gene            complement(119269..119781)
FT                   /locus_tag="Tpau_0109"
FT   CDS_pept        complement(119269..119781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0109"
FT                   /product="Protein of unknown function DUF2302"
FT                   /note="PFAM: Protein of unknown function DUF2302; KEGG:
FT                   rer:RER_47870 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76763"
FT                   /db_xref="InterPro:IPR009282"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPZ5"
FT                   /inference="protein motif:PFAM:PF10064"
FT                   /protein_id="ADG76763.1"
FT                   /translation="MSDLDDLLKSIPLADIAAQLGVSQDVASAAVNQTVPTLLAGLQAQ
FT                   DTTEAPSDLAQAADNGDGQQIVSSLFGEKTDDVAAAAAAPLSSGVTNDLVKQLLPILAP
FT                   IVISFVMKKLSGGTAAQPQQQAPAGNGDLLGSILGNMLGGGNTAGGAGSAAGNVLGGIL
FT                   GGLLNRK"
FT   gene            complement(120144..121070)
FT                   /locus_tag="Tpau_0110"
FT   CDS_pept        complement(120144..121070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0110"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   rha:RHA1_ro03731 alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76764"
FT                   /db_xref="GOA:D5UPZ6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPZ6"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADG76764.1"
FT                   /translation="MTTTPATTAQCTNRMVVLPAHWTTKSTTLGSVLLELANVRTHVVI
FT                   DQPTGPVTGPPVVLSSGLAGNWFDWDSCIELLRSERTVIRFDRPGYGLSDPWPEDTVPT
FT                   LDGEVRRYRDLLDALQIQRGVICGHSMASFYVEAFAREHPERTAAAVILDGSVEDSPRW
FT                   VLPTNLRADLLLRSADVAAASGLSRIGPAVHKLLVDSEPPAEHAQILSSEQYLRAAMLE
FT                   NGQYPVLAHELVDLRTKQPLQPGLPVTVAAAYTGRPTPWAASWLRQQRGLADRLDARFA
FT                   VIAPSGHHVMVEQPAQVAALILDAGGG"
FT   gene            121306..121866
FT                   /locus_tag="Tpau_0111"
FT   CDS_pept        121306..121866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0111"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_3790 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76765"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPZ7"
FT                   /inference="similar to AA sequence:KEGG:MAB_3790"
FT                   /protein_id="ADG76765.1"
FT                   /translation="MAAEDGSGLGLRGQTAGETKPPQCLYTPFGKNFSRASDGSDWNLY
FT                   YAASVGYTGPDGSRVTVTVDRQRVGSDVVALTTSWMSTCGTYDRAFPTFANPQVRNQRV
FT                   TTAFTREQTTSGVQTYRFVASSRSLDDATTGKPLPSGAGVTRVLLARVRSVVFTVEATG
FT                   KIGYADLDAMLATAIANAEAAPR"
FT   gene            121868..122110
FT                   /locus_tag="Tpau_0112"
FT   CDS_pept        121868..122110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0112"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein; KEGG:
FT                   mgi:Mflv_3643 RNA-binding S4 domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76766"
FT                   /db_xref="GOA:D5UPZ8"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPZ8"
FT                   /inference="protein motif:PFAM:PF01479"
FT                   /protein_id="ADG76766.1"
FT                   /translation="MLRHDGPVSEAIDVEISDEVIRLGQFLKLAGLIDSGAEAKGVIAD
FT                   GEVSVNGEVDTRRGRQLAVGDVVEVFGRSARVARG"
FT   gene            122175..122957
FT                   /locus_tag="Tpau_0113"
FT   CDS_pept        122175..122957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0113"
FT                   /product="Isochorismatase"
FT                   /EC_number="3.3.2.1"
FT                   /note="KEGG: mab:MAB_4406 isochorismatase/phenazine
FT                   biosynthesis protein PhzD; PFAM: isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76767"
FT                   /db_xref="GOA:D5UPZ9"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR016291"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:D5UPZ9"
FT                   /inference="protein motif:PRIAM:3.3.2.1"
FT                   /protein_id="ADG76767.1"
FT                   /translation="MENPASEVPSVTESHPQEAVSTAEVLGRRRLFQAAAWGTVGAVAV
FT                   GGARAGTADAAVALPGSVSYRIGEIPIPRNKVAWQLDPRRAVLLVHDVQRYFMRIFDER
FT                   TRGELLGNVARGQDWARRSGVPVIYSAQRGGATREQRGLIYDFSGAGMTADESDRGIEP
FT                   AVAPRPGERVLTKHKLSEYFRSDLLQYLRDQGRDQLVLAGVYANTGVLLTAADSIQNDI
FT                   QAFVIGDAVADQTPEGHRGGLAWVAARAGRVISAAELR"
FT   gene            complement(122979..123470)
FT                   /locus_tag="Tpau_0114"
FT   CDS_pept        complement(122979..123470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0114"
FT                   /product="regulator of ribonuclease activity A"
FT                   /note="KEGG: mmi:MMAR_5403 ribonuclease activity regulator
FT                   protein RraA; TIGRFAM: regulator of ribonuclease activity
FT                   A; PFAM: Dimethylmenaquinone methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76768"
FT                   /db_xref="GOA:D5UQ00"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR010203"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ00"
FT                   /inference="protein motif:TFAM:TIGR01935"
FT                   /protein_id="ADG76768.1"
FT                   /translation="MSDVQFTPTADLVDEIGEEVRSCDTQFRQFGGRRAFAGEVVTVKC
FT                   FQDNALLKSVLGEPGAGRVLVIDGSDENGVPSLHTALVGDIIAELGRGNGWAGIVAYGA
FT                   IRDAAVIGTLDIGVKALGTNPRKSTKTGAGERDVPLSFGGVTFAPGDTLFSDDDGIVLR
FT                   "
FT   gene            123531..125081
FT                   /locus_tag="Tpau_0115"
FT   CDS_pept        123531..125081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0115"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: rha:RHA1_ro03944
FT                   succinic semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76769"
FT                   /db_xref="GOA:D5UQ01"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ01"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ADG76769.1"
FT                   /translation="MPAPTQATFDRLRALAAIDHPEQRESRDVLEAFTGEKVTTIPVGT
FT                   VEDVEQAFVRARRAQKQWAARSAKDRAKVLLKFADLVNERRADLMDMAQLETGKARQYA
FT                   QEETLDVAMTARWYGKNAPKLLEQKNTAGMLPVFTNTRVRYQPKGVVGVIAPWNYPLTL
FT                   AVSDGVAALAAGNAVVLKPDSQTPYCALAAVELLYQAGLPRDLFAVVPGPGGVVGTAIV
FT                   ERADYLMFTGSSATGATLAEQCGKRLIGFSAELGGKNPMVVTKDADIAHTADGAARAAF
FT                   SNSGQLCISIERIYVEREIADEFARAFAERTANLALGAGYDFTNEMGSLASKSQIETVA
FT                   AHVDDAVAKGATVLAGGKARPDLGPFFYEPTVLKNVPEEAICFASETFGPVVSIYPVDS
FT                   VDEAVERANDTEYGLNASVFSGSTKQAQEIADRINAGTVNINEGYAAAWGSTAAPMGGM
FT                   GISGVGRRHGAEGLLKYCESKTIAQQRIIGIGGIKGIPRTVFLGVVPPIIKALKFIGR"
FT   gene            125200..125745
FT                   /locus_tag="Tpau_0116"
FT   CDS_pept        125200..125745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0116"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_0800 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76770"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ02"
FT                   /inference="similar to AA sequence:KEGG:MAB_0800"
FT                   /protein_id="ADG76770.1"
FT                   /translation="MDVTFIKRAGGYDVRVRRERGPELAPRGGPGGSPTVPHDAAHLIV
FT                   EIEAGLPGGVYGRIADANGLDGLFWPADPAARRRATRNRKQPSAAQSADMARSEYLASL
FT                   TVALWEVERGLRAPDPAWPGSLDDAEITDELRERIFARYDEFAPRWRALSDGGELTVAW
FT                   PAAAVSGRRPGRKPARRG"
FT   gene            complement(125702..126616)
FT                   /locus_tag="Tpau_0117"
FT   CDS_pept        complement(125702..126616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0117"
FT                   /product="GDSL family lipase"
FT                   /note="KEGG: nca:Noca_4490 GDSL family lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76771"
FT                   /db_xref="GOA:D5UQ03"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR037460"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ03"
FT                   /inference="similar to AA sequence:KEGG:Noca_4490"
FT                   /protein_id="ADG76771.1"
FT                   /translation="MRFRTLLLSLVAAVAAAPALPANAAPPAPTYVALGDSYSSLPADA
FT                   TVGDSQQERSCGRSTRNYPKLVADALGVPRVQLRDNTCGGADTDDAFSSQRAGDAKTGY
FT                   YDAAPQLDGIVPQTRLVTISLGGNDGDLYSSILKACATVARAAAPRCTADPASRPATLS
FT                   DAAVADRLGRITAANERIIRAVRERSPQARILVIGYPSVFGPDRTCAAIAPYRPESIPW
FT                   MRSILTERLNRAVQRAAVAERAEYIDMEPASKGRDVCSPRPWINGVTDVPRAAGMHPFP
FT                   EEGEAVAAAITRAVRASGPAVGR"
FT   gene            complement(126666..127361)
FT                   /locus_tag="Tpau_0118"
FT   CDS_pept        complement(126666..127361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0118"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mav:MAV_0179 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76772"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ04"
FT                   /inference="similar to AA sequence:KEGG:MAV_0179"
FT                   /protein_id="ADG76772.1"
FT                   /translation="MGLFGKKQKSSRAERRAQAKALKSKARLEAKLAAKNTAKSAKRSA
FT                   KNAVKSERGAQKSDVARAKVIARMQGKSDKLNLKIAETNARAAVDGKLLSEARLKRYVS
FT                   TARLLAPVVVPLAYRAAQAGRNKLDSARATRLGVPVDEVAQFAGFGGGLAARVAASRRS
FT                   LDQLATAHPDAETKAFVAAVAQRLDDLSAAITASESMPPARRRPAHQAIARELDGIDAD
FT                   LLNRLGVSS"
FT   gene            127572..129011
FT                   /locus_tag="Tpau_0119"
FT   CDS_pept        127572..129011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0119"
FT                   /product="RecB family nuclease, putative"
FT                   /note="TIGRFAM: RecB family nuclease, putative; KEGG:
FT                   nfa:nfa1140 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76773"
FT                   /db_xref="InterPro:IPR019993"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ05"
FT                   /inference="protein motif:TFAM:TIGR03491"
FT                   /protein_id="ADG76773.1"
FT                   /translation="MALRMEAAAVFRASIRDRLAALGPLTVIEPGEGAVTRTLAALGAG
FT                   AERIWGGVLPTANGRRGHSELLLRVRDGYLPVIVVNHKVSDPGSGALTSPLDRWAPVPD
FT                   ETVRARQHRGDQMRLAHLTRMLQDAGYASASLSGGSLGIGGDRIVVHDVAPLLPAYDER
FT                   FADRRDVLSGAVVTAPVRVAECRRCPWWPECERTLAATRDVSLVADGRSAPGLREAGIV
FT                   TVDQLAEYTGPQPDEVSVPIADLRAMARAWQRGQVLVRRRPEVKVRRADVEVDVDMESY
FT                   QEYGAYLWGTWLRRDGVDLGYRPFVTWEAVPTRDEGRSFAEFWAYLMDRRAEAHAAGKT
FT                   FAAYCYSQQAENKWLLSSADRFAGDPGVPSRAAVAEFIASPEWVDMFDAVGEAFLSLEG
FT                   RGLKKVAPVAGFHWRDAEAGGEASMLWYRVGVGMDPGYDAAERETQRQRILEYNEDDVR
FT                   ATAALRAFMSSDAVNDLPVVH"
FT   gene            complement(129044..130132)
FT                   /locus_tag="Tpau_0120"
FT   CDS_pept        complement(129044..130132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0120"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein LOC762216"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76774"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ06"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76774.1"
FT                   /translation="MSAPTHLSARIRAAVIVSLAVGTMAAAPAFAAPDSDSGSGGSSSS
FT                   GSSSVESSSDGKSIHGTSSNGTSFDFSIKDRNKAADGSSKSDKDKGKDGRDSDGSTGGA
FT                   KDDKDKDGKDKDDKGKDKHGLPGIGEILGGIFGGAGGGASSGASSAGGSATGPAGAAAA
FT                   IESPGTGSGGAALEGAGIRSGNPEPQGVGVREGGASAGGAGVRSGNPAPAPASSAGGRS
FT                   VDASPAGAPAVAAPAAPAAPVVAVPVIAPPVLAPPVLVAGPRVAPAAPVPAAAPKPGAG
FT                   DEGKDAADPAAKDQRAADSSRSQPTLLTAAYSSAQRVTPVATETAKQLSPALFAVLGGV
FT                   ALLGSGTFVDSLRRAHLGQAQA"
FT   gene            130325..130810
FT                   /locus_tag="Tpau_0121"
FT   CDS_pept        130325..130810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0121"
FT                   /product="putative transcriptional regulator, XRE family"
FT                   /note="KEGG: cai:Caci_8936 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76775"
FT                   /db_xref="GOA:D5UQ07"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ07"
FT                   /inference="similar to AA sequence:KEGG:Caci_8936"
FT                   /protein_id="ADG76775.1"
FT                   /translation="MDAGNTKYDSEALVGQGLFASRLEELFRTVPGPNGRAFTAKAIAQ
FT                   RSTALGFRLGESYLSQLRSGKAKSPSFRTVEGISAAFGVDVHYFLEDEAAQRTRDQIHL
FT                   MRLQADTKVQMAAFRLAGLSPDSVNMVNELIKVLRVQQGLPADPPELPVDSREAEGQ"
FT   gene            130875..131378
FT                   /locus_tag="Tpau_0122"
FT   CDS_pept        130875..131378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0122"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_4198 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76776"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ08"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76776.1"
FT                   /translation="MRTAKALRRLCENEVRSLDLDLPFDAVQLCEKYGRRRGRDILVIS
FT                   QPLPVGMPNGLWLVGDDADYFFYQANTSRTHRDQIIIHEFGHLIAGHQHVSAAPDAAQM
FT                   PPEEAAAALHRTCYDDENEWEAEMIASIILGWAAQAGAKAGRTARHDSLRGIQRALGGH
FT                   SRWL"
FT   gene            131375..132481
FT                   /locus_tag="Tpau_0123"
FT   CDS_pept        131375..132481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0123"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: svi:Svir_26770 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76777"
FT                   /db_xref="GOA:D5UQ09"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ09"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76777.1"
FT                   /translation="MKLVNVLGVAFFTIVLCWRIDRLYRSKAGVQAVAVTVAIAALTFA
FT                   VLLLGSPLASTVDGTLWKGASRLGGYVGLALGVAALAVAFFYGPTESARQKRAGMEAIP
FT                   LIAAVIGLSVAMTATPPAMRDASLDSLTVQELGFAVFFAIAGAYLMYGLADCVLSLTRL
FT                   MPFADGYLVTSLRMMAVGLGFTALGSLTQVVFVITSVLKLVSWPVLLTVSQVCTGLGIV
FT                   LFVLGMSYPGVRGFFVELTVRRKHREDYKRLEPLWELLTTAVPEVVLDAGRAGRDPHLK
FT                   FQRRIVEIRDVLVQLSPYLPDDFGDGTPEENVHNLLVAIDLRAEADGAAAPSAMVLPPD
FT                   GPTIDDDAAPLLVLSDAVRATPAEELQI"
FT   gene            complement(132482..133240)
FT                   /locus_tag="Tpau_0124"
FT   CDS_pept        complement(132482..133240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0124"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; NAD-dependent epimerase/dehydratase; KEGG:
FT                   rha:RHA1_ro04000 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76778"
FT                   /db_xref="GOA:D5UQ10"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ10"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADG76778.1"
FT                   /translation="MDVSGSSVIVTGGASGLGAATAKRFAEAGATVFGLDLQPSIDKAA
FT                   PVDNVHLIATDVTKEDEVKAAIAEAVKAGPLRVAVNCAGVGWAQRILSKKGVHPLDLFQ
FT                   TVININLVGTFNVMRLAAEQMSQQETADAQGSRGLVVNTASVAAFEGQIGQIAYTASKG
FT                   GVHAMTITAARDLAQFGIRVNTIAPGTINTPMLAGVTDEFKKTLEAGIPFPQRLGEPAE
FT                   YAQLAYFLAEHDYINGETIRMDGALRMAPR"
FT   gene            complement(133297..134004)
FT                   /locus_tag="Tpau_0125"
FT   CDS_pept        complement(133297..134004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0125"
FT                   /product="protein of unknown function UPF0016"
FT                   /note="PFAM: protein of unknown function UPF0016; KEGG:
FT                   rha:RHA1_ro04005 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76779"
FT                   /db_xref="GOA:D5UQ11"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ11"
FT                   /inference="protein motif:PFAM:PF01169"
FT                   /protein_id="ADG76779.1"
FT                   /translation="MLNALLVSFAVVFVAELGDKSQLMAMTFAAKFKWWIVLAGITVST
FT                   AVVHIASVGIGYALGSSIPTQLITAIAGISMLVFAFWTWRGDALSDDESTTADRVTRSV
FT                   FLAVTSAFFLAELGDKTMLATVTLTTQYNWFGVWLGSTVGMVAADALAIAVGAVLGSRL
FT                   PERAVAIGATILFFGFGGWLLFEAWPELDGVARIVTGAVVAVTVAAGLFVVRRAHHTAL
FT                   ANPATAKNPDSLV"
FT   gene            complement(134490..135092)
FT                   /locus_tag="Tpau_0126"
FT   CDS_pept        complement(134490..135092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0126"
FT                   /product="Superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /note="KEGG: rer:RER_48670 superoxide dismutase; PFAM:
FT                   Manganese/iron superoxide dismutase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76780"
FT                   /db_xref="GOA:D5UQ12"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ12"
FT                   /inference="protein motif:PRIAM:1.15.1.1"
FT                   /protein_id="ADG76780.1"
FT                   /translation="MAVYTLPDLDYDYSALEPHISGEIMELHHSKHHATYVAGANAALE
FT                   QLAEAREDGSIATKAPLLSKNLAFHLGGHTNHSIFWKNLSPNGGDKPVGDLAAAIDEYF
FT                   GGFDKFQAHFTAVANSLQGSGWSVLAYDHIGQRLVIQQLTDQQGNISINLTPLLMLDMW
FT                   EHAFYLQYKNVKADYVKAWWNVVNWEDVAARYAAAKG"
FT   gene            complement(135231..135434)
FT                   /locus_tag="Tpau_0127"
FT   CDS_pept        complement(135231..135434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0127"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76781"
FT                   /db_xref="GOA:D5UQ13"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ13"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76781.1"
FT                   /translation="MVVAITLVTGFTATRWGRRAMTVKHTNAGATSSPTHATTVHFSRS
FT                   LTRTSLTVAVLAAALVLILLLR"
FT   gene            135665..136063
FT                   /locus_tag="Tpau_0128"
FT   CDS_pept        135665..136063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0128"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76782"
FT                   /db_xref="GOA:D5UQ14"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ14"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76782.1"
FT                   /translation="MTEFSVGVREASPQAGRATRLRTLVGGRQTRTDVVVAITLLAISI
FT                   GATITNLYLTVQALPSFRECAAMACTYGSHFDVFAITFVVSLLVGTTFGAHAVLNLLNR
FT                   RNAWGYALLDAIISVGSLLAGLLWVSAV"
FT   gene            136080..136499
FT                   /locus_tag="Tpau_0129"
FT   CDS_pept        136080..136499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0129"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rer:RER_05160 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76783"
FT                   /db_xref="GOA:D5UQ15"
FT                   /db_xref="InterPro:IPR021215"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ15"
FT                   /inference="similar to AA sequence:KEGG:RER_05160"
FT                   /protein_id="ADG76783.1"
FT                   /translation="MTVGTVSGGDRLRAAAGPILAATGVGGLVLALHLRDPHVEYSWGV
FT                   CPLYAISGVYCPGCGGLRAVNDLTNFDFAGAFSSNLLVYPIAGILIWLWLRWLGSAVGF
FT                   DVPAVPKNRWLWIGVGVAIAVWCVARNVPGSPFAP"
FT   gene            136532..137452
FT                   /locus_tag="Tpau_0130"
FT   CDS_pept        136532..137452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0130"
FT                   /product="peptidase S49"
FT                   /note="PFAM: peptidase S49; KEGG: ami:Amir_0066 peptidase
FT                   S49"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76784"
FT                   /db_xref="GOA:D5UQ16"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ16"
FT                   /inference="protein motif:PFAM:PF01343"
FT                   /protein_id="ADG76784.1"
FT                   /translation="MSALVTELQDAAKAASHRVRSALGQAGGVVPVVRLEGPIAAPALS
FT                   GGLSSRGVLNLAGVETVLRKAFETDDAVAVALALNSPGGSPAQSELIGARIRQLAEKHD
FT                   LPVLAFCEDVAASGGYWLACAADEIFVTSTSIVGSIGVISASFGAKDLIEKIGLERRVF
FT                   TAGESKHRLDMFEDVREADVEWLHGVQGDIHSAFRTWVTERRGARLGDDPALFTGEVWI
FT                   GAKAVELGLADGVGTLRGTLADRFPEAEIETMHTPKPLLARLLSGGTSIADGGLAGAAA
FT                   ALTTGALDGALSGLHRRGLWASYGS"
FT   gene            137586..137936
FT                   /locus_tag="Tpau_0131"
FT   CDS_pept        137586..137936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0131"
FT                   /product="Rhodanese domain protein"
FT                   /note="KEGG: nfa:nfa1230 hypothetical protein; PFAM:
FT                   Rhodanese domain protein; SMART: Rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76785"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ17"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ADG76785.1"
FT                   /translation="MMDARGFPTDDGLISIDALPEVATITLLDVREPDEWELGHAPGAL
FT                   HIPLSDLPLRFEEIDLDSDVYVICRGGGRSESAVRYLETVGVEAAVVDGGMIAWAAAAK
FT                   PVVRSDGGPGVV"
FT   gene            137936..138772
FT                   /locus_tag="Tpau_0132"
FT   CDS_pept        137936..138772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0132"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa1240 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76786"
FT                   /db_xref="GOA:D5UQ18"
FT                   /db_xref="InterPro:IPR025565"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ18"
FT                   /inference="similar to AA sequence:KEGG:nfa1240"
FT                   /protein_id="ADG76786.1"
FT                   /translation="MQPASRTQPPGRRIRWLARRPPETLPEPRRAPSGEQPTPRYDDVP
FT                   RWGLRQEFAPAPTREEGRAEAASSLLYSVLQGATGILILAGLAEAGAYLLLVINRARTV
FT                   SKYLAWGADVSVFALGWLAVIALIGVYVAFARWLHAARAAAYEGLGTLDPRPTWQLWVY
FT                   CLVPVVNLVAAPVLALELVRAQDRAAGREPSTDGRTEFIRRWWAGWAALSIVTVGCVAY
FT                   AQASGGLQHRADAVLYTAITYVLGAAFLVLTLRLVRMIDAGPGSEHEVEEGRWLAV"
FT   gene            138757..139515
FT                   /locus_tag="Tpau_0133"
FT   CDS_pept        138757..139515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0133"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: nfa:nfa1250 putative glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76787"
FT                   /db_xref="GOA:D5UQ19"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ19"
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /protein_id="ADG76787.1"
FT                   /translation="MAGGVAGIVAHRGASGEYPEHTMSAFEAAVAEGADAIECDVRLTR
FT                   DHHLVCVHDRTVERTSDGTGAVSELDLADLKAMDFGSWKRPGHPEPVVTLDELIDLART
FT                   ADRKLFIETKHPVRFGGLVEQKLLATLQRHGLSRPDDPASAPVTVISFSGSAVWRVRRN
FT                   APGVPAVLLGEASRLLGGGAATAVRAQGIGPSVESLRERPDTVAKARAAGRFTYCWTVD
FT                   TEADVALCHGLGVEWIATNHPARARSWLSG"
FT   gene            139530..140426
FT                   /locus_tag="Tpau_0134"
FT   CDS_pept        139530..140426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0134"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rer:RER_01720 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76788"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ20"
FT                   /inference="similar to AA sequence:KEGG:RER_01720"
FT                   /protein_id="ADG76788.1"
FT                   /translation="MGRRERNATPREGSNRAEKVAAQRARSAESAAAARRPFEGLAAEC
FT                   DLIALRQFVPSATAPLAVSGSSREIRLATVLPGASFALVRDEAEGTVGYAALQTSVRPE
FT                   DPAAALAGAARFAADADTGEVLSEPAGGVITDVLDDGAALDITVHTDFNWWLAGEPDAQ
FT                   TRQLVDHANSLITPAARLDLGADGVGAPWWADTGSKAHLRWVHPAPEDELMAALARVHA
FT                   AGGLTLGEGSKFAGSFRADGLLIPVFDLDRESHPDEWVPGTVELGKRLAEALADDSELT
FT                   AAQRRSRDGLRDRQVSI"
FT   gene            complement(140423..141076)
FT                   /locus_tag="Tpau_0135"
FT   CDS_pept        complement(140423..141076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0135"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: nfa:nfa33150
FT                   putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76789"
FT                   /db_xref="GOA:D5UQ21"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ21"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG76789.1"
FT                   /translation="MTDERGRIGRPPKVNREQVVAAAADILTNDGPLKFSMRALASRLD
FT                   ISAMGIYHYFDSKNDLLGAVLEHQAWNTPVPELSDDPRERLVELPLAVITHLSRHPWVI
FT                   DVLSADEIIDAFSAWAFNEFLLTTDRLGIGEEDSLQLLFGIWRIVVGEVVVRNNIAMRN
FT                   ERPTQPWYEREVPAHVTERERLMQALGNVDDGINAYDVEVTLRAYLVGQLGQPA"
FT   gene            complement(141087..142487)
FT                   /locus_tag="Tpau_0136"
FT   CDS_pept        complement(141087..142487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0136"
FT                   /product="cell envelope-related transcriptional attenuator"
FT                   /note="KEGG: nfa:nfa1290 putative transcriptional
FT                   regulator; TIGRFAM: cell envelope-related function
FT                   transcriptional attenuator, LytR/CpsA family; PFAM: cell
FT                   envelope-related transcriptional attenuator"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76790"
FT                   /db_xref="GOA:D5UQ22"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ22"
FT                   /inference="protein motif:TFAM:TIGR00350"
FT                   /protein_id="ADG76790.1"
FT                   /translation="MNDERRRGDERPLAWSQVPEGEPSVTRRPVGNRQGPPRPQQPGRQ
FT                   PGQRGSGPRPGAGQQPFRPQNPPNPGNQQPRPTRVERPAPQGTWAPPQTPEPIPASTSR
FT                   RAGRVGERGSSGRVPPPPRPPRDRSRRRAAPEAPKPAAPPKVKRKRRIRPLRWLTAFLV
FT                   LVIVGTAAATFYFDGKLTRIDALAAYAGRIADTPGTNWLLVGSDAREGLTPEQQKDLAT
FT                   GGDLGGARTDTIMLVHIPKSGSPLLISIPRDLYVPVPGQGSYKINAAYFLGGPKLLVQT
FT                   FESKAKVRVDHYAEIGFGGFATMVDALGGIEMCPKYPINDPKAGIRLQAGCQNLSGAQA
FT                   LGYVRTRATPNADLDRVVHQREFMTALFTKATSPTTLLNPFEMWSLADATVGALTVDTD
FT                   THLWDLGRLAWALSSSPVTTTTPTGGSSDTDEGNALIWGKNTTEFFSLIAADQPVPDRL
FT                   LSGPGNSG"
FT   gene            complement(142577..143356)
FT                   /locus_tag="Tpau_0137"
FT   CDS_pept        complement(142577..143356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0137"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG:
FT                   mgi:Mflv_2806 abortive infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76791"
FT                   /db_xref="GOA:D5UQ23"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ23"
FT                   /inference="protein motif:PFAM:PF02517"
FT                   /protein_id="ADG76791.1"
FT                   /translation="MSAPEPVPASEKTPLRAEVLIVLLVTFGWSGMYSLIRLIGYQLGP
FT                   GVGGTTVSLNPSRSPHIPIDFLLQTLTAVQLFAWASLALYLLWRSGIGFADLGFALRGS
FT                   RRELLRNIGLGTGLAALIGLPGLVLYVAGRTLGVTANVLPAAGGDPGWRMVTYVLIAAG
FT                   NAVAEEVVVVGYFMTRLRQLGVGRAGTVAASALLRGSYHLYQGFGAGLGNVVMGVVFGA
FT                   AYDRWRRLWPLVIAHFVIDVVAYLGYALLKDHLGFLR"
FT   gene            143423..144883
FT                   /locus_tag="Tpau_0138"
FT   CDS_pept        143423..144883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0138"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; KEGG:
FT                   rer:RER_46260 hypoxanthine/guanine permease"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76792"
FT                   /db_xref="GOA:D5UQ24"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ24"
FT                   /inference="protein motif:PFAM:PF00860"
FT                   /protein_id="ADG76792.1"
FT                   /translation="MSAPAEPRLGPLDRYFQISERGSTISREVRGGLVTFFTMAYIVVL
FT                   NPIIIGGIVGNNKNTDVLGNVLPTAQVAAVTALAAGLMCIVFGAIVNYPFGIAAGLGVN
FT                   SLLAVSVAPQVTWPEAMGLVVIDGIIIVILGVTGFRTAVFRAIPAELKAAIAAGIGCFI
FT                   AFIGFVDSGFVRRIPDAAGTTVPVSLGIGNSVASWPTAVFVFGVLLMGILVVRKVPGAI
FT                   LLGVVITTIVALIVQKVTGLGPSIKDPHGWSLNIPELPSSLGGLPDLSLVGEVDVFGAF
FT                   TRIGVLAASVLVFALVLSNFFDAMGTITGMTKEAGLMKADGSVPNIGKALAVEGAGAIV
FT                   GGGASASSNTVFVESAAGIAEGARTGLANIVTGVLFLLAMFFTPLYEVVPSEAASPALV
FT                   IVGAMMIGQLKDIDWTQFGIALPAFLTVVTMPFTYSIANGIGIGFITWVVLAVAQGKAK
FT                   TVHPLLWIVAGLFLVYFAKAPIEGLFGI"
FT   gene            complement(144880..145698)
FT                   /locus_tag="Tpau_0139"
FT   CDS_pept        complement(144880..145698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0139"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mab:MAB_1432 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76793"
FT                   /db_xref="GOA:D5UQ25"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ25"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76793.1"
FT                   /translation="MSATPDDPTPQQHEGEPKPDLASRTKAHVGDVTTRARTHADDAAT
FT                   RAKTKAGDAASRAGEAAKRWLRRAIVAAIVVAVLVAAYFALAAYLPRKWADLLVGWVGT
FT                   DGGTLKGTVFGLGIGFLCAGLPLLLLWFAAKRAANHPKIATVLGLIAVIATVPNLMTLA
FT                   VAIGTGSGASYARTKIDQNAAGFRWATLIGVVIGVIAAIALAIFLEVQRRKRAKKKQQK
FT                   ALEKEAKAAQKQAEKDAKAAEKALKSGHAASSLDDEPSAPSGGGTGPSGT"
FT   gene            145812..146390
FT                   /locus_tag="Tpau_0140"
FT   CDS_pept        145812..146390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0140"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mmi:MMAR_1611
FT                   transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76794"
FT                   /db_xref="GOA:D5UQ26"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ26"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG76794.1"
FT                   /translation="MSDGPRRRDPERRRREIVDAAAALVLESGADALTHRKVAARAGVP
FT                   LGSTTQYFATLDDLREAALRNLMDEAEQWLADLEAEFVRDGASSAAYTGALHRYLSDPQ
FT                   LVRGDFAMTCAAASSPDMEELARHWTARLVEALARYIPVENARAVATFSDGATMDAVIA
FT                   ERPLDHALLASAIAALWSAPLGATKGTAT"
FT   gene            146387..147922
FT                   /locus_tag="Tpau_0141"
FT   CDS_pept        146387..147922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0141"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sav:SAVP032 QacA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76795"
FT                   /db_xref="GOA:D5UQ27"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ27"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG76795.1"
FT                   /translation="MTDLRTDHPSTMPFARRWASAAVLSISLLVITVDLTILNIALPDL
FT                   SADLRPTAAQQLWIIDAYSLVLAGLLVSTASLGDRFGRKRMLLLGYAVFGVASLLVLWA
FT                   DSPGEVIALRALLGVGGAMIMPTTLSMLRVIFTDPAERAKALGLWAAVSGLGAAIGPIA
FT                   GGVLLENFSWRAAFLVNVPFMAAVLIAGLLILPESTVPSPGRWDYVGALLSITGMVALV
FT                   WSIKRFAKDHTFASTPALVALLLAVIALSLFVYRSLHRPDPLLDVRLFERRQFTAAILA
FT                   ALGVMFAMAAALLLLAQWMQLVENYSPIETGVRLLPVAVAATVASIAAPWLARKLNARI
FT                   VLAGGLALAGIGMVLIDAADQLTYTAMIAPLVLVGMGMGSMTVASAMVMSGTPEEKAGN
FT                   AAALEETSYDLGNVLGVAVLGSIAAMLYTADADFAAIPGVDAATADAAGESLGAAMAIA
FT                   QQAQLPALAEHAAAGFTESLQTTGLVGGVLLLAVAAGVYLLTPKGTDITVQAH"
FT   gene            complement(147928..148665)
FT                   /locus_tag="Tpau_0142"
FT   CDS_pept        complement(147928..148665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0142"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rer:RER_01850 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76796"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="InterPro:IPR037119"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ28"
FT                   /inference="similar to AA sequence:KEGG:RER_01850"
FT                   /protein_id="ADG76796.1"
FT                   /translation="MSAPTIAEPTPAERVRTVAVVPHAAVLVADGHEPITIALHHVLGD
FT                   RLVIAVADDTPWLDGARAMVEINDISPLALRERTRSLVWLSGNLSEVADGAALAARVAI
FT                   ENPLESLLDVGNGSRLLTMPVETAVLADTAGASSVSGDELAAADPDPFAGYEAAWLAHV
FT                   ENDHPEMVGQLARRIPGKLRNHRIRLLGIDRFGIRLRAEHHELSDVDVRLNFAQPATDM
FT                   AALQRGIRILLGCPFLNGLRAAG"
FT   gene            148750..149148
FT                   /locus_tag="Tpau_0143"
FT   CDS_pept        148750..149148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0143"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rer:RER_01860 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76797"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ29"
FT                   /inference="similar to AA sequence:KEGG:RER_01860"
FT                   /protein_id="ADG76797.1"
FT                   /translation="MMAIELELLAPPREPMSLVDGLAIAGPSELTTQAYHPDDPRELVE
FT                   FLVRGVHESGPGFALEVTGPDAAVAVLCATVAALTGDDIEGALADPDEQRLAGLNPMAQ
FT                   DALRERLRHLIAPDPQAITDRLHALGLR"
FT   gene            complement(149152..150135)
FT                   /locus_tag="Tpau_0144"
FT   CDS_pept        complement(149152..150135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0144"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mab:MAB_2775c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76798"
FT                   /db_xref="GOA:D5UQ30"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ30"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76798.1"
FT                   /translation="MGEYDNPLDRISSGPAPQGPQPWRSNRLPTGSPYANGRYGTGHTK
FT                   RRRSRGRSGWVILVVAVVFIAGAIGWAAVSRPDSSPSAVPPLTRGADTAVPPSPPSVDQ
FT                   ITTSSLFTTALVTPRCALPAWSTDPAAIEAFSGAGTRCLEQVWRLPPNTVRVFSDPNGV
FT                   APGNDCPVGWTIRTVSSCGSATFVNRDGIVAAAGNQAAAALQWLSLSVASRAESRSGVG
FT                   TDVEALVRDAGGAPSPLGSEYLRREHMQTLCLSGSTIARLVGTAITEGDLERAAMDAAT
FT                   FTMVADLPDAPQLSRTNTRAWFDRGSRSPNQGPCGTAWTVPVDQIS"
FT   gene            150242..151177
FT                   /locus_tag="Tpau_0145"
FT   CDS_pept        150242..151177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0145"
FT                   /product="Prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="KEGG: mjl:Mjls_5415 prephenate dehydratase; PFAM:
FT                   prephenate dehydratase; amino acid-binding ACT domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76799"
FT                   /db_xref="GOA:D5UQ31"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ31"
FT                   /inference="protein motif:PRIAM:4.2.1.51"
FT                   /protein_id="ADG76799.1"
FT                   /translation="MTRIAYFGPEGTFTEMALLQCLDLAAQGRMDVPGVPLAGAERVSA
FT                   PSQVAALGLVADGVVDLACVPIESSVEGPVTPTLDTLGFGGDPLQIYAETDLAVSFSIV
FT                   GTVPLAEARTVGAYPVASAQVRGWLAANAPQADVVPAASNSAAAVDAAQGRVDVAVTTA
FT                   LAAAMHGVPELAAGVADVADARTRFVLCGRPGPAPARTGQDCTAVVLDVPSRPGSLALV
FT                   MAEFALRGVDLTRIESRPKRTVFGSYVFHFDCVGHIDDPAVGEALRALHRVCDDVRFLG
FT                   SWPRPGGPGTAPTDPGDSAEWFDRLRRGER"
FT   gene            151174..151809
FT                   /locus_tag="Tpau_0146"
FT   CDS_pept        151174..151809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0146"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: rer:RER_01880
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76800"
FT                   /db_xref="GOA:D5UQ32"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ32"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ADG76800.1"
FT                   /translation="MTGLLHLVRHGQTTANVAKALDTLPPGAPLTAEGSDQARRFAADR
FT                   PGTVPAVLLSSVARRAQQTAELIGAGWNVPVTVIDGVHEVQAGDLEGRTDEEAVRQFRD
FT                   VVERWHSGDRAAALPGGESADDLFARYLPAVAAVRAQYLDAGDVYLVSHGAAIRLVAAQ
FT                   LGGVDGEYAHKHHLPNTGEIVLRPLPGPTGGWELVSWADAPSPADPMG"
FT   gene            complement(151806..152153)
FT                   /locus_tag="Tpau_0147"
FT   CDS_pept        complement(151806..152153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0147"
FT                   /product="protein of unknown function DUF1025"
FT                   /note="PFAM: protein of unknown function DUF1025; KEGG:
FT                   mab:MAB_0150c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76801"
FT                   /db_xref="InterPro:IPR010428"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ33"
FT                   /inference="protein motif:PFAM:PF06262"
FT                   /protein_id="ADG76801.1"
FT                   /translation="MHVSRRAFQDWVSDALDDVPPQLAEAMNNVVVLVRDRNDEDPTIL
FT                   GLYEGIALTERDTSTYFGTLPDRIFIYREPLMDMCETEEQLRREIRVTVLHEIGHHFGI
FT                   DDQRLQELGWA"
FT   gene            complement(152156..153244)
FT                   /locus_tag="Tpau_0148"
FT   CDS_pept        complement(152156..153244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0148"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rop:ROP_39180 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76802"
FT                   /db_xref="GOA:D5UQ34"
FT                   /db_xref="InterPro:IPR026004"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ34"
FT                   /inference="similar to AA sequence:KEGG:ROP_39180"
FT                   /protein_id="ADG76802.1"
FT                   /translation="MADDTDTQPEPVQPPDGPDRLASDDAAAAKPDPLAGPVDADVTDL
FT                   RAGRVSAANLRAVLIAVIVGALALGGTLYAAGYFDPVSEDHGPRLAANGSTLARSKPGS
FT                   CITWDTAGALAAVDCSASHKFEVAGEPANTLPPDAKYPSEQQIAALREQVCTPVVAEYL
FT                   GQRLDPKGRYQMGLLTAGEKAWEGGDRTMRCGVQLVDGSGAVVDSTGKVANQDKATSWP
FT                   VGTCIGINDRGQATVPVDCSAPHAFEVTATVDLRQKFPDASWPTLAQQEDYLGGTCPAR
FT                   TTAWFGAQDGLRKSGLQLQWNTLSQEAWTAGARTSVCFVAASDGKKFIPVTGSAKSPNL
FT                   LIDGKKPVMPTFPGAAPPKPGR"
FT   gene            153319..154572
FT                   /locus_tag="Tpau_0149"
FT   CDS_pept        153319..154572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0149"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="TIGRFAM: seryl-tRNA synthetase; KEGG: mab:MAB_0153
FT                   seryl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); Seryl- tRNA synthetase, class IIa-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76803"
FT                   /db_xref="GOA:D5UQ35"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ35"
FT                   /inference="protein motif:TFAM:TIGR00414"
FT                   /protein_id="ADG76803.1"
FT                   /translation="MIDVKLLRENPDLVRASQRARGEDAALVDALLEADAHRRAAVLAA
FT                   DNLRAEHKTSSKSIGKAAPEERPALVAAAGELAAKVKEAEAEQARADEVFDETARKIGN
FT                   VIIEGVPAGGEDDFEVLEHVGTIPEITDPKDHLELAEGLGLLDMERGAKVSGSRFYFMT
FT                   GHGALFQMALLQLAVQKAVAHGFTLMIPPVLVKPEIMGGTGFLGAHADEIYRLEADDLY
FT                   LVGTSEVPLAGYHMGEIIDLNDGPIRYAAQSSCFRREAGSYGKDTRGIIRVHQFDKIEM
FT                   FVYCKPEDAEAEHQRLLDFEKEMLAAVEVPYRVIDVAAGDLGSSAARKFDCEAWVPSQE
FT                   RYRELTSTSNCTTFQARRLGVRYRDEDGRPQIAATLNGTLATTRWLVAIWENHQQPDGS
FT                   VRVPAALQPFLGTDVLRP"
FT   gene            complement(154581..154928)
FT                   /locus_tag="Tpau_0150"
FT   CDS_pept        complement(154581..154928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76804"
FT                   /db_xref="GOA:D5UQ36"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ36"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76804.1"
FT                   /translation="MHYPPGLAPARPSITRHRLWGLDLAIVITSVVGQILFWAALLTTI
FT                   GRSDELPMGTILCAAAGIGLGAIAIGAWLVRSMLLLTNHTVSVWYVIAPITGIVGTAVG
FT                   LAAAMAVMPPQ"
FT   gene            complement(155001..155735)
FT                   /locus_tag="Tpau_0151"
FT   CDS_pept        complement(155001..155735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0151"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: npu:Npun_F0186 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76805"
FT                   /db_xref="GOA:D5UQ37"
FT                   /db_xref="InterPro:IPR021994"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ37"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76805.1"
FT                   /translation="MSEPEFDRERRAAARSVRESHLMVRLFIALGVLTIAAGCYFTVVD
FT                   TMFLASASTAEGRVVDYEESASPKENGRTEYSYQRIVGYTVDGVDYRKRESGASSSEPA
FT                   IGDAVTVYYDPDDPQHAMIDAFMRKWLGPLAIIFGVLWTALFAAIQRWTRRKQGERERT
FT                   AFHGARIPLTVTDLRDSEWRDDDGNTRRAVVATMTGTDSGTGEARVFTRSYEGRWRHRR
FT                   APALGAPYVAFVDDSGAIIIPA"
FT   gene            complement(155735..156154)
FT                   /locus_tag="Tpau_0152"
FT   CDS_pept        complement(155735..156154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76806"
FT                   /db_xref="GOA:D5UQ38"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ38"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76806.1"
FT                   /translation="MWIVRVGIALARPIGPQWDWRFLVIPTISALGLTAAVFNLPREAR
FT                   WTYAKPRLEATSAAIRSGAMPVRSGESLRIGSYSLSYDDRADGNIWFRVVDAGFLNSEY
FT                   LVHSPVGHAVRPAEERHRNTVEHFDGQWWLVNEVF"
FT   gene            complement(156176..156268)
FT                   /locus_tag="Tpau_0153"
FT   CDS_pept        complement(156176..156268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76807"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ39"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76807.1"
FT                   /translation="MTLAATALVLTLCWGISLPGGDFMVLLLAF"
FT   gene            complement(156355..156942)
FT                   /locus_tag="Tpau_0154"
FT   CDS_pept        complement(156355..156942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0154"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rer:RER_00790 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76808"
FT                   /db_xref="GOA:D5UQ40"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ40"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76808.1"
FT                   /translation="MTTSASTALTPRAWWHRPPGLPLALASLIACGTWMVEASTPQDGS
FT                   PTLGVAILAGLSLIAFTWIGRTMISLAHRPRWSVRYAAVPLIGLITLGLVYLDVPFAAR
FT                   WIQAKPAFEHAAHAALADAQPTPTQLRLGTFSVTRSTVEGTVRFRLGTGAIGDTHYIVF
FT                   SPAGRPHTYGPPSEHDRVAHFDGPWWRVIDMY"
FT   gene            complement(156980..158038)
FT                   /locus_tag="Tpau_0155"
FT   CDS_pept        complement(156980..158038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0155"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_4457 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76809"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ41"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76809.1"
FT                   /translation="MNSPRFPRNNRKRVDDYYGVHDTGMATQAPPQRPAAPPPQQPPPA
FT                   GPQPATPPAGAPSRGQQAPPPTAPQAPSQPRPEPRRPEPEQRSKPDPLNDPLTSETFLG
FT                   VQPESDTFEAGMFGYSASSRPAPSDVPPESNGFDSGFDQFAPPRFEPRAENGRQESTGS
FT                   AAEHEPVIDLADHPDGYIDVEVVDVVEVDHEPPPVRETLAIDAFPYTQIDESYVDPTVL
FT                   PEPKERGDMTDFNESLTEAMSIEGALGVALVDSQSGMALATAGDPKEFNLEVAAAGNSA
FT                   LVQAMSRTLGDLDLDDHIEDILITLGSQYQIVRPIRQGAEGLFLYLVLDRARANLAMAR
FT                   FRLTKLEEQIEV"
FT   gene            complement(158035..159612)
FT                   /locus_tag="Tpau_0156"
FT   CDS_pept        complement(158035..159612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0156"
FT                   /product="Rieske (2Fe-2S) iron-sulfur domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] iron-sulphur domain; KEGG:
FT                   rop:ROP_39230 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76810"
FT                   /db_xref="GOA:D5UQ42"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ42"
FT                   /inference="protein motif:PFAM:PF00355"
FT                   /protein_id="ADG76810.1"
FT                   /translation="MQVTSVGHAGFHITTTAGTILCDPWVNPAYFGSWFPFPDNTQLDW
FT                   KALGDVDYLYVSHLHRDHFDAKNLAENINKDATVLLPDYPVPDLKRELEKLGFTRFFET
FT                   EDSVKHTVSGPKGDLDIMIIALRAPADGPIGDSGIVVADGETVLFNMNDARPVDMDVLG
FT                   DNFGHIDVHLLQYSGAIWYPMVYDMPKGSKRRFAEQKRQRGMDRARSYVDQVGATWVVP
FT                   SAGPPAFLDPELRYLNDEGRTGEETVLGDPSNIFPDQITFLEEMSKNGNDGGLLMIPGT
FT                   VGDFRGTEMLSLTHPVPEAEVMEIFENKTAYLDAFAERQAPVLAAEKASWAPDDGVPLL
FT                   GALKAKFEPIMQASALISDGIGYAVGLEMGDETVVLDFPNRIVREPAEGDGKYRYGFRI
FT                   APELVRTVLRDDEPDWVNTIFLSTRFTTWRIGGYNEFLYTFFKCLTPERIAYADGWFSE
FT                   AHDDSASTELDGWEVQRRCPHLKADLSKFGVVEGGKLTCNLHGWQWDLESGRCLTSSGH
FT                   ELRAKRLT"
FT   gene            159698..160468
FT                   /locus_tag="Tpau_0157"
FT   CDS_pept        159698..160468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0157"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="KEGG: mab:MAB_0165 putative acyltransferase; PFAM:
FT                   phospholipid/glycerol acyltransferase; SMART:
FT                   phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76811"
FT                   /db_xref="GOA:D5UQ43"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ43"
FT                   /inference="protein motif:PFAM:PF01553"
FT                   /protein_id="ADG76811.1"
FT                   /translation="MEPIYGTIIKVARGMWAYQGIQFTEVDFQKFPREGGAVVAINHTG
FT                   YLDFPFAGKPADEAGHRKVRFMAKKEVFDNSKTGPLMRGCKHIPVDREAGAEAYAAAVD
FT                   ALKAGELVGVYPEATHSRSFELKGFKSGAARMAIEANVPIVPVVVWGAQQIWTKGLPKQ
FT                   LGRNKFRVLIGVCDPLDPVGPPDELTARLKGEMQTMLYQLQDLYGPHPQGAAWVPRRLG
FT                   GSAPTLEEADALDAADIEERRRRREERLGSGDDA"
FT   gene            160461..161294
FT                   /locus_tag="Tpau_0158"
FT   CDS_pept        160461..161294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0158"
FT                   /product="Cof-like hydrolase"
FT                   /note="KEGG: mjl:Mjls_5404 Cof-like hydrolase; TIGRFAM:
FT                   Cof-like hydrolase; HAD-superfamily hydrolase, subfamily
FT                   IIB; PFAM: Haloacid dehalogenase domain protein hydrolase
FT                   type 3; Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76812"
FT                   /db_xref="GOA:D5UQ44"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ44"
FT                   /inference="protein motif:TFAM:TIGR00099"
FT                   /protein_id="ADG76812.1"
FT                   /translation="MPDAELGERPVLVASDVDGTLVDEAEKISPRTHAALHAVRAAGGH
FT                   FVLATGRPPRAVDPIADQLDFAPLAVCANGAVLYDTGTSKVVSAALMSPDLLAHIAELV
FT                   YEHLPGAGFAAERVAQGEHDAATPRFAASTGYQHAWLEPETVSAEDAVVLSHPAVKLLV
FT                   RQPGMTSDEMHARVAPHLAGIADVTYATNNGLIEFHVPGVTKATGIRAAMRHLGLSDDV
FT                   RTAAFGDMPNDAEMLRWAGVGVAMANAHPVALDAANMVTSTNLDDGVAQILERWF"
FT   gene            complement(161328..161924)
FT                   /locus_tag="Tpau_0159"
FT   CDS_pept        complement(161328..161924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76813"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ45"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76813.1"
FT                   /translation="MPWERLDEFIDTMEYWTEVQNYLESIEAQRATGTRLVAFGRPYLK
FT                   DENTLILPNGPARDQMDDGEILLSITRDDDGYSLRRTGYERGDTFTGRQEWKASNFDLV
FT                   GKYVLVRQNSRFRTKIGVGSPFHQWLDIGLASQWEKRHMSQDEVGVDWLYKYTNSSSPS
FT                   VYYYDYDNGDPLTFPFSLSYRDITDIYMKGVPQPH"
FT   gene            162462..164669
FT                   /locus_tag="Tpau_0160"
FT   CDS_pept        162462..164669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0160"
FT                   /product="SpoIID/LytB domain protein"
FT                   /note="KEGG: rop:ROP_39290 hypothetical protein; TIGRFAM:
FT                   SpoIID/LytB domain protein; PFAM: Stage II sporulation D
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76814"
FT                   /db_xref="GOA:D5UQ46"
FT                   /db_xref="InterPro:IPR013207"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ46"
FT                   /inference="protein motif:TFAM:TIGR02669"
FT                   /protein_id="ADG76814.1"
FT                   /translation="MPVWIDGGPRRRRVRRTLAIAMLPAIAVGGAALVFTGATSTDDPA
FT                   LAVGSNVTFTGQGNGHGRGMGQWGAFGYAKAGWKAEQIVAHYYGGSVLSRVDVNLPVKV
FT                   QLTQQKSVNVFAPAGAKVGDENVAPGQAVRIDGGNAVITEGCGGKVVKTIPAGDGTVSP
FT                   VNPAAGRPENEILRFCGSNASYRGALSTQDGKVFNTVNIEDYLRSVVPVESKVEWADQG
FT                   GTEALRAQAIAARSYALAESAKRGDRYNDTQDSQVYGGFAKEDKRSDAAVSSTAGLVMA
FT                   KDGFAVPTEFSSSTGGYTAGGDFTAVKDDGDVVSPFRNWNQSVPATKIASEFGVGKLES
FT                   IRITKVQSAAAPRVAQVEIKGSERTVTASGADVRKKLGLRSDWFVIDGQGGPGAAAAPS
FT                   VPSAPAAGSQNPPTSAPAPAPVPGNVVDRPIIAAPVDPFNPVPTAPNSSQIAPPGATTA
FT                   TVSPSGAPAVPAAPAAPAAPAAPAAVPGAATPAAPAAPAAPAAPAVPTVPAAPGGAAPA
FT                   VPAAPTAPAAPTIPGIPAPPAAGTGIDALQGRAITGKAAVEAAYRSAGGEKGTLGPVVA
FT                   NPITFPDGSMFQSYANGTIYYTPANGAQVVPSGIAAPATLMNWVTAFAAGGAPSLPPLP
FT                   LLNLIPGWGDVLGINPTQSDTPPGVPAVPVTPGAPAAPSAPAAPAAPAAPAAPAAPAVP
FT                   AAPSAPAAAPAAPAPAASAPAAPAGSGSTPLPVPTVPGAPS"
FT   gene            164728..165936
FT                   /locus_tag="Tpau_0161"
FT   CDS_pept        164728..165936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0161"
FT                   /product="UDP-galactopyranose mutase"
FT                   /EC_number="5.4.99.9"
FT                   /note="TIGRFAM: UDP-galactopyranose mutase; KEGG:
FT                   msm:MSMEG_6404 UDP-galactopyranose mutase; PFAM:
FT                   UDP-galactopyranose mutase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76815"
FT                   /db_xref="GOA:D5UQ47"
FT                   /db_xref="InterPro:IPR004379"
FT                   /db_xref="InterPro:IPR015899"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ47"
FT                   /inference="protein motif:TFAM:TIGR00031"
FT                   /protein_id="ADG76815.1"
FT                   /translation="MANTSSQPYDLLVVGSGFFGLTVAERAASELGKRVLVVERRSHLG
FT                   GNAYSEPEPETGIEIHKYGAHLFHTSNERVWEYVNKFTDFTGYQHRVFAMHKGQAYQFP
FT                   LGLGLVSQFFGRYFTPDEAKALIQEQAAEFDSKDAQNFEEKAISLIGRPLYEAFIKHYT
FT                   AKQWETDPKNLPAGNITRLPVRYTFDNRYFNDTYEGLPVDGYTKWLENMAASDLIDVRL
FT                   DTDWFDVRDELTAASPDAPIVYTGPLDQYFDYSAGRLGWRTLDFETEVLPTGDFQGTPV
FT                   MNYNDADVQYTRIHEFRHFHPERKNYPTDKTVIMREYGRFAGDDDEPYYPINTPSDREM
FT                   LAAYRELAKTEAAERKVLFGGRLGTYQYLDMHMAIASALSMFDNTLRPHLETGAALTEE
FT                   ANQ"
FT   gene            165933..167888
FT                   /locus_tag="Tpau_0162"
FT   CDS_pept        165933..167888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0162"
FT                   /product="putative galactofuranosyltransferase"
FT                   /note="KEGG: nfa:nfa1770 putative
FT                   galactofuranosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76816"
FT                   /db_xref="GOA:D5UQ48"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR040492"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ48"
FT                   /inference="similar to AA sequence:KEGG:nfa1770"
FT                   /protein_id="ADG76816.1"
FT                   /translation="MSSTDTQAKTLLQRVILPRPGEPLDVRSLYLEEAETNSRRSHAPT
FT                   RTSLNIAGESEVSFATYFNAFPASYWRRWTVLKDVVLRIELKGTARVDLYRSKVDGARI
FT                   ALGGNLVETDATGYGVAEFATDLGPFEDGGWIWFDVTADSDTEIISAGWYATVSEEGLP
FT                   DKRVTVGIPTFNRPDDAVAAIRALTSDPLVDEVIDAVLMPDQGNKKVIDHPDYADAIAP
FT                   LGDRYQRFEQGNLGGSGGYGRIMYEALRLTDSPYVLYMDDDIAIEPDSILRALQFARFA
FT                   KTPMLVGGQMLNLQDRSHLHCMGEVIDRGAFMWTAAPFVEYDHDFSKYPLSDKENSKNL
FT                   HRRIDVDGNGWWMCLIPRVAAEEIGLPMPLFIKWDDWDYGLRAAEHGYPTATVPGIAIW
FT                   HMAWSDKDDAIDWQAYFHLRNRLVVAALHHEGSTRGIMSSSIKALMKHLLCLEYSTVAI
FT                   QIEAMRDFLRGPEALYELLPTALPKVAAMRKEYPDAVVLPSATELPRTTGAATALGTKI
FT                   PLNPITKVKTLAAAVRNNLRPADPHNHEVPQANYPPLEARWFSLGRVDGVTVTTADGRG
FT                   VVYRQRDREKMFALMRESLTVHREVDRRFEEMKQRYRAAYGDLTSREAWSKIFEPTTPG
FT                   AERAGRIEPENAGEQK"
FT   gene            167885..168493
FT                   /locus_tag="Tpau_0163"
FT   CDS_pept        167885..168493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0163"
FT                   /product="phosphoesterase PA-phosphatase related protein"
FT                   /note="KEGG: mva:Mvan_5648 phosphoesterase, PA-phosphatase
FT                   related; PFAM: phosphoesterase PA-phosphatase related;
FT                   SMART: phosphoesterase PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76817"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ49"
FT                   /inference="protein motif:PFAM:PF01569"
FT                   /protein_id="ADG76817.1"
FT                   /translation="MSDREPGQGATFELNPEEAALVAVQAKLADRPGVLPAARGLSHFG
FT                   EHSLGWMGLAALGALLSKDRRRQYVTAGVGAFVAHAASVVIKRIVRRRRPDHPAIAVGV
FT                   GTPSKLSFPSSHATSSTAGSILLGRASGVPGGALLLPAAVVPPMLTSRMVLGVHYPTDV
FT                   AAGAAIGAATALAAIEGERLWTRREARKAGKNMTKGSDN"
FT   gene            168493..169413
FT                   /locus_tag="Tpau_0164"
FT   CDS_pept        168493..169413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0164"
FT                   /product="UbiA prenyltransferase"
FT                   /note="PFAM: UbiA prenyltransferase; KEGG: rer:RER_02140
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76818"
FT                   /db_xref="GOA:D5UQ50"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ50"
FT                   /inference="protein motif:PFAM:PF01040"
FT                   /protein_id="ADG76818.1"
FT                   /translation="MSEEPIEHGEPKVPSNLATGLIKAMRPRQWVKNVLVVVAPLAAGR
FT                   DQLEFVNFPNVGLAFIAFCLAASSIYLINDALDVEADRAHPTKRYRPIAAGVVPVNVAY
FT                   AVAFLLAAGAIGVSLLANKELAIVIGAYLVIQLGYCLGLKHQPVIDICIVSSGFLLRAV
FT                   AGGVAAELPKGLSQWFLLVMAFGSLFMAAGKRYAELQLAERTGAKIRKSLEYYTTTYLR
FT                   FVWTLAATSVVLCYGLWAFDKTTHPDNIWYTLSMVPFTVAILRYAVDVDGGEAGEPEEI
FT                   ALGDRVLQVLAVMWIGTVVAAVYFA"
FT   gene            169391..171394
FT                   /locus_tag="Tpau_0165"
FT   CDS_pept        169391..171394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0165"
FT                   /product="arabinosyltransferase AftB"
FT                   /note="KEGG: rop:ROP_39350 arabinosyltransferase AftB"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76819"
FT                   /db_xref="GOA:D5UQ51"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ51"
FT                   /inference="similar to AA sequence:KEGG:ROP_39350"
FT                   /protein_id="ADG76819.1"
FT                   /translation="MPRSTSPDASAVGRTASTSSFPLPRVTLWLGVAACAVLFGYGAWQ
FT                   RRWIADDGLIVLRTVRNLLAGNGPVFNMGERVEVNTSAAWTYIIWFFSWISGVQTEYVV
FT                   LTVALVLSVAAIPLAMLGTARLYKGGAGWKGLRGSGLLLLPAGGLVYMALPPARDFATS
FT                   GLEVSLTIFWVALLWWLAIAWSQQDRDPRDPKDVRRSWIITLTTAFVAGLSWLVRPEMA
FT                   VVGGLVLVVMVLAPIGLKQRLAVIAVAGFLPVAYQIFRMGYYGLPVPNTAIAKDASGSK
FT                   WDQGFLYLTNLVEPYSLWLPVVALAIAVPLIVLPARGARTPLTGGFRLPRGGVTGLRDH
FT                   LQRPAVIVAVMFLGGVIETLYWLRQGGDFMAGRVLLAPLFLLLLPVMVIPLRIPSRQEG
FT                   DSRIKGAARLLGGSAGAAVAAVLWVLVIGWALHASTFRGMPDGTAIGKTGIVDERAFYS
FT                   LQTGKSHPITADDYLDYPRMKSLQEILRQTPRGGVYLPSFDYDWWFIDPLPYPRPPDVP
FT                   LTQTVFFTNLGMTSMNLPLDVRVWDQVGLAWPVATHTARLEDGRIGHDKEMFPDWAVAE
FT                   AKAYPKRPALPPHIDPNWVNQARLALTCPQIQQLRDSYSAPMTFDLFKRNFKLSIATMG
FT                   MRIDRVPEYTLRMCRMDVPPPLTPEQYTMPKN"
FT   gene            171494..172405
FT                   /locus_tag="Tpau_0166"
FT   CDS_pept        171494..172405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0166"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   KEGG: fal:FRAAL1683 putative zinc-binding oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76820"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQ52"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ADG76820.1"
FT                   /translation="MTFAGRSIGFRNYGGPDVLVPLHDEKALDGPGRVLVRTAFSGVNP
FT                   VDVSFRIGRMDAFVGDIAAGFVPGMECCGEVVASSAPGLPVGRVVNALVLPGPAPRTGA
FT                   YAEFVQVDADRVGTVPAGLSPRAAACIPLNAVTASSILRSLDPAVETVVITGAAGALGR
FT                   FLVYASGAAGYRTIALARPGDEALLRGLGADDPVGDELRTPDVIIDAANLGAALSDRFT
FT                   SAGTVVRVRADTEYSLPHASLITATVREATDVAAHLDWWNGRIGGHPEVVGVVETFAPE
FT                   AAGAAQERLSVPGRRGRSALRW"
FT   gene            172554..173516
FT                   /locus_tag="Tpau_0167"
FT   CDS_pept        172554..173516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0167"
FT                   /product="diguanylate cyclase with GAF sensor"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; GAF domain protein; KEGG: smd:Smed_3728
FT                   diguanylate cyclase; SMART: GGDEF domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76821"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQI8"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADG76821.1"
FT                   /translation="MTVQLHPREHDRVAAVRSLRIMGSDPVPDLDRIAELSAALCEVPF
FT                   GSVNVIDFDRHYTVASVGAPRIHASREDSLCSLAVEGDQVIYAVDAKKDDRFLGKRFLD
FT                   IADPPIHLFAAAPICTADRLPVGTVRVYGSEPRQLSERQLRGLEDLADLAMSVLELRSA
FT                   ARTLHNTATTDAVTGLPNRHAMDLMVSERESAGIRLIAYADLDDFKRINDSFGHQFGDA
FT                   VLRAVARRIDAAIGEDDVVYRVGGDEFVIAARESDVPLEDMVDRLRAAVSDSPVTVDGR
FT                   PITVSATVGAVQVPVGGDPAAAIDAADAAMYRAKGNRFV"
FT   gene            173601..175241
FT                   /locus_tag="Tpau_0168"
FT   CDS_pept        173601..175241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0168"
FT                   /product="putative esterase"
FT                   /note="PFAM: putative esterase; LGFP repeat protein; KEGG:
FT                   nfa:nfa1840 putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76822"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR013207"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQI9"
FT                   /inference="protein motif:PFAM:PF00756"
FT                   /protein_id="ADG76822.1"
FT                   /translation="MHRAGRIGTLLVAGVMAVGAVVAPGPAGVGAPALAEPAPAQSRIL
FT                   GAAWAGDHRVDLTVFSAAMGGNVTVALLLPRDWHADPKARFPTLYLLDGMRARDDQSGW
FT                   LLETNAAEFYRDKNVTVVLPVGGQSSWYTDWRRPDNGKNYKWETFLAKELPPLLQQGWR
FT                   ATEARAAAGVSMGGTAAFTLAARNKGLYRFAGSYSGILSMSSPGTPESVGLAMRDAGNF
FT                   DSDAMYGPPTDPAWAQHDPLKLADQLRGVSLYFSSGNGSSSSSGQPAELQAMALEVLAR
FT                   SSNQAFAVELNRKGIPANAIYRPSGDHSWPYWQFENAQAWPQVQAALGVPDPRPCSAAG
FT                   AIGELAPKVAALGSCVTVEYPVPGGRAQDFRVGQIYWTADTGAQVVGGAIAGAYLGTGG
FT                   PGGALGFPTGGEQPLPDKKGRYQQFQNGTVYWSPQTGARAVRGAIKDKYAGAGYERSPL
FT                   GLPVSDEQRLRTGGGAFQRFQGGTVYWSPKTPATVVPNGPIFAEWGRQGYEAGRLGYPV
FT                   ADAVPAPGGVEQRFERGVIALVNGATEVR"
FT   gene            175339..175806
FT                   /locus_tag="Tpau_0169"
FT   CDS_pept        175339..175806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0169"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro04061 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76823"
FT                   /db_xref="InterPro:IPR007969"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQJ0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76823.1"
FT                   /translation="MAGLRGALAVAVMTGGVLLGAVACGGSSTVSAPTTAVDGGGPTSL
FT                   PATAPESSASVPSGYPGPPSVASSPKDKEFVAKMRSEGLVASDETIIGAAQYTCDALSQ
FT                   SPNPRYVETLVKGMLGPSRTGDGVSADKADKLATDDANKLIAEAKSSYCKK"
FT   gene            175813..176817
FT                   /locus_tag="Tpau_0170"
FT   CDS_pept        175813..176817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0170"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa1860 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76824"
FT                   /db_xref="GOA:D5UQJ1"
FT                   /db_xref="InterPro:IPR000675"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQJ1"
FT                   /inference="similar to AA sequence:KEGG:nfa1860"
FT                   /protein_id="ADG76824.1"
FT                   /translation="MSQQPGPSGGRKVSPAAIGVAVIVLIAVILVIILLITLLKPGPSG
FT                   PDIGAPDSSSSAPSTADRPKSQPADCPDVQVISVPGTWESKATDDPYRPTFNPNSLMLK
FT                   VTGPLQGAFAKDRADIWTTPYVAQLSNPVAIPPDGQASYEASRTEGYTKSVAQMKKVYD
FT                   RCKLTGFVLMGFSQGAVIAGDIAGEIGAGKGVIPAENVLGVGLISDPRREPGDARTAGP
FT                   NPPGVGVEVAYGGFSFMSLALRGKREGGFGAVKDRTVSLCGNKDPICNQPKDIFQAGQL
FT                   ATTLPELEKVLTGNSHALYATTADWSSNGQTATQWLQGWARGVIDKAPKPAHS"
FT   gene            176836..177777
FT                   /locus_tag="Tpau_0171"
FT   CDS_pept        176836..177777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0171"
FT                   /product="cutinase precursor"
FT                   /note="KEGG: mab:MAB_0178 cutinase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76825"
FT                   /db_xref="GOA:D5UQJ2"
FT                   /db_xref="InterPro:IPR000675"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQJ2"
FT                   /inference="similar to AA sequence:KEGG:MAB_0178"
FT                   /protein_id="ADG76825.1"
FT                   /translation="MAGNGKRALNVMGIAIAIAALIAIIVVIALIISMLNKPGPTPPGP
FT                   PGGQQAADCPDVQVISIPGTWESSATDDPVNPRFNPRSLMLQVSTPLAKRYPKLRADIW
FT                   TVPYVAQFHNPVAVPPDGQMTYAASRQQGTDRAIAQINKVNERCGRTGFVLMGFSQGAT
FT                   IAGNIAAQIGAGQGPVAAERLIGVGLISDSRRVQGEGRAIGPDPAGEGVEVTFSGFNAF
FT                   GVDLQGKRKGGFGAVDDKVVTICGSNDPICNQPKGGLLGLATGLPQVISTVTQNSHAAY
FT                   GTTSDWSLDGKTATQWLTGWAIGVIDKAPKTK"
FT   gene            complement(177780..178904)
FT                   /locus_tag="Tpau_0172"
FT   CDS_pept        complement(177780..178904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0172"
FT                   /product="Agmatine deiminase"
FT                   /EC_number="3.5.3.12"
FT                   /note="KEGG: mab:MAB_0588c peptidyl-arginine deiminase;
FT                   PFAM: Porphyromonas-type peptidyl-arginine deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76826"
FT                   /db_xref="GOA:D5UQJ3"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQJ3"
FT                   /inference="protein motif:PRIAM:3.5.3.12"
FT                   /protein_id="ADG76826.1"
FT                   /translation="MNRRRFVQAGTALVGFVLAACGAPSGSPAERSPIDRRGRRWHMPD
FT                   EGDPHERTWMAFAAREDIWGKDRAPGVQRSLALIATAIARFEPVSMLVSADQMGRAKEL
FT                   IGNAPGVTLVAAELDDLWIRDTGPVFVKGDQGLAGVDFNFNGWGNKQRHTSDARVAGLV
FT                   TAQARAEVLRTDLVLEGGGIEVDGEGTAIITESCVLNDNRNPGWTKQQVEAELSDLLGI
FT                   DRVIWLPGIKGRDITDGHTDFYARFASPGVVVAGLDEDPESFDYDVTRRHLDILRGATD
FT                   AKGRGLTVEVLRTPSTVREAYAEDDDFAAGYINFYLCNGAVISPQFGDAETDGEARATL
FT                   QRLFPGREVVQLDIDPIAGGGGGIHCATQQQPVR"
FT   gene            179298..180278
FT                   /locus_tag="Tpau_0173"
FT   CDS_pept        179298..180278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0173"
FT                   /product="putative F420-dependent oxidoreductase"
FT                   /note="KEGG: rop:ROP_39410 putative oxidoreductase;
FT                   TIGRFAM: probable F420-dependent oxidoreductase; PFAM:
FT                   Luciferase-like, subgroup"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76827"
FT                   /db_xref="GOA:D5UQJ4"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019923"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQJ4"
FT                   /inference="protein motif:TFAM:TIGR03621"
FT                   /protein_id="ADG76827.1"
FT                   /translation="MTTEPRKFRFAAGGAGNADEGGARKFVKLAQEAEELGFDTFAIPD
FT                   RLDAQVGPLAALGALAVSTSTIRLATSMLAMPFRHPAVLAKELTTIDVLSKGRLEIGLG
FT                   LGAFKDDFDQAGIEFESPDRRLQRLDEGLTVLDTLLRGQEAEFEGEIFSVQALKGYPRP
FT                   RQGPRPPIAIGAGARRTLELAARRADVVSINPRSSAEGMLKISDMSMDAVKNKVEVVKA
FT                   AAGERFADIELSWSIATIVVTDDREQVADFALKAIERGLSASIEIDKEVTIDDVLNSPY
FT                   LAIGTFDEIADQVRATRAATGMSYVGVVPTQMEAFAPVLEQLKGE"
FT   gene            180492..182402
FT                   /locus_tag="Tpau_0174"
FT   CDS_pept        180492..182402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0174"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   rop:ROP_39420 long-chain fatty acyl-AMP ligase FadD32"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76828"
FT                   /db_xref="GOA:D5UQJ5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQJ5"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADG76828.1"
FT                   /translation="MNNEFDQFLDEDGNIFFRPGTTLVDFVERNARERADTLAYRFIDY
FT                   SRERDGEVHELTWAQFGARLRAIGARLQHITKREDRVAILAPQGLDYVTAFFGALYAGN
FT                   IAVPLFSPDEPGHTDRLRIVLEDCKPTAILTSSGSAEACRNFFRHLPAKERPRIIAVDA
FT                   IPDSVGSTLKPFPIYRDTIAYLQYTSGSTRNPAGVQITYEAVGTNVIQMIHALDLNENS
FT                   RGVTWLPMFHDMGLLTVILPALGGKFITIMSPSAFVRRPGRWINELAAVEDGAETFAAA
FT                   PNFAYEHAAARGLPKEGETLDLSNVKGLINGSEPVTVSSMKKFNDAFAPYGLSPKAIKP
FT                   CYGMAEATLFVSSTPVENEARVVYVDRDSLAAGTFVVADENAEGAVPQVSCGDVALSQW
FT                   ACIVDPETGKELPDDSVGEIWLHGMNIGSGYWERAEESRETFQNYVTPLSEGTHSAGVK
FT                   NLEKARWLRTGDFGVYHDGELYITGRVKDLVIVDGRNHYPQDIEFTAQESNTKYIRTGY
FT                   LAAFSVPANELPQAVFENAHSGLTYDPNDQSEQLVIVAELGAGGAKQDQQALADGIRSA
FT                   VGAAHGVLARDILLVPGGSLPRTSSGKIARRAGRAAYIDGTLRGGYTQQAFPDAEANNV
FT                   Q"
FT   gene            182483..187597
FT                   /locus_tag="Tpau_0175"
FT   CDS_pept        182483..187597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0175"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: Beta-ketoacyl synthase ; Acyl transferase;
FT                   Thioesterase; phosphopantetheine-binding; KEGG:
FT                   rha:RHA1_ro04065 polyketide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76829"
FT                   /db_xref="GOA:D5UQJ6"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQJ6"
FT                   /inference="protein motif:PFAM:PF02801"
FT                   /protein_id="ADG76829.1"
FT                   /translation="MAENEYTPHEGPTGKAREDLSLEELRAWMRQWIADATKQPVENIT
FT                   DDKSLDEFGLGSRDAVSMASDIEDFTGVQLTATVAFQHPTIALLSQRIIDGDPVVSDDD
FT                   LAAEAAQYDRGEEFEANRGTHDVAVVGLATRFPKAGETPESTWEFLIGNGDATTDLPED
FT                   RWLEFKQDPRLKAVLDEANTFGGYLDDVASFDAEFFQMTPREVEMVDPQQRLALELTWE
FT                   ALEQANIPPSSVKGTRTGVWMGSSANDYQMLAVADPTKANPYALTGTSTSIVANRVSYF
FT                   YDFHGPSVAVDTACSSSLVAIHQAIRSLRDGETDMAVAGGVNMLIVPAATLGFDSLGAQ
FT                   APDGKIKAFSSDANGMIRAEGGGVVLLKRLADAERDGDDILGVIAGSAVTSDGKSNGIF
FT                   APNPEAQVINLRDAYIDAGIDPRTVDYLEAHGTGTILGDPLEADAIGRVLGRGRDAEKP
FT                   LLLGSAKTNFGHLEAAAGIAGVAKVLLSIRNGQIPASLNFAGPNPYIQFEANRLLMAAR
FT                   NTEWPRYSGHRIAGVTGNGFGGTNAHVVITEYIAPEIVEGETEADAADSADPNAVPEFY
FT                   AATADGVAVPLVLTAYVPSRRRAAAAELLEWLESDEATQYSLAEIGRTLASRNHGRVRS
FT                   VVLAKDLDEAIKGFRAIAEGKNAPNVISANQPDATGPAFIFSGFGSHHRKMAKQLYLEN
FT                   PVFKHYFDEVNELIIDESGDDYAEMITDDAQTFHIETGQVGIFAIQVALVGLFRHHGIE
FT                   PGVVLPHSMGEATAAWLTGGLSLEDAVRVICNRSRLMGEGEAMLPEEMERFMALVEYSA
FT                   DDIDTVLGEYEGLEICVYAAPTHTVIGGPGKVIDQIVAETEAKGLMARKLVTRGASHTS
FT                   QMDPLLGELQAELMGIEPHPLKYPMYSTVNKEEFYRAGHAPVHDVDYWIKGLRHSVWFT
FT                   QAVEKAVEAGYRTFIEFSPNPITLISVAAVTFGSGIQDAALVQTLKRKEDEPGTIMTAL
FT                   ATVFAHGHHVDVASLFGPGRYAPVPRTKFQRKHIWIQTKLPDGGSGMVPGAHVALPDGR
FT                   HVWQLDAGALTLGDQTRISLVDLAKNAAVQVLDGAAVTAAVEHGEAADGNTLTTTLTPH
FT                   PGGASIQVHENTGTGFRLLLDAVVVGGEASGSAAAPLITKAAPAAIADDADDALDAEPA
FT                   IAVSEETEAPAPEGSSTERWSPESGETVEHRLGVIIAETMGFEIEDLPKEIPLIDLGMD
FT                   SLIAMRIKNRAEYEFDIPPIQIQAVRDASFNDVVQFVEYAVEHRDQVDALAEHQSGTGE
FT                   MADAGKLAEMMQAAKDEAAAKASAPESAPESEPAAPSEPETGSDAPDLLDGAAVAEAIG
FT                   DGVPPRDAAERLTFATYAIVVGRSPGGVFNELDVLSEDVAEKLTARLSERAGGEVDIED
FT                   VIDSKNIEEMATYVGAVMNEATPVDGFVRTLRKPENTNRKPLFLFHPAGGNTTAYEALL
FT                   RKLPQDLPVYGFERVEGEVEDRVREYLPKLKQIQPEGPYRLAGWSLGGAFAYGLGRALE
FT                   DEGQQVEYIGLLDVVAPTVPLTDEPAEKKARLQRWETFARKNYDIGSEIELPMDRLEAA
FT                   DDEGQFKIIMELVQLSDKKVPTSMIEHQRTSFIDNRMLIKVNPADYGRFEGKVTLYRAD
FT                   RMHDGAVELEPNFADIAPDGGWAPVVEDLEIVKIGGDHLQIIDEPYIGKIATHMSAELE
FT                   RADAERS"
FT   gene            187610..189193
FT                   /locus_tag="Tpau_0176"
FT   CDS_pept        187610..189193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0176"
FT                   /product="carboxyl transferase"
FT                   /note="PFAM: carboxyl transferase; KEGG: rha:RHA1_ro04066
FT                   propionyl-CoA carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76830"
FT                   /db_xref="GOA:D5UQJ7"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQJ7"
FT                   /inference="protein motif:PFAM:PF01039"
FT                   /protein_id="ADG76830.1"
FT                   /translation="MADVTDVTEQVDTPDLHTTAGKLADLHRRLEAASDPGSERAKARR
FT                   DAKGLPSARQRMHMLFDEGTFVELDQLAKSPGDDKIKDGVVIGYGLVNGRKVAAFSHDQ
FT                   TVGAGTVGEMFGRKMVKLYDFAATAGLPVVGINDSGGARIQDAATSIAWYAELGRHQDG
FT                   LCGQVPQISMILGTCVGGAVYAPANTDVLVGVEDNTYMFVTGPEVIRPTTGEMTSAEDL
FT                   GGAVKQATWGNLHHVAKDEQAAFDWVKRYLGFMPDSVHQRPPLVNPGIEPELTDTDLSL
FT                   ESIIPDADNAGYDIHDVILRVFDDGDFLEYAELWAPNIVCGFARSDGQSVGVVANQPMH
FT                   MAGTLDTQASEKAARFVRLCNSFNIPLVFLVDVPGILPGVEEEKIGTIRRSGKFIFSYV
FT                   EAAVPKVTIILRKSYGGAWAVMGSKQLGADFVFAWPTARLAVMGAEGAAAIIKRREIEE
FT                   AGENGPAIRQAFIDFYNQFMATPWLAAERGYIDGVIEPRGTRLLIRKCLRQLQDKELQR
FT                   VPRRTYLMPM"
FT   gene            189196..190545
FT                   /locus_tag="Tpau_0177"
FT   CDS_pept        189196..190545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0177"
FT                   /product="D-lactate dehydrogenase (cytochrome)"
FT                   /EC_number="1.1.2.4"
FT                   /note="KEGG: rer:RER_51320 FAD-linked oxidase; PFAM: FAD
FT                   linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76831"
FT                   /db_xref="GOA:D5UQJ8"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQJ8"
FT                   /inference="protein motif:PRIAM:1.1.2.4"
FT                   /protein_id="ADG76831.1"
FT                   /translation="MPSLESFPQLTGAVLTDPDVTAAYATDHCSPVFGAVPLAVVLAET
FT                   TEDVAAAARWCYANDVVMVPRGAGSGLAGGASAIEGCVIISLAKMDAILEINVADQYAR
FT                   AEAGVINAHLDAAAREVGLMYPPDPSSYEICSIGGNVATNAGGLRCVKYGVTREYVLGL
FT                   TVVLPDGRIITTGRRTVKGVTGYDLTQLLCGSEGTLGIVTEVTVKLRPAPLIAPTTVAA
FT                   SFPDVVSAASAVAAVVGTGVVPALMELMDRGTLECVEAMRPFGLEDETRAMLIGQGSTP
FT                   EDAAVLAREFDAAGAHYVVVSDDPAEAAELLSVRRAAFHAYEYAGNMFSEDVGVPRSKL
FT                   PEMFARIEEIAAKYQVAIPTCAHAGDGNLHPTLIYSRELTEVPQAIWDAADEVFQAALD
FT                   LGGTLTGEHGVGVLKARWVGDELSDDVLELHRGIKAVWDPKNLLNPGRGF"
FT   gene            complement(190740..191225)
FT                   /locus_tag="Tpau_0178"
FT   CDS_pept        complement(190740..191225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0178"
FT                   /product="putative GAF sensor protein"
FT                   /note="PFAM: GAF domain protein; KEGG: xfn:XfasM23_0503
FT                   putative GAF sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76832"
FT                   /db_xref="InterPro:IPR000614"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQJ9"
FT                   /inference="protein motif:PFAM:PF01590"
FT                   /protein_id="ADG76832.1"
FT                   /translation="MSFSVPELSGSPAERYAELAGFASALIDGEPDRVANAANLSALVK
FT                   ATVPDLNWVGFYFFDGTELVVGPFQGLPACIRIPLDRGVCGAAARTGRTQRVDDVHAVA
FT                   DHIACDGATNSELVVPLVRDGELIGVFDLDSEKPARFTDDDQRGLEAIAAVYLDSLR"
FT   gene            191588..192571
FT                   /locus_tag="Tpau_0179"
FT   CDS_pept        191588..192571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0179"
FT                   /product="putative esterase"
FT                   /note="PFAM: putative esterase; KEGG: rop:ROP_50250
FT                   mycolyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76833"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQK0"
FT                   /inference="protein motif:PFAM:PF00756"
FT                   /protein_id="ADG76833.1"
FT                   /translation="MRMRNGWAKRATAAAITVAAIPALAGGIGSIGAANAWGPGNAKNP
FT                   PKGFKQAFVNGAGMPNVKVRSWASTTTDPKKAPTVVLLDGLRATWDVSGWERDSNVAFL
FT                   SQKGINVVTPVGGTSSWYADWQNPSSTNRQPYRYTWASFLKTSLPQYIRSLGFSDNVSL
FT                   IGLSMSGSAALINTIESNGYYKRAASLSGLVNISAPGIPIAVGIASLDSGGYNAGLDMW
FT                   GGPLDSRWAKNDPTVQVGRFKNIPLWISAGNGVFGKYTPNPGPADVIQGVPLEWLALSQ
FT                   ARSFEGATKRAGLTKTHFDFPPAGTHTWGYWQDQVWQMQRTGWFTK"
FT   gene            192884..193849
FT                   /locus_tag="Tpau_0180"
FT   CDS_pept        192884..193849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0180"
FT                   /product="putative esterase"
FT                   /note="PFAM: putative esterase; KEGG: rop:ROP_50250
FT                   mycolyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76834"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQK1"
FT                   /inference="protein motif:PFAM:PF00756"
FT                   /protein_id="ADG76834.1"
FT                   /translation="MRAAWGKRAGAAAVTVAMVPALAGMGAGVAGAWGPGSAKNPPKGF
FT                   KSERVNGAGMPDVLVRSWASTTTDPAKAPTVVLLDGLRATQDVSGWERDSNAAFLSEKG
FT                   VNVVMPVGGTASFYTNWANTSRHGNGTYKATWGNFLATSLPAYIKSRGFSDNLSLVGIS
FT                   MGGGAALINAANNPGVYKRAAALSGFLNTSAPGMPVAVGVAMLDAGGYNVLDMWGGPLD
FT                   ANWAKNDPTVQAARLKGIPVWITASTGEPGKYTPNPSPADIVQGVPLEILAKSQSEAFK
FT                   AAADKAGVKGHYDFSAVGTHTWGYWSDQVWQMQRTGWFNS"
FT   gene            194055..194900
FT                   /locus_tag="Tpau_0181"
FT   CDS_pept        194055..194900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0181"
FT                   /product="HpcH/HpaI aldolase"
FT                   /note="PFAM: HpcH/HpaI aldolase; KEGG: mgi:Mflv_4009
FT                   HpcH/HpaI aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76835"
FT                   /db_xref="GOA:D5UQK2"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQK2"
FT                   /inference="protein motif:PFAM:PF03328"
FT                   /protein_id="ADG76835.1"
FT                   /translation="MNAAQPERFDAAARSRTDIVVLDIEDAVAPKDKVAARTNVVDWLN
FT                   SENDGVPNSGWVRVNGFGTQWWADDLEALRGAQHLGGIMLAMVESMDHVTETAKRLPDT
FT                   LIVALVETARGLERISEIASAKGTFRLAFGIGDFRRDTGFGGDPTTLAYARSRFTIAAK
FT                   AAHLPGAIDGPTVGSKGLLLSEATAVSAEFGMTGKICLTPDQCHPVNEGLSPSPEDIRW
FT                   SREFFAEFDRDGGEIRNGSDLPRIARATKILDLARAYGIEVSDGLEGEHAPAPSDTFHY
FT                   "
FT   gene            complement(194953..195345)
FT                   /locus_tag="Tpau_0182"
FT   CDS_pept        complement(194953..195345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0182"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: mjl:Mjls_0601
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76836"
FT                   /db_xref="GOA:D5UQK3"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQK3"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADG76836.1"
FT                   /translation="MIDHFGINCADLDAAKRFYDGVLATVGARRLMDFDVAVGYGTEQP
FT                   VFWISGAAAGTSNREAHIAFAAPDAATVDEFHRIALELGAQSLHAPRLWPEYHPGYYGA
FT                   FVRDADGNNVEAGLPRRRVSARETAA"
FT   gene            complement(195428..197104)
FT                   /locus_tag="Tpau_0183"
FT   CDS_pept        complement(195428..197104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0183"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /note="KEGG: mgi:Mflv_0749 phosphoenolpyruvate-protein
FT                   phosphotransferase; TIGRFAM: phosphoenolpyruvate-protein
FT                   phosphotransferase; PFAM: PEP-utilizing protein;
FT                   PEP-utilising protein mobile region; PEP-utilising protein
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76837"
FT                   /db_xref="GOA:D5UQK4"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQK4"
FT                   /inference="protein motif:TFAM:TIGR01417"
FT                   /protein_id="ADG76837.1"
FT                   /translation="MSSQQSTVTVLAGTAVVPGVAYAPVMWPGERPELPAVGGELPETE
FT                   RDAEAVRLSSAARTVAGRLRERASQATGAASEVLAATAGLASDKAWLSAAEKLIRSGSP
FT                   AEGAVAAATEQFADMFTTIGGLMAERVTDLRDVRDRVLAELLGRPEPGVPTPTAPSVLL
FT                   ADDLAPADTAGLDPALVVGIGTRLGGPTSHTAIIARQLGIPCIVGLAEAGTVEAGTLVL
FT                   LDGAEGTVTVAPPADGARARVAEAMRMAEDVARWRGPGRTSDGTAVAILANVQDGPSAR
FT                   TAAERQVEGVGLFRTELAFLNRADEPSVDEQQALYREVIDAFPAGKVVIRTLDAGSDKP
FT                   LKFIDHGHEDNPALGIRGIRIAATDPGLLERQLDAIAAAATGAAEAPWVMAPMIATAAE
FT                   ARSFAAQCRARGLTPGVMIEVPAAALCAEAVLAEVDFVSVGTNDLTQYAMAADRMSSEL
FT                   AALTDPWQPAVLRLIRLTADAGAGAGKPVGVCGEAAADPLLACVLVGLGVTSLSCAAGA
FT                   AAAVGARLGGVTLQQCRWAAEAAVASADPQAARDAARRALS"
FT   gene            197207..197977
FT                   /locus_tag="Tpau_0184"
FT   CDS_pept        197207..197977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0184"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="KEGG: mjl:Mjls_0072 DeoR family transcriptional
FT                   regulator; PFAM: regulatory protein DeoR; Helix-turn-helix
FT                   type 11 domain protein; SMART: regulatory protein DeoR"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76838"
FT                   /db_xref="GOA:D5UQK5"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQK5"
FT                   /inference="protein motif:PFAM:PF08220"
FT                   /protein_id="ADG76838.1"
FT                   /translation="MYAEERQRAISDLVAARGRASVTELAERYDVTPETVRRDLDALER
FT                   LGGVRRVHGGVVAAGVLAGAESGVGEREVLSAEAKRAIGEAARAFLPPAGGSVLFDAGT
FT                   TTIAAAREIPAGHRLAAVTNSLAVATTLAGRDGVELRMLGGRIRGLTQAAVGAGTVAEI
FT                   AGLHADVAFLGTNGLSARRGLSTPDAEEAAVKSALLNAADVVVLLADASKFDHESLVSV
FT                   GALDRIDALVTDVAPVGELGAALAEHDVTVVVAP"
FT   gene            197974..198945
FT                   /locus_tag="Tpau_0185"
FT   CDS_pept        197974..198945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0185"
FT                   /product="1-phosphofructokinase"
FT                   /note="KEGG: mkm:Mkms_0090 ribokinase-like domain-
FT                   containing protein; TIGRFAM: 1-phosphofructokinase; PFAM:
FT                   PfkB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76839"
FT                   /db_xref="GOA:D5UQK6"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQK6"
FT                   /inference="protein motif:TFAM:TIGR03168"
FT                   /protein_id="ADG76839.1"
FT                   /translation="MIVTVTANPSLDRLIALGAPLRRGAVHRAEATVADPGGKGVNVSR
FT                   AVHVAGEPTVAVLPADAGDPLLLALGRLGVPARAVPSGCEIRSNITIAEPDGTTTKLNS
FT                   PGAELGPAVARALEDAIVAAADGAAWVALCGSLPPGLPDDWYARIVERLAGGPRIAVDT
FT                   SGPALAAVADAGVDLLKPNAEELAELVGVGDQDFEHRVAAGDLEAARVAAEELHRRSGA
FT                   AVLATLGAAGALLVDGGTWFATPPPTTVRSTVGAGDSALAGYLLGHTAGEPAPARLRLA
FT                   VAYGSAAAALPGTRAPRPDQLATADVRLRPLETASPEEPETS"
FT   gene            198942..200963
FT                   /locus_tag="Tpau_0186"
FT   CDS_pept        198942..200963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0186"
FT                   /product="PTS system, fructose subfamily, IIC subunit"
FT                   /note="KEGG: mkm:Mkms_0089 PTS system, fructose subfamily,
FT                   IIC subunit; TIGRFAM: PTS system, fructose subfamily, IIC
FT                   subunit; PTS system, fructose subfamily, IIA subunit; PTS
FT                   system, fructose-specific, IIB subunnit; PFAM:
FT                   phosphotransferase system PTS fructose- specific IIB
FT                   subunit; phosphotransferase system EIIC;
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system EIIA 2"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76840"
FT                   /db_xref="GOA:D5UQK7"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQK7"
FT                   /inference="protein motif:TFAM:TIGR01427"
FT                   /protein_id="ADG76840.1"
FT                   /translation="MTEPIITPELVALDIAAGTEKSEVIGYLAHRIAEAGRAHAVDALI
FT                   EAALAREGQSATGLPGGIAIPHCRTASVTAASLAFARLDPRVDFGAPDGPADLVFLIAA
FT                   RESGGSQHMKLLSALARALVRPEFVASLRTASTPEEVVALVDEVITPASPAPKPAPADP
FT                   PAAPPAKRPAVIAITACPTGIAHTYMAADALKLAAERAGVDLTVETQGSSGSSPLSAQT
FT                   IAEAGAVIFATDVGVKGRERFAGKPVVTSGVKRGINEPDAMIAEAVAAASDPRAAIVDG
FT                   DAATTAESAPAHAGLGGELKRALLTGVSYMIPFVAAGGLLMALGFLMAGYEIGSEHGSD
FT                   GVSNGAYFALHNSLWNLPDGGMLQYLGGVSFAIGQAAMTLMVPVLAGYIAYAIADRPGL
FT                   APGFVAGVLAGTVGAGFIGGVVGGLLAGVVALWLSRIPLPQWARGLQPVVIIPLLGTLI
FT                   TGGLMYMVLAGPLRWVNESMTSALNGMSGSSKIALGAVLGLMMCFDLGGPVNKAAYAFG
FT                   VAGIGLSTAGVPQWEIMAAVMAAGMVPPLALALATFVRPGLFTEPERENGKAALPLGLC
FT                   FISEGAIPFAAADPLRVIPTMMLGGAVTGGLSMALSAQLRAPHGGVFVMFATNGTWWKF
FT                   LVALAVGVIVSAAAVVTAKAVWRRDAPVESPQPAAVAA"
FT   gene            201026..201283
FT                   /locus_tag="Tpau_0187"
FT   CDS_pept        201026..201283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0187"
FT                   /product="Phosphotransferase system, phosphocarrier protein
FT                   HPr"
FT                   /note="KEGG: mjl:Mjls_0069 phosphotransferase system,
FT                   phosphocarrier protein HPr; TIGRFAM: phosphocarrier, HPr
FT                   family; PFAM: phosphoryl transfer system HPr"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76841"
FT                   /db_xref="GOA:D5UQK8"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQK8"
FT                   /inference="protein motif:TFAM:TIGR01003"
FT                   /protein_id="ADG76841.1"
FT                   /translation="MPSTTVTVGSAVGLHARPAAVIANAVNESGHDVTLSVAGGDPVDA
FT                   GSALMIMTLGAEQGVEVTVESGDQATVDAIAALVAQDLDA"
FT   gene            complement(201303..201929)
FT                   /locus_tag="Tpau_0188"
FT   CDS_pept        complement(201303..201929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0188"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ami:Amir_0454 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76842"
FT                   /db_xref="GOA:D5UQK9"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQK9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76842.1"
FT                   /translation="MSTQIFEHAQPRLAALRRRCDAAMGRLRGGIDEVRPTTGWRVLTS
FT                   VVYSGLIAVVIVGAAVLLLGVKPAGPAISNVSAVEVGDCVTVSDGKADRAGCDATGMTF
FT                   SVAEKVAAKTACSLGSYARVESEGATLCVVPNMTLGNCYQVRPDQSATTDIRPVTCPTG
FT                   LGGAAPANVVRVTERASGGPLNCRGTAALNYPAPQPVSYCIAPAS"
FT   gene            202037..202954
FT                   /locus_tag="Tpau_0189"
FT   CDS_pept        202037..202954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0189"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; KEGG: rer:RER_37880 dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76843"
FT                   /db_xref="GOA:D5UQL0"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQL0"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ADG76843.1"
FT                   /translation="MPQDGPVIAVGPTPDPEFDAAITRGGGVPGPLAGAEGLVWIDSTT
FT                   VPTDIPDSVRWVQLPFAGIENFVGSGLLEHYPGITFSSAAGAYSTTVAEHALSLLLAGV
FT                   RGLWHRESEWDAKGAAPRVGLLGGSTVAIVGAGGIGRDLAPQLRALGVSVIAVNRSGSD
FT                   VTGAVVVTADKLDEVWSQVDHVVLAAPATAETRSLVDASVLAQLKPHSWVINVARGALI
FT                   DTDALVDALRRGAIGGVGLDVTDPEPLPGDHPLWSIPNAIITPHVANPPQHLRPALLDR
FT                   VEINVRRVANGLQPLAVVDRAKGY"
FT   gene            202954..203472
FT                   /locus_tag="Tpau_0190"
FT   CDS_pept        202954..203472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0190"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="KEGG: sma:SAV_1295 MarR family transcriptional
FT                   regulator; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76844"
FT                   /db_xref="GOA:D5UQL1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQL1"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADG76844.1"
FT                   /translation="MPGADGATPGPATRDDIDLIIRGMVGFAKRIRSEARFLHSEVSYV
FT                   DFTLLFVLNETPGLRAVDLAEAVSIDKSTASRQLASLERRGLIRRDSVPSSPRSRSLRL
FT                   TERAESVLADTDREWRRRIEERTADWPAEDVRAFATLIDRYMDTELPGDAAEPGLSGRS
FT                   DAGHQPTGQ"
FT   gene            203697..205223
FT                   /locus_tag="Tpau_0191"
FT   CDS_pept        203697..205223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0191"
FT                   /product="NAD(P) transhydrogenase, alpha subunit"
FT                   /note="KEGG: mva:Mvan_0120 NAD(P) transhydrogenase subunit
FT                   alpha; TIGRFAM: NAD(P) transhydrogenase, alpha subunit;
FT                   PFAM: alanine dehydrogenase/PNT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76845"
FT                   /db_xref="GOA:D5UQL2"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="InterPro:IPR026255"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQL2"
FT                   /inference="protein motif:TFAM:TIGR00561"
FT                   /protein_id="ADG76845.1"
FT                   /translation="MIIGVLKEAQPGETRAAGTPTTVAQLIKLGYQVVVDSGAGEASSF
FT                   SDDAYVEAGASIGDARAADVVLGVNAPSAAQLDGIRPGASLVSILAPGLNPDLLADLRG
FT                   RGITALAMDAVPRISRAQSMDVLSSMANIAGYRAVVEAAHVFGRFFTGQVTAAGKVPPA
FT                   KVLIVGAGVAGLAAIGAAGSLGAIVRATDPRPEVADQVASLGGEYLSIADEESEVSATG
FT                   YAKEMDDDYKAREAQLYADQCKDVDIIVTTALIPGRPAPRIITEEMVASMKPGSVIVDM
FT                   AAQNGGNVAGTVKDQAIVTENGVTIIGYTDLAGRLPAQASQLYGTNVVNLLKLLTPEKD
FT                   GELVLDFEDPVQRSITVTRDGEILWPPPAVSVSAAPQAAPAAQAQAQPEKQPMATSTKV
FT                   GLTLFGIALLFVVNAFAPDPIPRHFTVLVLAIVIGYYVIGKVHHALHTPLMSVTNAISG
FT                   VIVVGAIIQVGLNNTAIQALAGVAILLASINVFGGFAVTRRMLTMFSKGA"
FT   gene            205225..206646
FT                   /locus_tag="Tpau_0192"
FT   CDS_pept        205225..206646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0192"
FT                   /product="NAD(P)(+) transhydrogenase (AB-specific)"
FT                   /EC_number="1.6.1.2"
FT                   /note="KEGG: msm:MSMEG_4108 NAD(P) transhydrogenase, beta
FT                   subunit; PFAM: NAD(P) transhydrogenase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76846"
FT                   /db_xref="GOA:D5UQL3"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQL3"
FT                   /inference="protein motif:PRIAM:1.6.1.2"
FT                   /protein_id="ADG76846.1"
FT                   /translation="MSVESIATAAYLVAALLFILSLAGLSKHESARTGWLYGVIGMVIA
FT                   IAATVALALNKSEVAGTATVILVVTALIGAAIGLYRARVVQMTGMPELIALLHSFVGLA
FT                   AVLVGWASYLEVERGWIPGEAAHYTGGLLKIHHAEVFIGVFIGAVTFTGSIVAYLKLSA
FT                   KMKSAPLVLPGKNYINIGALVLFAVFTVWFVIDQQLWLLIAVTVIALLLGWHLVASIGG
FT                   GDMPVVVSMLNSYSGWAAAAAGFLLSNDLLIVTGALVGSSGAYLSYIMCKAMNRSFISV
FT                   IAGGFGIEAAPSEDQDYGEHTETNADSVAELLKNAKTVVITPGYGMAVAQAQYGVAELT
FT                   RELRKRGVTVRFGIHPVAGRLPGHMNVLLAEAKVPYDIVLEMDEINDDFADTDVVLVIG
FT                   ANDTVNPAAAEDPNSPIAGMPVLTVWEAENVIVFKRSMASGYAGVQNPLFFRTNSAMLF
FT                   GDAKDRVQDILAAIN"
FT   gene            complement(206711..207361)
FT                   /locus_tag="Tpau_0193"
FT   CDS_pept        complement(206711..207361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0193"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   ach:Achl_2748 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76847"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQL4"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADG76847.1"
FT                   /translation="MARIAIIGGHGKVALLLAQVLSARGDQVTSWIRNPEHAPDVTATG
FT                   ATPLVLDVENASRDEIANALAGNDAVVFSAGAGGGNPDRTYAVDRDAAIRSVQAAEQAG
FT                   VRRYLMVSYLGAAPDHGVPESDPFFHYAEAKAAADVAVRASDLDWTVLMPGRLTLDEPS
FT                   GRVDPAAERAADNPGTSRANVALVAASALDRPDTIGKDLPFTDGDVTIEQAWA"
FT   gene            complement(207406..208017)
FT                   /locus_tag="Tpau_0194"
FT   CDS_pept        complement(207406..208017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0194"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   kra:Krad_4013 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76848"
FT                   /db_xref="GOA:D5UQL5"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQL5"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ADG76848.1"
FT                   /translation="MTSALLAGLGLGLSLIVAIGAQNAYILQVGVRGRGIAPVVAVCIA
FT                   SDVALICAGVAGLGAAVSGRPAVLEAVKWAGTVVLIGYGLRSLWAARRADGLTAGGNTA
FT                   GSVAAVITAALALTWLNPHVYLDTVLLLGSASTRYGTDRWWFAAGAVIASIAWFGLLGF
FT                   GARRLAGTLGRPAVWRALNAGIGVLLLVLAARLATLPLGG"
FT   gene            208089..208982
FT                   /locus_tag="Tpau_0195"
FT   CDS_pept        208089..208982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0195"
FT                   /product="transcriptional regulator, ArgP, LysR family"
FT                   /note="KEGG: ach:Achl_0269 transcriptional regulator, ArgP,
FT                   LysR family; TIGRFAM: transcriptional regulator, ArgP
FT                   family; PFAM: regulatory protein LysR; LysR substrate-
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76849"
FT                   /db_xref="GOA:D5UQL6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017685"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQL6"
FT                   /inference="protein motif:TFAM:TIGR03298"
FT                   /protein_id="ADG76849.1"
FT                   /translation="MLSGQHLTTLVAVVEEQSFGAAAARLGITQSAVSQRIRALEQRVG
FT                   HVVVTREGPCRPTDQGSVLLGLARGVATLEAEALGRLADGAGPAPVLDVGVNADSLATW
FT                   FGSVIAAAAGWGDGTRLRLQVDDENPTADLLRAGAVLGAVTTDPEPVQGCAVEYLGYMR
FT                   YLPVCTPEFARRWNRGGWWRWREMPVVQFDLRKDDLQNRVLRWHGVTADPGTVDYPPAH
FT                   RIPSSEGFAHAVRVGLGWGSLPEAQLGDALDRGDLVRVGERPVDVKLFWQSWRLHTRAT
FT                   GRLTDAIHAAAAVDLR"
FT   gene            209019..210491
FT                   /locus_tag="Tpau_0196"
FT   CDS_pept        209019..210491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0196"
FT                   /product="phosphoesterase PA-phosphatase related protein"
FT                   /note="KEGG: mgi:Mflv_0311 phosphoesterase, PA-phosphatase
FT                   related; PFAM: phosphoesterase PA-phosphatase related;
FT                   diacylglycerol kinase catalytic region; SMART:
FT                   phosphoesterase PA-phosphatase related; diacylglycerol
FT                   kinase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76850"
FT                   /db_xref="GOA:D5UQL7"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQL7"
FT                   /inference="protein motif:PFAM:PF01569"
FT                   /protein_id="ADG76850.1"
FT                   /translation="MAESAIRSLRRGFSELDGKLFDAVADSSSPLLDHTMRPLSAAADH
FT                   SVLWMAIAAGMSTGGLSLRRGAVRGLASLAVTSLVVNQGLKRIYPRARPAFAGVPVKRA
FT                   RRQPTSNSFPSGHAASAAAFAVGVGLENHSAGYLLGALAAAVGLSRVATGAHYPADVLA
FT                   GFAVGAGIAAAGARLVPPVDEGCSTTPAPTVEQVRPAPDGAGLVVILNPSSGDGTGRRV
FT                   ANELRAALPGAEIVELEPGADVAAIAAEAASRAEFLGVAGGDGTVATVAAQAVAADTPL
FT                   AVFPAGTFNHFAKDIGSDTVSAAVDFLRRGMVTRVDVVWLNEEKMLLNTASIGAYPEFV
FT                   RTRSRLQRRRIGRPSATVRAILKVLRNSAPVRVRIGGRPVTVSFFFLGNSQYGAAGFVP
FT                   GRRSRLDDGMLDVRYLEDGHRNAAARLLLSWLSGRITTSKIYREVQAPEVTIEADRPFR
FT                   VAHDGEAGDLHTRAHFRVGHRALRVFGRSEVG"
FT   gene            complement(210488..211297)
FT                   /locus_tag="Tpau_0197"
FT   CDS_pept        complement(210488..211297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0197"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mgi:Mflv_0488 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76851"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQL8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76851.1"
FT                   /translation="MALAFALVGVVSAAGCGLTPSSRPSSPEPSRFTRTEAAATTPSVA
FT                   PYAVDAPGRTVAVAPRPTTGAGITTFADSFGFYASVCTLGFFARYPNGQVVAFTAGHCA
FT                   DLARQARPDDAPVARYLTSASRSTAFGEYIKATRTRRGQDIAIIQVLGADVRAVADAIG
FT                   PVTGYSTAAELRDGRPEICIVGARTGRSCGVFDTIDGRRVTWAGTPAVEGDSGGPVYAR
FT                   WPDGTFTAVGVVNSVHTRADGTGTGGGSGTLVADDILANSMTLMGTT"
FT   gene            complement(211336..212199)
FT                   /locus_tag="Tpau_0198"
FT   CDS_pept        complement(211336..212199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0198"
FT                   /product="peptidase S58 DmpA"
FT                   /note="PFAM: peptidase S58 DmpA; KEGG: fal:FRAAL5354
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76852"
FT                   /db_xref="InterPro:IPR005321"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQL9"
FT                   /inference="protein motif:PFAM:PF03576"
FT                   /protein_id="ADG76852.1"
FT                   /translation="MPASLVVTIPGVRIGHHTDAAARTGCTVVILPDGTVGSGEVRGGA
FT                   PASREFDLLSPERSVGEIHAAVLTGGSAFGLACADGVMRRLEEEGRGVQTVAGRVPIVP
FT                   TLGLFDLMVGDSAVRPTAENGYTAAASAAHDAEVNGLIGAGTGATVGKSRGIDGIRDAG
FT                   LAYAEARSGALIVGALCAVNAFGDVLTGAAADPGLGDYAPFATPGERENTTIGVVLTNA
FT                   RLTKSECLILAQGAHDGLARAIDPPHTRFDGDAFISAATGQVDAKIDLVRALAIGAVTE
FT                   AIRSRA"
FT   gene            complement(212210..212596)
FT                   /locus_tag="Tpau_0199"
FT   CDS_pept        complement(212210..212596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0199"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro00326 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76853"
FT                   /db_xref="GOA:D5UQM0"
FT                   /db_xref="InterPro:IPR035197"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQM0"
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro00326"
FT                   /protein_id="ADG76853.1"
FT                   /translation="MTDLHRPDPLHYLAWVYTGKLPAKNRSWVRHTLTCRTWVARHLAR
FT                   GQLAMVPVYGLLLLLPGPVGLRAATVLLGVLLNAFYNAAYIRPNRARRLEKNGLDPALE
FT                   NPHAVERRAATRLAYESAHAAERA"
FT   gene            complement(212597..213076)
FT                   /locus_tag="Tpau_0200"
FT   CDS_pept        complement(212597..213076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0200"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="KEGG: rer:RER_45540 MarR family transcriptional
FT                   regulator; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76854"
FT                   /db_xref="GOA:D5UQM1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQM1"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADG76854.1"
FT                   /translation="MTDSDAPTVDGDPLALERQVCFALAVANRAVLSVYRPILAPMGLT
FT                   HPQYLVMLALWGAAPMSVKEIGEALQLDSPTLSPLLKRLEAQGLITRSRAAHDERQIDV
FT                   DLTDAGRALREQALNVPPAVIERLGASLSELEDLHRVLTTINARALAAGALERET"
FT   gene            complement(213125..215461)
FT                   /locus_tag="Tpau_0201"
FT   CDS_pept        complement(213125..215461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0201"
FT                   /product="DNA polymerase LigD, polymerase domain protein"
FT                   /note="KEGG: mav:MAV_1056 ATP-dependent DNA ligase;
FT                   TIGRFAM: DNA polymerase LigD, polymerase domain protein;
FT                   DNA ligase D, 3'-phosphoesterase domain protein; DNA
FT                   polymerase LigD, ligase domain protein; PFAM: ATP dependent
FT                   DNA ligase; DNA primase small subunit; ATP dependent DNA
FT                   ligase domain protein; mRNA capping enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76855"
FT                   /db_xref="GOA:D5UQM2"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014144"
FT                   /db_xref="InterPro:IPR014145"
FT                   /db_xref="InterPro:IPR014146"
FT                   /db_xref="InterPro:IPR033649"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQM2"
FT                   /inference="protein motif:TFAM:TIGR02778"
FT                   /protein_id="ADG76855.1"
FT                   /translation="MAQTRENREVDGVHVQLTNLDKVLYPATGTTKAEVIDYYQAIAPV
FT                   AVPHLRDRPLTRKRWPNGVDKTAFFEKRLPSHAPAWIRRGAQHHSDGESLYPVVENTAD
FT                   MVWLGQQAALELHVPQWTFIADGENEEPGPPDRLVLDLDPGPGSTLDDCAALALRIRDL
FT                   LAAMGLDGHPVTSGSKGMHIYSTLPGGLSSPGARKVAHAIASQLEAESPELVTASMSKD
FT                   QRGGRIFVDWSQNSGSKTTISPYSLRGREHPWVAAPRSWDELSRPGLQQLEFHDVLARV
FT                   RTSGDLLAPLLSGTPAPPEPVDLDEYRAKRDAAKTPEPFGGAASTGDPIFVIQEHHARR
FT                   LHYDFRLEHDGVLASWAVPKNLPDDPAVNHLAVRTEDHPMDYAAFEGSIPKGEYGGGDV
FT                   SIWDHGTYELEKWRKDEVIVTLHGARLRGLRYALIRTGEKNWLAHLTKDKTAPAKAAAA
FT                   QAPDPMLPSESTIDRLSGEDWAFEGKWDGYRIMATVRGGALSLRTRSGRVVTGEFPEFE
FT                   SLARDLDGMDVVLDGEAVVLDDAGVPSFHLMAGGESRTGAVRLYLFDVLELNGVDLTKR
FT                   PWSVRREVLESLAPLLDSDDSIGVPALVEASTGLVAATLSAERGWEGIVAKRRDSPYLP
FT                   GQRVRAWLKHKNWRDLQVAIGGWKPGKGSRANRIGSVLVGLPAETGLVYLGSVGSGLRD
FT                   RDLDALAQRLEPLRMKRSPFTASIDDPDARDAVWVLPQVVGDVRYSSLRRGGHLRQPSW
FT                   RGFRDDLLPGDLPGEAEIPWEGPDE"
FT   gene            215644..216480
FT                   /locus_tag="Tpau_0202"
FT   CDS_pept        215644..216480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0202"
FT                   /product="Ku protein"
FT                   /note="TIGRFAM: Ku protein; PFAM: Ku domain protein; KEGG:
FT                   mav:MAV_1050 Ku protein; SMART: Ku domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76856"
FT                   /db_xref="GOA:D5UQM3"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQM3"
FT                   /inference="protein motif:TFAM:TIGR02772"
FT                   /protein_id="ADG76856.1"
FT                   /translation="MRAIWTGELSFGLVNVPVKVYSAIESHDAKSHQVDAKDGVRIRYK
FT                   RVREGTDDEVEFANIANAYEADSGDTVILSKEDIKSMPVEKHREIAVTEFVPREDVDPI
FT                   MFDKPYYLEPSSKSPKAYVLLRQALQETDRLAICTFTLRNRTRLCALRVVGNVMVLQTL
FT                   LWPDEIRTPDFPALTEDVKIRPQELAMAASLIDSMSTDFDPEQYEDDYQVQLQQLIEAK
FT                   STGETAFPDAPEDEGDEDDEVADLLAALRASVKSRESAKPAAETKKPARTRKREAS"
FT   gene            complement(216477..217037)
FT                   /locus_tag="Tpau_0203"
FT   CDS_pept        complement(216477..217037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0203"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mva:Mvan_1927
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76857"
FT                   /db_xref="GOA:D5UQM4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR041347"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQM4"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG76857.1"
FT                   /translation="MGRWQPDARARLESAALEEFGERGYDTVTVAEIAARAGLTERTFY
FT                   RHFADKREVLFAGQDVLRDLLVERTAEALASAPPWAALERAFTAAAEAIAARDELPLRR
FT                   QTVVEANQALRERELYKLDLIARSLGALLAEHGADGARTLGEASVAAFKVAFEEWVRVP
FT                   GAAPLTQRVAASFATLRRGVAAR"
FT   gene            complement(217064..217945)
FT                   /locus_tag="Tpau_0204"
FT   CDS_pept        complement(217064..217945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0204"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; dTDP-4-
FT                   dehydrorhamnose reductase; Male sterility domain; KEGG:
FT                   acp:A2cp1_1649 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76858"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQM5"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADG76858.1"
FT                   /translation="MRYLVTGASGFVGTAVTAELIAAGHEVRGLVRSDRAAEAIRSLGA
FT                   EPVLGTIEDTDLLRAAAAASDGVVHLAFNHDFSRFEESARVERGAIEAFGTALEGSDRP
FT                   LAIASGVAGLTSGRTAVESDRPAPGSPRSGNADAALALADRGVRATVVRLAPSVHDASP
FT                   AGFVAHLVETARATGSSGYVGDGEQRWAAVHRADAARLFRLAVERGRAGEVYHAVGEEG
FT                   VPTRAIAEAVAALTGVDVAPVPDAEAAHRFGFLAGILALDSPASNAWTRERFGWNPTGP
FT                   GLLADIAAWPGA"
FT   gene            complement(218023..219828)
FT                   /locus_tag="Tpau_0205"
FT   CDS_pept        complement(218023..219828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0205"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; condensation
FT                   domain protein; KEGG: mmi:MMAR_0087 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76859"
FT                   /db_xref="GOA:D5UQM6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQM6"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADG76859.1"
FT                   /translation="MRLTNVAHLRLPFGRLVGYDVTASSPGPSLPVSFDQGRHVAGGDR
FT                   PGSWMALSFHLPAPVPREMLAAAWLAVIARHGTLRTAFTAGPAGAPELHEIEIGPGGWV
FT                   EHPIEPGQAVNDALRDVLDTACSPYQRPAHRLCVLETADGPTVVIAADHSHVDMWSMLV
FT                   IVRDFLAALADVRAGRTPSTAAVPAFVEHTRALQNRPPAPEQVRRRWAEILAESGDVMP
FT                   RFPLPLGTPEPHLERVEVRDVFDVDDSAAFAAQAREDGVSTLAATIATMTSVTRALADE
FT                   PLRAVFPVHSRHGGQEAGGRPGTIADETWHDSVGWFITNSVIECTSPEPQAAAAAVREA
FT                   VQLGSWPLEEILEPWGGMPEVPGMFAISWLDLRRLPVRVDSTGLAAQYVGASIRTDGVM
FT                   LWFILDQEGLHLRCRYPDTPQARENVGAWLDMLVSRMRSAARESVGGTLRVGGRVYRVQ
FT                   RAARDDVPDIVALLSDDEIGRTRESAETAGYDAAFDVVARDRSHYLAVVRDEADRTVGT
FT                   MHLTVIPGLSRSGTTRLQIEGVRVAASERSRGLGTAMIEWAHHHGRTHRATLSQLTTDA
FT                   TRERARAFYTRLGYRSEHVGLKREL"
FT   gene            219880..220659
FT                   /locus_tag="Tpau_0206"
FT   CDS_pept        219880..220659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0206"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mmi:MMAR_0086
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76860"
FT                   /db_xref="GOA:D5UQM7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQM7"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADG76860.1"
FT                   /translation="MPRFDVPGAALDTELSDEGGHPVVQLHGLTSSRARDRVLDLDLGR
FT                   GLSGTRLLRYDARGHGRSTGRTVPEDYRWPALADDLLRLLDACFPGERVHGVGPSMGTG
FT                   TLLHAAVRDPGRFSGLTLMVPPTAWATRPAKAAEYRIAADAIEERGLSEFLSAAEDVVS
FT                   PPATNGAPATLPEVTERLLPSVFRGAALSDLPEREALAAIEVPVTLLAWIDDPAHPVST
FT                   AETLAELLPRATLTVARTPADVALWPTVLRDDVARTR"
FT   gene            complement(220459..221529)
FT                   /locus_tag="Tpau_0207"
FT   CDS_pept        complement(220459..221529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0207"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: svi:Svir_15760 DMT(drug/metabolite
FT                   transporter) superfamily permease"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76861"
FT                   /db_xref="GOA:D5UQM8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQM8"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADG76861.1"
FT                   /translation="MKNRLPALALVIVMVAWASAFVVIRGIGPHVSPVPLAEGRLLVGA
FT                   AVLGVIWALHALYTGDVRLPRGRALALTVAYGALWFALYTVLVNAAEQHLDAGTTALLV
FT                   NIAPIIVAVLAGAFLHEGFPPLLTAGIVISFAGAAVIAFSGDGRRDGAGVALAVAAALL
FT                   YGISVVAQKLVTRSTDPLTATALGAIIGAIVLLPWAPQLFRELAAAPIGSTAGVLYLGL
FT                   VPTALAFLLWAYALAHTPAGVTASSSYAVPALSILLSWGFLAETPTAWGLLGGVLCLVG
FT                   VAVARLPRRSARPGDVVAQDGGPQGDVRGGAGDGQRGAREELGEGLGGRDGVRRIVDPG
FT                   EQRDRDLDRGERLAFR"
FT   gene            221612..222517
FT                   /locus_tag="Tpau_0208"
FT   CDS_pept        221612..222517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0208"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: mmi:MMAR_4902 putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76862"
FT                   /db_xref="GOA:D5UQM9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQM9"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADG76862.1"
FT                   /translation="MLDAHRLMIFRSVAATGSVAAAAASLGYTPSAISQHVAALQRETG
FT                   LQLLERVGRGVELTPAGRVLATEADGVLERLNALGATVDDLRAGKANRITMNVFATAGT
FT                   HWMPSVVQTLAAEFPDTRLRLRIEDEVNEIAARRPDLAVAVRQEHSQTTAVAGFSHEDL
FT                   LVESYVAVVPEDHPFAERELIDMAELEHARWIDNDVRRGACRQAVLDACAGAGFTPRFV
FT                   VETTDYPSALRFVARGVGVTVLPRLGATELPEGTVSVDVCNPAPRRTIVAYVKDSECRN
FT                   PVVRRAMQLLRESAAAAIRP"
FT   gene            complement(222504..223862)
FT                   /locus_tag="Tpau_0209"
FT   CDS_pept        complement(222504..223862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0209"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   art:Arth_3774 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76863"
FT                   /db_xref="GOA:D5UQN0"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQN0"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG76863.1"
FT                   /translation="MTIDENVRTVPDRGRLRWFLIGSVALISFSAFESLAVGTVLPRAA
FT                   EQFGATAEYSVAFGAAFAAMIVAIAWVGPWVDRSGVRPPLIAGALLFAAGLLIVGSAPG
FT                   MTVLAVGRGVQGLGSGLISVVLYAMVGRLIPPAGRPRVFAAYSTAWVVPSLVGPAIAGL
FT                   AAGTVGWRWVFLGLAAPSLLALFATLRATTGLDESAYRNDDPPNRGVLFAALAAGTAAA
FT                   VAQFAAPQGGSGFLLLAAAAFVIAVIAARRMLPAGSLIGRPGIPRLMLANLLMAGSFFA
FT                   AEIYVPLYLVHIDRLSPFAAGSVMTGAALLWALASQLQARIPPDGALRERLPLIGSSLL
FT                   TLALVAVATSFAVDAPWPVIFATWAIGGFGMGLTYPTLSILMLGRSADDEQGTNSSALK
FT                   LSDAVGTALAIACTGALFAQVLAWGNSGFAVTLLVPLASGLATVAVTSRLTAE"
FT   gene            223887..225317
FT                   /locus_tag="Tpau_0210"
FT   CDS_pept        223887..225317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0210"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mva:Mvan_4580 H+ antiporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76864"
FT                   /db_xref="GOA:D5UQN1"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQN1"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG76864.1"
FT                   /translation="MVEVNREKPVEYAVVRRHRRKVHTDLGSRQHVPRMLRPLLRRDYR
FT                   LLFVTLLCALTTDGMWLVSVVWQVIDMGGSATSVSLVSGAASVGLLVSTLAGGVLADRV
FT                   SQQRILFVLELLKVVVIGGVGVLALTGAITIPLLMAGSLALGLVSGFYFPAYSALVPRL
FT                   VPPDELLAVNGYESAVRPAAAMAVGPAVAAWIIAVASPGAALLVGGAICLFAALWVVRI
FT                   RVPRTEAADEAEPGSPLRELWEGIKYVRQTPWLLATLLFASLMVLVTVGPIDVLLPFAI
FT                   KDQAHGAASEHSMILAAYGFGGVAGALFMAARRMPRRYLTVMMGVWGIASLPMLVFGIA
FT                   ESVWPMVIAGFVLGVLFEAPVVIWGTLLQRRVPRRLLGRVSSLDFFVSLVFMPVSFALA
FT                   GPVSQAIGLTATFVLAALVPVPLAVIAILAARMPQDELAHPLVDEDDEDDGTGAAGDAA
FT                   DAPVTPTVNAPAPEGTVG"
FT   gene            225328..225654
FT                   /locus_tag="Tpau_0211"
FT   CDS_pept        225328..225654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0211"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: rsa:RSal33209_1649 trancriptional regulator,
FT                   PopR-like protein; PFAM: helix-turn-helix domain protein;
FT                   SMART: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76865"
FT                   /db_xref="GOA:D5UQN2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQN2"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADG76865.1"
FT                   /translation="MTSGVASIDTHEPMEAQVPPRPPLLREVYGRVLRQERTRQGRTLA
FT                   EVAREAGVSTQYLSEVERGRKEASSEVLSSVCDALGGSLIEFVGGVHRELVGSRPAPVA
FT                   LAAA"
FT   gene            complement(225659..226672)
FT                   /locus_tag="Tpau_0212"
FT   CDS_pept        complement(225659..226672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0212"
FT                   /product="adenylate/guanylate cyclase"
FT                   /EC_number="4.6.1.1"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   KEGG: mab:MAB_4771 putative adenylate cyclase; SMART:
FT                   adenylyl cyclase class-3/4/guanylyl cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76866"
FT                   /db_xref="GOA:D5UQN3"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR032026"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQN3"
FT                   /inference="protein motif:PRIAM:4.6.1.1"
FT                   /protein_id="ADG76866.1"
FT                   /translation="MGDAGELDIDELLLPGTREYTFRELAELGGMDIEDLRAWWTSAGF
FT                   ADLRDDDTKAFTRDDVEIVRDLAALFADGVVDADAVVPGSQALGQAMYRLAEWQAPMIR
FT                   HYLEAARADDAPDPASGAALVIDRMDNLQAHIWRRHLAAATQRLMTPEADEEGDITATM
FT                   AVGFADMVGYTRLSRGLAVPELSTLLSTFETRMRTVIYGGGGWIIKGVGDEVMFAADEP
FT                   AAASRIALELQTPHDYPELDAIDLEFPQLRVGMAYGEVLQRYGDLFGNVVNLAARLTSA
FT                   ARPGTVLVDGQLAEAIADVPDLDTRSLRAYRARGFSAVHPHLLRWAKQPKENEDEA"
FT   gene            226704..228092
FT                   /locus_tag="Tpau_0213"
FT   CDS_pept        226704..228092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0213"
FT                   /product="L-serine dehydratase 1"
FT                   /EC_number="4.3.1.17"
FT                   /note="TIGRFAM: L-serine dehydratase 1; KEGG:
FT                   rha:RHA1_ro05336 L-serine ammonia-lyase; PFAM: serine
FT                   dehydratase alpha chain; serine dehydratase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76867"
FT                   /db_xref="GOA:D5UQN4"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQN4"
FT                   /inference="protein motif:TFAM:TIGR00720"
FT                   /protein_id="ADG76867.1"
FT                   /translation="MTISVFELFSVGIGPSSSHTVGPMRAGADFADEVAASGPDAVRSV
FT                   RAVHVDLYGSLAATGRGHGTFAAVLLGLEGQRPETVDPDYVQVRSAEIDASGITRFGGV
FT                   AEVPLSTQGIVLHPLTVLPRHTNGIRFRAEFGDGSEYEAVYYSVGGGFVERESGADTVN
FT                   PLAGTTAVPHDFDTAASLLELTRRTGRSIPQLMMDNEIVLRGGPPEKAEKDVRDGLLHI
FT                   WTVMCACIERGFRSEGTLPGGLDVKRRAPGLYRRLEESGESDAMDWLNVAAMAVNEENA
FT                   CGGRIVTAPTNGAAGIVPSVLYYALKFRPGLADRAEDVVCDYLLTAAAIAVLYKRRASI
FT                   SGAEVGCQGEVGSACSMAAGALAQIAGATPAQVENAAEIGIEHNLGLTCDPIGGLVQIP
FT                   CIERNAIASVKAVNAARIALHGDGTHRVSLDQAIETMRQTGADMLSKYKETSLGGLAVN
FT                   VPEC"
FT   gene            228130..228534
FT                   /locus_tag="Tpau_0214"
FT   CDS_pept        228130..228534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0214"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: art:Arth_0808 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76868"
FT                   /db_xref="GOA:D5UQN5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQN5"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADG76868.1"
FT                   /translation="MDVLTVAAVCFRDEAGRVLTVRKRGTDAFMLPGGKLEPGEAAIDC
FT                   AVREISEELSVALTAQDLTHLVSWRGPAANEANTDIESTVFATTLRVEPRAAAEIAEAR
FT                   WLDPADHGDVIIAPMLEQYLFPRLAGAPSA"
FT   gene            228531..229688
FT                   /locus_tag="Tpau_0215"
FT   CDS_pept        228531..229688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0215"
FT                   /product="protein of unknown function DUF1006"
FT                   /note="PFAM: protein of unknown function DUF1006; KEGG:
FT                   kse:Ksed_08640 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76869"
FT                   /db_xref="InterPro:IPR009351"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQN6"
FT                   /inference="protein motif:PFAM:PF06224"
FT                   /protein_id="ADG76869.1"
FT                   /translation="MRISQSQARRIALAAQGFEPGFAGASTPTMRHVQKTIDRLKLIQI
FT                   DSVNVVARSQYLPVFARLGDYDTTLLDRARDTAPRRLVEAWAHEASLVPPQTWPLLRHR
FT                   RTADRVAQRFASYDARHPGQLDRLRGALAELPPLTARALEAHLEHEQVVEKTHWGWNWS
FT                   SVKEGLEVLFHAGEVTSAGRTSQFERLYAPTSTVLGELAEHEVSDEDAYVELIRQSAKA
FT                   HGIGTLRCLRDYFRLTTAQAAPAVEKLVASGELVPVQAEWWPGTVYLHAEAKRPRSIAA
FT                   RALLSPFDPVVWQRERAEALFDFFYRIEIYTPKEKRVHGYYVLPFVFGDRIVARCDVKA
FT                   DRKASELLVHTTTWEPGGRDAASETALEETVSEMAHWLGLENYRF"
FT   gene            complement(229685..230569)
FT                   /locus_tag="Tpau_0216"
FT   CDS_pept        complement(229685..230569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0216"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="PFAM: filamentation induced by cAMP protein Fic;
FT                   KEGG: msm:MSMEG_2181 cell filamentation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76870"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQN7"
FT                   /inference="protein motif:PFAM:PF02661"
FT                   /protein_id="ADG76870.1"
FT                   /translation="MSAARPLRDIAGPLRNLVPERAVSLHGAIANSVLEGWEPRLQDIE
FT                   RLAAMADGAVTLARYVEAAIERALASAAAVGAPDCVDVPVGFPDTVYPETRVLRNRFGI
FT                   RDAQALRQLEFEVGTAQEFGIETGLTELAQTFDGGHLAAIHRTLFGTVYPWAGVFRKYD
FT                   MALGHTTFHAHWISRYLGDAATMLNHRLPHQPIELMGPQRDRQHYARQAAEAYAYLNCA
FT                   HPFREGNGRSSKTLLQVLAAKAGYRFDYSAVSKKQWDTASRRSAPDYGHYRPDAHPLFS
FT                   VFTTITAPLTASA"
FT   gene            complement(230579..232114)
FT                   /locus_tag="Tpau_0217"
FT   CDS_pept        complement(230579..232114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0217"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: sma:SAV_1689 ABC transporter ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76871"
FT                   /db_xref="GOA:D5UQN8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQN8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG76871.1"
FT                   /translation="MATSLAVSALTLHWPDGTVVFDDLSFTVPAGHAALVGANGAGKST
FT                   MLRILAGLITPTSGSVSGTGVVGYVPQHPQARAENTLADALGIGTALAALRRIEGGSAE
FT                   PSDFDAVGDDWDVEERATAALNGLGLRLGALDRTVGTLSGGEATLLAIAGQLLRRPDTL
FT                   LLDEPTNNLDAHARELLTDALDRFTGTAVVVSHDLALLERMATMIELYRGDVRVFGGPY
FT                   SHYREVLDAEQAAAEQAVTTAAGDLKAQKRDLVEAQTKLAKRKRYADKAEAQKRVPPIL
FT                   AGLLKQKAEVSAGKHRVLHEGRVDSAQDALAQAQEAVRDDRSVRIAMPDPGPGVHRVQL
FT                   DDPSLQVIGPERIALVGPNGSGKTTVLRRAIASARAAEPATVIGYVPQNVRFGADEDAT
FT                   LIDAVRTAHPDLDAQQAYAALARMLFRGKQAERIVGTLSGGERLRLALAIALLGNPAPS
FT                   LLVLDEPTNNLDIESVELLVEALLDWRGALAVVSHDRGFLDRLDLTREVEVSR"
FT   gene            232538..233836
FT                   /locus_tag="Tpau_0218"
FT   CDS_pept        232538..233836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0218"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: rha:RHA1_ro02081 ROK
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76872"
FT                   /db_xref="GOA:D5UQN9"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQN9"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ADG76872.1"
FT                   /translation="MTVVDIPANSATPTRTAQARAARARNPLTRPAVERAPRVAAPARV
FT                   FPPQLRVSEKPAAAVLRVIRRGGLVLRDEIVRETQLSAATVNRQVTALIEAGLVRERAD
FT                   RAASGVVGRPRLPLEVDPTGPLALGIHIGFRVSTVTMHDVSGKIVGAIQIPTPESGEPG
FT                   EVLSVIATSARRFLARWDGRTILGAGIAIGGRVDDRGVVADHPRLGWKDVALGERLSGA
FT                   IGLPVTVAPHVEAMAAAELHLSESLESQGSTLYFYGRETVGVALALHGAVHSPKSGPHT
FT                   IGHLPTRNVTLLDPRGTGRLEDAVTDTAVVEAAQVQKLAVRTVADLHKLAEGGNATAKA
FT                   IIAERGRVLGEAAALVADIFNPDRLILGGQAFTDYPAILPHVSAALKATSAEPSRAVRV
FT                   SGAGGRVQQQAAGAAALDGVYADPLGAIARATA"
FT   gene            complement(233733..234827)
FT                   /locus_tag="Tpau_0219"
FT   CDS_pept        complement(233733..234827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0219"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="PFAM: filamentation induced by cAMP protein Fic;
FT                   KEGG: btr:Btr_2350 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76873"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQP0"
FT                   /inference="protein motif:PFAM:PF02661"
FT                   /protein_id="ADG76873.1"
FT                   /translation="MTDDDWAAEQQRIAAQFYPGTTVLRNHAGITDPDTLHRYEYQLVE
FT                   RRAIELGDLSRPLLPATFDADHLAAIHRHLFGDIYPFAGQIRDYPLSKDGDNFAHYRNI
FT                   RDYLDAAAYDLRNSPDIRSKDPDRFAHAIADVFAHINTAHPFREGNGRSTRLLIEQAAA
FT                   EFAHFRIDLRTVTREQWNDASKAAHPQPGRFSPDRHRWCRSSAPHSSTHTLSASSPARP
FT                   SRRPRVRLPTDCGLTALQLPVWPAARSPAAPAPTRRAPRRPRSPDPGHRTSVATTPADS
FT                   PVRTSLSAPGLSPQRQGGHRGGDVAQVPVAVREPRCTLCAAGLGVLQFGVRRWRGRWRP
FT                   VDRRIRRRAQPHRRPAAARDPRHH"
FT   gene            complement(234837..235076)
FT                   /locus_tag="Tpau_0220"
FT   CDS_pept        complement(234837..235076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76874"
FT                   /db_xref="InterPro:IPR041535"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQP1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76874.1"
FT                   /translation="MTVTTTTDVEVPAWFAHCADLVDGLTTDQRDRVIRTVHSSYLEGM
FT                   DPERDNVEALVRLVRGERTTNQAIDEIKAAFGFG"
FT   gene            235514..237211
FT                   /locus_tag="Tpau_0221"
FT   CDS_pept        235514..237211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0221"
FT                   /product="transposase"
FT                   /note="KEGG: art:Arth_1780 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76875"
FT                   /db_xref="GOA:D5UMY7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:D5UMY7"
FT                   /inference="similar to AA sequence:KEGG:Arth_1780"
FT                   /protein_id="ADG76875.1"
FT                   /translation="MMGSKVELFAQIRRDARVEGMSIRALARKHGVHRRTVRQALSSAE
FT                   PPPRKTPERSSPRLDPFKAAIDAMLRSDLQAPRKQRHTATRIRERLAIEHGAVELSYST
FT                   VRDYVRVRRAQIEVEAGRRTEVFIAQDHAPGAEAEVDFGEVWVILNGVKTKCHMFVYRL
FT                   SHSGKAIHRVYPIGGQEAFLEGHVEAFRELGGVPTRHIRYDNLTSAVVAVLQGGDRRRQ
FT                   ENPRWTLFHSHYGFDPFYCQPGIAGAHEKGGVEGEVGWFRRNRLTPMPQVESLDELNEQ
FT                   IKTWEARDEGRRIDGRLRTVGQDYQHDRAALAPLPVEDFDPGLVLTPRVDRSAMITVRM
FT                   VRYSVPAHLIGRRVRVSLQASQLLVYDGRALVARHQRVAGRGIAKVDLDHYLEVLKFKP
FT                   GALPGSTALAQARAAGVFTASHDAFWAAARRVNGDVDGTSELIDVLLLHRSLPADAVTA
FT                   GIDAALRVGAVTVEVVAVEARRADAALLTTSDMTGGASSGRHRVRHADRREQRVVSLTQ
FT                   RRLADPAAVIAGLPPDRRPLPTVAAYDRLLRRRTASDAPPPPTPERHP"
FT   gene            237208..238032
FT                   /locus_tag="Tpau_0222"
FT   CDS_pept        237208..238032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0222"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein; KEGG:
FT                   art:Arth_1779 IstB ATP binding domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76876"
FT                   /db_xref="GOA:D5UMY6"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:D5UMY6"
FT                   /inference="protein motif:PFAM:PF01695"
FT                   /protein_id="ADG76876.1"
FT                   /translation="MSTTTSKSQATTLAPSLRRRGGLTEEAAIAAVDQACRRLRLPTVR
FT                   SMIDQHLAAAAKQQLSYQGFLAELLLAEVDDRDRRSTVRRVKAAGFPRDKWLADFDFDA
FT                   NPDIEAATIHQLATGDWIRHGLPLCLIGDSGTGKSHLLIGLGTAAAEQGFRVRYTLATK
FT                   LVNELVEAADDKQLAKTINRYGRVDLLIIDELGYMELDRRGAELLFQVLTEREEKNSVA
FT                   IASNQSFSGWTDTFTDPRLCAAIVDRLTYRGTIIETGTHSYRLAHTEGAAEF"
FT   gene            238083..238316
FT                   /locus_tag="Tpau_0223"
FT   CDS_pept        238083..238316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76877"
FT                   /db_xref="UniProtKB/TrEMBL:D5UMY5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76877.1"
FT                   /translation="MAITRGTERFALLAEQTQAAARRRGIAVTDEVIDQILNAEIERVA
FT                   KLMGIEPRTALLYTPADLPLTLAEMIAATHHQ"
FT   gene            complement(238343..239791)
FT                   /locus_tag="Tpau_0224"
FT   CDS_pept        complement(238343..239791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0224"
FT                   /product="plasmid pRiA4b ORF-3 family protein"
FT                   /note="PFAM: plasmid pRiA4b ORF-3 family protein; KEGG:
FT                   nca:Noca_0009 plasmid pRiA4b ORF-3 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76878"
FT                   /db_xref="InterPro:IPR012912"
FT                   /db_xref="InterPro:IPR024047"
FT                   /db_xref="UniProtKB/TrEMBL:D5UMY4"
FT                   /inference="protein motif:PFAM:PF07929"
FT                   /protein_id="ADG76878.1"
FT                   /translation="MAREYVEGLSPQERRVVLDAVVNARFAAEVDALTRVRQPTLLPVP
FT                   DRVVGFRVRLDLHGAKPPVWRRLELPGDLTLSAVHEVIQAAMGWYDCHLHKFRTGSDHR
FT                   SPAFLTAFDVSEGEEGVLEQDVRLDQVIAGVGDELWYEYDFGDGWEHKLKVEQVLDTCP
FT                   SASLCVAGKNACPPEDCGGLGGFHEVALWVRKGRDAAHLPDSFGSAEEANDWLPGGWDP
FT                   DVFDVDDANAAITLALFDPASVLAPGHGELGQIAHRLTMQGSSLLQGVLARPQSHGQAS
FT                   VSAAEAERLTEPYRLLLEEVGEGVKLTAAGYLPPVVVERFAQRSGIANWWMGKANREDL
FT                   TPPVATVREAAQAVGLLSVRKGRISPTRAARRIGGDPTALWEHIVGRLPCGTKDFDREA
FT                   GWLLLAVVGSGTPVENWRKEVSDLLYAAGWRTGGANRYPMMLPVTSPTYTILESMTDTH
FT                   RDRWHVRGTDDGIAATARAVLNQR"
FT   gene            complement(239949..240716)
FT                   /locus_tag="Tpau_0225"
FT   CDS_pept        complement(239949..240716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0225"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG: bcz:BCZK2732
FT                   CAAX amino protease"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76879"
FT                   /db_xref="GOA:D5UQP6"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQP6"
FT                   /inference="protein motif:PFAM:PF02517"
FT                   /protein_id="ADG76879.1"
FT                   /translation="MNADLLVRARAFFANQPADASCLLVLIRVIWVSASIVALMAPEEL
FT                   YEQDLSRGVVLAAVAATVGIVVVVGGHWLTQSSLLPSSRWLGFALPRRWWLWLPVGAAA
FT                   GFGLSRGLTALHLPQLWPALTDSTAQQLANNEQREAEAFTWTDWTHAAGEEVIFRMPVV
FT                   AAACFALGFTGARMPDASRARLSILAGVVIATALLFGLIHLDYGWYNVVTTWVLGAGCA
FT                   AIAIASRSVWPAATLHAAYNTANHFPDIVWSLW"
FT   gene            complement(240730..241104)
FT                   /locus_tag="Tpau_0226"
FT   CDS_pept        complement(240730..241104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0226"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76880"
FT                   /db_xref="GOA:D5UQP7"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQP7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76880.1"
FT                   /translation="MNSAATTIMLAAGNPADAPMPFFEMYIRPLILIGVGLFVVTWPLW
FT                   LVLAFVLAKPRGMARSAMLAARTPEQYRIARRRRNWLVFWHTLACVLGLGPFFAVAFGA
FT                   IKGPVIAPQARSYPVHYPYQ"
FT   gene            complement(241182..241331)
FT                   /pseudo
FT                   /locus_tag="Tpau_0227"
FT   gene            complement(241483..241869)
FT                   /locus_tag="Tpau_0228"
FT   CDS_pept        complement(241483..241869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0228"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76881"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQP8"
FT                   /inference="protein motif:TFAM:TIGR01552"
FT                   /protein_id="ADG76881.1"
FT                   /translation="MLLGMDRETVTATEFNRRPSEILARAVDGALVEVVRQGRPVAWVG
FT                   PLDLLEGLLARESEIEMTDDQFEALMTGVNGVRTAILELAEATDKASKRLATAADQSDS
FT                   VRAATTSRATNAIEDLVASLNRRA"
FT   gene            complement(241967..243022)
FT                   /locus_tag="Tpau_0229"
FT   CDS_pept        complement(241967..243022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0229"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: protein of unknown function DUF323; KEGG:
FT                   aau:AAur_1451 domain of unknown function (DUF323) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76882"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQP9"
FT                   /inference="protein motif:PFAM:PF03781"
FT                   /protein_id="ADG76882.1"
FT                   /translation="MTDEQKSSCCGTTANAPRTSAGDVGGGRHAAAPDETVAAQARRSV
FT                   VPTPAAAQTAHAVHDSRQVSIGPKPFLMGDFTGAGIAADEEGPAHPVGVSAYSIDATTV
FT                   TNAQFARFVDATGYRTTAQQRGSSTVFYSQVAPSATVLDVPDPQAWWWRTVEDAYWRNP
FT                   FGAGSTAENRPDHPVVHISYFDALAYCAWANRTLPTEAQWECAARGTILGETYPWGGQP
FT                   PIDGEPLKVNIFRGAFPDQPTTPVGTMPVTSLPPNDIGIYHSVGNVWEWTADAYVPGLY
FT                   AQRAATTLGPAGTAVDPRSPGDTDRDDFMLRGGSYLCHDSYCNRYRNSARTHATPHTST
FT                   SHIGFRTTAPM"
FT   gene            complement(243221..244120)
FT                   /pseudo
FT                   /locus_tag="Tpau_0230"
FT   gene            complement(244120..244413)
FT                   /locus_tag="Tpau_0231"
FT   CDS_pept        complement(244120..244413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0231"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   mlu:Mlut_10240 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76883"
FT                   /db_xref="GOA:D5UMQ2"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D5UMQ2"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ADG76883.1"
FT                   /translation="MPKPYPKEFRDDVVRVARNREPGVRLKQIAADFGISESCLMNWVK
FT                   TADVEAGSKSGSSAAQSATERQMRKRIRLLEQENEVLRRAAAYLSQANLPGK"
FT   gene            244484..244753
FT                   /pseudo
FT                   /locus_tag="Tpau_0232"
FT   gene            complement(244748..245608)
FT                   /locus_tag="Tpau_0233"
FT   CDS_pept        complement(244748..245608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0233"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to aspartic acid-rich protein
FT                   aspolin2-1"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76884"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQQ1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76884.1"
FT                   /translation="MEPCDAEAVGAAESPPDSPASPDFPVEAPDAPPLVERSGFSLGVE
FT                   PDEEPTDEDEPGEAEPEEVPDESDPDEPDSEGADEDASDPEPGDADDRDSDGLDSDDAE
FT                   PDDPDDPDDADSDDVDEVSPSGTAADADGDDGNNAAATNAPPKTTTPTTPRATPTTSGC
FT                   TPRPLPRPPTPSIRARGACPGLAPDAVRRRSREPNTALSRSQTRPTTTQHTTANTTEYT
FT                   AGTVISSYPPSEPPTSEHRQFHSFAQKYRPPLPPRPQQASTTPRRNHHQKRRQRPSCSG
FT                   KSSIL"
FT   gene            246027..246320
FT                   /pseudo
FT                   /locus_tag="Tpau_0234"
FT   gene            246684..248798
FT                   /locus_tag="Tpau_0235"
FT   CDS_pept        246684..248798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0235"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to CG4090-PA"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76885"
FT                   /db_xref="GOA:D5UQQ2"
FT                   /db_xref="InterPro:IPR028949"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQQ2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76885.1"
FT                   /translation="MPKFDYSVPAPAKGEYAFSLFGLFSINPFSGNTSVLGIKFNLWDT
FT                   VGNIAGGVGKAIDGVGKAIDGIVSPKPKDDGKPAIPGTTPQPFAQVVVGAAAFILLFGA
FT                   IYFATLPPQQRQDLIRRGTEPLNQWWNNARDRIHDLLNPAEPEAKTPTIGGEVKPPAQG
FT                   ATEPPHTTPNPVPSNPVSPVTPDLPAAPFTTPGGNGTGAGTVGTPTRPGTQIPAVPAGN
FT                   PGISTPAPGGGQDDPNNDDDDGPDKNPDKDTDHQSYPAGGIIGAGLGGASIETPGLPTT
FT                   PGTNPPEPNNGTPGTTTPLDPDHHLDPNKPDKATPVEIKPEPTAPKNPILGLAENILGF
FT                   FFPKPKPAIPEPSTPEHPGGTTTGTGTNNNSSKGDGGDSGDGGGDSAANSGNTGATTPS
FT                   TPATSNGEGPGSNGSSSTHEPPASTPTAGYPVDTLAKLATSEVYGPELEAVVAALQKEA
FT                   TGPTVSDVQAAQKRLIEQGNQAPAVDAMVNIVASMLAARDKQELAAAQQHLEDIAAKLG
FT                   VPVANLPKTDDMYLFPMSAAPTNPTHSPYERIRELLTQITWHNSQTVQEAYDQAKNRTY
FT                   SSAEAEQARKDFRDQLRTSGYEALLEMGYRPDAADSLSKSIAEQLMKKLVVTHNPDRIV
FT                   GGRSDKMVTFGDSRTNSSIGNANQRGAAAYLAWLEVQMKKNPDAIVRFDFVEPDDPETP
FT                   STTPPGGTDD"
FT   gene            248791..249426
FT                   /locus_tag="Tpau_0236"
FT   CDS_pept        248791..249426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0236"
FT                   /product="GAD-like domain protein"
FT                   /note="PFAM: GAD-like domain protein; KEGG: pst:PSPTO_2458
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76886"
FT                   /db_xref="InterPro:IPR014983"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQQ3"
FT                   /inference="protein motif:PFAM:PF08887"
FT                   /protein_id="ADG76886.1"
FT                   /translation="MTDDHFELFLRDVPLTTAGPACTQQHLDTYRGVLPNPLLSYWQEY
FT                   GFSGFGDGIVWLTDPLEWQATTTLITAGITHRPLGTDATYIPILRTAFGKIWFWTPGFG
FT                   RSLTITPAVGTASCIIQSAPRDLSLQATFATGDRERYDFDPKGFPGGLFEQVLTRCGPL
FT                   TVDQVYHFTPSIVSDDDPVDISTAQVANIHEWLAAVKTEVGDWSTFYI"
FT   gene            249520..250155
FT                   /locus_tag="Tpau_0237"
FT   CDS_pept        249520..250155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0237"
FT                   /product="GAD-like domain protein"
FT                   /note="PFAM: GAD-like domain protein; KEGG: pst:PSPTO_2458
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76887"
FT                   /db_xref="InterPro:IPR014983"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQQ4"
FT                   /inference="protein motif:PFAM:PF08887"
FT                   /protein_id="ADG76887.1"
FT                   /translation="MTDEHFELFLRDVPLTTAGPACTQQHLDTYRGVLPNPLLSYWQEY
FT                   GFSGFGDGIVWLTDPLEWQATTTLITAGITHRPLGTDATYIPILRTAFGEVWFWTPGFG
FT                   KSLVVAPVNATAVCTGLSRPNDLSLQSIFAMGSPSRYDFKPLGFPDGVFTRVLAQCGKL
FT                   DFDQVYHFNPSVIHDEDSVDIGTAEVADIHPWLAEVKDSVGEWPTAYI"
FT   gene            251269..251544
FT                   /locus_tag="Tpau_0238"
FT   CDS_pept        251269..251544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0238"
FT                   /product="prevent-host-death family protein"
FT                   /note="KEGG: lxx:Lxx22678 hypothetical protein; TIGRFAM:
FT                   prevent-host-death family protein; PFAM: protein of unknown
FT                   function DUF172"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76888"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQQ5"
FT                   /inference="protein motif:TFAM:TIGR01552"
FT                   /protein_id="ADG76888.1"
FT                   /translation="MTTVPLGEAKDRLSALVDSAESTHDIITITRHGRAAAVLMSADDL
FT                   ESMQETIFWLSRPGTAAAIAEAEHDAAAGTASSGNDLRAEFGLTPR"
FT   gene            251541..251834
FT                   /locus_tag="Tpau_0239"
FT   CDS_pept        251541..251834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0239"
FT                   /product="plasmid stabilization system"
FT                   /note="PFAM: plasmid stabilization system; KEGG:
FT                   mbt:JTY_1281 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76889"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQQ6"
FT                   /inference="protein motif:PFAM:PF05016"
FT                   /protein_id="ADG76889.1"
FT                   /translation="MTEDQSASAHLYEIAAGPAARRALRRLPTKVAAAIVEFITGPLAD
FT                   NPHRLSKPLRNEYDGYRSARRGDYRVLLRVDNSTRRVLIIDIDHRAHIYRPR"
FT   gene            252079..252414
FT                   /locus_tag="Tpau_0240"
FT   CDS_pept        252079..252414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0240"
FT                   /product="protein lsr2 precursor"
FT                   /note="KEGG: mab:MAB_0545 protein lsr2 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76890"
FT                   /db_xref="InterPro:IPR024412"
FT                   /db_xref="InterPro:IPR042254"
FT                   /db_xref="InterPro:IPR042261"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQQ7"
FT                   /inference="similar to AA sequence:KEGG:MAB_0545"
FT                   /protein_id="ADG76890.1"
FT                   /translation="MARTVTVTLTDDIEPEYEADETVVFALDGVEYEIDLASVNADKLR
FT                   AALGTYIEAGRRVGGRAKRGAKPGSRASIDREQSKAIRAWANANGYEVSSRGRIPQEII
FT                   DAYNSKA"
FT   gene            252539..252673
FT                   /locus_tag="Tpau_0241"
FT   CDS_pept        252539..252673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76891"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQQ8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76891.1"
FT                   /translation="MWRLVLSAAAEKKACQQAEESSAESASTPDFVVPHDAIPLFLLR"
FT   gene            252710..252943
FT                   /locus_tag="Tpau_0242"
FT   CDS_pept        252710..252943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0242"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76892"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQQ9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76892.1"
FT                   /translation="MAITRHTERFAQLAEQVQAAARFRGIEVQSAVVDQLLNAEIERVA
FT                   ELMGIEPRTALLYTPDDFPGTLAGAIAATHER"
FT   gene            252992..253068
FT                   /locus_tag="Tpau_R0004"
FT                   /note="tRNA-Met1"
FT   tRNA            252992..253068
FT                   /locus_tag="Tpau_R0004"
FT                   /product="tRNA-Met"
FT   gene            complement(253245..253424)
FT                   /locus_tag="Tpau_0243"
FT   CDS_pept        complement(253245..253424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0243"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76893"
FT                   /db_xref="InterPro:IPR028037"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQR0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76893.1"
FT                   /translation="MSITALLATAKDKLQANPQLIDKAAAAVNDRTGGRFASQISTATT
FT                   AANRWATRRPHPQQ"
FT   gene            complement(253736..255646)
FT                   /locus_tag="Tpau_0244"
FT   CDS_pept        complement(253736..255646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0244"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   rop:ROP_61080 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76894"
FT                   /db_xref="GOA:D5UQR1"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQR1"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADG76894.1"
FT                   /translation="MLFWIRVAFRGNASTYRWVCIASGVCALAGANAVTIFLAASDTSS
FT                   VPEAPDINRYAKDLVAADGLTSFAAVMAVVSLVSAAMVIHALVGSVANARRDALAVYRI
FT                   LGATPRRAGMIFLLECAVFTAIGAAVGAGIGTLLAPPTRVMLAYYDLAPQTIAVGPRTS
FT                   AVALVFVLVTIAAMVGSRSGYRDVMTHADEKTQQRARRRRSIRPVPFALAVVFLAGAAA
FT                   LAALVPPTESAINSVPFGGALLGVIGAALLTPAVTYTFAAITTAISHGAMVPDRLSSYL
FT                   RIGGRWSATGASRSARIAIPITLAITVVAVIFSLAQTGRSASEYDKLKSVAAESVLDTS
FT                   AHPDRGWNVSATADPHSVGVRGDSRWTVPGQRPTVISLFRITHPENLATIFPGISPAAP
FT                   LALITASEQDRSSLRVLSGDPNDTVGDTHRWVSPDRQEVTVRVVGKVSENRYLRYRYLV
FT                   VDATFPDSPDTPGFVFYPTPADGPAVTTRQWVEDQIKENQRSQAAGITAIVAVPILLCA
FT                   IALLGVVMNIRRELLPGRLTLQQIGLTRSDTAAVFAVIAATSIAGALITAAVPLILTIY
FT                   SEQRIVHGIGYGIPIALPIAPVAATALSISLITLASMVIGWRAPKGRTHHTQIPMSVVA
FT                   D"
FT   gene            complement(255666..256460)
FT                   /locus_tag="Tpau_0245"
FT   CDS_pept        complement(255666..256460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0245"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: fre:Franean1_0530 ABC transporter related;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76895"
FT                   /db_xref="GOA:D5UQR2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQR2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG76895.1"
FT                   /translation="MPPKLEHIERWLLLKSVTYQVSPNVQSSGAAVLQICGLTYAAGHP
FT                   SSTIVKDVNLTVRAGESVAVMGRSGSGKSSLLKLGGGLLQPTAGSVSVAGTRIDDLGEK
FT                   GRALVRRGPVGFIFQGLNLIENLSVADNLDVAGRIRGRRYTSAEKTAALETVGLAAMGS
FT                   RLVEDLSGGEAQRVAIARSLMSKPTIVFADEPTGALDSTNAANVTSLFKDVVAAGSAMV
FT                   VATHDPIVAANTSRVVFLSDGRIVGELSSPSAEEIARRVIAL"
FT   gene            complement(256567..259257)
FT                   /locus_tag="Tpau_0246"
FT   CDS_pept        complement(256567..259257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0246"
FT                   /product="serine/threonine protein kinase"
FT                   /note="SMART: serine/threonine protein kinase; KEGG:
FT                   sen:SACE_4230 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76896"
FT                   /db_xref="GOA:D5UQR3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQR3"
FT                   /inference="protein motif:SMART:SM00220"
FT                   /protein_id="ADG76896.1"
FT                   /translation="MVLSRSIAPEDCCIDSRGYFFYELPLYLRGGRDGDVSANRFSIPC
FT                   SDEWTSVLVNGWMNYVPPDARLPDQGWKIHVSTVPSQAAQVLARVADVCLRRGLPFKHL
FT                   PDMAAVVRSNAKYADRGGSGKFITIYPRQEDVELESLLVELEDQLASFVGPYILSDIRW
FT                   RDSPVFLRYGGFRSRTAVIDGESVAVIRDDESRDVPDHRVPYFMPPSRSKIPEFLRDIV
FT                   DSRVGGVSLITGHDFPYEVISAMHFANSGGVYLARHRDAPDTNVVLKEGRPHVAVDPAT
FT                   GNDAADRLLVEYNALVALRSVPGIVDAQRTFQAGGHRFVQIDFVDGNTLYDWVARNFPY
FT                   PTTASVDDYVCEALSIANQVSEAVREAHRRGYALVDVQPRNIFVDYDPELPNASLRVTL
FT                   IDLELAHSIFNDTGSPPPARFIGTPGFVSGIDDEFSAQQRDGYAVVRSIVHMFHPVTPL
FT                   SSVSDTLWDGQKKYIRDVFGTQSVEAIERIDAIFGSPLQRSVARARAAAVRSAWLPSCS
FT                   NSKEVRADLVTGILRSRTASRDDCVYPGSPAMYGTALGLASVGHGAAGVMLMLNRQAPC
FT                   VRQRRVFVAELDQFQALYQSSEDFSLLTGRTGMACALWELGAPRESVSALVSGCAGAAR
FT                   RSGRYGLADGAGGIAAAVASICQSGGDSSIASEIAELADTLTAGPAVERALNGSPGLFD
FT                   GMAGLAVGLLLLSLCPGVDAAALRSSGRTLVDAAVDTLVEAPDGSLHVRSRGALYPYLG
FT                   SGSAGVGVAVAVMHQLTGEPLTADHVHVLHRVRRACHVRSCLYPGLLKGMSGLLVAERM
FT                   FTELLGPPRTAMNPLELLAPFLFHSPSGLLSSGDGGRRLAVDYAHGAAGLLPALADSSH
FT                   LLDWLPVANPHRLLSPRTSQPITIN"
FT   gene            complement(259624..259848)
FT                   /locus_tag="Tpau_0247"
FT   CDS_pept        complement(259624..259848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0247"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76897"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQR4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76897.1"
FT                   /translation="MNQIRRRIAGVGAAAAIVLSGGFLAAPIASADHVSDCYALYDSTV
FT                   DYCNGIAASGRDAAPCFYAARENLRQCLS"
FT   gene            260224..260799
FT                   /locus_tag="Tpau_0248"
FT   CDS_pept        260224..260799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0248"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; KEGG:
FT                   mpo:Mpop_4538 prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76898"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQR5"
FT                   /inference="protein motif:TFAM:TIGR01552"
FT                   /protein_id="ADG76898.1"
FT                   /translation="MLTVTQAKADLSGLVKSAERGSTTTITVNGRPAARIVPADAPAPA
FT                   DAGGPWTLVTSNASNYLPWPLTPAGFVDKHRGGSPEDAQRSLIEEGKVAGGFETLLKAW
FT                   ARSDDRGREFAAQWLNLNTGASIIAVPSGDYWRGSGSYRYFFTLGEGRQILELEEWSAG
FT                   LLTWHDSSAAFHAAYAQAVELGNRRLSA"
FT   gene            260842..261657
FT                   /locus_tag="Tpau_0249"
FT   CDS_pept        260842..261657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0249"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG: nfa:pnf160
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76899"
FT                   /db_xref="GOA:D5UQR6"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQR6"
FT                   /inference="protein motif:PFAM:PF02517"
FT                   /protein_id="ADG76899.1"
FT                   /translation="MTDDSTSPAGGNAADERPRRRPWWQLYEANSLVGLAFAGMLWVVA
FT                   FSAYLMAPQDDYQVGQASAPAVIGFLILGLIVVALVVGITIMFGASVREVRRRLGFTRP
FT                   RGRAGWRWAWILVAIGLGIVIRMELVPAIGDLWPSIKIQSDAQRAADDLRDLQLAAPAW
FT                   MVWTHAAGEELIFRCPVVAAAVWAFGDGPLRWRQVPRVCVAVVAAVVAVTSVLFGLAHV
FT                   EFSWYNVAAAGVMGLACAVVAVVTRSIWPAAALHAAYNTFSIASMTRLW"
FT   gene            261721..262053
FT                   /locus_tag="Tpau_0250"
FT   CDS_pept        261721..262053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76900"
FT                   /db_xref="GOA:D5UQR7"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQR7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76900.1"
FT                   /translation="MATFLNVFGTLLTCWLYALIFGGVVMLVWWVLPRPILYALARRGS
FT                   GPAVAVLRVARVFERAYFIVLFPVLLVLFLLPLNNPRLQANIIYTFWASRELGAYSRRR
FT                   RASRPF"
FT   gene            complement(262050..262622)
FT                   /locus_tag="Tpau_0251"
FT   CDS_pept        complement(262050..262622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0251"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rer:pREC1_0014 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76901"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQR8"
FT                   /inference="similar to AA sequence:KEGG:pREC1_0014"
FT                   /protein_id="ADG76901.1"
FT                   /translation="MAEWEEPTLPGMPAPPARSSGRPAAAGPAPRRAFTTAPPPRAITA
FT                   FTAKLVPIETGCVIFTGAISTPDGYGRVTITLPGTSKPVTVSAHRFAFWTHHGALPDEG
FT                   VLEHHCNEPLCVRIATDHVHASTQSANLIHAINSGRHHNSETVVDSARRADHSRAVRAL
FT                   VIDGFDAGEYRKIRTNHATAAVTLPLF"
FT   gene            complement(263397..263804)
FT                   /locus_tag="Tpau_0252"
FT   CDS_pept        complement(263397..263804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0252"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76902"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQR9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76902.1"
FT                   /translation="MSTTTSRLTARQRARARVEASRADQVAREQRQIAAVATYFDEEDK
FT                   LARLIERGEIKHRTAQRDALAVLVDTDGMSAAAIAKLIGVKAAEVRAVLDYTPNTEHEG
FT                   TGGSVTESEQGDGPDADGAADSGTGVQGLEQ"
FT   gene            264528..267401
FT                   /locus_tag="Tpau_0253"
FT   CDS_pept        264528..267401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0253"
FT                   /product="TrwC relaxase"
FT                   /note="PFAM: TrwC relaxase; KEGG: car:cauri_pET4482726 TraA
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76903"
FT                   /db_xref="InterPro:IPR014862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQS0"
FT                   /inference="protein motif:PFAM:PF08751"
FT                   /protein_id="ADG76903.1"
FT                   /translation="MLGRGERPVMTIHVLHAGDGYTYLTRNTASGDRVREGRDQLSAYY
FT                   LEGGTPPGRWHGRGLAALAAHSPASEHATGPVAGQVTEAQMKALFGEGLHPDADAMMKA
FT                   GASVKDVKLGNKFPVFANEIPVLVAFNTAVKEHEREHGAAPSKEVRDALWKQVARTEFE
FT                   RANPNEPGADDKRVLAWAAKEKGKVRQPVAGYDLTFTPVKSVSVMWALADPETRAKIET
FT                   AHQAAVGDALSWLEDNAVFTKRGARGEQQLSTAGLTVAQFDHYDTRAGDPNLHTHCAVS
FT                   NKVLGSDGRWGAINSLPFFNNAVAASQRYNAVLAETLRAELGVEFVARQVGRGKQPIME
FT                   IAGIDTALLDGFSTRRAQVRARHEQLLAQYIADHGHTPGKHAEYALFQQATLETREGKD
FT                   VGPEGSGSLGKQLTAWQSKARALAPEQAQGEQLLAQCRIAGREALAAISNDPDAAPDRA
FT                   WHGPAAAAEEVLHKVCEQRSVWRETHLRTAAEAIIAAKLLPSGSDRRELVDTVVERALA
FT                   ESMIVGPGHELLDTTTGEIPERLRRDNGEHVLTNPGGPLLTSSRIVDAENTILDAAATP
FT                   TAHVATNAVIDAGIASVEENEPFPLNAGQAELVRHFCGSGALVAAGVGPAGTGKTTSMK
FT                   ATVAAWTADANRLPGAAVNRQVIPLAPSAVAATKLGDEIELTGNTIDSFTYWWTAMGGR
FT                   ETYLTAHQVLADPDAGFLARRDARDALKRCPTGAMYLVDEAGMASTRNLAIMVDIAEQT
FT                   GGVVRFLGDPYQLDAVTTGGAFAMLARATDAPELTDVVRFGTDTQQAENSLALRAGDEA
FT                   ALDLYEQRGWTHHHNTAGEAIDEMVAAHLADTASGRNSIVLASTREEVAAINAQIQAHH
FT                   RSGGRAQAGRTVDLSDGLAAGVGDRIVTRDNDSDYRQIGGKRANSRVLNGDLWNVEKIH
FT                   SDGSLTARHIEDGGRIHLPASYLTANT"
FT   gene            complement(267433..268332)
FT                   /locus_tag="Tpau_0254"
FT   CDS_pept        complement(267433..268332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0254"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   msm:MSMEG_4105 transposase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76904"
FT                   /db_xref="GOA:D5UMQ3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D5UMQ3"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADG76904.1"
FT                   /translation="MYPLVKELADDGVPVTVSCRVLKLSRQPYYRWLAAPVPATELVEA
FT                   YRANALFDASVDDPEFGHRLLADEARAAGEPMADRTAWRICRDNRWWSVFGKKRSSKGG
FT                   KPGPAVHDDLCTVTDEHGRTRHRFTADAPNRLWLTDITEHRAREGKLYLCAIKDAYSGR
FT                   IVGYSVDSRMKARLAVNALNNAVAMRGDVTGCIVHSDRGSQFRSRKFRRALEYHGLRGS
FT                   MGRVASCGDNAAMESFFSLLQNNVLDRHCWATRQELRTAIITWIERTYHRRRRQRRLGR
FT                   LTPIAFESTMNPAAPHAA"
FT   gene            complement(268332..268625)
FT                   /locus_tag="Tpau_0255"
FT   CDS_pept        complement(268332..268625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0255"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   mlu:Mlut_10240 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76905"
FT                   /db_xref="GOA:D5UMQ2"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D5UMQ2"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ADG76905.1"
FT                   /translation="MPKPYPKEFRDDVVRVARNREPGVRLKQIAADFGISESCLMNWVK
FT                   TADVEAGSKSGSSAAQSATERQMRKRIRLLEQENEVLRRAAAYLSQANLPGK"
FT   gene            268697..268810
FT                   /locus_tag="Tpau_0256"
FT   CDS_pept        268697..268810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76906"
FT                   /db_xref="GOA:D5UQS3"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQS3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76906.1"
FT                   /translation="MWPTNIAQVIVLALAGIVVTAAGSSLLVPQHIRGVLR"
FT   gene            269213..269518
FT                   /locus_tag="Tpau_0257"
FT   CDS_pept        269213..269518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0257"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76907"
FT                   /db_xref="GOA:D5UQS4"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQS4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76907.1"
FT                   /translation="MTMPLNYPPPPSPSLGECLTYALAASVLTAAGALLVAVVSMVQVR
FT                   RSRRRLVGAGVAMTDQERSTAVNAIRQLRVIRAHALVSFGFCVAVAGSCALARSLL"
FT   gene            269575..269745
FT                   /locus_tag="Tpau_0258"
FT   CDS_pept        269575..269745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76908"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQS5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76908.1"
FT                   /translation="MATDQKATTRRPMTESAAVEKHVRVMLDLLAAPRLVREQGVTVGR
FT                   TGDARTQRVVR"
FT   gene            269742..270095
FT                   /locus_tag="Tpau_0259"
FT   CDS_pept        269742..270095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76909"
FT                   /db_xref="GOA:D5UQS6"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQS6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76909.1"
FT                   /translation="MTPPTEVAAECVRTYTPASWAICNAVQDGSLVRYLTVLMIAGVIA
FT                   AAVALLVTVAILVQVRRAQARLGRDGTGMSPREMSVAASRIRQLRGFTLDGLCATAGAL
FT                   IAVGLAAAMRSVL"
FT   gene            270155..270730
FT                   /locus_tag="Tpau_0260"
FT   CDS_pept        270155..270730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76910"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQS7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76910.1"
FT                   /translation="MQGLNERSPDNGGEAVAAHLREVLDMLAAPALVREQVVFASSVRM
FT                   WPPRPGWDRTPGIGSIRLWTDCDLLAWFDAAAADGVALFGQQSRDEIRALTQATAMARM
FT                   CGEGAKAIWGLDVLGPGDYSPIPTSMKRVLWANDLVCFGPQLTEEQTAQIQAHLDDGHD
FT                   GHGRQETNAPVAVHGTECFATVWMGGTA"
FT   gene            270787..271530
FT                   /locus_tag="Tpau_0261"
FT   CDS_pept        270787..271530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76911"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQS8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76911.1"
FT                   /translation="MGTKQSTKKGPSYAEINEKLVRKAIVDNRGELARLDSTTAIREWF
FT                   DAWVATVDTEPQFVWKLFLRELNKGVGVNSAELWAKEQAEHRAQVAEAARVAPLLRVCT
FT                   AGFVGETPDGETVASWAICNAQADQSSRAYGEINPDKQKSYDPEDPNSADMVAAYKAVA
FT                   LLADAVGYLGGEAGVIRAQLVISNPNIDTDRLVSMALKDSVSLTVEHHEEADNPAVEVC
FT                   ETEVGERHWKDLAPRDFVIEGEQGQ"
FT   gene            271527..271991
FT                   /locus_tag="Tpau_0262"
FT   CDS_pept        271527..271991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76912"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQS9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76912.1"
FT                   /translation="MTEVADREELNMQEENVIPEVVGHLLAEGFSTSETGFDASGQRRW
FT                   WLLTLDEQAWVGVVADADGEPVGRAWIAADDTLAWCDAIPTGAVAATMMAHGSPYWHHV
FT                   DGIEFDESETARTWQDWLTGSLVTPGPALLAAMERFSAARAGARSEGAHG"
FT   gene            271984..273735
FT                   /locus_tag="Tpau_0263"
FT   CDS_pept        271984..273735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0263"
FT                   /product="conjugal transfer protein"
FT                   /note="KEGG: cms:CMS_2699 conjugal transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76913"
FT                   /db_xref="GOA:D5UQT0"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032689"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQT0"
FT                   /inference="similar to AA sequence:KEGG:CMS_2699"
FT                   /protein_id="ADG76913.1"
FT                   /translation="MDRATRGPVIVSGLLAVAAFAVLVVPSIISSGKGPAVLMLLGGVL
FT                   VLVGGLVAVVRMQRSSAGGGASSPVTCKIDDCAQYMPSHREVEQFTAKAVKKTALRLSR
FT                   DGFDPKNPATWGLDLGTLVPTRHALMLDFESCIFVVAGMRRGKSQAFAIPWTLDGPGAV
FT                   IVTSNKIDVYRETSVLRRRAGHREWLFDLQDLTGSGAPEIRFDPFEMITDLETAMQAAG
FT                   HFVSSVQKKGATAHSYFDNAGVRILAAYMLAASLIGGDLLHVARWLDKPRETLAAEILI
FT                   EYGFSDLGSQVKARNQLDPRQQEGFFDPARMFIEAVVNPKFARWVVPEERGVIARHPET
FT                   GKHIVKDVKDSRPVFKAAEFVRSTDTLYALSQHGEGSPAPLVTALVGIVIETARTVANR
FT                   EQGGRLKRPIIAILDEVANICRLKGLPNMMSYCGSIGVVLAPILQSKTQGENIWGDEFT
FT                   AAWNSANAVAYLGGNRDDELEREISARIGDQDKTRENKSYSSGSTNYSENTSREPIMPP
FT                   ELVGELPKGRGILLASGCRPVVIAPSMAYQSKRAGEIDAAKKEYDASHRVRANDLEDNT
FT                   EGERKAA"
FT   gene            273732..274226
FT                   /locus_tag="Tpau_0264"
FT   CDS_pept        273732..274226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0264"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rer:pREC1_0028 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76914"
FT                   /db_xref="InterPro:IPR032584"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQT1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76914.1"
FT                   /translation="MSDLDSFDFALDDEDEYGTTAGHNSGDGKKVEQEFTTIAEFVDGV
FT                   IIKLITRDSGEYFWLPTWFDYPEVVERLEHLWRDYELARAQEESMTGWWLYRFDPTWAV
FT                   LTSRFGPMGIGEPREPLRAAIAPDGHRVHLVIEMKFATEAPEPSTGGAPVASEQFENLD
FT                   D"
FT   gene            274219..274860
FT                   /locus_tag="Tpau_0265"
FT   CDS_pept        274219..274860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76915"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQT2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76915.1"
FT                   /translation="MTDPQASEARDLHPAREHEHEPQRPQVVEVELTDNEYTLSVRDAQ
FT                   GNVVDAVSGLLPSGIPAAEFLRQQGVQVSEGSWEFAHLTRGDETVGGWRAQGTTTTGWD
FT                   ATKERVGGRNAARAVPVANEPPTGPSRGAEADRGVRAGDSERTISVSEQSIDAAAARSA
FT                   DGLRSAAEHDGAIEQTARAEVNFDHAMTTNAYTGDDQTWRQNRPTTATAP"
FT   gene            275068..275673
FT                   /locus_tag="Tpau_0266"
FT   CDS_pept        275068..275673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76916"
FT                   /db_xref="GOA:D5UQT3"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQT3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76916.1"
FT                   /translation="MARRRRESHRRLNLETGSDLILLSPRDATRYARNTQLRAAVAYPG
FT                   VFLLLFGLLAVTYAQVVSGFDPALGLVGVIGTVALAAGIGAALLVTFALRVTPVDDPLT
FT                   HAELDSYPGDVATTIRVGLAGLMPGGIGPGEYRPLAVARNRGLRRKYENGWDSVEIARV
FT                   QYRDAACPPGDRIPGLNRDQGEQRRLQVNPGTPTISED"
FT   gene            275927..277090
FT                   /locus_tag="Tpau_0267"
FT   CDS_pept        275927..277090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0267"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   art:Arth_1766 transposase IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76917"
FT                   /db_xref="GOA:D5UQT4"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQT4"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ADG76917.1"
FT                   /translation="MTAAPAVGQEPIIVGIDTHKETHHAAILSARGKFLADRKFPATAL
FT                   GYSQLLTWTATVGTVAAFGIECTGSYGAGLLRHLLAEGHDVREVNRPHAHTAARRGKTD
FT                   AIDAEAAARKVLAGEAPVVPKDTTGAVESIRMLTLARNSAVKARSTAQTQLQNVLITAP
FT                   HTLREQINSDVSGPKARVAACSRLRPNISRLNEPAQAAKLTLRSLAQRVESLDDEIATL
FT                   DRELGQLVAATTPTLVSKLGIGTGHAAQFLISAGGLTPCSWTRVIQHMAGGSENPRMAR
FT                   KSYTDEFRCRAVDLYESTPGATLQGIAADLGVSRGSLKGWVDKLGSGTRTASAAAGVSV
FT                   GRRESQAARITRLEAENGVLRVEQAKLAEERDILRQAAKYFAGETSW"
FT   gene            277087..277995
FT                   /locus_tag="Tpau_0268"
FT   CDS_pept        277087..277995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0268"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   mva:Mvan_0583 integrase catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76918"
FT                   /db_xref="GOA:D5UQT5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQT5"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADG76918.1"
FT                   /translation="MNRFQFVEDHKDAYGVKRLCQVIGIARSSFYAWLAAAQGRAARTA
FT                   ADSVLAGRIRVLQDPKQGGDRAYGAPRITADLNAGAAESERVNHKRVARVMREHGLAGI
FT                   RLRKRVKTTVPDQSGRRFPDLIGRNFSTGGPGRRYVGDITYLPIADGSNLYLASVIDLG
FT                   SRKLAGWSMATHMRTELVENALRAAQRERGTLAGAIFHSDHGSVYTSKAYTALCEHFGV
FT                   TQSMGAIGSSADNALAESFNATLKRELLQGRPAFGDQATAYRAVFRWANRYNTRRRHSA
FT                   IGNITPNTYETAYRATLTQAA"
FT   gene            278036..278356
FT                   /pseudo
FT                   /locus_tag="Tpau_0269"
FT   gene            278376..279470
FT                   /locus_tag="Tpau_0270"
FT   CDS_pept        278376..279470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0270"
FT                   /product="N-acetylmuramoyl-L-alanine amidase family 2"
FT                   /note="KEGG: cjk:jk0553 putative secreted protein; PFAM:
FT                   N-acetylmuramoyl-L-alanine amidase family 2; SMART: Animal
FT                   peptidoglycan recognition protein PGRP"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76919"
FT                   /db_xref="GOA:D5UQT6"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006619"
FT                   /db_xref="InterPro:IPR015510"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQT6"
FT                   /inference="protein motif:PFAM:PF01510"
FT                   /protein_id="ADG76919.1"
FT                   /translation="MGISRSVSRRTALIAGATFTAAIAGGGQRAVGAPVPTQLGPAGYV
FT                   SVDLTGTQGQRVALRIGLPGGKSVEIAVRRTTHGRDDRPLPNTSELIALPPDTIDLEVI
FT                   TDAGISISPTRYRIATAPNFQAPVATHYGWGFPVVTRSGWGADPALQTWGEPEYTPAQL
FT                   ITVHHTAQPRGDEFIDYRDAIRSIYRFHALPEAEGGRGWGDIGYHLIIDPNGVIYAGRD
FT                   TGTEAPIFTPGTTSLKPRTSVVTAGHVYQANSGNIGICVIGDFTGSQPTPAARAALTQV
FT                   LSALCQQLQLNPQAAVQYANPNNAVRATQWAVSGHRDWSKIAGPTECPGDELWALLPAL
FT                   RSATELKIADENRVPRTAPSAPVS"
FT   gene            complement(280311..280439)
FT                   /locus_tag="Tpau_0271"
FT   CDS_pept        complement(280311..280439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76920"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQT7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76920.1"
FT                   /translation="MSEQDNGPQKRQSPTTWTVISLLVQAARLVVDLVRLIRDSVI"
FT   gene            complement(280680..281588)
FT                   /locus_tag="Tpau_0272"
FT   CDS_pept        complement(280680..281588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0272"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   mva:Mvan_0583 integrase catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76921"
FT                   /db_xref="GOA:D5UQT5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQT5"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADG76921.1"
FT                   /translation="MNRFQFVEDHKDAYGVKRLCQVIGIARSSFYAWLAAAQGRAARTA
FT                   ADSVLAGRIRVLQDPKQGGDRAYGAPRITADLNAGAAESERVNHKRVARVMREHGLAGI
FT                   RLRKRVKTTVPDQSGRRFPDLIGRNFSTGGPGRRYVGDITYLPIADGSNLYLASVIDLG
FT                   SRKLAGWSMATHMRTELVENALRAAQRERGTLAGAIFHSDHGSVYTSKAYTALCEHFGV
FT                   TQSMGAIGSSADNALAESFNATLKRELLQGRPAFGDQATAYRAVFRWANRYNTRRRHSA
FT                   IGNITPNTYETAYRATLTQAA"
FT   gene            complement(281585..281914)
FT                   /locus_tag="Tpau_0273"
FT   CDS_pept        complement(281585..281914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0273"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   nca:Noca_2153 transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76922"
FT                   /db_xref="GOA:D5UQT9"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQT9"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ADG76922.1"
FT                   /translation="MARKSYTDEFRCRAVDLYESTPGATLQGIAADLGVSRGSLKGWVD
FT                   KLGSGTRTASAAAGVSVGRRESQAARITRLEAENGVLRVEQAKLAEERDILRQAAKYFA
FT                   GETSW"
FT   gene            282026..283240
FT                   /locus_tag="Tpau_0274"
FT   CDS_pept        282026..283240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0274"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   transposase IS111A/IS1328/IS1533; KEGG: sen:SACE_4185
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76923"
FT                   /db_xref="GOA:D5UQU0"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQU0"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ADG76923.1"
FT                   /translation="MQPIYVGVDIGKRFHHACVIDATGSVLLSRQVLNSESDLNAIAAE
FT                   VERQAEGAAVWVIDVVSEISALLLAILAAREVAHVVRYVPGAAVSAMSKSFVGEGKTDA
FT                   RDAKVIAELGRLRRSLRTVSLRDDATAALTTLTSYRSDLAAEWVANINRLRAILTSIFP
FT                   GLEQQLDLSTKFPLILVSMFCTPTAVIEAGEKGVHEALLTAGVYRNSAARLAAAAMESA
FT                   RHQSVRGAGESDIAALTMRLASRLLLLLDERKLLDKQIAELFRQHRHAALIESIPGLGP
FT                   QLGAELLVCLNGDIRNFANAGKLASYAGLVPVPRDSGRISGNMRRPRRYNRRLRRVFYL
FT                   AAMTSLKDPDSRSRQYYDRKRSENRTHTQATLALARRQVDVLWAVLRDERPYTGAAPEG
FT                   AVMAA"
FT   gene            complement(283780..285885)
FT                   /locus_tag="Tpau_0275"
FT   CDS_pept        complement(283780..285885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0275"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nca:Noca_4254 kinetoplast DNA-associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76924"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQU1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76924.1"
FT                   /translation="MTVCRALINPASANLRGLYVALTRGKAENHAYTATPATIDEHTED
FT                   QHLHGAGDERAADNSRAILAVVLAKDDGHKAAVEHIQEALAASTDPQTARDAYTAARDL
FT                   LVADYTDHLLAAHLPAAIVATIDADPAGKARIRSVVDQLIASGASSTVIGARLNAVHDG
FT                   LETARNLPAFIAYKINPPASAVAAQEHRAARELFVRDYTDHLLATHLPAAVVATIDADP
FT                   DSRRSIENAVDRLHAAGATDIPARFADADTRLENLSPGASYTAHLLRSLRRPTHANEQA
FT                   DPSPAQIAAHLHADPAGNAQLNAALTALAPLPDLTPEPDPADLPALPPAHPGADRSLRE
FT                   HAHHAVDSHDRATADQLAIDRPADTEPEAAQPVAAALTTEQLLAAETTPALAPGLDPAT
FT                   LAAAARAVDEATRGPDTEPATEPAETAPDTEAPADPAAAERKALAARTVAEFKQHSIRR
FT                   LPASELDYIARTGGRKHADRLRELRHHTPREVAEHEASAQRLALYERSYAREQPYRDAI
FT                   TAHRKAIDALDTARTKRDAVARELADTGRLSPRRRELARELDTRTAAVTAAEKAAEDAR
FT                   RTRSQEQARAGKHPVTDGALQAAREHTENARAEAEKAQARQQAKIAELTATITARQQAA
FT                   LTEQERRSQLDPTQLKIEQKLRGAALEHAQQQAQQRKDAARARAGRFANDPARPVSRGV
FT                   DGPTRGR"
FT   gene            286000..286293
FT                   /locus_tag="Tpau_0276"
FT   CDS_pept        286000..286293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0276"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   mlu:Mlut_10240 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76925"
FT                   /db_xref="GOA:D5UMQ2"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D5UMQ2"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ADG76925.1"
FT                   /translation="MPKPYPKEFRDDVVRVARNREPGVRLKQIAADFGISESCLMNWVK
FT                   TADVEAGSKSGSSAAQSATERQMRKRIRLLEQENEVLRRAAAYLSQANLPGK"
FT   gene            286293..287192
FT                   /locus_tag="Tpau_0277"
FT   CDS_pept        286293..287192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0277"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   msm:MSMEG_4105 transposase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76926"
FT                   /db_xref="GOA:D5UMQ3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D5UMQ3"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADG76926.1"
FT                   /translation="MYPLVKELADDGVPVTVSCRVLKLSRQPYYRWLAAPVPATELVEA
FT                   YRANALFDASVDDPEFGHRLLADEARAAGEPMADRTAWRICRDNRWWSVFGKKRSSKGG
FT                   KPGPAVHDDLCTVTDEHGRTRHRFTADAPNRLWLTDITEHRAREGKLYLCAIKDAYSGR
FT                   IVGYSVDSRMKARLAVNALNNAVAMRGDVTGCIVHSDRGSQFRSRKFRRALEYHGLRGS
FT                   MGRVASCGDNAAMESFFSLLQNNVLDRHCWATRQELRTAIITWIERTYHRRRRQRRLGR
FT                   LTPIAFESTMNPAAPHAA"
FT   gene            287267..287596
FT                   /locus_tag="Tpau_0278"
FT   CDS_pept        287267..287596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0278"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   nca:Noca_2153 transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76927"
FT                   /db_xref="GOA:D5UQT9"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQT9"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ADG76927.1"
FT                   /translation="MARKSYTDEFRCRAVDLYESTPGATLQGIAADLGVSRGSLKGWVD
FT                   KLGSGTRTASAAAGVSVGRRESQAARITRLEAENGVLRVEQAKLAEERDILRQAAKYFA
FT                   GETSW"
FT   gene            287593..288501
FT                   /locus_tag="Tpau_0279"
FT   CDS_pept        287593..288501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0279"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   mva:Mvan_0583 integrase catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76928"
FT                   /db_xref="GOA:D5UQT5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQT5"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADG76928.1"
FT                   /translation="MNRFQFVEDHKDAYGVKRLCQVIGIARSSFYAWLAAAQGRAARTA
FT                   ADSVLAGRIRVLQDPKQGGDRAYGAPRITADLNAGAAESERVNHKRVARVMREHGLAGI
FT                   RLRKRVKTTVPDQSGRRFPDLIGRNFSTGGPGRRYVGDITYLPIADGSNLYLASVIDLG
FT                   SRKLAGWSMATHMRTELVENALRAAQRERGTLAGAIFHSDHGSVYTSKAYTALCEHFGV
FT                   TQSMGAIGSSADNALAESFNATLKRELLQGRPAFGDQATAYRAVFRWANRYNTRRRHSA
FT                   IGNITPNTYETAYRATLTQAA"
FT   gene            288586..289368
FT                   /locus_tag="Tpau_0280"
FT   CDS_pept        288586..289368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0280"
FT                   /product="F420-dependent oxidoreductase, G6PDH family"
FT                   /note="KEGG: mva:Mvan_5448 luciferase family protein;
FT                   TIGRFAM: F420-dependent oxidoreductase, G6PDH family; PFAM:
FT                   Luciferase-like, subgroup"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76929"
FT                   /db_xref="GOA:D5UQU6"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019945"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQU6"
FT                   /inference="protein motif:TFAM:TIGR03557"
FT                   /protein_id="ADG76929.1"
FT                   /translation="MDMRFGYTLMTEQAGPAQLVRDAVAAEEAGFDFEVSSDHYSPWLL
FT                   AQGHAPYAWSVLGAVAHVTSRVDLMTYVTCPTIRYHPAVVAQKAATMQLLADGRFTLGL
FT                   GSGENLNEHVVGEGWPGIRDRQAMLSEAIEIIRKLHAGGTVDFRGEYFQVDSARIWDLP
FT                   DNGVPIGVAVSGDRGVSEFATLADHLISTDPRRSLVEKWNANPGTTLIGQGARAIGQLP
FT                   ICWDREKNAAIERAHGLFRWFAGGWGVNADLPTPRACC"
FT   gene            289404..290277
FT                   /pseudo
FT                   /locus_tag="Tpau_0281"
FT   gene            complement(290280..290714)
FT                   /locus_tag="Tpau_0282"
FT   CDS_pept        complement(290280..290714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0282"
FT                   /product="protein of unknown function UCP032285"
FT                   /note="PFAM: protein of unknown function UCP032285; KEGG:
FT                   cgb:cg1510 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76930"
FT                   /db_xref="InterPro:IPR011235"
FT                   /db_xref="InterPro:IPR038231"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQU7"
FT                   /inference="protein motif:PFAM:PF08877"
FT                   /protein_id="ADG76930.1"
FT                   /translation="MGFSAFRVWASKFGLTVSVEPEAQNSDYESGVAQIAGREWHVRTA
FT                   RNTPTKPGAFVAFWRRGMDGQTLPFSVERLDAGLLVFVESEGRRGVFKFSASHLAELGI
FT                   ASASDRGGKRGFRVYPSWCEGLNPQARATQRAQAPAFDEY"
FT   gene            290779..290997
FT                   /pseudo
FT                   /locus_tag="Tpau_0283"
FT   gene            complement(291081..292820)
FT                   /locus_tag="Tpau_0284"
FT   CDS_pept        complement(291081..292820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0284"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding protein"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; thiamine pyrophosphate protein central region;
FT                   thiamine pyrophosphate protein TPP binding domain protein;
FT                   KEGG: msm:MSMEG_3964 pyruvate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76931"
FT                   /db_xref="GOA:D5UQU8"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQU8"
FT                   /inference="protein motif:PFAM:PF02775"
FT                   /protein_id="ADG76931.1"
FT                   /translation="MGAGTVADSMVRTLHASGVRRMYGVAGDSLNGLTDALRRDGRVEW
FT                   AHVRNEEAGAFAAGAEAELTGNLSVCVGSCGPGNLHLINGLYDANRNKVPVLAIAAHIP
FT                   RVEIGSSYFQETHPTAIFSECASYVELVSDVEQFSWVFSQALAHAVATSSVAVVVIPGE
FT                   IFFADAPAKDVPAVRPPDSATVPGAEAVASAVAAIDGAQRPAILAGVGAATGRAEVLAF
FT                   AERIKAPIVHSLRAKVWAEWSNPFDAGMTGLLGYDSGYRAIEHCDLLVLLGTDFPCRAF
FT                   LPDDTPVVQLDARGEHIGRRVPVQYPLVGTVKETVATMNRLVQEKTDRTFLDTVREHYR
FT                   RRRAKFDALAESGGPETSPLHPQHVAAIIDRLAADDAVFTCDVGTPTVWFARYIKMNGS
FT                   RSMIGSFCHGSMANALPQAIGAQCAAPHRQVIALCGDGGLSMLMGELLTLRQLNLPVKI
FT                   FVFTNESLAFVELEMKEAGLINHATSLTNPDFAKVADAAGLHGLRVQQASQLEGVVRDA
FT                   LAYPGPTLVDVAVARQELSIPPNVTLKQAKGFSLYATRTILSGRGDELVDVVKTNLREI
FT                   RAL"
FT   gene            293552..293983
FT                   /locus_tag="Tpau_0285"
FT   CDS_pept        293552..293983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0285"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="KEGG: rsa:RSal33209_0055 MarR family transcriptional
FT                   regulator; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76932"
FT                   /db_xref="GOA:D5UQU9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQU9"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADG76932.1"
FT                   /translation="MPEADSSDHDLGLDITIAALRFLRDTRNGAPVSPEQLSLLTTLAC
FT                   NGAPVGLKELASIEKINRSTLTGFLNLLEQSGLVIRCPHPYDSRRVTARITSYGYEVID
FT                   QCKKYYGDQLRKMDVTSRRLIQLCARLHPQMLDLARFEE"
FT   gene            complement(294186..294719)
FT                   /locus_tag="Tpau_0286"
FT   CDS_pept        complement(294186..294719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0286"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_1242c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76933"
FT                   /db_xref="GOA:D5UQV0"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQV0"
FT                   /inference="similar to AA sequence:KEGG:MAB_1242c"
FT                   /protein_id="ADG76933.1"
FT                   /translation="MRSSTRLVDRFITLLTGLVLLGIGGWLLAYRLGERHIVSASQRLI
FT                   PDKIADTPDSPWWNPAVGIAGVALVLLALWLLLQHLRTNTAKTVATAHGGTVDLTKVAT
FT                   AVAEDLSTSPLIRKARSTTIQHKDQPTIQVRVTIAPGAPVQELAELARAAQTEVTAATN
FT                   PDIGLQLLVDSEDK"
FT   gene            complement(294716..295498)
FT                   /locus_tag="Tpau_0287"
FT   CDS_pept        complement(294716..295498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0287"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_1243c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76934"
FT                   /db_xref="GOA:D5UQV1"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQV1"
FT                   /inference="similar to AA sequence:KEGG:MAB_1243c"
FT                   /protein_id="ADG76934.1"
FT                   /translation="MTTEPVALTTDGSEREAPDRTARNDKGSTVIDDRVRRRLVEHAVR
FT                   SASGTAEERGLTSLIGLGLPSVEFSNNDRSVDVKIAAIWPFNSAHLVSEVQSSINNELA
FT                   RSLAERPNTARVHIARVIERRPGSKAPAASGSALKEGEPSDPSVRTVPRKTAGSVFVAI
FT                   PVLLVLMAVGIVAIRDTVIWFGWAHGSRWIDAVLRIADDLKWEWWTWPAAIAAVALGGI
FT                   FVTAALKPRRRSHTAVTDHLWFGRTLHSRRREEFEVPS"
FT   gene            complement(295501..295686)
FT                   /locus_tag="Tpau_0288"
FT   CDS_pept        complement(295501..295686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0288"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_1244c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76935"
FT                   /db_xref="GOA:D5UQV2"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQV2"
FT                   /inference="similar to AA sequence:KEGG:MAB_1244c"
FT                   /protein_id="ADG76935.1"
FT                   /translation="MTPGNFTVWGTVIGLLVAIAIVTGGIVGFLLAVVFGAAGLAIGAH
FT                   FDGLIDLTALRKSGRS"
FT   gene            complement(295692..296018)
FT                   /locus_tag="Tpau_0289"
FT   CDS_pept        complement(295692..296018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0289"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mab:MAB_1246c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76936"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQV3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76936.1"
FT                   /translation="MSNNRAVLVDRVVEVVTAINGVAGLHAGGTGAPATYLPGRTITGI
FT                   RFDGRRGQVDIVAEYRRDSDLRALAERVGEAATESAGVPVDVVVADIVPPSKPDYGNGV
FT                   SPKE"
FT   gene            complement(296015..296491)
FT                   /locus_tag="Tpau_0290"
FT   CDS_pept        complement(296015..296491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0290"
FT                   /product="protein of unknown function DUF322"
FT                   /note="PFAM: protein of unknown function DUF322; KEGG:
FT                   mab:MAB_1247c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76937"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQV4"
FT                   /inference="protein motif:PFAM:PF03780"
FT                   /protein_id="ADG76937.1"
FT                   /translation="MASNTSTSTASDSAEKKATGSELATSNGRGGTSIADVVVSKIAGI
FT                   AAREINGVYDLGGQAARVVGKIRETLPGSPDLTQGVNVEVGEKQAAVDIGIVAEYGVAI
FT                   HDLATGIRNNVIDAVEKMTGLEVTEVNITVHDVHLDEEDYDDDASSSPSEPRVQ"
FT   gene            complement(296615..296935)
FT                   /locus_tag="Tpau_0291"
FT   CDS_pept        complement(296615..296935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76938"
FT                   /db_xref="GOA:D5UQV5"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQV5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76938.1"
FT                   /translation="MKRSLSGVVLIFLGIALLAFGVVALGFQNSVAGWAFVAVGVMTIM
FT                   LGAAALLSIRYGADRHVDKDRGELDPILGDGATSSAEERKFAERYRENSHEAGGRHRAR
FT                   GV"
FT   gene            complement(297464..298561)
FT                   /pseudo
FT                   /locus_tag="Tpau_0292"
FT   gene            complement(298595..299371)
FT                   /locus_tag="Tpau_0293"
FT   CDS_pept        complement(298595..299371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0293"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76939"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQV6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76939.1"
FT                   /translation="MIDSMGHDRQDRFPDDHVPGGNAGRPWQPRGDLGDLDPDALFGAF
FT                   GQPLTDGPTIEWMPGMADQMLRELAPLLAEDGIDITADALDTDLATLQAALDRAVARHN
FT                   HTLATPTGEQRSWCTSTLRLLAESIDTDNLDLAEGILETVPPESPDGKATVAGVIGVGA
FT                   QLLDSWLTTPPAGINKTAAATIVIRPPRWHGERAAIDLLALARKNKAHLSHGKIIAAHG
FT                   GHTTLYGTALAVTAVLAAWADHTKTTVTNLAGTHLR"
FT   gene            complement(299408..300718)
FT                   /locus_tag="Tpau_0294"
FT   CDS_pept        complement(299408..300718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0294"
FT                   /product="transposase mutator type"
FT                   /note="PFAM: transposase mutator type; MULE transposase,
FT                   conserved domain; KEGG: kse:Ksed_06390 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76940"
FT                   /db_xref="GOA:D5UQV7"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQV7"
FT                   /inference="protein motif:PFAM:PF00872"
FT                   /protein_id="ADG76940.1"
FT                   /translation="MPVLAVVENKRDGSGETGDSEAPRSLLDEIVRDGARRMLAAALEA
FT                   EVAAYVASCAGEVDEAGRRLVVRNGHHAAREVVTAAGAVPVKAPRVNDKRVDEVTGERR
FT                   RFSSSILPAWARKSTQVAEVLPLLYLHGLSTSDFTPALTQFLGTSAGLSPATITRLTRD
FT                   WQAEAAAFGTRSLAETDYVYVWADGIHLKVRLAQEKVCLLVLIGVRADGSKELIALDDG
FT                   YRESTQSWLDLLRSCKRRGMRSPVLAVGDGALGFWAALREVFPETREQRCWFHKIANVI
FT                   NALPKSVQRSAKAALTEIWNAQDREHAEKAARVFVADYAAKWPKAAAKITDDLDVLLAF
FT                   YDYPAEHWVHLRTTNPIESTFATVRLRTKVTKGPGSRAAGIAMAFKLIQAAQTRWRAVN
FT                   APHLVALVRAGARFDQGRLVERAATTPETTAADDAAA"
FT   gene            301522..301731
FT                   /locus_tag="Tpau_0295"
FT   CDS_pept        301522..301731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0295"
FT                   /product="CsbD family protein"
FT                   /note="PFAM: CsbD family protein; KEGG: mab:MAB_1241c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76941"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQV8"
FT                   /inference="protein motif:PFAM:PF05532"
FT                   /protein_id="ADG76941.1"
FT                   /translation="MSISDDAQNKAEDLKGRAKEAAGAVSGNEDLKTEGKADQVEAQIK
FT                   DKVADVADAVKSGVDAVKDKLSGN"
FT   gene            301832..302647
FT                   /locus_tag="Tpau_0296"
FT   CDS_pept        301832..302647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0296"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: rop:ROP_07010
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76942"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQV9"
FT                   /inference="protein motif:PFAM:PF07681"
FT                   /protein_id="ADG76942.1"
FT                   /translation="MIRRIARALLGSYFIYSGANTLLRPGETAHAAAGVVHKAQETFPE
FT                   APLPASPAAWARALGGVQLSAGTLLALDRLPRLSALTLAGSLAAATATENRFWSESDPG
FT                   IREEATVHFLKNISLIGGLVIVGLDTEGEPGVVWRTKRAGRRAADRAAAAVAVLNPAAD
FT                   NGSDTKNLAAELQEKAHDTAEKLGDRLADTREVIERNIAHAGEMAAPVASTLAQAAGTQ
FT                   AARLSTAASETLTDLREHAPAYAEQVRDNAQRLVATAQDHTPAVRQPQA"
FT   gene            complement(302887..304365)
FT                   /locus_tag="Tpau_0297"
FT   CDS_pept        complement(302887..304365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0297"
FT                   /product="condensation domain protein"
FT                   /note="PFAM: condensation domain protein; KEGG:
FT                   nfa:nfa30230 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76943"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQW0"
FT                   /inference="protein motif:PFAM:PF00668"
FT                   /protein_id="ADG76943.1"
FT                   /translation="MISGFAEHWQCPTGEWVVWAPDANTCEAMRNAPDLGVETSFIQAD
FT                   HLRSGIEGESCVRRLVFTSFTVHDKFDAETIAKVFTDFVRAHETFHTAFPVSTDLRPRG
FT                   RTLRPEQISLAVTARSQDHPERTVKDHLIESVPTLHEWAAFAFAVNGIENAGPDAVDPH
FT                   FQVVVGSDHMFTDGVSQAISFFEILSRYTAARTGTPYEPVPVRPYPQFCAEQRALAATL
FT                   TPTHPDVEQWRDTLARAGGMPKFPLPLGLGPGEAAPGKIAVHASFVDAAQAARFGAAAK
FT                   QAGGNTSSALLAVLGQVHHALTGERLFTMLIPRADRSATGDAMAVGWYVTLVPVQFDAS
FT                   GTFAEATRNAQEALGVARQLDRTPVFPVIDMLANDPGFPVQHGFTSPMLSYIDVTRVPG
FT                   AELARQHDFSVFANATPSREVFMWINRDESGLDFNAQHPETVEATRAVDTVFRLLRDRI
FT                   IEVGKALGLRETGLSTVSVDSSGSSANGIAPGQL"
FT   gene            304595..304720
FT                   /locus_tag="Tpau_0298"
FT   CDS_pept        304595..304720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76944"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQW1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76944.1"
FT                   /translation="MLVHHVMLSAATATPVVTAKSQHAHNNRDGTHTFKHASMLR"
FT   gene            complement(304793..305662)
FT                   /locus_tag="Tpau_0299"
FT   CDS_pept        complement(304793..305662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0299"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rer:RER_02300 porin MspA"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76945"
FT                   /db_xref="InterPro:IPR015286"
FT                   /db_xref="InterPro:IPR036435"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQW2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76945.1"
FT                   /translation="MTKKSNYRPIMVAHPLGRRSLSAAIATGILLVATPLQVQASPVSP
FT                   SNERAGAVQERMVTKTTPTGVVMKVGLRSPRVESYPPLDSSPFSREAFLSMRGSAILTG
FT                   QKDAIKSSRTKLDMGYQIGYPMSVAKDGAKIGIVTPNLTVNAGVKPEAGVGANAGVTPK
FT                   FGVNGSATGGGGTSGGNGSGTVGGNVGADVPLGVNASSKVGAELGVKSDIIPSQKIDFT
FT                   IGHGEIKEISVAKFELKQDDAILDVDGTEISVTAMAGRVSIRPYVRASIETAKGISTTV
FT                   VYGAVAYL"
FT   gene            complement(307376..308275)
FT                   /locus_tag="Tpau_0300"
FT   CDS_pept        complement(307376..308275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0300"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   msm:MSMEG_4105 transposase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76946"
FT                   /db_xref="GOA:D5UMQ3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D5UMQ3"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADG76946.1"
FT                   /translation="MYPLVKELADDGVPVTVSCRVLKLSRQPYYRWLAAPVPATELVEA
FT                   YRANALFDASVDDPEFGHRLLADEARAAGEPMADRTAWRICRDNRWWSVFGKKRSSKGG
FT                   KPGPAVHDDLCTVTDEHGRTRHRFTADAPNRLWLTDITEHRAREGKLYLCAIKDAYSGR
FT                   IVGYSVDSRMKARLAVNALNNAVAMRGDVTGCIVHSDRGSQFRSRKFRRALEYHGLRGS
FT                   MGRVASCGDNAAMESFFSLLQNNVLDRHCWATRQELRTAIITWIERTYHRRRRQRRLGR
FT                   LTPIAFESTMNPAAPHAA"
FT   gene            complement(308275..308568)
FT                   /locus_tag="Tpau_0301"
FT   CDS_pept        complement(308275..308568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0301"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   mlu:Mlut_10240 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76947"
FT                   /db_xref="GOA:D5UMQ2"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D5UMQ2"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ADG76947.1"
FT                   /translation="MPKPYPKEFRDDVVRVARNREPGVRLKQIAADFGISESCLMNWVK
FT                   TADVEAGSKSGSSAAQSATERQMRKRIRLLEQENEVLRRAAAYLSQANLPGK"
FT   gene            complement(308608..309519)
FT                   /locus_tag="Tpau_0302"
FT   CDS_pept        complement(308608..309519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0302"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   mva:Mvan_0583 integrase catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76948"
FT                   /db_xref="GOA:D5UQW5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQW5"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADG76948.1"
FT                   /translation="MNRFQFVEDHKDAYGVKRLCQVIGIARSSFYAWLAAAQGRAARTA
FT                   ADSVLAGRIRVLQDPKQGGDRAYGAPRITADLNAGAAESERVNHKRVARVMREHGLAGI
FT                   RLRKRVKTTVPDQSGRRFPDLIGRNFSTGGPGRRYVGDITYLPIADGSNLYLASVIDLG
FT                   SRKLAGWSMATHMRTELVENALRAAQRERGTLAGAIFHSDHGSVYTSKAYTALCEHFGV
FT                   TQSMGAIGSSADNALAESFNATLKRELLQGRPAFGDQATAYRAVFRWANRYNTRRRHSA
FT                   IGNITPNTYETAYGPAARVGDI"
FT   gene            complement(309516..309845)
FT                   /locus_tag="Tpau_0303"
FT   CDS_pept        complement(309516..309845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0303"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   nca:Noca_2153 transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76949"
FT                   /db_xref="GOA:D5UQT9"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQT9"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ADG76949.1"
FT                   /translation="MARKSYTDEFRCRAVDLYESTPGATLQGIAADLGVSRGSLKGWVD
FT                   KLGSGTRTASAAAGVSVGRRESQAARITRLEAENGVLRVEQAKLAEERDILRQAAKYFA
FT                   GETSW"
FT   gene            309871..311073
FT                   /locus_tag="Tpau_0304"
FT   CDS_pept        309871..311073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76950"
FT                   /db_xref="GOA:D5UQW7"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQW7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76950.1"
FT                   /translation="MCWITRVQEQGVRPSLCNDARTSPVQMPRSSNSEVNRIAGFVWRM
FT                   PGIFDRDRDLTSSSGRRAVFPGVVPIIVAAVVVGVALILGAVSVSHRAPNGNRDDVVAA
FT                   EQKVHETQMRLDAALLGGLSEVQSVAAPAVGKAVDWQRDVTTVLGRRSELRSVYAVANR
FT                   DGSVLARAGNTPSRIAGGTRIEPPAGGFGLLQASTSGAEPIILAIALSHDQSVTVVAEF
FT                   EPRKLNSLLMRFAGDSVVLGRTGKVILSSKGYRAFSMPGAETARLGGEATSVPFATILG
FT                   SGDDAAVLASERVGGQGPVSDLLWVVVQRTPVKPAIFSLPVSKRAALVAFGLIGLSTGA
FT                   LLLWLYASTTVPLRKVIAWLELVVHDHGAATPPLAPAPRRFDEVGALTSGLLYLVKRGP
FT                   R"
FT   gene            311070..312260
FT                   /locus_tag="Tpau_0305"
FT   CDS_pept        311070..312260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0305"
FT                   /product="Mur ligase middle domain protein"
FT                   /note="PFAM: Mur ligase middle domain protein; KEGG:
FT                   dsy:DSY4395 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76951"
FT                   /db_xref="GOA:D5UQW8"
FT                   /db_xref="InterPro:IPR008337"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="UniProtKB/TrEMBL:D5UQW8"
FT                   /inference="protein motif:PFAM:PF08245"
FT                   /protein_id="ADG76951.1"
FT                   /translation="MIVLYALVVSACLALLGCGVLEQYRHHRNLHSIPIRVVVNGIRGK
FT                   SSITRLCAGALRGGGLVTVAKTTGTAARFIPPDGVDEQIHRRFGLANVIEQVGIVRRAA
FT                   SFRPDALVIECMAVLPDLQEINERKLIHSTICVICNVREDHVDEMGPTLEDIARSLSRS
FT                   MPEGGVCITAEKEYVHILREEARKRGCRLVEVESDDIGDEILAEFPFITFKENIAIALA
FT                   VAELCGVDYRAALRGMIESPADPGTVAVKEYRYRGTVITVANLFAANDPESTRMNVELL
FT                   TARGLIGRPLNVIVNCRPDRVERNGQMGALTSALDPERIILIGEPTRSARVTVPDQLAV
FT                   RIADLGGRLDFDRVLAAIASDDDGEASVVTIGNIHGNGEILLHAFETLDHNPLEAP"
FT   gene            312260..312739
FT                   /locus_tag="Tpau_0306"
FT   CDS_pept        312260..312739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0306"
FT                   /product="poly-gamma-glutamate synthesis protein PgsC"
FT                   /note="KEGG: sha:SH0532 poly-gamma-glutamate synthesis
FT                   protein PgsC"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76952"
FT                   /db_xref="GOA:D5UR99"
FT                   /db_xref="InterPro:IPR008338"
FT                   /db_xref="UniProtKB/TrEMBL:D5UR99"
FT                   /inference="similar to AA sequence:KEGG:SH0532"
FT                   /protein_id="ADG76952.1"
FT                   /translation="MSGTLSPQVASIALAIGIVLALCCYLVTNLSPGGMITPGWLAVAF
FT                   LEDIQRVPLIFGMTVATWISTILVQKWVILYGKRLFASVILISVVYSLGIYLVVHGQYP
FT                   LLFAQQTLGFIIPGLIAYQLVRQPRVPTIACTCAVTLGAYGLLASGILLDLVPAT"
FT   gene            312736..313752
FT                   /locus_tag="Tpau_0307"
FT   CDS_pept        312736..313752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0307"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO4672 secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76953"
FT                   /db_xref="GOA:D5URA0"
FT                   /db_xref="UniProtKB/TrEMBL:D5URA0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76953.1"
FT                   /translation="MIRLDLRELSARGRRLAVLCFVFVIIGGTGIGIGTARVYSRANST
FT                   EAVELLPAFSTLHFERLADPARTLARDDRGRVVAIMTDGARTVVLAGRLRTFVEPETTA
FT                   AIVASNARVLLLPRSWSAGGEGDTWFSTWYLAARETSVDLLEAATQYLTGADSDFDARG
FT                   IEYRGDAHYPGVSATGERVPGDFNDYLGVAWTFSDGATRQAPPTRSRALSSAGLVRLVF
FT                   GYRGGMPLSGHVRDPSGMAPTVDELFYGAGATIAPVTGAAVSDLGRLQPGDLLFFDTDP
FT                   DATLDQVAIYLGVDQRSEHRFIMSRREADGPTMGDTGGRSVVDRGRFASALRAVKRI"
FT   gene            313749..314651
FT                   /locus_tag="Tpau_0308"
FT   CDS_pept        313749..314651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0308"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce4411 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76954"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D5URA1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76954.1"
FT                   /translation="MTERRFRMSRRRLLIATAGLSMTSPVTGCGPLGGHATTLDGLVTE
FT                   LSNSLSPSQAYRMPNPDERASVTRGIRSLHTGGINAARAELATVGFRAELVPDAQSRRD
FT                   YVVARSERGTERAWGMLILAASTPAPDILLEVPHPRADLGTEFLGLDLLRSLPRSALLI
FT                   AGAHRRADSENADVAHNPESMFHQIAVEYSMRGAMQLQLHGFADSSLQHRDIVVSAGPG
FT                   LASPPAQDIADALDNGFDVCRAWNGRCGEIEGRTNVQAIEAASRSSPFVHLEINRTTRA
FT                   STHRQSDLKSSLIRVLRAL"
FT   gene            complement(314913..315704)
FT                   /locus_tag="Tpau_0309"
FT   CDS_pept        complement(314913..315704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0309"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   cai:Caci_1970 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76955"
FT                   /db_xref="GOA:D5URA2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:D5URA2"
FT                   /inference="protein motif:SMART:SM00530"
FT                   /protein_id="ADG76955.1"
FT                   /translation="MAHVTDSGNSGNGIDAHERRREMGRFLKARRARGSLPAGKAMTRQ
FT                   QVAELVHVSIDYYTRIEQGRATPSASVTNQIFEVFKFNADERKYIKDLVDPGATLPPSE
FT                   PSGFMHTFLAGVREVPAIIVGPHTSIHGWNAAANRIIVNFDEIPAAERTLARMIFGNAN
FT                   FRALFANIREYEILAAGVLRSTSAPSPACPKLVEEVEYLSSRYPTFKYLWARFTVSQPR
FT                   GRRELTLVDNKGNEKCFELASFQNIDDRWYRILMLIRPGAT"
FT   gene            315830..316759
FT                   /locus_tag="Tpau_0310"
FT   CDS_pept        315830..316759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0310"
FT                   /product="monooxygenase FAD-binding protein"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG: sco:SCO3245
FT                   salicylate hydroxylase (secreted protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76956"
FT                   /db_xref="GOA:D5URA3"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5URA3"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ADG76956.1"
FT                   /translation="MIGTSTVEVAVVGGGIGGLSAAVSLMSVGIDATVYERAPELGEVG
FT                   AGVSLQPNALRVYEQIGILDDIKDIGSPMNRTLYLTAGGALVEQEGYTGIGVYRPDLIE
FT                   VLKSKLPPENIKLGKQAIGYTESGNKALVEFADNTTELADVVIAADGIRSTLRRSLNSD
FT                   NDGFVFSGLMAYRGVLPTSAVPDFPAEAAIDWMGGGRFIRAYRLRNGQLLNWIAVVPTD
FT                   NIFSENWTLPGNPDELRKEFPSKNWDPLAINILKQVQTTARYALFDRDPILEWHRDRVV
FT                   LLGDAAHPMLPHDRAGRKLCNRRRDCDR"
FT   gene            complement(317426..317962)
FT                   /locus_tag="Tpau_0311"
FT   CDS_pept        complement(317426..317962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76957"
FT                   /db_xref="GOA:D5URA4"
FT                   /db_xref="UniProtKB/TrEMBL:D5URA4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76957.1"
FT                   /translation="MTESLEHTTPRVRLRHLAGWALVAYGLAAGTINALDNHGLSGRLS
FT                   GLFAGIALVIFGMMIVWRSTSTRIAGTAAALLVLGLTLAPLADNRAAQHAETDTPPNEQ
FT                   ILNAIHSDPAALAGVTAVSADGDDIRITTANPNEAEALLQVTLKHVSTGKYGTYRWVVV
FT                   ENTDGTTLVQQASRT"
FT   gene            318554..320206
FT                   /locus_tag="Tpau_0312"
FT   CDS_pept        318554..320206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0312"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_6766 PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76958"
FT                   /db_xref="UniProtKB/TrEMBL:D5URA5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76958.1"
FT                   /translation="MKLKSIRSGALTSVLAVATVVGVVGAQLAVPPTAERSSPGVEYVL
FT                   TAGDPSDGSASSGSDSSGSGSAAGESNDAPTAAGSASGTETGSPTATDTAAEKSGTAGT
FT                   ATGAQTTGTASAGTANGAAATGTQTTGTATGSAPEQPTATTTPTGTTEAAPTTAVAPAT
FT                   TQAGTAAPSAAVVPSATAPSATASSEPSPSGASTSATATPKTATGQSDAQQPTVAPSAS
FT                   PRTDTASPGGDTTVPAAPSSPFVQLARDIGGALGGLIGTGTGGLVGVVGGADFATPART
FT                   LGSSIGSAIAAVAAGAAEGAASELLGWNHGLDLIGGGLGIAGATVKGAATELGRSLPGL
FT                   GGAVLTSAEQVVVPLSKTVAGATGTAVGGAIGTSLAAVASAAATATGVGVVLVPFLAAG
FT                   LPYAGARIGGSIGGVVGDVVGDALTGGFRGAAAGGGIGGIIGGAYDSATTGTPLLAALR
FT                   ASAEAGLQGAASAGPAGAVVGAATGFPSLGAAIGELIGKVGASPFDVPGLPRIVGPTAE
FT                   LLGRTIGGGIGGAANLAIGTIGGLIGVTLGKEK"
FT   gene            320206..320835
FT                   /locus_tag="Tpau_0313"
FT   CDS_pept        320206..320835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0313"
FT                   /product="Lipoprotein LpqT, predicted"
FT                   /note="PFAM: Lipoprotein LpqT, predicted; KEGG:
FT                   mjl:Mjls_5766 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76959"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="InterPro:IPR019674"
FT                   /db_xref="UniProtKB/TrEMBL:D5URA6"
FT                   /inference="protein motif:PFAM:PF10738"
FT                   /protein_id="ADG76959.1"
FT                   /translation="MRRTLFALLTTAAVLVAAGCSGSSDEAPATTTTAATDMTLDEYLK
FT                   SHGVAVVAQTAADLKGVRIAVQQPPNWFVDSAFQLPNTFAVIADTRATSEGFTPNATVL
FT                   VHRLTGDIDPAEAIRRGPVDTTRYPGFRQDSVQIGTRDGDPSSTIRGSYDDGKGRRLAV
FT                   SSTYVIHSGAQQRLAVQLLVTTTEKQAQTLRGDVQTLVDGLKITDV"
FT   gene            complement(321366..322082)
FT                   /pseudo
FT                   /locus_tag="Tpau_0314"
FT   gene            complement(322162..323295)
FT                   /locus_tag="Tpau_0315"
FT   CDS_pept        complement(322162..323295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0315"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76960"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR039535"
FT                   /db_xref="UniProtKB/TrEMBL:D5URA7"
FT                   /inference="similar to AA sequence:KEGG:CNBK0040"
FT                   /protein_id="ADG76960.1"
FT                   /translation="MEQNTLKRRGAGLIGRDAERSAGGYTLYAPLSGDGAVYLVDEDGA
FT                   EVHRWNLPYRPGRHARLLADGSLAYNGNLVGSGEGPALFDMWRKYSGGSMARYDRDGKM
FT                   LSEVVDPLQHHDAHHLDDGRILYAALEPLTGNRARAVRGGHPGTEAAGPDGTPTVYADT
FT                   IQEVGPDGELLWSWNAFDHLDVLDFPLQAHYWREHWPLINSVQPLGDDAVVASLRSVSA
FT                   VVVIDRATGDVRTVADPETVAQQHHVTPLDSGTLLVFDNGTFRHGESVTYSRVIELDPA
FT                   DGSVVWQYADNPREAFFTPFMGGAQRLWNGNTLITEAAFGRLFEVTAEGRVVWEFVVPQ
FT                   FSAYPDPSTRTVFPAVGNAVFRAYRYPAEQVQAWGLA"
FT   gene            324014..324661
FT                   /locus_tag="Tpau_0316"
FT   CDS_pept        324014..324661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0316"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_2560 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76961"
FT                   /db_xref="InterPro:IPR013207"
FT                   /db_xref="UniProtKB/TrEMBL:D5URA8"
FT                   /inference="similar to AA sequence:KEGG:MAB_2560"
FT                   /protein_id="ADG76961.1"
FT                   /translation="MKKYVTRRFVGVIAGLGAAAVIVTGCSNASDTASSATSAAGSAAS
FT                   DATAAVGSAAASVSSAVAGATPEAKVKDSDGKEITLIGPVAAKYNAATPEQRADLGAAL
FT                   TGERSSGKRDNGVVFQQFKGGVIVAKNNNADTPAFITWGKIRDAWNVNRDTTGNPAANG
FT                   ANGSVGPLGVPTSDETTEGTVKTSTFEHGKITFDTTTGKVEVTVNGKQVAAN"
FT   gene            complement(324996..325427)
FT                   /locus_tag="Tpau_0317"
FT   CDS_pept        complement(324996..325427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0317"
FT                   /product="regulatory protein ArsR"
FT                   /note="SMART: regulatory protein ArsR; KEGG:
FT                   rha:RHA1_ro04775 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76962"
FT                   /db_xref="GOA:D5URA9"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5URA9"
FT                   /inference="protein motif:SMART:SM00418"
FT                   /protein_id="ADG76962.1"
FT                   /translation="MSSESSSDLQEVNARLEAIEQRLHALEASGDAKIVSSLRTPPDDA
FT                   ASSTELPLVRISNFFSAIGNPTRLSIIRALAEGAKTPAEILSAVEIESKGKMYHHLRTL
FT                   TGTSILARTAGGAYQISSDYMARVIAEMSAVALEVTASH"
FT   gene            complement(325435..326004)
FT                   /locus_tag="Tpau_0318"
FT   CDS_pept        complement(325435..326004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0318"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_1516 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76963"
FT                   /db_xref="UniProtKB/TrEMBL:D5URB0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76963.1"
FT                   /translation="MITFILASLLSMTVFSQHPLRAFDRLRKADRNGLVLPDWRFFAPD
FT                   PIRYDFALLFRTGTGSDNVTEWQFAQPATCSRQWRHGLWYPEQRLNKALLDVCQSALKS
FT                   LRNTNPGSAEAPLLILRSLAEISARQTSPSEQLSENMKYPYISTEKMQFAITRYGGFDS
FT                   KARMEVLYVSEASALWKNRIAKSDRS"
FT   gene            complement(326008..327711)
FT                   /locus_tag="Tpau_0319"
FT   CDS_pept        complement(326008..327711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0319"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_1515 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76964"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5URB1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76964.1"
FT                   /translation="MLSRIDKISAATTLLSSLESILVSNSKEYQAIYEDPYAANLAPTT
FT                   PTWWSAIGSKNGTRTLHCVRIVSSVICLTNANNRVKSVTSMAVLLSSALLLPKHHYGAE
FT                   GSDHAAFVSRLSVTLARCSGLRPTEVDACLWYAGLQSVLSYTVAGVTKLTNPSWLDGSA
FT                   LTGIMRTRTFGNKTVWDFMNNHPGFAKTATCITVFGEALYPVVFVLPARPREWMIRGAE
FT                   IFHITTAFTMGLNRFPWGFGSMLPAVRYITAKHSELSEKRYDRVPVFVGITSCVGLAVG
FT                   FMAQRRSTAEYRTLRAATSNFNSTDGGSIRYRSYGDPNKHTIIIEPAIGESGLDAERLA
FT                   HEIAQEYHVVVRFEELLCDGVPYSISRTLADFIGFWNEESGAAPTLLAHRSAASNSILA
FT                   AALCPDRVSGLVLMNPELPSAAGTPEEVNRRKQMDQNLAIRQFTLQMGLGWTAITPHEG
FT                   PDKSSRHLRSAFNVPHRWRNARSSLRKYFSLDPSALIAPLTILDCQISLVATREVNPKT
FT                   REILGKAQKLCEFNCVNENNSSTSSLTDPHSIRYLSREVLPALFPPTPRE"
FT   gene            complement(327823..328044)
FT                   /locus_tag="Tpau_0320"
FT   CDS_pept        complement(327823..328044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76965"
FT                   /db_xref="UniProtKB/TrEMBL:D5URB2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76965.1"
FT                   /translation="MFQTMEAPSLNRSVVADASEVLDAIDFDLQSGVVYEFTANSQRYW
FT                   TTACLMASQASVDIASGAAAEAAEAAFL"
FT   gene            complement(328558..328884)
FT                   /pseudo
FT                   /locus_tag="Tpau_0321"
FT   gene            329376..330293
FT                   /locus_tag="Tpau_0322"
FT   CDS_pept        329376..330293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0322"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mtb:TBMG_00761 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76966"
FT                   /db_xref="UniProtKB/TrEMBL:D5URB3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76966.1"
FT                   /translation="MVLARARTAAPRSSKPGVSSGELVATVGVVGKELDSLGPVLGQGG
FT                   HRSGGATLGAGEAGGDHDKDSCMGAAGERSSAQLSRTQTGAGGSVVATAAGTAGIGGAV
FT                   CPAGKPEVETVLVWSSACAAISGAAHGGARGGGPGDLVEPPCPQFTFDAVLFFAGGEGA
FT                   GGTDPLRVTRSRGLMHPIHPTGRIDIDQTAAMQRLYRGRGYLRRSRARQYLFECCRRYW
FT                   DPGIDQAIPRRQTLFACSCEAVVSRELTSSSSLTQLAPTTARSILGVSEFRCKWPDSLT
FT                   RAGWWERGSDDRDTACHGRWQATN"
FT   gene            330247..331533
FT                   /locus_tag="Tpau_0323"
FT   CDS_pept        330247..331533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0323"
FT                   /product="transposase mutator type"
FT                   /note="PFAM: transposase mutator type; MULE transposase,
FT                   conserved domain; KEGG: mul:MUL_4727 transposase for
FT                   IS2606"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76967"
FT                   /db_xref="GOA:D5UR87"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:D5UR87"
FT                   /inference="protein motif:PFAM:PF00872"
FT                   /protein_id="ADG76967.1"
FT                   /translation="MTETLHVMDDGRQPTEQELQLARELVAQAREQGASMSAPGMLRAL
FT                   TKTMLETALDEEITEHLGYDKHHIEGRGSGNSRNGARTKTVITETVGPIEIEVPRDREG
FT                   SFDPKIVAKHQRRLNGVDEIVLSLAARGLTSGDIVAHFDQIYGASISKDTISRITDKIV
FT                   EEMTGWFNRPLEPIYVAVFIDALHIKVRDGQVANRPFYAAIGVDLDGHKDVLGIWAGEG
FT                   GGESAKFWYAVLSSLKSRGVNDVFFLVCDGLKGLPASVAAVWPETIVQTCVIHLLRNSF
FT                   KYVPRQHWDTLKRDLKPIYTAIDATAAEAALDALDDTWGQKYPTMIRLWRNAWDEFIPF
FT                   LDYNIEVRRVLYSTNAIESLNARYRRAVKARGHFPTEQAALKTLYLVTRALDPSGRGQN
FT                   RWAARWKPALNAFAITFADRIPGLNRDQG"
FT   gene            complement(331543..333093)
FT                   /locus_tag="Tpau_0324"
FT   CDS_pept        complement(331543..333093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0324"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cmi:pCM2_0032 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76968"
FT                   /db_xref="UniProtKB/TrEMBL:D5URB5"
FT                   /inference="similar to AA sequence:KEGG:pCM2_0032"
FT                   /protein_id="ADG76968.1"
FT                   /translation="MVGVSPDAAWDFTRAMSLRSHVRGLSADGYSEFISCDRAAPAGVW
FT                   AVYLTDARLRYRLLGFDFDAKGDTAEIAAVARTAAQHSADQLVSMLRACGIEHVVCESG
FT                   PSGGRHVWVGLATPLSVEYVSALADLARTVFGRVQASGEWVLDIGMLSNRKTGLLRPPG
FT                   SPHAAGGASTVIAGDPTVLLPDARSTTRQQVDALVQLLQEAKAALPADAGDPIDGGGHQ
FT                   RSVTVAEAPDGHLWIPGTFRELSGPALAKVHAPITASTDASDVLFSILCSCARAHWSFT
FT                   DVHTRLAGLPGLEHARTRRSKHHPGTRERRPRKGSQSPKQVLAADWRRAIAYLADHSTT
FT                   SEDHDLPDDPDFARRTAAICQATTGIRQRADANMRRWSIRGGAADRLVLDALCEIADNV
FT                   VQLTIGADVRTLAEMAGITRERSRNALHRLSRDGWITLAAEHTGPHAAVWTLNNTSPQP
FT                   AEVPTATPAETAPERGPHVDTEESTTRVSLGAIGPGEPTPPVAEGPPAEDGGSVRFSV"
FT   gene            333298..336843
FT                   /pseudo
FT                   /locus_tag="Tpau_0325"
FT   gene            336938..337228
FT                   /locus_tag="Tpau_0326"
FT   CDS_pept        336938..337228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0326"
FT                   /product="PE domain protein"
FT                   /note="PFAM: PE domain protein; KEGG: mgi:Mflv_5460 PE
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76969"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:D5URB6"
FT                   /inference="protein motif:PFAM:PF00934"
FT                   /protein_id="ADG76969.1"
FT                   /translation="MVGLNVAPIQLLSGTNEVIANVATTSGLVGGAAGTLGAVIPAGID
FT                   DVSLMVAAGSAAHAANYLAVTVVDHAAVAQYAVSLSAVAATYVAADNAVQF"
FT   gene            337242..338579
FT                   /locus_tag="Tpau_0327"
FT   CDS_pept        337242..338579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0327"
FT                   /product="PPE protein"
FT                   /note="PFAM: PPE protein; KEGG: mkm:Mkms_0078 PPE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76970"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:D5URB7"
FT                   /inference="protein motif:PFAM:PF00823"
FT                   /protein_id="ADG76970.1"
FT                   /translation="MTFPALPPEVNVGRLMTGPGPAPLTASAAGWSVVASAASARSVFL
FT                   TSLLPRLAASWQAPETALMTKNVAMYLAYNESVRVHALLAATRHTKQAADYSAALAGMA
FT                   QIPEIAQNHVTHGVLEATNFLGINTGAIAANEAQYAAMWAQNASMMFGYLANSTANMTF
FT                   EPFLPPKPIASPSTSPISPAAAGAASVGDAVVTKLSLAAQGAAAIASSLAMRTSGSVLI
FT                   GTKMVQSIVSGALRTEDSATTSAQNATDREHATTGPKLGAQLVQQAGAAGIGGAGVAAS
FT                   SLLGLGQQAGQQSIQVATSAGVTVQPLSQLVASIDNDNRTASVGYFGARPGSPGLETLA
FT                   GGGTIAGAASVMRGAMPAQIIAPATWNTGGLTVAPPPPPPPRLLAEPVRAPQPVSSTAP
FT                   VTRSNGKQRDRVVVPATAAIPIPVYQDAPPQYETVPVDVPSAGKEG"
FT   gene            338675..338974
FT                   /locus_tag="Tpau_0328"
FT   CDS_pept        338675..338974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0328"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76971"
FT                   /db_xref="UniProtKB/TrEMBL:D5URB8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76971.1"
FT                   /translation="MIYEMNTAAHAAGTATTEQIAQATLANIKFVRTTAEAYAAANSGQ
FT                   TSLKAVAHMHEIIAVCDAEQKKLENVGISLKQNNGLITNTDMDGGDIFQGYIGL"
FT   gene            339014..339313
FT                   /locus_tag="Tpau_0329"
FT   CDS_pept        339014..339313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76972"
FT                   /db_xref="UniProtKB/TrEMBL:D5URB9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76972.1"
FT                   /translation="MPIDLIKVDYANYDTTSTLLGKSAAIADGLIAELVGNNTANLNAG
FT                   NWVGPDQGSYQDVHNACVEANERLAEVIRKAGIKVQTAATIHQAGQAQAASLYF"
FT   gene            339315..340178
FT                   /locus_tag="Tpau_0330"
FT   CDS_pept        339315..340178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0330"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nfa:nfa8210 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76973"
FT                   /db_xref="InterPro:IPR025734"
FT                   /db_xref="UniProtKB/TrEMBL:D5URC0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76973.1"
FT                   /translation="MPDNDSGGGLSAFGVSIDELSLLMRLADVTELAPIVLAVHPNVYR
FT                   PDDQSAVDLAVLPGLIAAGLVDADGAIDPEVARWLRALQAPAAEIALRVFDGDSALRGA
FT                   IVRHDDLVVVVFRHDDLLTLQGYRTDGEDFDSTVVDPVWRVLGSCDPADFDSLTLGAAE
FT                   LREIVSMYNPASTDPRGEREFRGRLREHDLPPHTVDVLVDAARYSGRRAEVVYHRVDLN
FT                   GVRTQAQWALGVMDTDQGRVLSTTTRGRGGDNDVILSPGTRRRFAEGLNELVARGGCVG
FT                   WFDIAN"
FT   gene            340258..341997
FT                   /locus_tag="Tpau_0331"
FT   CDS_pept        340258..341997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0331"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: msm:MSMEG_0067 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76974"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5URC1"
FT                   /inference="similar to AA sequence:KEGG:MSMEG_0067"
FT                   /protein_id="ADG76974.1"
FT                   /translation="MSDGATNVHLPFAEQNKTEGTPVPTTPQSVAGALASNAAAVRPVV
FT                   TPGPVSDEGTDSAPSTTEWEEPELPVVDDAGEAGPVPTAAEEAPAAAVADAAAVADAVA
FT                   SDDDRPTREQPVIVDEPAGRPEAEAAPTADTAAAGGQASPQGGPQVTGPQPAAQAPQQA
FT                   RTVPVPAQQPQQQWQGQAPQAQPGQHQFAQPHTGQFQQPQFAGQPPTGQFQAPVQGRPP
FT                   SPLPFGHAAPGQIAPPQPQHAGMPMRPMGESVSAPMSTASSSFQQHIRMSDSAMRVTGW
FT                   RAWLKRMGIDVGPSTSDQEHAERVHRIRVPKNKFHVTSVFADSAGGTLLVGVLGQILER
FT                   TRADNVVALDLDPDGGDLDQVTAWHQGGSTARTLIQQSDLSDRNQVDKHLAVTSTNLHV
FT                   LPTPWRFNGRDVADYDDVLDLYSIFRPHYSLALVDAGRGLQTVTGTGVLEISSALILPA
FT                   SATTRGVRKVAATIDWLRHHGWHGLLANTIVVINHTKKRGSVTVEQFDELFRAGQKLRV
FT                   HEIPYDPHLDADTPIDLDLLKPRTVRAFELLAADLADTFNSGYEPPAATKLAELQVRSH
FT                   EGR"
FT   gene            342002..343588
FT                   /locus_tag="Tpau_0332"
FT   CDS_pept        342002..343588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0332"
FT                   /product="secretion protein snm4"
FT                   /note="KEGG: msm:MSMEG_0068 transmembrane protein; TIGRFAM:
FT                   secretion protein snm4; PFAM: protein of unknown function
FT                   DUF571"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76975"
FT                   /db_xref="GOA:D5URC2"
FT                   /db_xref="InterPro:IPR006707"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR024962"
FT                   /db_xref="UniProtKB/TrEMBL:D5URC2"
FT                   /inference="protein motif:TFAM:TIGR02958"
FT                   /protein_id="ADG76975.1"
FT                   /translation="MAFPTTPGAPGGAPSPHQAGAAPGKPVVPEQVRVLVEVGESSVER
FT                   SLLARRRLSVVMDSVIPGLEQIFPDHDFSTAGAWTFAREGGTPLSRDKSLADAGVLDGD
FT                   RLILAETFSNQTFRPLIESTADAIQEFCRQRFRRFTSGTARTLGLIALVLGAAVFAALV
FT                   LLAWMADSSVLWWFPVAAIGSIAVITAAVSADRQYHSQQVAYALQLAAAPVLFSTGFVL
FT                   IPPDGGADGAFTAANVLTGAVFTLIGVVILGRSSGLGAAVLAGLGLVSAATVVASALFA
FT                   YTPLGRPAIPAIGVIGGLLLANWVQGWALMLARVRPDTLPPPGEDIDRSELDVAYHVDT
FT                   FDDESTTELARGDENTALERKSRTAAKLLTGFYVAVAAILVVSALTILVPDTHYFWGEV
FT                   VIAALVSVICVLRGRTLDDRVHATVFFIAGFLIAAGLAIVLVGAVGSNLARLTVIVVSA
FT                   VVLLAFGAGALLLADRVSAEEGLMAKPLSARLMGRIEFGEKTAIFVVVMLALWTTRLFA
FT                   FLRELDLSFLK"
FT   gene            343589..345031
FT                   /locus_tag="Tpau_0333"
FT   CDS_pept        343589..345031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0333"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; KEGG: msm:MSMEG_0083 membrane-anchored mycosin
FT                   mycp1"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76976"
FT                   /db_xref="GOA:D5URC3"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023834"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D5URC3"
FT                   /inference="protein motif:PFAM:PF00082"
FT                   /protein_id="ADG76976.1"
FT                   /translation="MLASTRSLATRAAAAVAVGAIVALLGGTVPPQALAVVPPVADIGG
FT                   APPDTDGPERPLRYNNPRCVEPGVLPNSNLAAAPAPSTTLRIDEAQRFSTGAGVTVAVL
FT                   STGVRPQARLRALDGAGDNMNPADRGLLDCDSTGTLVAGIVGAQPAVGDGFVGVAPDSR
FT                   VMSIRVDSTAFALQNSPADNDDPNASRAAVTARSIARAVVRAANRGARVIVIPEPVCMA
FT                   ADAQFRQREIGGAVGYATQVKDALFVVGAGATDRNGGNTGANTCKPNPDPDPGSPDDPR
FT                   GWRRVSTVATPNWFDGQVLSVGATTAEGSPLPGSLNGPWLDVAAPGAGLVSLSSRGGDG
FT                   VVNALPADRTLVPFAGPEFAAAYVAGTAALVRSRYPQMRAKDVAARIVATAHAPGRGTD
FT                   NKVGRGLIDPVAALTAKVPEEGVDIDVQSVEKLLVPAPPPSPDTRPRRTAALVAGVGLI
FT                   VVVLVAGVVAALRPRRTGKRRS"
FT   gene            345032..347185
FT                   /locus_tag="Tpau_0334"
FT   CDS_pept        345032..347185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0334"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mgi:Mflv_5453 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76977"
FT                   /db_xref="GOA:D5URC4"
FT                   /db_xref="InterPro:IPR021368"
FT                   /db_xref="UniProtKB/TrEMBL:D5URC4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG76977.1"
FT                   /translation="MTTEAQPGRTVDDAPPHPEVTRLRRPVWLSVTLRRALVWAVLSTV
FT                   FVALTAGRWPTWAVTAIPVIGALVAFVSVHGSVLSERIAARAHYLRRRRAGYDGLPGRV
FT                   IDVDGCGVRWGDGYELVSAIELTADLAETRLRDGRAYAADTVPLDLLASMMTQYGLNVD
FT                   IDVSSAGRRVPPGPAYRASYAQGVRFYSAMAERSTWLILRVNTRRNLAGIVRRGPSRTA
FT                   GPTALMAATRRLEQRLHERRIRARILPPAELAQLDSLLSFGADARRGEEQWNHVSYGNS
FT                   YATTYFVDPGRMSTEKLDRWWGLDTDSTAVVLRLRKRSAQAPVEISGLVRYDTATPQID
FT                   NHDDSLILVAGRQRELALATLPGGATSVADLPSAPLTKLAAVEIPVGPAGPVWGIADGA
FT                   AIALPLFDGSPVPETLQVEFASDLTVVQLILLRSVGAGASVAVRTERPDRWLMLANTLA
FT                   DPSRFRIVDAGDRRPADITVFDGVEVDAVPERTLLTVHGAGSELGDKADVTVAQTTQSK
FT                   VIVRIGRRAPIEMVLNPTDEELRYCDVVVPPLASTAGELPVQQRQPRQPPAPPRHVPTA
FT                   PPAPWSRAIPQSAPPAPRPVPPAVPPAVPPAVPPAAQPAGAQQAVPPVPPSGAPAPAVP
FT                   AAGLPPQGAPQQPRIRRPVRPAPPPPFERGSGAQRKTDAGRWVRRGRDDEPGGPARRPR
FT                   REPGAPRWAQPKDEPPGPPPTSR"
FT   gene            347256..349271
FT                   /locus_tag="Tpau_0335"
FT   CDS_pept        347256..349271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0335"
FT                   /product="serine/threonine protein kinase"
FT                   /note="KEGG: mul:MUP011 transmembrane serine/threonine-
FT                   protein kinase PknQ; PFAM: Serine/threonine protein
FT                   kinase-related; tyrosine protein kinase; periplasmic
FT                   binding protein; SMART: serine/threonine protein kinase;
FT                   tyrosine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76978"
FT                   /db_xref="GOA:D5URC5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D5URC5"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADG76978.1"
FT                   /translation="MAEPGEVIAGYVVESVLGTGGMGTVYRVRHRTLPRSVALKVLQSQ
FT                   FSADPSVRARFDREADIVAGLKHPHIVDVYDRGESDGHLWIAMELVEGGNVAQIVQREG
FT                   PFSLDRAVAVIEQVADALDEAHGHGILHRDVKPANFLVDRGRRGEQIKLADFGIGAAQT
FT                   EVGQHTQTGTVVGTLAYTAPEALLGNPIDHRADIYSLACAAVVLLTGAPPFNTTISGQL
FT                   MLAHISQNPPSIRVKRPDLSPEIDYVLGRAMAKNPADRYNSAGEFADALSSAARRMSGA
FT                   AGIAPPPPPAGTNWQGTPSNPALATGFNPGAPAGYSGPPPGAAVPAQFYGGPSSPSNPS
FT                   MVPPSPAKSRRPLIVGAAAAVVVLVAIAIGAFALTGGGASDGRPALDSWSARTVTDING
FT                   DTRINERPTRIVALGPGDAEIVTALGFDVVAGGNGPKSELPSWVPSLKEVPTAGTSTNP
FT                   DRAAIEKAKPDLIIDTDPAGSAASKDLKSVANSIAVSPAGSKGWTWQEQMAYIAEALGA
FT                   KDRASAVRKTYEQRITELRAAHPDFTGKKVDLVHYDGQATRLATNAASPFQLLGQLGFT
FT                   MQVPAKGSGSSWLTVASVDLYAVVNTSSVDRTVVARTDPSAGNGGYDGLPAALTYGAPI
FT                   VILDTGSGVDALLYGGPLAIDTVADDVIPAIAKGVK"
FT   gene            349271..349861
FT                   /locus_tag="Tpau_0336"
FT   CDS_pept        349271..349861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0336"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rop:ROP_51460 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76979"
FT                   /db_xref="UniProtKB/TrEMBL:D5URC6"
FT                   /inference="similar to AA sequence:KEGG:ROP_51460"
FT                   /protein_id="ADG76979.1"
FT                   /translation="MAEQTLTAADLDRFAAALAAGKRPTVYLIEAVPSLGLAGGASAKV
FT                   VEVSGTTVTVRPAGVDDQLPYDARELRATKQPKPVKPATAAKAAPKAAPATAKSVAITV
FT                   FVGADNAAAVKVTRNANKPAGAREVALPAVQKALAGLGDKEAQGTVDEVLSTAREAAAD
FT                   RVAQLQAELAAAKKSLASLDRAKRGNASTTRGR"
FT   gene            349870..350526
FT                   /locus_tag="Tpau_0337"
FT   CDS_pept        349870..350526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0337"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: fal:FRAAL6601 putative
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76980"
FT                   /db_xref="GOA:D5URC7"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D5URC7"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ADG76980.1"
FT                   /translation="MTESIHHLNLSADEVLTSTRSVRKRLDLERPVPLEVITDALEVAL
FT                   QAPSGSNAQGWHWIVLTDPEKKRIVAEHYARSFAAYAAAGAQARAANPPKDLDTAEKVA
FT                   SSAQYLADVMHEVPALVIGAIHVPGGELPEGNQAGVWGSLLPAAWSLSLALRERGLGSA
FT                   WTTLHLVYEREVAEALGLPENIRQGVLLPVAYTKGTDFKPAKRAPLETVLHVNGW"
FT   gene            350611..351162
FT                   /locus_tag="Tpau_0338"
FT   CDS_pept        350611..351162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0338"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: cai:Caci_2169
FT                   isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76981"
FT                   /db_xref="GOA:D5URC8"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:D5URC8"
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /protein_id="ADG76981.1"
FT                   /translation="MNALVVIDVQESFRQRANWSEVSNPGIVGDVNRLVVAARERGEPV
FT                   VWILHSEPGSGGVFDPASGHVVLQPGLVPLPGEPLLTKTTRNAFTSTELGRLLQRGGVT
FT                   GLTIAGIQTEQCCETTARLAADLGFDVDFVTEATATFPIVRPDTGAVLGTDAIIERTEF
FT                   ALAGRFARIRTLDEAVAGAA"
FT   gene            351185..352072
FT                   /locus_tag="Tpau_0339"
FT   CDS_pept        351185..352072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0339"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: sen:SACE_5167 AraC family transcriptional
FT                   regulator; PFAM: helix-turn-helix- domain containing
FT                   protein AraC type; ThiJ/PfpI domain protein; SMART:
FT                   Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76982"
FT                   /db_xref="GOA:D5URC9"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D5URC9"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADG76982.1"
FT                   /translation="MAVLLVPGVHLLDVAGPTQAFGTATDLGHEYALRYIGESARVASH
FT                   QGLPLVAETDFPRLRVSDIALVPGWRTESGAVPLSATTLHRIADHHAAGGTVMSVCAGA
FT                   FALGAAGLLDGRRCTTHHQLCDRLERRHRAATVVRDVLHVTDGTVRTSAGIASGIDATL
FT                   ALLADRHGSAVAAAVSRAMVVYARRNGHAPQHSVMLRHRSHVNDAVHRALDVIDGRFAE
FT                   SLPLSELSAAAGVSARTLTRAFDAELGITPLRYQQAVRVEHAGLLIEHGATMESAAQAV
FT                   GFTDARMLRRLRSR"
FT   gene            complement(352100..353266)
FT                   /locus_tag="Tpau_0340"
FT   CDS_pept        complement(352100..353266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0340"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: svi:Svir_30260
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76983"
FT                   /db_xref="GOA:D5URD0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D5URD0"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG76983.1"
FT                   /translation="MAPSNTRLRPAERRRQLVDVATGLFLDRGYGNVAVADIARAAGIS
FT                   GPSVYRHFPDKEAILAAAMRSAVDEMSAATDSALARPGATFDDLAAAVFAMAVDKPGPL
FT                   ALWRWNRRHLTAEQAREMIAASEGVLGRWTEVLRRDHPEVTDDDARVLAWAVLAVGGSV
FT                   PPSRGRIGTRRYRTDLERISERVLRAAPSIAPHLPAPPPRRAPVVRSDEILDAASELFF
FT                   SRGYSTVGMDDIGAAVGISGPSVYGHFPSKGSILVGIVARARAALEIGVLGAAAHAEGD
FT                   PIAELRALVRSYAANLVSSTDLAVAFTVGREVVIESGGEALLAAQKAYLARWVALLEAG
FT                   GEVDGAGARIAVGAAMTIANDFARTRRLRRRARFHDELVALMDAALGI"
FT   gene            353423..354634
FT                   /locus_tag="Tpau_0341"
FT   CDS_pept        353423..354634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0341"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; KEGG:
FT                   svi:Svir_30250 acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76984"
FT                   /db_xref="GOA:D5URD1"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D5URD1"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ADG76984.1"
FT                   /translation="MSDAFIYEAIRTPRGKLKGGSLTAIKPTDLVVGLIDEIKDRNPDL
FT                   DPAAVDDIVLGVVSPVGEQGADIARTASIVAGLPDTVAGVQINRFCASGLEATNMAAQK
FT                   VGSALGDDLVLAGGVESMSRVPMGSDFGALFYDPQYSYDNYIAPQGIGADLIATIEGFS
FT                   RDDVDQYSAQSQELAAKAWDEGRFAKSVVPVKDQNGLVVLDNDEHRRPGTTAADLGKLR
FT                   PAFTVVGEMGGFDAVALQKYTHVEKIDHVHTGGNSSGIVDGAALVLVGNEAGGKKAGLT
FT                   PRGRIVATASTGADPTIMLTGPTPATEKVLAKAGLTKDDIDVWELNEAFASVVLKWMKD
FT                   FKLDREQVNVNGGAIALGHPLGATGAMLVGTVLDELERTGGRYGLITLCIAGGMGSATI
FT                   IERI"
FT   gene            354669..356861
FT                   /locus_tag="Tpau_0342"
FT   CDS_pept        354669..356861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0342"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding
FT                   protein"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase NAD-binding;
FT                   Enoyl-CoA hydratase/isomerase; 3-hydroxyacyl-CoA
FT                   dehydrogenase domain protein; KEGG: mab:MAB_0851 fatty
FT                   oxidation protein FadB"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76985"
FT                   /db_xref="GOA:D5URD2"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5URD2"
FT                   /inference="protein motif:PFAM:PF02737"
FT                   /protein_id="ADG76985.1"
FT                   /translation="MSDNMIRWEQDADGIVTLTMDDPNSSANTMNELYGTSMRATVDRL
FT                   EAEVDSITGVVLTSAKKTFFAGGNLTEIRKATKADAQQVFDNVQEIKKDLRRLEKLPKP
FT                   VVAAINGAALGGGLEIALAANHRIAADVKGSKIGLPEVSLGLLPGGGGVTRTVRMLGLQ
FT                   GALMGVLLQGQQMAPGKAQKTGLVNDLVGTVEELVPAAKAWIKANPEAATQPWDVKGHR
FT                   IPGGSPIDKTLAPNAPAFPANLRKQLKGAPMPAPEAIMAAAFEGTYVDFDTALEIESRY
FT                   FTKLATGQVSKNMIKAFFFDLQHINGGGSRPDGYEKYQAKKVGVIGAGMMGAAIAYVSA
FT                   KAGIEVVLKDIDQAAADRGKDYSVKLEEKALAKGRTTQEKSDALLARIHPTVDPQDFAG
FT                   VDLVIEAAFESVEVKNKVFQEIEDIVEPDAILGSNTSTLPITILAEGVKRSEDFIGIHF
FT                   FSPVDKMPLVEIIKGEKTSDAVLAKVIDYTLQIKKTPIVVHDSRGFFTSRVIGTFINEA
FT                   LAAIGEGVDPVYLEQAGQQAGYPAAPLQLTDELTLTLMQKIRKATEDALTAEGKPVPQH
FT                   GAFAVVDWMVENGRTSKKDGAGFYDYADGKRTGLWKGFQEHFKSGSVTPDFAELQERML
FT                   FIESIETVRCFDEGVLESVADANIGSIFGIGFPAWTGGVLQYINGYEGRPGTPAEGLTG
FT                   PKAFVAQANALAAKYGEQFTPPESLVAKAEAGETYE"
FT   gene            complement(356948..357592)
FT                   /locus_tag="Tpau_0343"
FT   CDS_pept        complement(356948..357592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0343"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa31070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76986"
FT                   /db_xref="GOA:D5URD3"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="UniProtKB/TrEMBL:D5URD3"
FT                   /inference="similar to AA sequence:KEGG:nfa31070"
FT                   /protein_id="ADG76986.1"
FT                   /translation="MTTDTTSSASAPQEQPPRHSLVDEVRGYASDVVTKVWQSVLGIGI
FT                   VAIVLGAVILAWPSPTLRVVGVLFAIYLLLIGILQLYTVFGPIKSESNWWRFLTFISGA
FT                   LSIVLSVLAFRSEGDSLVMLAIWIGVGWLIQGIVGFAVGLDLPNGTPHRILSIFASILF
FT                   TIAGVIVVIYPYDAIAPLTYGTGIALIIIGLVQVVHAFQIRSSANKAIPQV"
FT   gene            complement(357676..358293)
FT                   /locus_tag="Tpau_0344"
FT   CDS_pept        complement(357676..358293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0344"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gox:GOX1008 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76987"
FT                   /db_xref="UniProtKB/TrEMBL:D5URD4"
FT                   /inference="similar to AA sequence:KEGG:GOX1008"
FT                   /protein_id="ADG76987.1"
FT                   /translation="MASEENVVLLTWPTTAPAYEAQSRLTELGNSGAVEVRESAVVERG
FT                   ADGTLTVPQGDSGTVGLATLGGSTLGVLVGVLGGPVGALLGWASGALIGGAWDLSRADD
FT                   SDSVIAALSSSIPPGANALLADVVEGSHDAIDGLAARSGARLVRKPTGEVLDEIDASEE
FT                   AADEAAAAARKKVREEKKADRSADRHARVDKLKEKLNISSGS"
FT   gene            complement(358595..359365)
FT                   /locus_tag="Tpau_0345"
FT   CDS_pept        complement(358595..359365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0345"
FT                   /product="ANTAR domain protein with unknown sensor"
FT                   /note="PFAM: ANTAR domain protein; GAF domain protein;
FT                   KEGG: kra:Krad_2459 response regulator receiver and ANTAR
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76988"
FT                   /db_xref="GOA:D5URD5"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR012074"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D5URD5"
FT                   /inference="protein motif:PFAM:PF03861"
FT                   /protein_id="ADG76988.1"
FT                   /translation="MAVPAHKQSTEQLPSVLGTVHEAPPAEEVPLEELTLSERMGEIAR
FT                   LLREQSSDSESLLTAVTQFAVDQVPGASFASITLVDPKGGITHPVVIGDAAQRVADVQR
FT                   ELEEGPSVGATFESTTILVEDTATEPRWPRFAEAAKEAGVGSILSFCLYVQNDAYGTLD
FT                   LMAREANAFDAESQSIGSLFAVHAAVAFSAVREKEQIRAALTTRDVIGQAKGMIMERYK
FT                   LDSDGAFRLLARLSQDSNVRLAEVAEQVIEAGPD"
FT   gene            complement(359481..361511)
FT                   /locus_tag="Tpau_0346"
FT   CDS_pept        complement(359481..361511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0346"
FT                   /product="Neprilysin"
FT                   /EC_number="3.4.24.11"
FT                   /note="KEGG: nfa:nfa56400 putative peptidase; PFAM:
FT                   peptidase M13; Peptidase M13, neprilysin- like"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76989"
FT                   /db_xref="GOA:D5URD6"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR042089"
FT                   /db_xref="UniProtKB/TrEMBL:D5URD6"
FT                   /inference="protein motif:PRIAM:3.4.24.11"
FT                   /protein_id="ADG76989.1"
FT                   /translation="MTSEPALDLSFVDPDIRVQDDLFGHVNGKWLDGHEIPADRSSDGA
FT                   FYALRDAAELHVKEIVEEAAADAAATGDAAKIGDLYSSFMDTAAIEAAGVAPVADEIAE
FT                   IRWADSATDLATVLGRLQRTGVGGLLGYYVDTDAKRSDRYLVQVTQSGISLPDEAYYRD
FT                   EQYAPLRAKFTAHVADTFRLATRLAPALLEGIVTAGEEDAAAASVLDLETAIAAGHWNV
FT                   VDRRDADKSYNLRTFADLGTEAPALQLRAWTAALTAAEAFAEVFAEVNVRQPSFVTHAA
FT                   ALLSDRPLAQWRTWLAWRVLRARSPYLSDELVAANFAFYGTALTGATENRERWKRGVGL
FT                   VEEHLGFAVGELYTARHFPADSKARMQALVADLVEAYRRRIVELPWMTPATRERALEKL
FT                   GKFTPKIGYPDAARDYSSLQIQRDDLLGNVRRGNAAEHDREFAKIGAPVDRDEWFMTPQ
FT                   TVNAYYNPGMNEIVFPAAILQPPFFAPTADDAVNFGGIGAVIGHEIGHGFDDQGAKYDG
FT                   DGNLEDWWTDTDREEFGKRTRALIEQYDELTPRELGADSEHHVNGGFTVGENIGDLGGL
FT                   GIALVAYGIARERAGGTVDDPSTEADGLTGLQRVFYSWGQIWRGKSRPEEAIRRLAIDP
FT                   HSPPEFRCNAIASNLDEFYSAFGVTEGDTLFLAPERRVSIW"
FT   gene            361672..363732
FT                   /locus_tag="Tpau_0347"
FT   CDS_pept        361672..363732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0347"
FT                   /product="peptidase S15"
FT                   /note="PFAM: peptidase S15; X-Pro dipeptidyl-peptidase
FT                   domain protein; KEGG: nfa:nfa51880 putative peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76990"
FT                   /db_xref="GOA:D5URD7"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR005674"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013736"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5URD7"
FT                   /inference="protein motif:PFAM:PF02129"
FT                   /protein_id="ADG76990.1"
FT                   /translation="MILNRLGRALTALLAVTVIVAGAAVPALRAPAAAEPWKPGAGVAG
FT                   MINPEWIASHDGPSQYPRMATEWDVPIRMSDGTVLRANIFRPADASGKAIETAMPTIVN
FT                   MTPYTKFISTIVTLVTNVPVLYPALVGLLNLFNFSGTPIAGVDDLRNTLNGGLLNTFTV
FT                   DQKLVQSGYTQVVVDVRGTGNSQGVWQVFAQREQQDTVEVLDWIRKQSWTNGRFGMAGV
FT                   SYSAINQLQVASKNPEGLQALFPVVPGADIAADIVAPGGGLGVGFIGPWLAMVNILKFI
FT                   PDLRSLLNGTFDWKWLQDRLQNPAVFVPELLTGVFSPTVEGLTPTTKELINKDSTLRAA
FT                   FQTPLDKVTTPTFALGGWNDLFTNTEWRLPTALSALSTAKKKLIMGDAAHVTVTNDMGG
FT                   VGQPTRADVLQKAWFDKWLKDADNGIDNYAPVTVHRMGGGWWQGDTFPEPEQKYQRMYL
FT                   SSLPSGTAPTALSDNSLQTSPPKVPARRTVGPGLSTLCSNDTGQAMFGLLVFQGCTKDN
FT                   RVAEMNALTFTSKPVGKPTVISGPINLRLNTTQDAKDAYWSVMVTDVGPDGRSEKISSG
FT                   QLTTSLRQIDESRSTRTAGGDMVDPYYKLNLADRQLVAPGQVVPLDIGTHAVSAVLKPG
FT                   HRLRVDVFALNLIKAMTVGPVTAETQFRPQHVLIDPKQPSYLVVPSDRPLP"
FT   gene            complement(363745..364470)
FT                   /locus_tag="Tpau_0348"
FT   CDS_pept        complement(363745..364470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0348"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein; KEGG: rop:ROP_51800
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76991"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D5URD8"
FT                   /inference="protein motif:PFAM:PF02678"
FT                   /protein_id="ADG76991.1"
FT                   /translation="MHVLVTAADRAASEMPGVRSRHCFSFGDHYAPANTHHGVLLACND
FT                   ESVAAGRGFDTHPHRAVEIVTWVLGGALVHQDSEGHAGVVYPGLAQRMSAGTGILHSER
FT                   NDRPEPAGAGVRFVQMWLAPDDASAAPSYEQREVSADVDRGGLVTVASGDPARDAAIRI
FT                   GARGATLHCARLAPGATVDLPEAPFGHLYVAAGSAVADGTGALVDGDSLRTIADGIRIT
FT                   AGAGGAELLYWEMHRRLGD"
FT   gene            364553..366175
FT                   /locus_tag="Tpau_0349"
FT   CDS_pept        364553..366175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0349"
FT                   /product="penicillin-binding protein"
FT                   /note="KEGG: rer:RER_10670 penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76992"
FT                   /db_xref="GOA:D5URD9"
FT                   /db_xref="InterPro:IPR007887"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D5URD9"
FT                   /inference="similar to AA sequence:KEGG:RER_10670"
FT                   /protein_id="ADG76992.1"
FT                   /translation="MRPSVGRRTGAAALVSLLLLTLAACGDDETADVTKMLDGYAAAIG
FT                   ERNAVAAAGFTSSPDAASGVIGRTLRDMRPEKVSVKAQNVQRYSGGNATFDLKTQWNFG
FT                   KGRDWEYTTKGSASSLSIGWRISWDPAVLAPGLTTSTAIRQIRTDARPPKVFARDNSEL
FT                   MFAGTVHKLTVDPNQTTNLTDSLTRVAKIVAPVAPLVTPESLAAKAKADPGKPVPVVDL
FT                   RGDDYAVLEDKLKAVPGLRDTEAPDLLIANRQLFSPLFTGIKGAWQANRDATAGWAVQL
FT                   VTEEKPPTQVVGFQGPPGPDLKTSMDPKVQLAAENAVVQLGQPAAMVVVSISSGAVLAA
FT                   AQNNQASLESPDWALTGLSTTGPVLAPVYSEVNSAAGKDTGKQAGLLSPLGLGTAFAMT
FT                   GVTTVTAELPGTGGRPAAELGADTMKASPFGLAVFASAIAKGKTTAPYVVQGQTATPSA
FT                   PMGDVDGTILAAVRAKMEATVSPSGDGSDLVSSKVKGLVGTNGPQGPGWFVGYRGDQAF
FT                   AIMVSGERSGSGSLQVAGSYLTQ"
FT   gene            complement(366165..366605)
FT                   /locus_tag="Tpau_0350"
FT   CDS_pept        complement(366165..366605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0350"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cmi:CMM_2441 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76993"
FT                   /db_xref="GOA:D5URE0"
FT                   /db_xref="InterPro:IPR021414"
FT                   /db_xref="UniProtKB/TrEMBL:D5URE0"
FT                   /inference="similar to AA sequence:KEGG:CMM_2441"
FT                   /protein_id="ADG76993.1"
FT                   /translation="MRIPVIAVIDALLVVLFASIGRFNHGESLSPAGVAETSWPFLLAL
FT                   AVGWAFAYVLSAIRGHEPGRAQTFSPGRIFPEGVIIWVSTVAVGMTARGLLTEDGVQVS
FT                   FVIVTAIVLGIFLLGWRAIAQVVLARRARSAEAVSGPDVPTA"
FT   gene            complement(366663..367787)
FT                   /locus_tag="Tpau_0351"
FT   CDS_pept        complement(366663..367787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0351"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: mgi:Mflv_5498 diguanylate
FT                   cyclase; SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76994"
FT                   /db_xref="GOA:D5URE1"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D5URE1"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADG76994.1"
FT                   /translation="MPDVSPDHGRENLRTLVALWWRGGPSYDQRIAYLHNRSLLPMIRV
FT                   VVSVCAALLGLMSIALIPLVRPLTVVDVVRLTVCGAVALFWAVRWQLGEVPNARWASVF
FT                   VASSIIAIYVASSTQNEPLAAALGVASLAMIATFGALILSTRAFLVNAALIFAAIAAST
FT                   LPVLPGYGWAQTLLGAAILIGATIGVPATMQFGMSFSWFDTAEAGTDPLTGAFNRRGLH
FT                   TIWATWAMRRSPAAEHAAVIVVDLDRFKAVNDTHGHTAGDEMLVQVARTLRSIGASVDA
FT                   LVARLGGDEFALLVVGHDEAECTNLAHRIRRGIAAVPPVGASAVTASIGVAVDDAPATD
FT                   PGLIDRLLAAADEAMYQAKRTGDAVAVAPGNPVL"
FT   gene            complement(368056..369246)
FT                   /locus_tag="Tpau_0352"
FT   CDS_pept        complement(368056..369246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0352"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   mab:MAB_4524 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76995"
FT                   /db_xref="GOA:D5URE2"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:D5URE2"
FT                   /inference="protein motif:PFAM:PF03706"
FT                   /protein_id="ADG76995.1"
FT                   /translation="MSDRESTDPDEPTPDDDAGKSTLITRERLKWVRRGVLVLIAAILA
FT                   FEAVYFWPTVAKSLRELRHIQWEWVIACVIAVWFSFDSYAQVTRVLLRSAGVRVKQMQV
FT                   LGLQFASNAVSQSLPGGQVLAPTLVYRRTRMWGASRVIAAWQIVMSGLLMSSGLAVLGL
FT                   VGGLLAGAKTSPYSVVFSVALLVVFIVMMQYVASHPDGLYVVGARLIRWVNDLRNKPED
FT                   TGLARWKEILDQLQAVKLSRRYGVEAFGWSLFNWVADVACLAFACYAVGDAPGLAALAG
FT                   AYAASKVVNTISPIPGGLGLVEAALVPALVLAGMPASQALTATILYRLVSYLLVVIIGW
FT                   IVFFVSYRDTMDVDPDAGADGGPGDGSDAETGTAPGTDAAKSGPDDDSPGTPPGPA"
FT   gene            369344..370549
FT                   /locus_tag="Tpau_0353"
FT   CDS_pept        369344..370549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0353"
FT                   /product="putative signal transduction histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: mkm:Mkms_3090 putative signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76996"
FT                   /db_xref="GOA:D5URE3"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5URE3"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADG76996.1"
FT                   /translation="MDGTVSRLRRVVPTGRDDESHRPGDDDPRAPLWRGAQYFRAISVI
FT                   YAVGRHIDEAGRYERIGWSWVLIGLLVAFSALAALAYVRGFGRNRWFVGGEFVVAAALA
FT                   LSTWLVASPGFTQFNQALPTTLWLTNPVVSAAILGGPVAGLIGGVVIAAVNAIYRDVFP
FT                   ESTLRDANYPVFMSVGLGLGVAARMATKSREQVRAAERVAAEARARERLAREVHDGVLQ
FT                   ALAFLSRRCAELGGAATALGELAAQQERALRRLIAESPDTAGPDEAGGTVDLRELVRPL
FT                   ATAARSPVTLAEPGGPVALPAGTAAEVAAAVRNALDNTARHAGPGVRAFLLIEDVGDAV
FT                   LVTVRDDGTGIAPGRLDEARAEGRLGVSESIVGRIRALGGRAELTTDIGEGVEWELWVP
FT                   RN"
FT   gene            370522..371190
FT                   /locus_tag="Tpau_0354"
FT   CDS_pept        370522..371190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0354"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="KEGG: rop:ROP_52210 putative NarL family two-
FT                   component response regulator; PFAM: response regulator
FT                   receiver; regulatory protein LuxR; Sigma-70 region 4 type
FT                   2; SMART: response regulator receiver; regulatory protein
FT                   LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76997"
FT                   /db_xref="GOA:D5URE4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D5URE4"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADG76997.1"
FT                   /translation="MGTVGTSELDDAAIRVLVVDDHPMWRDAVARDLEARGFTVAGTAD
FT                   SVAAAGRIAGAVQPTVVLMDMSLPDGDGAAGTTLVLQHAPQAAVLILSASDEREDVVEA
FT                   VKAGACGYLVKSASAEELVAAVRATAAHQPVFTPGLAGLVLGEFRRMAAEPEPAGPQLT
FT                   PRETEVLRLVAKGLSAKQIATRLHLSHRTVENHVQATLRKLQLGNRVELARYALENGLD
FT                   "
FT   gene            complement(371187..373244)
FT                   /locus_tag="Tpau_0355"
FT   CDS_pept        complement(371187..373244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0355"
FT                   /product="copper-translocating P-type ATPase"
FT                   /note="KEGG: mgi:Mflv_2852 copper-translocating P-type
FT                   ATPase; TIGRFAM: copper-translocating P-type ATPase; heavy
FT                   metal translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase-associated domain protein; Haloacid dehalogenase
FT                   domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76998"
FT                   /db_xref="GOA:D5URE5"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D5URE5"
FT                   /inference="protein motif:TFAM:TIGR01511"
FT                   /protein_id="ADG76998.1"
FT                   /translation="MNHSGMNHASMDHTALDHTATDHGGGHGGHGDHVAQFRRLFWIML
FT                   MLAVPVVALSDMFAMIAGYSLPAVPGLAWVSPILGTVMYVWGGRPFLTGAVSEIKARRP
FT                   GMMLLIGLAITVAFVASWGASLGLLHHQLDFWWELALLIVIMLLGHWIEMRSLARTTSA
FT                   LDSLAALLPEEAERIEDGAVVIVAPSELRVGDVVVVRPGGSVPADGAVVEGRAAMDESM
FT                   ITGESQTVERTVGETVTAGTVATDSGLRVRVTATGDDTALAGIGRLVEQAQNSTSRAQA
FT                   LADRAAGWLFWYALGAGALTAAVWTVLGEPDQAVIRTITVLVIACPHALGLAIPLVVSI
FT                   ATERAAKAGVLVKDRMALETMRTVDTVLFDKTGTLTRGEPVVTEIVGGGEVLALAAAAE
FT                   ADSEHPLARAIVRSARDRGLTVPAATGFTSSPAVGVTAVVDGATIRVGGPNLLAEENVR
FT                   ELPAADAWRERGAIILHVLRDGAVIGALALADEVRPESREAVDALHALGIQVVMITGDA
FT                   EAVAHAVADELCIDRVYAGVRPEDKAAKVAELQGETRIVAMVGDGVNDAPALAQANVGL
FT                   AIGAGTDVAIASAGVILAGDDPRSVLSVIELSHASYRKMKQNLWWAAGYNLISVPLAAG
FT                   VLAPIGFVLPMSVGAILMSLSTVVVALNAQLLRRLDLRPQTVTARILQRR"
FT   gene            complement(373284..374729)
FT                   /locus_tag="Tpau_0356"
FT   CDS_pept        complement(373284..374729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0356"
FT                   /product="fumarate lyase"
FT                   /note="PFAM: fumarate lyase; Fumarase C-like; KEGG:
FT                   aau:AAur_3794 aspartate ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADG76999"
FT                   /db_xref="GOA:D5URE6"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:D5URE6"
FT                   /inference="protein motif:PFAM:PF00206"
FT                   /protein_id="ADG76999.1"
FT                   /translation="MGMTETTRSEHDLLGDIDVPADAYYGAHTARALLNFPITGIPIAT
FT                   HTHLVNALACVKQAAAEANRQLGVLTDERTEAIVAACERIRGGGLHEWFVVDTIAGGAG
FT                   TSTNMNANEVIANAALEELGRPRGDYATLHPLDHVNLGQSTNDVYPTAIKIALITQLRD
FT                   LQEALTGLRAEFAAKSEEFGGIVKMGRTQLQDAVPMTLGQEFGAFATTLGEDIVRLQEA
FT                   TRLLHELNIGGTAIGTALNSHPGYRAKVIERLREITGIYELVGASDLIEATADVGVFVQ
FT                   LSGVLKRIAVKLSKTCNDLRLLSSGPRAGLNEIHLPAVQAGSSIMPGKVNPVIPEVVNQ
FT                   IAYEVIGHDVTITMAAEGGQLQLNAFEPIIARSLVESIAHLTRGARVLGERCVAGITAN
FT                   TARLEQSVAESIGVVTALSPSIGYAAATAVAAQALEEGRGVVEIVRERGLLDEATLDSL
FT                   LSPEYLTGHPPHALHPGSAEKHD"
FT   gene            complement(374803..375081)
FT                   /locus_tag="Tpau_0357"
FT   CDS_pept        complement(374803..375081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0357"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_2469 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77000"
FT                   /db_xref="InterPro:IPR000468"
FT                   /db_xref="InterPro:IPR035905"
FT                   /db_xref="UniProtKB/TrEMBL:D5URE7"
FT                   /inference="similar to AA sequence:KEGG:MAB_2469"
FT                   /protein_id="ADG77000.1"
FT                   /translation="MTTTYTVDGRRVVDRDSFYAELGRAVNGPGGYFGGNLDALVDCLR
FT                   GGFGTPEDEPFDFRITHADDVRTALGPKLYAEVVDVFATSGVPLQTA"
FT   gene            complement(375083..375469)
FT                   /locus_tag="Tpau_0358"
FT   CDS_pept        complement(375083..375469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0358"
FT                   /product="guanine-specific ribonuclease N1 and T1"
FT                   /note="PFAM: guanine-specific ribonuclease N1 and T1; KEGG:
FT                   mab:MAB_2468 putative guanyl-specific ribonuclease Sa"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77001"
FT                   /db_xref="GOA:D5URE8"
FT                   /db_xref="InterPro:IPR000026"
FT                   /db_xref="InterPro:IPR016191"
FT                   /db_xref="UniProtKB/TrEMBL:D5URE8"
FT                   /inference="protein motif:PFAM:PF00545"
FT                   /protein_id="ADG77001.1"
FT                   /translation="MRTATRTAGALLVAFGLSTAVTSLPSASAALPSCALSSLPPEATD
FT                   TVNLIHQGGPFPYPKNDGVVFQNREGILPAKASGYYHEYTVPTPGSSTRGARRIVTGGT
FT                   PLTSPPVYYYTGDHYSSFCTLTGA"
FT   gene            complement(375522..376223)
FT                   /locus_tag="Tpau_0359"
FT   CDS_pept        complement(375522..376223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0359"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: rop:ROP_11210
FT                   putative TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77002"
FT                   /db_xref="GOA:D5URE9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D5URE9"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG77002.1"
FT                   /translation="MTSATAVSAHTDTLKPMPRPSTRAVERHTPGPTRAEAKERTRQAL
FT                   LDEALALAGERAFASLSLREVAKAAGVVPTAFYRHFASMDDLGVTLVEDAMRVLRRMLR
FT                   EGRRDGRPSGEEAVRVVAKQARANDAEFQFLVRERYGGSPELQRAIDVELRLFAKDLTH
FT                   DLSRIPALADWSVEDLDMIADLYVTIILGFVAELVRIDPRNTRDENELIDRTKRQLTVV
FT                   ALGLGSYRPRE"
FT   gene            376305..377357
FT                   /locus_tag="Tpau_0360"
FT   CDS_pept        376305..377357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0360"
FT                   /product="Oxidoreductase FAD-binding domain protein"
FT                   /note="PFAM: Oxidoreductase FAD-binding domain protein;
FT                   oxidoreductase FAD/NAD(P)-binding domain protein;
FT                   ferredoxin; KEGG: mab:MAB_1588c putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77003"
FT                   /db_xref="GOA:D5URF0"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D5URF0"
FT                   /inference="protein motif:PFAM:PF00970"
FT                   /protein_id="ADG77003.1"
FT                   /translation="MSRFTRIAGNVIEAVLTPHAVDRYLELVDPMVTWTEIRGRVTAVS
FT                   RRTDRSVTFTVTPTRQFTGFEAGQFIQVSVVIDGVRQTRCFSPAGSALWPGDLEFTVTA
FT                   DAGGQVSTHLRDNLRVGDVLGLSPAAGSFTLPGAPGDRPGRIRLISGGSGITPVLSILR
FT                   TLVDEGYTGSVDLLHFCRDSADNPYRAELDLLARRSGVSVTYVYTRAGGRHLGAEHLPD
FT                   FGDVGFACGPAALLETAKALYAEAGVELRVEEFAPPAAAAPSGDATGTLRFTEAGTEVD
FT                   NDGRSILDQAESSGLFPESGCRMGICFSCTAVRTSGCTTNILTGETDSEPDQHIQLCIS
FT                   APVGDVEIAL"
FT   gene            377385..378557
FT                   /locus_tag="Tpau_0361"
FT   CDS_pept        377385..378557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0361"
FT                   /product="fatty acid desaturase"
FT                   /note="PFAM: fatty acid desaturase; KEGG: mab:MAB_1587c
FT                   fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77004"
FT                   /db_xref="GOA:D5URF1"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:D5URF1"
FT                   /inference="protein motif:PFAM:PF00487"
FT                   /protein_id="ADG77004.1"
FT                   /translation="MTEHITLTADQVEAIGERFDAIRARILADLGEKDREYIYSIVRAQ
FT                   RGFEIAGRAMMYLPPLWPLAVGSLGVSKILDNMEIGHNVMHGQYDWMREPGLNSREFEW
FT                   DTVCPADQWKHSHNYLHHTFTNVLDMDRDIGYGILRMAPEQKWHPYYLGNLAYASALMV
FT                   LFQWGVMLHDLEAERLIKGERRWSDIKDLVRGMRKKAGRQVLKDYVLFPLLTGPLFPLT
FT                   FAGNLSANLIRNLWTYSIIFCGHFPSGVQTFTKEETANETKGEWYVRQMLGSANIDGGR
FT                   LFHIMSGNLSFQIEHHLFPDIPANRYPEIAAEVRATCEEFGLPYNTGSLRNQLTSTWKK
FT                   IAKLSLPNSWTKQEPDLAVTIERVKAEDAAKKALAQAGWQRGAAREMVTA"
FT   gene            378583..378810
FT                   /locus_tag="Tpau_0362"
FT   CDS_pept        378583..378810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0362"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rop:ROP_11180 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77005"
FT                   /db_xref="UniProtKB/TrEMBL:D5URF2"
FT                   /inference="similar to AA sequence:KEGG:ROP_11180"
FT                   /protein_id="ADG77005.1"
FT                   /translation="MGKLERRKDLAQEAVESTAIRVGRIATIITTAVADVAREIGDAVS
FT                   DGLEMRNAAKRAAADEARTAHRTATRDDEA"
FT   gene            378910..379404
FT                   /locus_tag="Tpau_0363"
FT   CDS_pept        378910..379404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0363"
FT                   /product="alginate regulatory protein AlgP"
FT                   /note="KEGG: pag:PLES_56471 alginate regulatory protein
FT                   AlgP"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77006"
FT                   /db_xref="UniProtKB/TrEMBL:D5URF3"
FT                   /inference="similar to AA sequence:KEGG:PLES_56471"
FT                   /protein_id="ADG77006.1"
FT                   /translation="MSAIEQGKAVVKKISQVINGLTQARGAAGRAADEKSQITSDVSDV
FT                   KSAGKEVTEGVSNLKSAGSKLDSDVKSTAANVSADIAAVKGVKTKPAAKSDAKPAAKTD
FT                   GAPAAKTDGAPAAKSDGAPAAKAEAKPAAKADAKPAAKAETPKAAAPKPAPSAPKTDPK
FT                   A"
FT   gene            complement(379474..382467)
FT                   /locus_tag="Tpau_0364"
FT   CDS_pept        complement(379474..382467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0364"
FT                   /product="large membrane protein"
FT                   /note="KEGG: mva:Mvan_0196 large membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77007"
FT                   /db_xref="GOA:D5URF4"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:D5URF4"
FT                   /inference="similar to AA sequence:KEGG:Mvan_0196"
FT                   /protein_id="ADG77007.1"
FT                   /translation="MFAAIGRFSYAFRYTIIAVLFVSIAATGVWGFLGLGSKTKMNGLY
FT                   DEKSDSVAASKLTDEANGRFAQSDILVLVKAADGKKVTDAEVKDSVESARTKILDQFAK
FT                   GPDAKLYGADAENTSMRPASYTTLPAADNPFVRNEANGESWGFFTLPLKSNDDTQRGLD
FT                   WADIREPIRDILKTQADGKFEARFAGLVPVTSEVTEGVQRDQKKAELIALPLVAIVLFF
FT                   VYGGIVAAVLPMIIGVMTIGASMAIASVLAQFMEVNLFVGPIISLIGLGIAHDYGLFMV
FT                   SRFREELDEGYDTPTAVRRTVMTAGRTIVMSSLLIVGALACLYISPLGLLTSMATGALL
FT                   GVFIAALLSLVLLPAMLAVLGPRVFALSFHWFLTIFDKWKLPLIGGIIHWAAEKTGKPK
FT                   TKANIENGMWGKVTDAVMRKPIAYTVGVVTLLLAITIPVIGLQFGGISQTYLPPTNETR
FT                   QAQDKFFETFPAYTGQSIQIVFTNADDAQIKQVLDEANKIPGFVHTDPADRNSSRFSPP
FT                   TAAVATAKSDGSPLQIRGEGPEVKVRTSNGNLQDPNDTKAVSQAVEQIRGITMDGADAS
FT                   KGVGFMVGGMPTLQNDSIDSMLGKLPLLMGLLVVVTTLMMFLAFGSLVLPIKAVLMSIL
FT                   SLGSTLGFLTWMFVDGHGGSIFNFSGGPLMAPVLVLVIAVVFGLSTDYEVFVISRMIEE
FT                   RAAGATTVQSIRAGTANTGRIITAAAILLACVAAAFATSDLVMMKYVSFGLMFALLIDA
FT                   TVVRMVLVPAVMKLLGDDCWWAPEWMRKIQHAIGLGETALPAETRDGRPLASVRPPSAV
FT                   PGRAAPQLVGAGAPVVPGSLGSAEQRPIPDSAADPTAPSNNERPSGQIRMGNRRPGPPP
FT                   AGQPPRPSAPMQRPPQDPRSYQPPVPGQRRPGPPPQGPGGPRGPQGPYGPPGQGGGPRP
FT                   SGPMPRQQRPGGPAGPGGPGGPRPPYPPRPQGPGGPGGPGGRGPGQRPFPGPSGDGPRP
FT                   HQQRDRDE"
FT   gene            complement(382501..383166)
FT                   /locus_tag="Tpau_0365"
FT   CDS_pept        complement(382501..383166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0365"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa54850 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77008"
FT                   /db_xref="UniProtKB/TrEMBL:D5URF5"
FT                   /inference="similar to AA sequence:KEGG:nfa54850"
FT                   /protein_id="ADG77008.1"
FT                   /translation="MTGTATDPSEASLDAARRVLLVWDAPNLDMGLGSILGGRPTAAHR
FT                   PRFDALGRWLLEYTAALESDTDSRLEPEATVFTNIAPGTADVVRPWVEALRNVGYAVFA
FT                   KPKVDEDSDVDADMLDHIEVRRYRPGLGGLLVASADGQAFREPLEEIAATGVPVKVLGF
FT                   REHAAWALQSPTLEFVDLEDIAGVFREPLPRVSLDSLPDEGAWLQPFRPLSSLLSSRV"
FT   gene            complement(383163..383966)
FT                   /locus_tag="Tpau_0366"
FT   CDS_pept        complement(383163..383966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0366"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="TIGRFAM: tRNA (guanine-N(7)-)-methyltransferase;
FT                   KEGG: nfa:nfa54840 tRNA (guanine-N(7)-)- methyltransferase;
FT                   PFAM: putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77009"
FT                   /db_xref="GOA:D5URF6"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5URF6"
FT                   /inference="protein motif:TFAM:TIGR00091"
FT                   /protein_id="ADG77009.1"
FT                   /translation="MESVPESQDPRAEHRRLYPRVTSFRSRRGALTPSQQRAMDEMWPT
FT                   IGRDIPPARPVDGAPNEDAFPAPSHPLDAPAWFGRTAPLIVEIGCGTGTSTVAMAEAEP
FT                   ERDVLAVEVYLPGIAQLVGGVQRQGLTNVRVVRGDGVAVLEDMIAPGSLEGVRVYFPDP
FT                   WPKARHHKRRLLQPRMFSLIADRLRVGGILHVATDHADYAEAIAEVAPSEPLLRPVELP
FT                   PRLADANLPISVDRPVTKFQDKAAQVGREIHEFVWERVVEEGAHR"
FT   gene            384004..384735
FT                   /locus_tag="Tpau_0367"
FT   CDS_pept        384004..384735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0367"
FT                   /product="protein of unknown function DUF1396"
FT                   /note="PFAM: protein of unknown function DUF1396; KEGG:
FT                   mjl:Mjls_2429 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77010"
FT                   /db_xref="InterPro:IPR009830"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:D5URF7"
FT                   /inference="protein motif:PFAM:PF07161"
FT                   /protein_id="ADG77010.1"
FT                   /translation="MIVRNSRHTALRLATLMVALLAAFGLVAGCSKAEGEAKKNDAPLP
FT                   DATTMIDSSSAAAKALRDVYLDLSVDGTVPKLPVKSVSAYLTNDPKVAGQGDADVIFNG
FT                   TQVKAKFVVVDSKLWAQFGAGQSYQDMGLAADIYDASAILDPNKGIANLIASVREPKAE
FT                   GREQIGGVETVRLSGIIPGSALAGIVPKADLGDRPVTFWVQEAAPNNLVRANVGFDAGT
FT                   LTVTLSDWGKKQQLIDPKTAK"
FT   gene            384732..386321
FT                   /locus_tag="Tpau_0368"
FT   CDS_pept        384732..386321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0368"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mjl:Mjls_2428 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77011"
FT                   /db_xref="GOA:D5URF8"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5URF8"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG77011.1"
FT                   /translation="MTQAPAVAAPAAGPVRGRGVAIGAAGLAVLLGALDTYVVVSVLED
FT                   IMRSVQIPINRLQEATLIVTCYLLGYIAAMPLLGRLSDRFGRRLVLQASLVLFIVGSVI
FT                   TATADTVPTVLAGRVVQGVASGALLPVTLALAADLWSARRRAAVLGWVGAAQELGSVLG
FT                   PVVGVGVVALVHDKFTSVPADDAWRVVFWVQVPLALVAILLIQLSVPTRSGTEKQSVDV
FT                   VGGLLLAVALGLSVMGLYNPDPNGEQILPPNGPVLLGGAAVAFVAFAVWEKFARTKLID
FT                   PAGMRVLPFLAACAASVCAGAALMITLVDIELYARLVLERSQVDSVVLLVRFLIALPIG
FT                   AILGGLIAARIGDRWISVAGLLVAAAGYLLIAQWPRDVLAADYFGALPVLDTSLAVAGF
FT                   GLGLVIGPLSSAALRAVSLSQAGIASALLVVARMSGMLIGVAALTVFGLHRLAAIQAGM
FT                   PAPQVQGDFVARVKAMAGQVQDAYAIMFGEVFAVTAVICLVGAVFAAFVAGGRHQSPQS
FT                   SAEDGDALVTSS"
FT   gene            386360..387073
FT                   /locus_tag="Tpau_0369"
FT   CDS_pept        386360..387073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0369"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa54810 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77012"
FT                   /db_xref="UniProtKB/TrEMBL:D5URF9"
FT                   /inference="similar to AA sequence:KEGG:nfa54810"
FT                   /protein_id="ADG77012.1"
FT                   /translation="MGDLTVRGGPPRVRLLGRDGVGKSVLAAALERRGIATTKRDSGDA
FT                   NLYCLAGGLRATDRAAIATLAAGRTPLLVAWTKADAAGSWRAADARAAELAGELGRPVL
FT                   AVMALLDVIGTDELDIARRLAASAFALPESVAEAAAALGDDASVLVRTGGYGLACAIGA
FT                   LRETPSLSTDELLPRLHELSGVDLLAEPVIAAFAGFEARREAEFDETLRTVARTDCARR
FT                   DEAEHLLLDRLARVS"
FT   gene            387070..388110
FT                   /locus_tag="Tpau_0370"
FT   CDS_pept        387070..388110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0370"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rop:ROP_52280 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77013"
FT                   /db_xref="GOA:D5URG0"
FT                   /db_xref="UniProtKB/TrEMBL:D5URG0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77013.1"
FT                   /translation="MTVLVAAQDAAGAIAVARALDGAPAVVGADGALTPLAEQPREVDA
FT                   AVYVLDACVPADPVDSVALGRLRARWGTVVAATGAEAYPDSAATCAESARRLGVAVLPV
FT                   EPGLAAIRAALACAPAPEPCVPAVPARPNPALERADRSAYLRSTVARMRAALLAESAER
FT                   FRGRDDDASPERVRARLERTVAGLELSLHEYLRAAYRGTFAGWPSPPEPAVPVLSRPDP
FT                   TEPPAHRRRPEDAAVLVLGASAGLGIGRAVAAPLEALGTLRWLALPISLVVGLAAALWL
FT                   LRVRRRTSARASRRAWSDGAAAAHRQRVEYEIAAALVAAESDAALRLARGPGTEPRPDA
FT                   SNGHGA"
FT   gene            388100..388435
FT                   /locus_tag="Tpau_0371"
FT   CDS_pept        388100..388435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0371"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mab:MAB_4503c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77014"
FT                   /db_xref="UniProtKB/TrEMBL:D5URG1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77014.1"
FT                   /translation="MEPEFGLFAGGDSDAAGPDLFDGAVPAAAPSSEGLWVSADGGWFD
FT                   VHALDTDGDGHPDTGTLSGPGGTAVFTDLDADGVADVYHRIRPDGTFETWRFSGGSWHL
FT                   LDRGEVM"
FT   gene            388524..390368
FT                   /locus_tag="Tpau_0372"
FT   CDS_pept        388524..390368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0372"
FT                   /product="Phosphoenolpyruvate carboxykinase (GTP)"
FT                   /EC_number="4.1.1.32"
FT                   /note="KEGG: mgi:Mflv_0451 phosphoenolpyruvate
FT                   carboxykinase; PFAM: phosphoenolpyruvate carboxykinase
FT                   (GTP)"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77015"
FT                   /db_xref="GOA:D5URG2"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/TrEMBL:D5URG2"
FT                   /inference="protein motif:PRIAM:4.1.1.32"
FT                   /protein_id="ADG77015.1"
FT                   /translation="MTSATIDGLDGDSIPTKHAKLIEWVREVAELTQPERVVWADGSEE
FT                   EWDRLTAEMVAAGTFTKLNENKKPNSFLALSDPADVARVESRTYICSETKEAAGPTNNW
FT                   VRPAEMRATMTDLYRGSMQGRTMYVIPFCMGPLGAEDPKLGVEISDSPYVVVSMKIMTR
FT                   MGTAVLDKLGEDGFFVKGLHSVGKPLAPGEADVPWPCSETKYITHFPETREIWSYGSGY
FT                   GGNALLGKKCYALRIASAMAHDEGWLAEHMLILKLISPEDKVYYIAAAFPSACGKTNLA
FT                   MIQPTLPGWRAETVGDDIAWMRFGKDGRLYAVNPEFGFFGVAPGTSMDSNPNAMKTIDA
FT                   GNTLFTNVAKTDDGDVWWEGMSAAPQHLTDWRGNDWESSSAENEDGLVTVAAHPNSRYT
FT                   TPMSQCPSIAPEWDDPQGVPISAILFGGRRKTTVPLVTQARDWKHGVFMGATVGSEQTA
FT                   AAEGKVGTVRRDPMAMLPFLGYNVGDYFDHWLNIGKQADESKLPEVFYVNWFRRGEDKR
FT                   FLWPGFGENTRVLKWIIDRIEGNAAGKETPVGIVATPEELDLTGLDTPVEDVAEALAVN
FT                   VDEWRGEIPSIEEWFSFVGDKLPTGLQDELDALKQRLG"
FT   gene            complement(390500..391252)
FT                   /locus_tag="Tpau_0373"
FT   CDS_pept        complement(390500..391252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0373"
FT                   /product="major intrinsic protein"
FT                   /note="PFAM: major intrinsic protein; KEGG: ach:Achl_1986
FT                   major intrinsic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77016"
FT                   /db_xref="GOA:D5URG3"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:D5URG3"
FT                   /inference="protein motif:PFAM:PF00230"
FT                   /protein_id="ADG77016.1"
FT                   /translation="MTDNISLGVVFGSEVAGTAMLTLLGCGVVANVLFTRGKGSGATMT
FT                   IAWGWGLAVFAGVYVAAKSGAHLNPAITLGLLSRGASEYAPGVPVSAASTAVYFSAQLI
FT                   GAFLGAVLCWLTFKAQFDSAADPADKLGVFATAPAIRSYGWNAVTEVVATFVLVYVVLN
FT                   FGGTPTGLGPLAVALVVVGIGLSLGGPTGYAINPARDLGPRLAHLLLPIPGKGGSDWNY
FT                   SWVPILGPIVGGVIAGLAARWLPFAVGG"
FT   gene            complement(391371..392237)
FT                   /pseudo
FT                   /locus_tag="Tpau_0374"
FT   gene            392525..393835
FT                   /locus_tag="Tpau_0375"
FT   CDS_pept        392525..393835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0375"
FT                   /product="flavin-containing monooxygenase FMO"
FT                   /note="KEGG: msm:MSMEG_1682 flavin-containing monooxygenase
FT                   FMO"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77017"
FT                   /db_xref="GOA:D5URG4"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5URG4"
FT                   /inference="similar to AA sequence:KEGG:MSMEG_1682"
FT                   /protein_id="ADG77017.1"
FT                   /translation="MSDTEVEALVIGAGQAGIAMSEHLGAHEIPHLVVERDRIAERWHS
FT                   WRWDSMVANGPAWHDRFPGLEFDIRPDDFAGKRQVADYLCAYAEMINAPIRTGVEVTSV
FT                   TKCTGRAGFRVDTSQGVIHARYVISATGAFQKPVIPAILPQHARIHQIHSVDYRNPQQL
FT                   PGGAVLVIGAGSSGVQIADELRSSGRRVFLSVGPHDRPPRRYRGRDFCWWLGVLGQWDA
FT                   ATPPAGAEHVTIAVSGANGGRTVDFRALAADGITLLGRAERFERGALRFSDDLRANIEA
FT                   GDASYLSMLDEADDYVLRNGLDLPEDPQARTSLPDPECMLDPVREVDLAAEDIRSVVWA
FT                   TGFANDFGWLKVDVFDDRGRPEHQRGVCTEPGIYFLGLPWLSRRGSSFIWGVWHDARHL
FT                   ADQIAIQQGYLRYTGSECARSERGADRNDRSAQGARP"
FT   gene            393832..394281
FT                   /locus_tag="Tpau_0376"
FT   CDS_pept        393832..394281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0376"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: msm:MSMEG_1681
FT                   endoribonuclease L-PSP superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77018"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D5URG5"
FT                   /inference="protein motif:PFAM:PF01042"
FT                   /protein_id="ADG77018.1"
FT                   /translation="MNTPAARPTHRRIRPFNTRDTYPEQNLDNDLCQAVVAGGVVYLRG
FT                   QIGQDLDTRESVGVGDVKVQAHQAMRNISQLLEEAGSSLRDIVKVTVYLTDVRYREVVY
FT                   RVMGEWLAGVYPVSTGLVVDALARPEWLVEIDAVAVLSAPEGVAR"
FT   gene            394402..394695
FT                   /locus_tag="Tpau_0377"
FT   CDS_pept        394402..394695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0377"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   mlu:Mlut_10240 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77019"
FT                   /db_xref="GOA:D5UMQ2"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D5UMQ2"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ADG77019.1"
FT                   /translation="MPKPYPKEFRDDVVRVARNREPGVRLKQIAADFGISESCLMNWVK
FT                   TADVEAGSKSGSSAAQSATERQMRKRIRLLEQENEVLRRAAAYLSQANLPGK"
FT   gene            394695..395594
FT                   /locus_tag="Tpau_0378"
FT   CDS_pept        394695..395594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0378"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   msm:MSMEG_4105 transposase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77020"
FT                   /db_xref="GOA:D5UMQ3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D5UMQ3"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADG77020.1"
FT                   /translation="MYPLVKELADDGVPVTVSCRVLKLSRQPYYRWLAAPVPATELVEA
FT                   YRANALFDASVDDPEFGHRLLADEARAAGEPMADRTAWRICRDNRWWSVFGKKRSSKGG
FT                   KPGPAVHDDLCTVTDEHGRTRHRFTADAPNRLWLTDITEHRAREGKLYLCAIKDAYSGR
FT                   IVGYSVDSRMKARLAVNALNNAVAMRGDVTGCIVHSDRGSQFRSRKFRRALEYHGLRGS
FT                   MGRVASCGDNAAMESFFSLLQNNVLDRHCWATRQELRTAIITWIERTYHRRRRQRRLGR
FT                   LTPIAFESTMNPAAPHAA"
FT   gene            395613..396248
FT                   /locus_tag="Tpau_0379"
FT   CDS_pept        395613..396248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0379"
FT                   /product="protein of unknown function DUF1028"
FT                   /note="PFAM: protein of unknown function DUF1028; KEGG:
FT                   msm:MSMEG_1680 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77021"
FT                   /db_xref="InterPro:IPR010430"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D5URG8"
FT                   /inference="protein motif:PFAM:PF06267"
FT                   /protein_id="ADG77021.1"
FT                   /translation="MQQALIASSSPAVASRCAHIRAGTGVVASQNVTNPGLGTMVLGSL
FT                   AGGADARSALEWALAREEFPAYRQVTIVDARGRTAVHSGARSLGVHGHAVGEQAVAAGN
FT                   LLADEAVVREMLAGYRHSSAPAFEVRLLDGLSAALGAGGEAGPVRSAGLMVVEDVAWPV
FT                   TDLRIDDADDPISELKRLWRIWEPQKGDYRLRALDPTRAPSYGVEGDL"
FT   gene            396245..397399
FT                   /locus_tag="Tpau_0380"
FT   CDS_pept        396245..397399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0380"
FT                   /product="amidohydrolase"
FT                   /note="KEGG: msm:MSMEG_1679 AmiB; TIGRFAM: amidohydrolase;
FT                   PFAM: peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77022"
FT                   /db_xref="GOA:D5URG9"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR017144"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D5URG9"
FT                   /inference="protein motif:TFAM:TIGR01891"
FT                   /protein_id="ADG77022.1"
FT                   /translation="MTSLDEAIESVVAGVHPNLLDLARDLFDHPEVAWEEVRSARRVAA
FT                   QLSDHGFEVTERYVGVDTAFAATIGTGGLHFALCAEYDALPGLGHACGHNLISAITVGA
FT                   AISLAPLVDDLGLTLTVLGTPAEEGGGGKIELLERGAFAGQHAAAMVHPGPVDVARAKP
FT                   FAVSHSHIDYRGKAAHAAAYPDRGVNAADAFTVAQVAIGLLRQQLPSSVRVHGVVTHAG
FT                   EAPNSIAEHTEGRWYVRAETLAELESIEPRVMRCFEAGAWATGAELTVSPESKPYAEFR
FT                   TDEQLLACCQSRARAIGRRFDDGGDAMMARASTDMGNVSQALPAIHPYIGIDSLPAVNH
FT                   QPEFAAATLSAAAGTAVAQGAVALAGTVVDAATRSSIRRRLESV"
FT   gene            397470..399572
FT                   /locus_tag="Tpau_0381"
FT   CDS_pept        397470..399572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0381"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; FAD-
FT                   dependent pyridine nucleotide-disulphide oxidoreductase;
FT                   KEGG: rop:ROP_14630 histamine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77023"
FT                   /db_xref="GOA:D5URH0"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037348"
FT                   /db_xref="UniProtKB/TrEMBL:D5URH0"
FT                   /inference="protein motif:PFAM:PF00724"
FT                   /protein_id="ADG77023.1"
FT                   /translation="MRDPRYDILFEPVRIGPVTARNRFFQVPHCNGMGYRDPSGEAAMR
FT                   RVKAEGGWAVVCTEQVEIHPTSDIGPFIELRLWDDHDLPAIARIAEQIHEGGALAGIEL
FT                   AHNGLNSPNLISRETPLAPQHLPVVSWNLDPVQARAMTKADIADMRRWHADSVRRSLQA
FT                   GYDIVYVYAGHAIGGLHHFLSRRYNNRSDEYGGSLENRVRLIREILEDTREIVEGKAAV
FT                   ACRISVDELLGDEGITRAEMEDVFGLIGELPDLWDLVLGSWEDDSVTSRFGPEGEQEPF
FT                   VTGLRDLTSKPVVGVGRFTSPDTMVRHVTSGILDLIGAARPSIADPFMPNKIERGDLDD
FT                   IRECIGCNICVSGDFTMSPIRCTQNPTMGEEFRRGWHPESIAPKRSSSSVLVIGAGPAG
FT                   LEAARALGNRGYPVTVTEASRILGGRVVGESKLPGLSAWIRVIDYRLHQIARLDNVELY
FT                   RESAMNADDVLDVGFDHVVVATGASWRRDGVGRWHTRPIDIEPGVDVLTPDDIIAGARP
FT                   QGHRVVLFDDDHYYLGAVIAELLASEGFVVTLVTPVPQVSQWTTNTMEAHRIRKRIIEA
FT                   GVEVRTDTAVSTVMVDGVVTACRFTGRTGWIDADSVVLVTARLPHDDLYTALHDRASEW
FT                   SDAGVQSVRGVGDAWAPGTIAAAVWSGHRFAEELDAPLGDAPVPFRREVTQLTIEPVFP
FT                   RPASSS"
FT   gene            complement(399604..400512)
FT                   /locus_tag="Tpau_0382"
FT   CDS_pept        complement(399604..400512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0382"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: rha:RHA1_ro01787 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77024"
FT                   /db_xref="GOA:D5URH1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5URH1"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADG77024.1"
FT                   /translation="MADYTLRQLEYFVAVAEANSITRAAAAVHLSQSAMSTALADLEGA
FT                   LGVQLVVRHHAKGITLTPAGRELVVASRQLLASAADLRSAAQGLGSSLSGTLSVGCFQV
FT                   VAPYVLPTLLSVASQKLPRLELRTTEVDLADLAEGVADGTFELGIGYDLVDDPRLKRWP
FT                   LRTISPHVLVSGSHPLAQNASVHLSELADEPMALLDLPHSRDYFRRIFAAAGVEPNVRY
FT                   RSTTVETCRALVGRGLAYTVLNFQSAVPMALDGHPVASVPIADASPALTMVLLNAVAAK
FT                   PTRRATVVAELCRDLFGSEGA"
FT   gene            400652..403444
FT                   /pseudo
FT                   /locus_tag="Tpau_0383"
FT   gene            complement(400843..401742)
FT                   /locus_tag="Tpau_0384"
FT   CDS_pept        complement(400843..401742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0384"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   msm:MSMEG_4105 transposase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77025"
FT                   /db_xref="GOA:D5UMQ3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D5UMQ3"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADG77025.1"
FT                   /translation="MYPLVKELADDGVPVTVSCRVLKLSRQPYYRWLAAPVPATELVEA
FT                   YRANALFDASVDDPEFGHRLLADEARAAGEPMADRTAWRICRDNRWWSVFGKKRSSKGG
FT                   KPGPAVHDDLCTVTDEHGRTRHRFTADAPNRLWLTDITEHRAREGKLYLCAIKDAYSGR
FT                   IVGYSVDSRMKARLAVNALNNAVAMRGDVTGCIVHSDRGSQFRSRKFRRALEYHGLRGS
FT                   MGRVASCGDNAAMESFFSLLQNNVLDRHCWATRQELRTAIITWIERTYHRRRRQRRLGR
FT                   LTPIAFESTMNPAAPHAA"
FT   gene            complement(401742..402035)
FT                   /locus_tag="Tpau_0385"
FT   CDS_pept        complement(401742..402035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0385"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   mlu:Mlut_10240 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77026"
FT                   /db_xref="GOA:D5UMQ2"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D5UMQ2"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ADG77026.1"
FT                   /translation="MPKPYPKEFRDDVVRVARNREPGVRLKQIAADFGISESCLMNWVK
FT                   TADVEAGSKSGSSAAQSATERQMRKRIRLLEQENEVLRRAAAYLSQANLPGK"
FT   gene            complement(403499..405001)
FT                   /locus_tag="Tpau_0386"
FT   CDS_pept        complement(403499..405001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0386"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: rop:ROP_14650
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77027"
FT                   /db_xref="GOA:D5URH4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D5URH4"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ADG77027.1"
FT                   /translation="MPEPSDVTSINWHERASTIKLPTTSFIDGRSTPALSRESFDVVNP
FT                   ATDQVLTAVSAGGADDIDAAVKAARRAFDDGRWNGLSPTERGERLIRFADLLLENIEEL
FT                   ALLVTLEMGKVIRDSYTVEVPGAAAVFRYYGEVIDKIPGELPPTADGSVAMVRRIPVGV
FT                   VGAVVPWNFPLDIAAWKVAPALAAGNSVVLKPAEESPLSALRMAEIATEAGIPDGVFNV
FT                   VPGLGTTAGRALGVHPGVQCLAFTGSTEVGKKFLAYSAESNMKQVWLECGGKSPNIVFA
FT                   DYDDLDRAAEMTCFGIFGNQGEVCSANSRLLVQRTIAEEFLTKVVEQAATYRPGDPLDP
FT                   DSITGAMVSEKHLDRVLAACSQAGSDGRTLLGGKRIEGPGYFMEPTVVVDLPLDAAAMT
FT                   DEIFGPVLSVAVFDDEAEAVAIANDTAYGLAGSVWTSSLDRALRVSDALHAGTVSVNTV
FT                   DALSPGTPFGGFGESGFGSDLSVHALDKFTGLKTTWIARHAR"
FT   gene            405131..405982
FT                   /locus_tag="Tpau_0387"
FT   CDS_pept        405131..405982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0387"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   rop:ROP_38490 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77028"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5URH5"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADG77028.1"
FT                   /translation="MDLRIDGRVFLVSGATRGIGAAVVRTLLAEGACVGGYARRVADEV
FT                   DDSRQLIGAAEAADAGQVRAFVDRCAERFGRVDGVVANAGQGLIAGPDAPLDVWHDQFD
FT                   QRITHAKNLIDAALPHMRRTDAPVIVLLNAVSAHHPDPEMAPVSAARAALASYAATLSH
FT                   HLAPDRIRVVSVDLGMIDTDRQRARHTASQSPIEYDEWLVDEAVRRGIPWGRAGTRRRS
FT                   PTSLAREEGGGRQRGVRCGEQDRFGTAADRMSKAASIRSGIGMLRFARSATPVRDPGCS
FT                   ST"
FT   gene            complement(405832..407010)
FT                   /locus_tag="Tpau_0388"
FT   CDS_pept        complement(405832..407010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0388"
FT                   /product="Beta-lactamase"
FT                   /EC_number="3.5.2.6"
FT                   /note="KEGG: mpo:Mpop_1481 beta-lactamase; PFAM:
FT                   beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77029"
FT                   /db_xref="GOA:D5URH6"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR001586"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D5URH6"
FT                   /inference="protein motif:PRIAM:3.5.2.6"
FT                   /protein_id="ADG77029.1"
FT                   /translation="MRSLIAAVLTAAVMTGCSAQPAEHPNQSPSAAPDQVSTTARSVIT
FT                   ELRRAHAIPGIAVAVVLGARTTVVTDGTLGAEDSRAVGPDTLFEIGSVSKIYTALLGAT
FT                   AEADGRISLQDSPARFLPWLRGTPLAGVTLDQLGTYTAGEFPLQFPPSVTDETSMRDYF
FT                   TTWRPTAPAGTTRRYANPSIGLFGLSAAAAYGMDYPVALRERVLTPLDLRDTYISIPDS
FT                   AADRYAWGRTSDSPRVRLSPRPLDAEAYGVKTTPSDLAAFTAAFMNPTTPPAIRSAMQP
FT                   RYEVSPMRQSLGWEGIASPATRKRVQDANAAGITGASRPVTPTGPEPSCLLNKTGSTKG
FT                   FGTYVLLHPGSRTGVALLANRNIPIPDRIDAAFDILSAAVPNLSCSPQRTPR"
FT   gene            407180..407938
FT                   /locus_tag="Tpau_0389"
FT   CDS_pept        407180..407938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0389"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   rop:ROP_38490 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77030"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5URH7"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADG77030.1"
FT                   /translation="MDLRIDGRVFLVSGATRGIGAAVVQTLLAEGACVGGYARRVADEV
FT                   DDSRQLIGAAEAADAGQVRAFVDRCAERFGRVDGVVANAGQGLIAGPDAPLDVWHDQFD
FT                   QRITHAKNLIDAALPHMRRTDAPAIVLLNAVSAHHPDPMMAPVSAARAALASYATTLSR
FT                   HLAGDRIRVVSVDIGMIDTPRQRERHAASGSGLDYQDWLAGEAERRGIPWGRAGTTAEV
FT                   ADTVAFLLSPRSSYSTGTSIAIAGGLHPRP"
FT   gene            complement(407941..409158)
FT                   /locus_tag="Tpau_0390"
FT   CDS_pept        complement(407941..409158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0390"
FT                   /product="HNH endonuclease"
FT                   /note="KEGG: mjl:Mjls_0290 hypothetical protein; PFAM: HNH
FT                   endonuclease; SMART: HNH nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77031"
FT                   /db_xref="GOA:D5URH8"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:D5URH8"
FT                   /inference="protein motif:PFAM:PF01844"
FT                   /protein_id="ADG77031.1"
FT                   /translation="MEEEDIGTASGAGGEVIAGLSALERLRARVVFDQYRLIVELLRAR
FT                   VCERIAAGAAQDRWEAGVASEVALALRVSTNRATAMLSRAKVLARDLPATFARLREGDV
FT                   SPEAVEVIVAGVSHLEPRLKTEADTALCGENFAAGGLGLKRLQDTVKQVAYRLDAQATV
FT                   DRVALAAKDRRVTVRPAPDCMARVSILLPVAQAVGVYAALKTAADAVFGVPGEPRSRGQ
FT                   IMADTAFARITGREAAEGQPVTVNLTVPASVLLGDQPGAAHLSGGGTLPGEIARHLVGR
FT                   AAEQAIAWVKRLYVQPESGAVVGLDSRSRLFPRGLAEVIAARDRYCRTPYCDAPIAHTD
FT                   HIAPHAHGGPTSLANGQGLCAACNYAKEAAGWSSRTVDDETGRHTVETHTPTGHVHRST
FT                   APPQAA"
FT   gene            complement(409336..409761)
FT                   /locus_tag="Tpau_0391"
FT   CDS_pept        complement(409336..409761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0391"
FT                   /product="dual specificity protein phosphatase"
FT                   /note="KEGG: sma:SAV_5613 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77032"
FT                   /db_xref="GOA:D5URH9"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:D5URH9"
FT                   /inference="similar to AA sequence:KEGG:SAV_5613"
FT                   /protein_id="ADG77032.1"
FT                   /translation="MRQWADSTAGLVRLPSGTLVRGRSLRAGAPADAATVTLALTWLPP
FT                   ESAPGRILWVRTPDFGVPLAPGAARRRIAQAHELLSTERVEVVCGGGIGRTGTGLAALA
FT                   ILDGLSPADAVEFVRAEYHPRAVETPWQRWFLRTFRR"
FT   gene            complement(409758..410909)
FT                   /locus_tag="Tpau_0392"
FT   CDS_pept        complement(409758..410909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0392"
FT                   /product="monooxygenase FAD-binding protein"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG: kra:Krad_0778
FT                   monooxygenase FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77033"
FT                   /db_xref="GOA:D5URI0"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5URI0"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ADG77033.1"
FT                   /translation="MWRTNSLRVAVVGAGIGGLAAAAGLQRAGAEVIVLEQAARFLPRG
FT                   SGLSLFDNGFTALRSLGLEERVRAVTADGPPEIPVGTRTVDGTRVSTFRPETAAGLRVI
FT                   DRTELHQALLGALVPDTVRPGIRVEGVNRDTVDLGPSGLLSYAHVIVGADGIRSRVRGS
FT                   YAGDPGAAYCGYGAWRGITAAPVALEDAGETFGRGERFGYVPLRDGRVYWFAVRPSTAD
FT                   DEPEPGELLERFGQWHDPIPELITATETKRIGYQPIERLARPLRTFSRGQAALVGDAAH
FT                   AMPPTLGQGANLALEDAAVLVSVLRPLATDPDPRAVPAALTSYDKQRRRRTQRIARQAH
FT                   LLGAAGQWPNPLVAFGRDLAFRFAPDGLMDWGMRRVQQWTPPT"
FT   gene            411087..411617
FT                   /locus_tag="Tpau_0393"
FT   CDS_pept        411087..411617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0393"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_2883 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77034"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:D5URI1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77034.1"
FT                   /translation="MSIADEWEIWFPDAYEIGSESVRSFARATRNWHVPYAASRVVPAD
FT                   SAVPATMLGAPLLQAASALVGKAIPGCNLSAILHAGQTFHYLRALQIGDIVSVGTRLGS
FT                   HIVKADTDLITVDCMVYVADEPCVSAEIFIAHSQRETGIDLEAADRLADEVMMTGTGPS
FT                   NSDEYAANVASSI"
FT   gene            complement(411614..413290)
FT                   /locus_tag="Tpau_0394"
FT   CDS_pept        complement(411614..413290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0394"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="KEGG: nfa:nfa8260 hypothetical protein; PFAM: AAA
FT                   ATPase central domain protein; Tetratricopeptide TPR_4;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77035"
FT                   /db_xref="GOA:D5URI2"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR023835"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041627"
FT                   /db_xref="UniProtKB/TrEMBL:D5URI2"
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /protein_id="ADG77035.1"
FT                   /translation="MTASASALSAFRAGVAALGIQVGEFEATPRDAALARRAFAAATAA
FT                   DPGMADAWLGRAAAGETTAEVLAALHRTADALGSAARRAGLSPGDLAGTFATGMYVDYP
FT                   LRDAATAHVAYAARLLADGAPDDAERALDAAVSCPIERYQRAVVCATGRRWGEVLTALD
FT                   GLGGWDDEALAAAGHAIAGAAAAQLGRFAEAARHLTAAAAGPVPGAAAAARYCHGLVLR
FT                   EQGDEDGARALLERAAPSYPPAEAALRDPNHRLVLASPDEPVAEDAQAEDSADLLAEAA
FT                   AELDRQVGLREVKEQVARLRTTMQLAQVRADRGLSSGARSLHLAFTGPPGTGKTTVARI
FT                   VARMYRGLGLLQTENVVECSRRDLVGQYLGATAIKTSAVIDSALDGVLFIDEAYTLVQD
FT                   GLSGGDAFGREAVDTLLARMENDRDRLVVIIAGYDGEIDRFLGSNEGLASRFARRIRFP
FT                   GYSPGELAEIGEAMARARDAVLTGEAAAVLEACCAGITDRLDQLGNGRFVRNVIEAAEE
FT                   EREMRLAESGADLAGLDEAQLMRIEGADMARALEALVGVAV"
FT   gene            complement(413334..413816)
FT                   /locus_tag="Tpau_0395"
FT   CDS_pept        complement(413334..413816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0395"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rer:RER_50940 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77036"
FT                   /db_xref="UniProtKB/TrEMBL:D5URI3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77036.1"
FT                   /translation="MHLEPRVLMQLSGLLDLREGKFFASCFGNRVPDDLLAAVTVHGAA
FT                   TNKATAGFASPSRAQSAMPVEIEHWDDVPPHDGDWDTVLSTTLCVDTSGTVELFSPADG
FT                   AVGEIVEFPMARGYYVVEACARHAGDGADEWRLRLWHSDEVGPDLKEIREIALLAR"
FT   gene            413835..414623
FT                   /locus_tag="Tpau_0396"
FT   CDS_pept        413835..414623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0396"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: nfa:nfa46550 putative ABC transporter ATP-
FT                   binding protein; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77037"
FT                   /db_xref="GOA:D5URI4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5URI4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG77037.1"
FT                   /translation="MPQPGASGKLDDMSESTFAVAARAVDLTKVYGEGDNVVHALAGVS
FT                   VDFLTGEFTAIMGPSGSGKSTLMHCLAGLDTASSGSVQVGGTELTSLSDKQITELRRDR
FT                   IGFVFQAFNLVPTLTALENITLPLDIAGRKPDQQWLDTVVDRLGLRPRLDHRPTELSGG
FT                   QQQRVACARALVGRPDIIFGDEPTGNLDSRSGAEVLSILRSAVNDFRQTVVIVTHDPRA
FT                   ASYADRVVFLADGRIVDEMRGPTAETVMDKMIHLDELVGG"
FT   gene            414625..417195
FT                   /locus_tag="Tpau_0397"
FT   CDS_pept        414625..417195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0397"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   rop:ROP_61080 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77038"
FT                   /db_xref="GOA:D5URI5"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D5URI5"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADG77038.1"
FT                   /translation="MASPMRKVALRNLMAHKGRLFLTVLSVLLGTSFIAGSMVFTGTLS
FT                   KAFDGISDRIAVGVDARVAPKDAQGQGGFGPQGPGVPLSALDRVRAVPGVRIAQPAVTG
FT                   SIALRDGKGDVVSPTGAPQTGGAYLPPGESFESDGLKITEGRAPSGPNEMVLNDSAADR
FT                   LDLPVGSKTTVVTPRSPGPIEATIVGTYTASVDTGGYIGALFAKDEAQKLFGDGATTPN
FT                   IDVAAAPGTSPEQLRDRLAQALPELDVKTGDEVRTEFTDQVNQGLSFLNYFLVAFGLIG
FT                   LLVGVFIIYNTFSMLVAQRLKELALLRAIGASRPQVRNSVVLEALVVGVLGSAAGLATG
FT                   IGLAWLLQAVVKAAGAGFPDTGIVVAPSVAITVMLVGTVVTVISALIPAVRASKVPPVA
FT                   AMRAQDGGSAASVLVRGAIGAALFLSALALLFVATTESGSGAAIMVGVAGFGLVLAVVI
FT                   GGPALVGPVLGGVGTVLAKPFGPAGRLGRTNVMRNPQRTTATAFALVIGVALVGVIGTL
FT                   GASMQKSIDSQVDTGIRSDLVLQAPQFGMPPAALTAIKDVPGIGTKTTLYAVPTRIDGD
FT                   RQNLLAVDGDVNAVFNLTRVAGTLDLKSGGLLIDEDKARAEGWEVGSKVALGSATGREQ
FT                   AETTVTGIYAKAGGLSGPVVTVGEVNTLYPPAQGATSPIVTPQSVFIGAADGTSVEDLK
FT                   DRLREAVKPLLVVNVDDQQDLKDQAGQAITALMGVLYGLLGLAVIIAILGIINTLALSV
FT                   VERRREIGMLRAIGMIRSQVRKSIYLESMLIALFGAVLGLVLGVLLGTSLVYALRDEGL
FT                   GSVVVPWSTVLVMLVASAFVGVGAAILPAIRASRTPPLAAIAEG"
FT   gene            417264..418307
FT                   /locus_tag="Tpau_0398"
FT   CDS_pept        417264..418307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0398"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: mmi:MMAR_4486 dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77039"
FT                   /db_xref="GOA:D5URI6"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5URI6"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADG77039.1"
FT                   /translation="MKVVVIGAGYAGTIAANRLMKKAGGADVTVVNPRGEFVERVRLHE
FT                   YIAGSGSATTPLADMLNPAIRLVVGSVETIGDGSVTLADGTVLPFDHLVYAAGGAITAP
FT                   AGTVAVGGFESAGRARTALAALPDGALVTVVGGGLTGIETAAEIAESWPALRVRLLSEG
FT                   EIGASLGVGARRRVHRELERLGVQLRRGRYEEPDGAGLVLWAIATQVSDLAARSGLAVD
FT                   DSGRVLVDEFLRSVSDPRIVAVGDGAAVPDARLSCQTALPQGAHGADNLARIIAGAEPK
FT                   RFSMGYTGQNVSIGRRSAVIQTARRDDTPTRIWFGGRPAAFVKEQVCTMARGAARTANY
FT                   AWLPAPK"
FT   gene            418304..419179
FT                   /locus_tag="Tpau_0399"
FT   CDS_pept        418304..419179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0399"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: mva:Mvan_4806 ECF subfamily RNA polymerase
FT                   sigma-24 factor; TIGRFAM: RNA polymerase sigma-70 factor;
FT                   RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   Sigma-70 region 4 type 2; sigma-70 region 2 domain protein;
FT                   sigma-70 region 4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77040"
FT                   /db_xref="GOA:D5URI7"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014303"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D5URI7"
FT                   /inference="protein motif:TFAM:TIGR02957"
FT                   /protein_id="ADG77040.1"
FT                   /translation="MTTAAEVFTEYRPLLFSIGYEILGSVADTEDVLQESYLRWSDVDL
FT                   AVVENPRAYLARIVTRQALNALRGAARRREQYVGPWLPEPLETPSGDAPTEHVLTGEAV
FT                   TTAMLLVLESLTPTERAVFVLREVFGFGYPEIAEAVGKSEATVRQTAHRARGHVQARRP
FT                   RTVVDPAVAQGAAERFLTAAATGDVQALMDVLAPDAVYLGDGGGVVSAARRPVHGADKV
FT                   ARMLIGLFRKGAAMGEMGLRFAVYNGMPAMVVSFDGVVDQVTCIEVDGAIVTGVYCVRN
FT                   PAKLRSVSMG"
FT   gene            419618..421666
FT                   /locus_tag="Tpau_0400"
FT   CDS_pept        419618..421666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0400"
FT                   /product="MgtE intracellular region"
FT                   /note="PFAM: MgtE intracellular region; KEGG: similar to
FT                   gag protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77041"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="UniProtKB/TrEMBL:D5URI8"
FT                   /inference="protein motif:PFAM:PF03448"
FT                   /protein_id="ADG77041.1"
FT                   /translation="MRAAVQFGAAKGQWDRLGVVTQAAAATVLVSSVALAALPATSITA
FT                   IPTPAQVLAQPPAALKADFVPVGLIDLLPDSTLVRELSNADPARIARIMAQIPPSKVAA
FT                   IMGQMPTESVVAIMNEMDTGALTNIVGGLPTAKLSEVVAGLSNDKLSALVGGIPVDKLG
FT                   PVVASLPADTLSKLVGSIPTDKLAQVVATLPSETLTQVVGGIPVEKLGPVVASLPTETL
FT                   SGLVASIPVEKLGPVVASLPASTLTQLVSGLPDETLKQIVGDIPVEKLGPVVASLPADK
FT                   LTQLVSKIPVAKLTEVVSNLPDDTLKELVGGIPVEKLAPVVASLPADKLSALVGSIPID
FT                   KLTTVVSNLPDDTLGKIVAGIPVEKLGPVVAGLPSETLIKLVAAIPNDKLKEVVGGLPD
FT                   DKLLAIMDGKLIGRVVTSLAGSLLTAQGWRTVPPLLVDAVQYSATGILGIPGQVVQGIP
FT                   VVGPVLSVPVSLATGALSTGINAAAALARPIAELIGTIIALPVQLVGPFLNGGGVGNLF
FT                   ASNAIGTQLTDAVTSVVSGGKHAKQDDGAVAVTQAAPVETGGRHALSSAEDPATEAAAL
FT                   AALDTARSGGRHAKDDDASTTTPSTPPTGSATPTDSAASSGAGATASSDSPSESPVREQ
FT                   ASTPTEAPVKTEAAEEKATANEAPAQTPSTSSDTTESGASGADGAAA"
FT   gene            complement(421736..422509)
FT                   /locus_tag="Tpau_0401"
FT   CDS_pept        complement(421736..422509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0401"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: rha:RHA1_ro05186 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77042"
FT                   /db_xref="GOA:D5URI9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5URI9"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADG77042.1"
FT                   /translation="MSWKDATSKHATSRLRRRATLRRSVRLLSDFRFEQSEPARFYGSL
FT                   ARDTVDLTADLFWEPLDGALVLDVGGGPGYFEDAFAEHGAVYVPIEPDPSEAHAAGITA
FT                   SRGVRGSGLALPIADGAVDVCLSSNVAEHVRDWRAMGAEMLRVTRPGGLVILSYTCWFG
FT                   PFGGHEMGLSHYLGGERAARRYTTKHGHPPKNLYGTSLFKVGANDGLDWAATVDGADLV
FT                   AAFPRYHPSWAWWIVRVPGVREVFTSNLVLAFRKH"
FT   gene            422544..423686
FT                   /locus_tag="Tpau_0402"
FT   CDS_pept        422544..423686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0402"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   rop:ROP_52370 putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77043"
FT                   /db_xref="GOA:D5URJ0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D5URJ0"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADG77043.1"
FT                   /translation="MREVLLLCWRDTRHPQGGGSELYLERVGEELARRGVAVTLRTAMY
FT                   PGAARSETVDGVRVSRGGGRFTVYPLALLAIVAARFGRGPLRGIRPDAVIDTQNGIPFF
FT                   ARLVAGVPVTVLVHHCHREQWPVAGRLVARIGWFIESKLSPWVHRRSQYLTVSLPSAEE
FT                   LGLLGVGPERVAVVRNGIDALEPGVADVRSETPRMVVLSRLVPHKQIEDALFVLARLRH
FT                   RVPDLHLDVIGSGWWDDELYRHALRLGVLDRVTFHGHVTEQRKHRLLSRAWVHVMPSRK
FT                   EGWGITVIEAAQHGVPTVGYVSSKGLTDSVVDGATGLLVRDLAGLTEAVAGVLADPLLR
FT                   AELGEKARQRAGEFSWQATADGVGRVLASSVTGDRVGGLV"
FT   gene            complement(423716..423955)
FT                   /locus_tag="Tpau_0403"
FT   CDS_pept        complement(423716..423955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77044"
FT                   /db_xref="UniProtKB/TrEMBL:D5URJ1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77044.1"
FT                   /translation="MTTPHTLTANAPYRTGALPLPGADPTRWLKASLHRALDRLAPRVE
FT                   DGEVLVRMGCGRANIIGVPSQDNRIVEVAGHTRR"
FT   gene            424105..424320
FT                   /locus_tag="Tpau_0404"
FT   CDS_pept        424105..424320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0404"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77045"
FT                   /db_xref="GOA:D5URJ2"
FT                   /db_xref="UniProtKB/TrEMBL:D5URJ2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77045.1"
FT                   /translation="MVEESGLTARRAWLLVVLGIVNVAVALARDWSQWPDFRTVLAAVI
FT                   AVFGAAILGTGVFALVRAPWKRKSDE"
FT   gene            424313..425068
FT                   /locus_tag="Tpau_0405"
FT   CDS_pept        424313..425068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77046"
FT                   /db_xref="GOA:D5URJ3"
FT                   /db_xref="UniProtKB/TrEMBL:D5URJ3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77046.1"
FT                   /translation="MSNPHPGAVPAPVSSSRSGYDGSGSGKREREAPTVFALPVWLLRW
FT                   AATIVMAVWILGLVAVGAMGWSVEAPFSTKIARGLLFAIAFLSAMVAGQVFRFTRGARP
FT                   LPSRTDTLMFTVYLAANFCLLAAIWSGLPWDRPREGRALLLVGAVLLAAAGGLWIRERK
FT                   RKKNEPAEIEAPIAHRTVATASGERTIKVGLPMPADDGYWVAWWSVAGLPAGYLVHPAF
FT                   GPDSATALARALSAAETAATSTAGSGAPS"
FT   gene            425078..426751
FT                   /locus_tag="Tpau_0406"
FT   CDS_pept        425078..426751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0406"
FT                   /product="response regulator receiver modulated
FT                   FAD-dependent pyridine nucleotide-disulfide oxidoreductase"
FT                   /EC_number="1.8.1.9"
FT                   /note="PFAM: response regulator receiver; FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase; KEGG:
FT                   rer:RER_40230 two-component system thioredoxin reductase;
FT                   SMART: response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77047"
FT                   /db_xref="GOA:D5URJ4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5URJ4"
FT                   /inference="protein motif:PRIAM:1.8.1.9"
FT                   /protein_id="ADG77047.1"
FT                   /translation="MAETQSRPAILTVDDDPSVSRSVARDLRRRYGETHRIVRAESGQQ
FT                   ALEALRELKLRGDTVAVLLADYRMPEMSGLDFLESAMDLFPTARRLLLTAYADTGAAID
FT                   AINVVDLDYYLLKPWDPPEEKLYPVIDAQIEAWECTDHRHIPEVKVVGHRWSARSSEVR
FT                   EFLARNQIPYRWFSSESPEGQRFLAAAGSDGLELPLVVAEDGAALCAPSDQELANHIGM
FT                   TTAPSEEFYDLVVVGGGPAGLGAAVYGASEGLRTVLVERHSTGGQAGQSSRIENYLGFP
FT                   DGVSGTQLTDRARRQAGKFGAEVITTSDVVELDVTGSSRTVKFADGTSVGAHTVILATG
FT                   VAYRQLDSPGVERLTGAGVYYGSALTEAPNCKDLDVYIVGGANSAGQAAVYLAKGAKSV
FT                   TLLVRGESLEASMSYYLIQQLAAIDNVHVRTGTEVVEAHGEEHLDKLTLRNRSTGEQET
FT                   VPADYLFVFIGAAPRTEWLDGVVVRDEHGFVITGPDIGGIEGTRREWPLDRPPFHLESS
FT                   VPGVFVAGDVRSESAKRVASAVGEGAMAVMFVHRYLAGQD"
FT   gene            426751..428208
FT                   /locus_tag="Tpau_0407"
FT   CDS_pept        426751..428208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0407"
FT                   /product="histidine kinase"
FT                   /note="KEGG: rer:RER_40240 two-component histidine kinase;
FT                   PFAM: ATP-binding region ATPase domain protein; cyclic
FT                   nucleotide-binding; SMART: ATP-binding region ATPase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77048"
FT                   /db_xref="GOA:D5URJ5"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5URJ5"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADG77048.1"
FT                   /translation="MSAPHECLKDELRTLFLFEKLTDEQLEWLCERGRIEEFPAGPVYR
FT                   EDDPAESLFVLLDGTVSLSMRVGDSEVETNRTDHRGVYAGAWRSFLGEGMGTTYNSSMR
FT                   AVTDCRFYILPSRDFGELMQQWFPMAVHLLEGVFYGSKRTQRMIGERERLLALGSLSAG
FT                   LTHELNNPAGAAVRAASTLRTRVSGMRHKLAVIANGAWHHDLLVQLVDLQADAVDRVAT
FT                   APTLGPLEASDREDEIADWLDDHGVQNGYELAPGFVAAGLDLEWFEAVLEQVGGDMLPK
FT                   AVAWLYYTVETELLLNEITDSTTRISTLVSAAKQYSQMDRAPFQTLDVHELIDSTLVML
FT                   SQKFGDVTVSKEYDGALPEIRGFGAELNQVWTNLIDNALGAMQGAGTLTLRTSHDDEHV
FT                   LVEVGDTGPGIPDGVVNRIFEPFFTTKPVGEGTGLGLDISWRIVVNKHHGDLSVKSEPG
FT                   STWFRVKLPIAGPPREPDEAEELDTGV"
FT   gene            428252..429337
FT                   /locus_tag="Tpau_0408"
FT   CDS_pept        428252..429337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0408"
FT                   /product="mycothiol-dependent formaldehyde dehydrogenase"
FT                   /note="KEGG: rha:RHA1_ro02587 mycothiol-dependent
FT                   formaldehyde dehydrogenase; TIGRFAM: mycothiol-dependent
FT                   formaldehyde dehydrogenase; PFAM: Alcohol dehydrogenase
FT                   zinc-binding domain protein; Alcohol dehydrogenase GroES
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77049"
FT                   /db_xref="GOA:D5URJ6"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR017816"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5URJ6"
FT                   /inference="protein motif:TFAM:TIGR03451"
FT                   /protein_id="ADG77049.1"
FT                   /translation="MPQVVRGVVARAKGEPTSVVPIVIPDPGPGEVVVSVQACGVCHTD
FT                   LHYREGGINDEFPFLLGHEAAGVVESVGEGVDHVAPGDFVVLNWRAVCGQCRACKRGKP
FT                   QYCFDTFNATQKMTLEDGTELSPALGIGAFAEKTLVHQGQCTRVDATADPAVVGLLGCG
FT                   VMAGLGAAVNTGGVSRGDTVAVIGCGGVGDAAIAGARLVGARTIIAVDRDPKKLDWARD
FT                   LGATHAINAAETDAVEAIQELTGGFGADVVIDAVGRPETWKQAFYARDLAGTVVLVGVP
FT                   TPDMTLDMPLIDFFSHGGSLKSSWYGDCLPERDFPQLVDLYQQGRLPLDKFVTERISLD
FT                   EVEAAFETMHRGEVLRSVVVL"
FT   gene            429334..429960
FT                   /locus_tag="Tpau_0409"
FT   CDS_pept        429334..429960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0409"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   rer:RER_54690 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77050"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D5URJ7"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ADG77050.1"
FT                   /translation="MSLRTERVITSGQFSLDGGTWDVDNNVWLIGDDAEVVVVDAAHSA
FT                   DPIVAAVGGRTVRAIVCTHGHNDHVTVAPQLSERLDAPILLHPGDDVLWDMTHAGIAHE
FT                   DLADDQRIAVAGTDIQVIHAPGHSPGSVCLYLPEADELFSGDTLFAGGPGATGRSYSDF
FT                   SVIIDSIRDRLFALPPQTRVNTGHGDGTTLGTESPHLEEWIRRGH"
FT   gene            complement(429988..431412)
FT                   /locus_tag="Tpau_0410"
FT   CDS_pept        complement(429988..431412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0410"
FT                   /product="condensation domain protein"
FT                   /note="PFAM: condensation domain protein; KEGG:
FT                   nfa:nfa30230 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77051"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:D5URJ8"
FT                   /inference="protein motif:PFAM:PF00668"
FT                   /protein_id="ADG77051.1"
FT                   /translation="MISGFAEHWQCPTGEWVVWAPDANTCEAMRNAPDLGVETSFIQAD
FT                   HLRSGIEGESCVRRLVFTSFTVHDKFDAETIAKVFTDFVRAHETFHTAFPVSTDLRPRG
FT                   RTLRPEQISLAVTARSQDHPERTVKDHLIESVPTLHEWAAFAFAVNGIENAGPDAVDPH
FT                   FQVVVGSDHMFTDGVSQAISFFEILSRYTAARTGTPYEPVPVRPYPQFCAEQRALAATL
FT                   TPTHPDVEQWRDTLARAGGMPKFPLPLGLGPGEAAPGKIAVHASFVDAAQAARFGAAAK
FT                   QAGGNTSSALLAVLGQVHHALTGERLFTMLIPRADRSATGDAMAVGWYVTLVPVQFDAS
FT                   GTFAEATRNAQEALGVARQLDRTPVFPVIDMLANDPGFPVQHGFTSPMLSYIDVTRVPG
FT                   AELARQHDFSVFANATPSREVFMWINRDESGLDFNAQHPETVEATRAVDTVFRLLRDRI
FT                   IEVADGVRPHLVATAS"
FT   gene            431633..432331
FT                   /locus_tag="Tpau_0411"
FT   CDS_pept        431633..432331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77052"
FT                   /db_xref="GOA:D5URJ9"
FT                   /db_xref="UniProtKB/TrEMBL:D5URJ9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77052.1"
FT                   /translation="MSRPKLGAPFSRWWYAWFAVVAVMMVSSVQDRRWATAVLWLAILA
FT                   AATSEIARSLRQRNLAFGIAGILGVVAALLGYAERDWLAVGLGAMIAVVLVAFLPKIRH
FT                   DVPTCRVRTEELVGRTVADATHLLGFDDRRQPAGLSGPELVPMPPGEQDLGDPELIVTA
FT                   VTVVVDAGTQAQIDAATITFGVADSDDPAIPAAGSATSLALTKSEAQDRLVGIVGGGPA
FT                   DIRPRRFPGS"
FT   gene            432396..433100
FT                   /locus_tag="Tpau_0412"
FT   CDS_pept        432396..433100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77053"
FT                   /db_xref="GOA:D5URK0"
FT                   /db_xref="UniProtKB/TrEMBL:D5URK0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77053.1"
FT                   /translation="MGPPPNRWGAVLAIAYGPGSAAVQAYAGNWTLAAFVLAVSAGIAA
FT                   FGAPSRRWETTLTCAMVIGFAAMAASGFSRGQTFSVIIGSVLAVVVSLTCWHRRWKAAD
FT                   CRVRTEELVGLTVTQASGLLGFAAGRQPDGLRDPELVAVPAAELDLSEPSLIVTSVVVD
FT                   PTGPALTFGVADGAGLALGRAARGEYQRELSARVGGFPADIRPLRWPGSTGARSMSTVG
FT                   GVADGSRPELQP"
FT   gene            433142..433777
FT                   /locus_tag="Tpau_0413"
FT   CDS_pept        433142..433777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0413"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77054"
FT                   /db_xref="GOA:D5URK1"
FT                   /db_xref="UniProtKB/TrEMBL:D5URK1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77054.1"
FT                   /translation="MSLAALMMLPAIALQAAAGNWDLMLLTLGAALALLLADVRSAMRW
FT                   HVLRWTAVVSGIAGAALMMANGSRIFVFGAAVSLLLWGRLALIRQSGANRSAFPSEDLV
FT                   GLTVAEAKGRIGFDDDRAPHGLEEPTLVAVPAADIDLQSPSLIVTGVVVDDREGIMTFG
FT                   VTEPDRLSADLDRDDLQRQLVDQVGGCPADILPLAKPDPLSKYRPRAM"
FT   gene            complement(433915..435594)
FT                   /locus_tag="Tpau_0414"
FT   CDS_pept        complement(433915..435594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0414"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro05188 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77055"
FT                   /db_xref="GOA:D5URK2"
FT                   /db_xref="UniProtKB/TrEMBL:D5URK2"
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro05188"
FT                   /protein_id="ADG77055.1"
FT                   /translation="MRSRDAALAAWSAVLAFVILGPLATAGRYLLLRDAVSTPRSYVTD
FT                   AALGLGGNAARATPQDWLVALGSHVVDGGVLVTVLLFMALVAAGWGFGRCALAVLSAVG
FT                   RPAGLGGGLAAATVALWNPFVAERLLQGHWSLLAGYAAIGWMVVAGLRLTGWRQAGGFA
FT                   AALAAGGLTPTGAVFAVIAGLVVAPRRWAVLLGLFVLAAVPWLYPSLVSGTGVRADPAS
FT                   ISVFAARAEPGLGTFGSLLGLGGIWNSQAVPDGAPWLWTVFFVVLLAGGALVLRSVRTH
FT                   PPLGRLALLALAAVVLPTLAATGPGVAFLEHLVQAIPGSGLLRDGQKWVALAVPLYATC
FT                   AAALVGAVPAVARPGATVAAVVIPVAVLPGLVWGVGGALTPTSYPASWRQIAAEVPADQ
FT                   GAVAVLPPGMFRTFAYGPAAPALDPAPRMLRAPVLQTGELRVGGRAIDRVPGAAAAAED
FT                   ALAAGGPELAGRLAVLGVGWVLVEAVVIDGAQAFPAVPLPGLSPVAQTPALRLYRVPGR
FT                   IATVDAPSRLQRGGAWTAHIVWLGLMVGGAGLLVARRGRELT"
FT   gene            435625..436824
FT                   /locus_tag="Tpau_0415"
FT   CDS_pept        435625..436824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0415"
FT                   /product="xylose transporter"
FT                   /note="KEGG: rha:RHA1_ro05189 xylose transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77056"
FT                   /db_xref="GOA:D5URK3"
FT                   /db_xref="UniProtKB/TrEMBL:D5URK3"
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro05189"
FT                   /protein_id="ADG77056.1"
FT                   /translation="MSGLALVTVGSMLANLCSYLVHLPASRWLGPAAYGEFASLLQLSL
FT                   ILAVPALALQTVVARQVVRGAGAEQMRRLGYRVAIGSAVLAALAAPLAAAGLHTRVGTA
FT                   AAALAAAPALVLLAVEQGLLQGERRFRRLALLLGVAGLGKLVFTVPGLLWGVGPALLGT
FT                   TVGALVAAALGRALAGNPAGHDAEADAGVRAVLGASSVQLVLVVFASLDLLLSRPVLGA
FT                   TAAGTYALGAVAAKIAFWLPQAVGVVFFPQLATPERSRSALRIVIALLSGLGVLCVAAA
FT                   AIAAPLATLLAGEEYRAVQGWLWLFAAQGALLALLQGLLLYSIATERTRMSALAWVILA
FT                   VEAAVLLTVPHTVGEMITAAALCAAAAVMVVGLVTGVSAGRDSSDRSPRSATRPASAGR
FT                   "
FT   gene            complement(436754..438085)
FT                   /locus_tag="Tpau_0416"
FT   CDS_pept        complement(436754..438085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0416"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rer:RER_11110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77057"
FT                   /db_xref="GOA:D5URK4"
FT                   /db_xref="InterPro:IPR021424"
FT                   /db_xref="UniProtKB/TrEMBL:D5URK4"
FT                   /inference="similar to AA sequence:KEGG:RER_11110"
FT                   /protein_id="ADG77057.1"
FT                   /translation="MAEGRSRLARVIGPILIFLGVLLITSAIAGPAYVAGKLKTIPLDL
FT                   DVTTVAQSVKPADSQADAEFPAKSLDLCSIGKQRAVVNEVSVKTQTRTLVQSPSDKSTM
FT                   TVQSGSSMVIPSIKTKGEPRHPELTNANKGERPCDDGLVQAWVDRVSLDRETGAPTGKT
FT                   SETVYSPGESAPAVKVADRKGLQYRFPADTSKENGKYSFYDLITRKNVALDFVEEKEVS
FT                   GTNTLRLRGSQDWVDMSTVRDGNDPTLGTVLTMPAGWWGIGGVDPKDDITLNRWAKTDV
FT                   ELWVDPKTGIIVDQSLHYTQQFRLPAQVVPNTPKPVRDFKMDVFDAQQRWVDDTVRSQA
FT                   EAAKSEQNKLAVAKTVVPIAGGVLGLIALGLGGFALFQGRTAPGGNGGGRRSDDGAAPT
FT                   LPLDDDATAAAPTDDEPVTEAFNAQPKPDESQTEAIDLRNRDQH"
FT   gene            438243..439457
FT                   /locus_tag="Tpau_0417"
FT   CDS_pept        438243..439457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0417"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: rop:ROP_52410
FT                   putative acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77058"
FT                   /db_xref="GOA:D5URK5"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D5URK5"
FT                   /inference="protein motif:PFAM:PF01757"
FT                   /protein_id="ADG77058.1"
FT                   /translation="MTRPDTSDFTIAAPAGAAGFVPALEGMRACAAVTVLLTHTAFQTG
FT                   QVDGSVMGRVWGRFDMAVAVFFALSGFLLWRAHARAAWTHTPRPDTGRYYRSRIVRILP
FT                   AYLVVAVVALALLPRSDPPSGSTWLANLTLTQVFVPFSLTDGLTQMWSLSVEMAFYLLM
FT                   PIAALVLLRMRGARARWRIPTVLAAAAVSLSWAWVGDTLPLPRGVNHHNWLPAYVPWFA
FT                   AGIVLAEVVYAPAHRYRALRRIATRRICWPAAVAVFAVVVTPLGGPVTLDTPAPWQFAT
FT                   RMALGGVLALLLLAPLVLAPSDTPPGRLGSGPMLALGRWSYGIFIWHLVVLSAVFPLFG
FT                   ILAFNGKMMQVTALTVVFSAAVAALSYAWIEEPARRALARYEHRRFAPAPQDAVIEEAE
FT                   EEAAP"
FT   gene            complement(439423..443637)
FT                   /locus_tag="Tpau_0418"
FT   CDS_pept        complement(439423..443637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0418"
FT                   /product="coagulation factor 5/8 type domain protein"
FT                   /note="PFAM: coagulation factor 5/8 type domain protein;
FT                   KEGG: rha:RHA1_ro05192 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77059"
FT                   /db_xref="GOA:D5URK6"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR021798"
FT                   /db_xref="UniProtKB/TrEMBL:D5URK6"
FT                   /inference="protein motif:PFAM:PF00754"
FT                   /protein_id="ADG77059.1"
FT                   /translation="MWAFVALLALSFLSSPGKIVADTKLDLTANPLGFLARAANVWSSQ
FT                   SPLGQVQNQAYGYFFPHGSFFALGQVLHVPPWITQRLWWALLLFAGFWGIVRLAEALNT
FT                   GSRGSRIVAAAAFVIAPHVLTTLGAISSETAPVMLAPWVLLPLVQMVQGHDAPLRNLAA
FT                   RSAVAVALMGAVNAVATGLACAVAALWWLLHVRFGAGTRRFWTFSAWWTVCVALATTWW
FT                   IVPLLIMGRVSPPFLEFIESSRATTQWASLPEVLRGTTSWSPFISDERAAGAMLTTTPA
FT                   AVVVTGLLAAAGIAGLTMRHTPKRGVWITVLLVGLAGIGAGYASGLGSPVAEPVRVFLD
FT                   SVGAPLRNVYKLEPFLRLPLVFGIAHLLARAPLPGTVDLTRVRAAIAHPERDRVAAGAL
FT                   AVVVVLTLAGGMAWAGKLAPRGPYQKIPDYWGQAAGWLADHASGTAPGQARAERALVVP
FT                   GAPFGAQLWGLTRDEPIQPLAETPWAVRDAIPLNPPGAIRALDSVQRLFSAGTPSAGLA
FT                   PTLRRQGIGYLVLRADLDPDTSRSARPALARAAILGSPGITEVARFGPDTAPPTVKNVT
FT                   VDSGLRPPLPAITIYQVDDRDVPAGPYLADLPDIPRVAGGPESLLTLQTDAAAAGRREI
FT                   GPALLSSDAAAAGLPAGPTTVTDTPKNRETDYGRVDDHSSAIRSASDPRRTLNRLPDYP
FT                   VTGAGLVDGEWDGATVSASSSASDATQLGTVLPGASPAAAVDGDKDTSWVSSGLDHAVG
FT                   QWLQFDLPRAREDLAVTVTVGRALGPAVTRLMISTEAGTVYSDPVTAGTPITLVAPSDS
FT                   TRWLRITAAETANRSWGNQFAISEARLTDARTDTTIPARHDVVVPGTGLQPTRWVFGQD
FT                   TMGRSGCVVTPGPDGRDGPVQCADIAIGPEEPGALRRTVNGPGAPAVTPTMTLRARPGQ
FT                   ALSTLLGAPSAPSSFADAAVGDGRGNGGAASDGDPNTVWTAPQSSTDATAPKPVLRLRL
FT                   PAPQLVTGLTLALPRGEAPARPTQVGVDLGTGRQVRDIETDADTATIALEPAITDSIAI
FT                   SLLDWDERINVNTLGFPEKMAAGLADVSALGPDGAPVPGSTPASPDRPVTVSCESGPSL
FT                   RIGDRTVRFRIESTARSLRDGAPVRAVPCESGPLPLPGGRQQVVATPGDAFSVETLTLD
FT                   TPEAAAATPAATTSPRIQSWTPDRRIIAVTHSEVERVLVVPESRNSGWAATAPDGTPLR
FT                   AVTVNGWQQGWVVPPGVDGNVTLRYSLNATYRIGLFGGLMLLLILASLALTRGAPAGRA
FT                   EPVQAWQPAWAIAGLGIGAVSFVLSGWPGLAIWATTGAATAVISRLQVSEDRRAAIRVF
FT                   CAAGFTAAGMLLLATGPWHAESGYVGHGPWPQGLALAGILIMAWSAVPPRIREPLPPQP
FT                   PR"
FT   gene            complement(443678..443878)
FT                   /locus_tag="Tpau_0419"
FT   CDS_pept        complement(443678..443878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77060"
FT                   /db_xref="InterPro:IPR022566"
FT                   /db_xref="UniProtKB/TrEMBL:D5URK7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77060.1"
FT                   /translation="MDRTTIIASATAALAGIVVAVALALVSGAAAGQSTPSTDINTVSK
FT                   DKGFIEGSSNYGARDDSGANK"
FT   gene            complement(443916..444410)
FT                   /locus_tag="Tpau_0420"
FT   CDS_pept        complement(443916..444410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0420"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: rop:ROP_52450
FT                   putative Usp family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77061"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D5URK8"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ADG77061.1"
FT                   /translation="MTAPVKVLIAYDGTESAQRAVKYASKVLAQGRETEAVVVTAWEST
FT                   IHQAARLSAMSGVAGAGAAETALTRETDVVHTEAKQTNAEGVELARAAGFTARGELVEV
FT                   ATTVWTAIIGASDAENVDVIVTGSRGTTGLKALWHSSVSEHVLRGCKRPVMIVPSGVPE
FT                   L"
FT   gene            444568..445296
FT                   /locus_tag="Tpau_0421"
FT   CDS_pept        444568..445296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0421"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_3767c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77062"
FT                   /db_xref="UniProtKB/TrEMBL:D5URK9"
FT                   /inference="similar to AA sequence:KEGG:MAB_3767c"
FT                   /protein_id="ADG77062.1"
FT                   /translation="MRQRRFGAAVGLVTVGVFVAACNGSSGGGASPSSASPSTPAAAPI
FT                   TTPVKELVLTASELPPGITAVPVTDDQIRASIDQMSGVASTSTITPAECGSATALVDAT
FT                   KKLDVTQLGMVAGSTDTGAATETVVTEKPDLAKFRANFSGKCNAMSARMQVQGQQVTTE
FT                   TRTTVQDAPTSEASDAVVLRQDTDATMSGGERSTQKTLMGIAVVRGYAVSVTVMGMTGE
FT                   PDQALFDKLFTASVAKVAKG"
FT   gene            445355..446245
FT                   /locus_tag="Tpau_0422"
FT   CDS_pept        445355..446245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0422"
FT                   /product="SMP-30/Gluconolaconase/LRE domain protein"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: rop:ROP_65780 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77063"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:D5URL0"
FT                   /inference="protein motif:PFAM:PF08450"
FT                   /protein_id="ADG77063.1"
FT                   /translation="MTATVLAAAAALVVPAAASATPVPVCGGWTSSVLRSGMGTLENLA
FT                   FDGAGAVYVSKQNAVTGRGQVLRGRSPATLASLADLPNPGGLVIRDGRVFVTTANSAPS
FT                   GLFGATDGTVAELDPGTASVRTWAAGLTMPNGLAALPDGRFVTSTVLGPKQGTVVSARG
FT                   GVPTSFALRGESVNGLWFDGASGRLWASTATSAQTGLYAIDPARPAAPRRYAVPGLGPA
FT                   NFADDLTVGPDGAVYATLDLPGKVVRLDPETGALCTIDAGHRGVTSVRFGRGTGWDPRS
FT                   LYATTLGGKLLRLTP"
FT   gene            446268..447431
FT                   /locus_tag="Tpau_0423"
FT   CDS_pept        446268..447431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0423"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: rop:ROP_52460 putative glycosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77064"
FT                   /db_xref="GOA:D5URL1"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:D5URL1"
FT                   /inference="protein motif:PFAM:PF00933"
FT                   /protein_id="ADG77064.1"
FT                   /translation="MMRLFRNLTVMVIAAAGVAACGTSSGPDAPTSVTSAVPAPNSSTA
FT                   SSSAAARPVSCEIDYLSKLSVREKVAQLLMVGVKDAADARRAVQQYGVGGIFVGSWTDK
FT                   SIFAGGALKQVSAAGKVPLMVSVDEEGGRVSRVPGANLVSARQLAKTKTVEQARAEGKR
FT                   VGALMASMGITVDFAPDADVSAQLADSVIGDRSYSDDPAVVTKYAKAFAAGLRDGGVYP
FT                   VYKHFPGHGHSSGDSHQGGVSVPPLAELKKKDLVPFRAAATDDAGIMVGHLTVPGLTEK
FT                   GTPTSLSPNTMRLLRDGAGYGAAPFAGPIFTDDLSGMKAVTDTFTVPQAVTKALVAGAD
FT                   VALWISTDQLGAAVAQVEAAVRAGTLPMQRLDASVLRVARAKHAVRC"
FT   gene            447510..448115
FT                   /locus_tag="Tpau_0424"
FT   CDS_pept        447510..448115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0424"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: nfa:nfa54640
FT                   putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77065"
FT                   /db_xref="GOA:D5URL2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015292"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D5URL2"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG77065.1"
FT                   /translation="MAGGTKRLPRAVREQQMLDAAIKVFSRNGFYETSMDAVAREAEIS
FT                   KPMLYLYYGSKDELFAACVTREVGHFMRSIEFDATPALPPSQRLRSVIEGFLKYVDQNR
FT                   DAWRVMYREASGQASFATLVEANRERVVEMTAVLLREAAKYAPEDTDFELYAVALVGSG
FT                   EAIADRLATGKVELDRAVEIMTSFLWGGIRGERPEDGK"
FT   gene            complement(448126..448233)
FT                   /locus_tag="Tpau_0425"
FT   CDS_pept        complement(448126..448233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77066"
FT                   /db_xref="UniProtKB/TrEMBL:D5URL3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77066.1"
FT                   /translation="MRGTFMFIVKLFGHYLHTSSLSDSLAKESGHVARA"
FT   gene            complement(448266..449150)
FT                   /locus_tag="Tpau_0426"
FT   CDS_pept        complement(448266..449150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0426"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   rha:RHA1_ro05198 MaoC-like dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77067"
FT                   /db_xref="GOA:D5URL4"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR003965"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D5URL4"
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /protein_id="ADG77067.1"
FT                   /translation="MAQNVTVLQAPPSSLSVLTRGLKGILPVVGKHGKLTPETPLPDRT
FT                   VELTVDVDPARVAEYCDVVGLQNTGEVPVNYLYVLSFPLIMDLFLADDFPAAAVGSVHV
FT                   ENTITRRRRVVPGEKLTLRTSAENLREHRKGMLIDFVTEFTDADGASVASEVSTMMIQQ
FT                   KTSLSGEPAGPAPKEGRPGAPDALLSADGGLIRRYAGVSGDRNPIHMSPLGGKAFGFPS
FT                   SIAHGAWTAAAILRVLEGHIPDAVVYHVRFGRPVVLPAKIGLFVTRTDESTEIVARDLK
FT                   KGFPHVTATVTPL"
FT   gene            complement(449152..450510)
FT                   /locus_tag="Tpau_0427"
FT   CDS_pept        complement(449152..450510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0427"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: rop:ROP_52490 putative
FT                   3-oxoacyl-[acyl- carrier-protein] reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77068"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5URL5"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADG77068.1"
FT                   /translation="MPDAPSTDFYAAFVKSGPGSFLASRLGLPQPPSLRRYQPGKPALA
FT                   GPVLLGGSGRLVEPVRELLADYDLVVNNGGARGAEKLGGAVFDATGITSIDDLKGLYEF
FT                   FGPQIRSLGNSARIVVLGTTPELIEDIDEHIVQRALEGFTRSVAKELRDGATAQLVYVH
FT                   PKASTGASGLASTLRFLLSGKSAYVDAQVIRITDKDAEAPADWDKPLAGKVALVTGAAR
FT                   GIGATIAEVLSRDGAHVIAADIPAAGEALSEVANKVGGTALPLDVTAPDAGAKIAELVK
FT                   SRHSGLDIVVNNAGITRDKLLANMDEGKWNSVMAVNLKAPKQLVDDLLAAGALNEGGSV
FT                   VDVSSIAGIAGNRGQTNYGATKAGVIGIVDAYTSVLAEKNITINAVAPGFIETAMTAAI
FT                   PLATRQAGRLMNSLQQGGQTVDVAETISYFAAPASAAVTGNVVRVCGQSLLGA"
FT   gene            450616..451899
FT                   /locus_tag="Tpau_0428"
FT   CDS_pept        450616..451899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0428"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; KEGG:
FT                   nfa:nfa54600 acetyl-CoA acetyltransferase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77069"
FT                   /db_xref="GOA:D5URL6"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D5URL6"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ADG77069.1"
FT                   /translation="MANSEIRPVAILGGNRIPFARSDRAYAKASNQDMFTAALNGLVSR
FT                   FNLQGEQLGAVVGGAVLKHSRDFNLIRESVLGSPLSPYTPAFDVQQACATGLQAINTVA
FT                   QGIAAGRFEAGIGGGTDTTSDAPIGVSEGLRKVLLDLNRAKGNVDRLKLVGKLPGNLGI
FT                   DIPRNGEPRTGMSMGEHAAITAKEMGVARSEQDELAALSHKNMAAAYDRGFFEDLITPY
FT                   LGLTRDDNLRPDSSVEQLSTLKPVFGVSLGDATMTAGNSTPLTDGASTVLLSSDEWAKE
FT                   KGLPVLAYLKDVEYAAVDYVGGKDGLLMAPTYAVPKLLERNGLTLQDFDFYEIHEAFAS
FT                   VVLATLQAWESPEYCKEKLGLDKPLGSIDRSKLNVNGSSLAAGHPFAATGGRIVASTAK
FT                   QIKENGGGRALVSICAAGGQGITAIIEG"
FT   gene            451985..452407
FT                   /locus_tag="Tpau_0429"
FT   CDS_pept        451985..452407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0429"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; KEGG:
FT                   stp:Strop_0728 CoA-binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77070"
FT                   /db_xref="GOA:D5URL7"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5URL7"
FT                   /inference="protein motif:PFAM:PF02629"
FT                   /protein_id="ADG77070.1"
FT                   /translation="MTATDQTIERILRDYDTITVVGASADPAKAANEVPAYMREHGWRI
FT                   IPVNPKADEIVGEKVYRTLADIPEQVGLVDVFRPSDQTPEIARQAVAAGATALWLQLGI
FT                   RSAEARDIAEAAGLLYVEDRCLIIEQRRTGITREAN"
FT   gene            452409..452912
FT                   /locus_tag="Tpau_0430"
FT   CDS_pept        452409..452912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77071"
FT                   /db_xref="GOA:D5URL8"
FT                   /db_xref="UniProtKB/TrEMBL:D5URL8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77071.1"
FT                   /translation="MGTTGIVIVVVVAIVAISLLISVGWFLRDSNKRIQKFAKSSDLVP
FT                   GRPGRAPAEWSTSSAPEALLHQRVRYAIADVHGNGNPVAVPPPADSAVTGKPGDLDDLD
FT                   DAVFALDDRIIAAAQLPAAERTKALAELEPAVASLEGLTGRLWEAPSHRRHELIDAVIS
FT                   RLRG"
FT   gene            complement(452890..453963)
FT                   /locus_tag="Tpau_0431"
FT   CDS_pept        complement(452890..453963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0431"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: mmi:MMAR_4188
FT                   integral membrane acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77072"
FT                   /db_xref="GOA:D5URL9"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D5URL9"
FT                   /inference="protein motif:PFAM:PF01757"
FT                   /protein_id="ADG77072.1"
FT                   /translation="MVAPTAPAERIPALTGLRASAAFAVCVTHAAFWAGDFTPDAWGAA
FT                   YARLETAVPVFFALSGYLLVRPWLTGTADVRRYFAHRAWRILPAYWAVVTAVYLIYMWR
FT                   SDPSDSGHGWGGYLRNMLFVQVYGVGHVHTGLAQMWSMCVEVAFYLVLPLIGIALVRRA
FT                   PRSWVVPAAMTALTAGWVALVTATELFGKTARTWPPSYAAAFAAGITVALFADRVHWTP
FT                   LRRRALLAAAMLSYAVLLTPLAGPIDLALPNPGQGVLKYLLEALIGGVLVAWAASGPSR
FT                   VLASRPMVWLGGISYEFFLIHVMVMDVVVLDLFGWSLFQGSTGPIAVVTTVLTVPLAWL
FT                   LHTAVERLRRATRATGR"
FT   gene            complement(453967..455967)
FT                   /locus_tag="Tpau_0432"
FT   CDS_pept        complement(453967..455967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0432"
FT                   /product="YhgE/Pip C-terminal domain protein"
FT                   /note="KEGG: mab:MAB_4762 hypothetical protein; TIGRFAM:
FT                   YhgE/Pip C-terminal domain protein; YhgE/Pip N-terminal
FT                   domain protein; PFAM: ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77073"
FT                   /db_xref="GOA:D5URM0"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="InterPro:IPR023908"
FT                   /db_xref="UniProtKB/TrEMBL:D5URM0"
FT                   /inference="protein motif:TFAM:TIGR03062"
FT                   /protein_id="ADG77073.1"
FT                   /translation="MSDKKSPKRSNTVPIAAGLAFGSEIKRFGRSRMTRAAIVVLMLLP
FT                   LVYGALYLWAFWDPFGNVNKMPVALVNADKGTIVKDQKINAGAEVEKSLKDDKSLDWNI
FT                   VSPAEARQGVKDGTYYFMLELPENFSSAIASPMTGKPEKAQLRAVYNDANNYISSTIGQ
FT                   TAMAQVLNAVSTRVSGQAVNQVLSMMITAGAGIEQAADGAGKLADGLVTANDGAAKLAD
FT                   GLATAKTGSAQLKTGSQQLSDGINQATDPILAVTRALSGLGGNTAELQQSATALVEAAD
FT                   KAGVFVKTQDTALAGIDAAIRQLAASPDPAARQAADGLRAIRGQLAQASVTEQTKQQII
FT                   AAQNGAIALTEQLRTPGSPLQTVLSKVGGTGDDLTAKLTQLRDGAAQVAAGNAQLDNGI
FT                   TQLSSGAGQLATGTVQLKDGSRELATKLGEGAQSVPKWSQEQTSQVASTIGGPVQLDST
FT                   HENRAPNFGTGMAPFFLTLALFFGALVLWMVFRPLQNRAIAAEVLAIRVVMASYLPAAA
FT                   IALCQAVILYCVVRFALGLEVAHPVGMFLFMLGVSLAFVAFTQAVNALVGPAVGRVLIM
FT                   ALLMLQLVSSGGMYPVETTARPFQVLHKYDPMTYGVNGLRQLVSGGIDHRLWQAVAVLV
FT                   FLWVVSVTVSCLSARRNRLWNLDRLMPAIKI"
FT   gene            complement(455973..456641)
FT                   /locus_tag="Tpau_0433"
FT   CDS_pept        complement(455973..456641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0433"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP2368c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77074"
FT                   /db_xref="UniProtKB/TrEMBL:D5URM1"
FT                   /inference="similar to AA sequence:KEGG:MAP2368c"
FT                   /protein_id="ADG77074.1"
FT                   /translation="MDDDQPNDVQLTAVNIGVDGEHGPLFQGIDLEFGPGLHAVQMPAG
FT                   RDQDALLLTLAGRLKPTHGTVDALGATSPGEIRKKCAIAAFADIDELDESVSVETVLSE
FT                   QRRWLAPWYSMVPLSAGRLEMDQVFGELDRPEPKTPIVELTDLQLFLLRITLALLGNRP
FT                   ILIVGDLEQVRDNPGRADAVQRLGAIATRYTVIVGVTNPLGGTAPQHTLHDRRALTRKD
FT                   "
FT   gene            complement(456804..458636)
FT                   /locus_tag="Tpau_0434"
FT   CDS_pept        complement(456804..458636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0434"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   nfa:nfa54510 putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77075"
FT                   /db_xref="GOA:D5URM2"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:D5URM2"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ADG77075.1"
FT                   /translation="MGHYKSNVRDIEFNLFEDLGVGEVLESGAYGDLDTDTAKEMLREA
FT                   ARQAEGPIAESFAEADRNPPVFDPETHEAKINEAFKKSQAIFADGGWAYLGLNDELGGT
FT                   DVPRSLYWGIGELFLGANPPIFMFAAGPGFAQILFDEGTDEQKKWAKIAAERNWNATMV
FT                   LTEPDAGSDVGAGRTKAIKQEDGSWHIEGVKRFITSATVDDMFESTFHLVLARPEGGAP
FT                   GTKGLGLYFVPKYHFDEDGNLGEHNGAFVTNVEHKMGIKTSTTCELTFGGHGIPAKGWL
FT                   VGEEIKGIAQMFKVIEHARMMVGTKAIGTLSTGYLNALDYAKQRVQGADLTQMADKTAP
FT                   RVTITHHPDVRRSLLTQKAYAEGLRAVYLYTAAHQDVRTATPVSGADEEMAYKVNDLLL
FT                   PIVKGVGSERAFTLLGTESLQTFGGSGFLQDYPIEQYVRDSKIDSLYEGTTAIQAQDFF
FT                   FRKILRDRGAALGHVAGEITKFIEANAGGAFAADIALLKTATEDVQAMAATLTGFALAS
FT                   QQEPKELYKVGLGSVRFLMAFGDLMVGWRLLHQAVIAQAKLDGGASGADKSFYEGKVGV
FT                   AKFFAANMLPLLTSVKDVVAAVDNEPMELDEAAF"
FT   gene            complement(458777..459508)
FT                   /locus_tag="Tpau_0435"
FT   CDS_pept        complement(458777..459508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0435"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; Methyltransferase
FT                   type 11; KEGG: rha:RHA1_ro05204 3-demethylubiquinone-9 3-
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77076"
FT                   /db_xref="GOA:D5URM3"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D5URM3"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ADG77076.1"
FT                   /translation="MSTPDGAGPKHAAPDTVSPDGIDRADQEREEGTLGPLSPDALARE
FT                   ERQIRDAEAWDARYRSTDLVWGAPPDPWIVEQVTILPPGRALDVGAGEGRHALWLATRA
FT                   WDVTAVDFSRVGLDKAATVAARQPRTVRARLHWTPLDVTVDEIPNSPYDLAIWAYVHPD
FT                   AEQRAGAIARAAHALAPGGLLLLLAHERLEGHDGLPTFGAAEVSAALPEDMVVEHVEWR
FT                   ESDPHHGTGVDLAVRARRRWQ"
FT   gene            complement(459505..460275)
FT                   /locus_tag="Tpau_0436"
FT   CDS_pept        complement(459505..460275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0436"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="KEGG: rop:ROP_15710 putative endonuclease IV; PFAM:
FT                   Xylose isomerase domain protein TIM barrel; SMART: AP
FT                   endonuclease family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77077"
FT                   /db_xref="GOA:D5URM4"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D5URM4"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ADG77077.1"
FT                   /translation="MRIGAHVRSDTHPVETAESLGVDVIQMFVADPQSWKKPEPHPQTQ
FT                   ALRDSPLEIVVHSAYVINVASLNNRLRMPSRKAVEQQAAAAADLGAFGLVVHGGHLRDG
FT                   EDLQGGIDNWRKLFTRQEEKGGFGVPILIENTAGGDGAIARQLETIDRLWDAVGDQGAG
FT                   FCLDTCHAWAGGEELLGIVERVLAITGRIDLVHLNNSRDEFDSARDRHANLQDGTIDPD
FT                   LLADVARAADAPVILETPADGLADDVAYLKEALL"
FT   gene            460418..461599
FT                   /locus_tag="Tpau_0437"
FT   CDS_pept        460418..461599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0437"
FT                   /product="protein of unknown function DUF1023"
FT                   /note="PFAM: protein of unknown function DUF1023; KEGG:
FT                   mjl:Mjls_0770 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77078"
FT                   /db_xref="InterPro:IPR010427"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5URM5"
FT                   /inference="protein motif:PFAM:PF06259"
FT                   /protein_id="ADG77078.1"
FT                   /translation="MVVGEALRAPQSWTGGTAEAYDRWAGYAVRATAELDAALRRAEAE
FT                   IARGGPGLAERLAAIELPAAVPVREAPASAPEPAAWTRHRANRVRLAAQLRELRAIARP
FT                   TAAQRRRLAMAETVAARLAELDGAVDPITGARVPVQLLTYEPEAFGGDGAVVVSIGDLA
FT                   AADRVGVLVPGMGTTAASLGAVGGGAARLYAAARRADPDGSVAAIAWIGYDAPSGRGAA
FT                   AQVVTGHAASRGAERLRADLAEVSAMAPDDARTVVFGHSYGATTAATAGRHGALAGTVD
FT                   AMVLFGAPGAGPVRSAAELGLADGVYVARDRDDPVPPGAFLGGLAGRALGMVPGLMGLG
FT                   LGVDPAAESFGATAIAADGPTGRLGAHSGYLDAASPALAEFGRILAGVRDDAR"
FT   gene            complement(461783..463333)
FT                   /locus_tag="Tpau_0438"
FT   CDS_pept        complement(461783..463333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0438"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bfa:Bfae_02660 arabinose efflux permease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77079"
FT                   /db_xref="GOA:D5URM6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5URM6"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG77079.1"
FT                   /translation="MTTLTTPTSRAQPRATARDWCALAVLMLPVLLVSVDGTVLGFALP
FT                   SIAATLGPTAAQQLWIIDVYPLVLAGLLVSMGSLGDRFGRRRLLLIGATGFAAMSVVAA
FT                   YSPTAAALIAARAGLGFFGAMLMPSTLSLLRNIFADPNQRRLAIAVWASCFAAGAALGP
FT                   IVGGLLLEYFWWGSVFLLAVPVLIPLLALAPAFIPESRDPAPGRIDPTSIALSLLALTP
FT                   IVYAVKSMAKGGDLMHTVVPALIGVIATVAFVRRQLRRPDPMLDVRLFRHRQFSGSVAV
FT                   NLLAVFSLIGFMFFISQHLQLVIGQSPMQAAIALLPGMLATMVAGLLVVRLVRHVAPAV
FT                   VVAGGLTLAAAAYVLIALFASPDSVTVILGAFALLGMGVGATETISNDLIVSSVPAEKA
FT                   GAASAVSETAYEMGTVLGTAVLGSILAGAYTANLVLPAGMDTGQASAASETLAGAHHVA
FT                   GQLPAETGAALITAADQAFETGVVITSSIGAVLMLVAAAIAWYTLRAPSESTARTVAQ"
FT   gene            463433..463975
FT                   /locus_tag="Tpau_0439"
FT   CDS_pept        463433..463975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0439"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: aau:AAur_0986
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77080"
FT                   /db_xref="GOA:D5URM7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041479"
FT                   /db_xref="UniProtKB/TrEMBL:D5URM7"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG77080.1"
FT                   /translation="MPPPPAARAKLLDAYVRILIEQGERAATLEAVAAEAGVSKGGLLY
FT                   HFGSKDALVEGLIGRLNELVEQDVELMRAAPEGAVDYYVRTSNYADTPLDRTIVAVLRL
FT                   SQVANTRAQEAIQAMQQRWLETLVEQVPDEAAARAVILMGDGLYYNAALSGGRHVATDE
FT                   QIEELLALVRHMLDAPR"
FT   gene            complement(464123..464338)
FT                   /locus_tag="Tpau_0440"
FT   CDS_pept        complement(464123..464338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77081"
FT                   /db_xref="UniProtKB/TrEMBL:D5URM8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77081.1"
FT                   /translation="MTTVEARGVDQALAGMEAGHLMAGMPLTDTAEAMVRRIATGESTV
FT                   EQEVEAARRRALARMDPQQRKPPHSP"
FT   gene            complement(464858..465343)
FT                   /locus_tag="Tpau_0441"
FT   CDS_pept        complement(464858..465343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0441"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mlu:Mlut_12550 guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77082"
FT                   /db_xref="UniProtKB/TrEMBL:D5URM9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77082.1"
FT                   /translation="MTQWQPIQRSEQERVTPEQGGPAITSSNVKVLVMLKPLPDGGWSS
FT                   IFYEESKRHQLAIRRFAEWEDKVGYHLDTDREHMSPDIARFDRVVEATNERYQAEVLPG
FT                   VRREAAAEQRAQDRVAAIEAELASIPIPGAKQLRATRPEASGAKQAPPRRRRRFGIF"
FT   gene            466529..466750
FT                   /locus_tag="Tpau_0442"
FT   CDS_pept        466529..466750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77083"
FT                   /db_xref="UniProtKB/TrEMBL:D5URN0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77083.1"
FT                   /translation="MLVATEPVEGWGSGPSEAGESVPPIEGIRHNSLVFEIQCDLGHVG
FT                   VVEFGLHKGQTHVRVTRVDVDTDEDLDD"
FT   gene            466942..467712
FT                   /locus_tag="Tpau_0443"
FT   CDS_pept        466942..467712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0443"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: ckp:ckrop_0178 putative short-chain
FT                   alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77084"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5URN1"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADG77084.1"
FT                   /translation="MPSIFISGGASGIGRATALRFLSEGWTVGVYDVNQAALDELTAEH
FT                   PQIVTGILDVRDFGQWEAALADFATHTGGTLTVLDNNAGVLFSGDLDEVTPEQIKLQID
FT                   IDALGVTYGAKAALPYLTGVEGAHLVNISSASAIYGQPGIATYSAAKFYVSGFTEALEL
FT                   EWEKHGIRVVAIWPLWAKTALAETDAKSTRTLGVNITPEEVAEQVWNSVHPGVQVPFLP
FT                   RVHYSVGTLTTLLSNSSKFAPRSVVRLINRFTSQ"
FT   gene            467787..469415
FT                   /locus_tag="Tpau_0444"
FT   CDS_pept        467787..469415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0444"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   nfa:nfa7120 acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77085"
FT                   /db_xref="GOA:D5URN2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D5URN2"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADG77085.1"
FT                   /translation="MQDGELSIARLVEYSRRVFPEARITTWTGTELRDASFAEIGDRAA
FT                   QLAHALTKLGVQRGDRVATFMWNNNEHQVAYAGVPAMGAVLHTLNLRLSPEQAVFIIKQ
FT                   ADDKVILVDASVAPLLSKYIAATPNVQHVIVTNGPKEALEAPEGITVHSLDELLDGEPT
FT                   TFDWPEIDERDPAVMCYTSGTTGDPKGVVYSHRSIWLHSMQVNSSSGMSLGNADSVLAI
FT                   VPMFHVMSWGLPYAAMMGGITLVMPDRFLQPEPLLQIMAAAKPTFAAAVPTIWQGVAAQ
FT                   LAVTPQDISHLREVVVGGAAVPPSMIRAFDKLGTRIVHAWGMTETSPLGSVSRPPFGIE
FT                   DDDREFAYRVTQGRFPASVQARLIDDEGNEQPWDGESSGELEARGPWITGAYYSPEGNV
FT                   VDESKFHDGWLRTGDVASISPDGFMTIRDRTKDMIKTGGEWISSVELENTVMSNPTIAE
FT                   AAVVGVPDEKWDERPFVLAVVKDPADADIEKQRAYLTDLLPKWQIPERWAFVTEVPKTS
FT                   VGKFDKKVIRAEYADGTYPVVDARA"
FT   gene            complement(469526..470026)
FT                   /locus_tag="Tpau_0445"
FT   CDS_pept        complement(469526..470026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77086"
FT                   /db_xref="UniProtKB/TrEMBL:D5US19"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77086.1"
FT                   /translation="MGWNVSILHIAAPGPDAGGSLILGADRRTDPAGDDDAWARAVDGG
FT                   TVVASGDILDPHAVERFAAHTGVPVTSVMIGSTGGAYGIEVYRDGALVRRVGETDDGFS
FT                   DQVGPPLAEESLPAVLAEKHSEDRYFALFAAVAGITDLSFLADAEFARVITPELTFGPE
FT                   GLD"
FT   gene            complement(470052..471290)
FT                   /locus_tag="Tpau_0446"
FT   CDS_pept        complement(470052..471290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0446"
FT                   /product="Glutaminase"
FT                   /EC_number="3.5.1.2"
FT                   /note="KEGG: sgr:SGR_6768 putative glutaminase; PFAM:
FT                   Glutaminase, core"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77087"
FT                   /db_xref="GOA:D5US20"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D5US20"
FT                   /inference="protein motif:PRIAM:3.5.1.2"
FT                   /protein_id="ADG77087.1"
FT                   /translation="MTEQTIGDSISTDNPVNAAMARVLDDVRREDHPGHVADYIPQLAK
FT                   VDPDQFGIASVSVRGHSYAAGDYRVQFTIQSMSKPFVYALALQELGTTAVCERIGVEPS
FT                   GEAFNAISFDPSGRPENPLINAGAIVSTSLISAETGDERFAKIRAGLSRFAGRELELDE
FT                   SVYKSESETGFRNLALAALAKSTNALRVPVEDALDPYFRQCSLLVDAHDIAVMGATLAN
FT                   SGVNPCTGERVVDTVVARHTLSVMTGCGMYDRSGAWMCSVGIPAKSGVGGGIVAAAPGE
FT                   YGVGVFSPPLDEAGNSARGVAVLQKMSSEFGLHLLDRPMTPVSALESITTDPATGHVTL
FT                   RLRGEVDFVAVEEVVHEALKAGRLRQGTTVVLDLTNATRVSVVATYLINQLISDVGYGA
FT                   RVIVVDPSGLLTN"
FT   gene            471439..472824
FT                   /locus_tag="Tpau_0447"
FT   CDS_pept        471439..472824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0447"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   msm:MSMEG_2450 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77088"
FT                   /db_xref="GOA:D5US21"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5US21"
FT                   /inference="protein motif:PFAM:PF00202"
FT                   /protein_id="ADG77088.1"
FT                   /translation="MTELLPDGRTIDEATAAGARAHELDRAHVFHSWSAQAQINPMTIV
FT                   ASEGSYVWDGEGRKLLDFSSQMVNTNIGHQHPKVVAAIAEQAAKICTIAPQHVNEARSE
FT                   AARLIAERTPGDLNKVFFTNGGADANEHAIRMARVHTGRPKVLSRYRSYHGGTELSINV
FT                   TGDTRRFANDHGAQAVAHFDGPFLYRSSFYAETEEQESQRALEHLERTIVLEGPNTIAA
FT                   IILESIPGTPGIMVPPPGYLAGVRELCTRYGIVMIADEVMSGFGRSGKWFAIEHGATEA
FT                   GPVVPDLLTFAKGVNSGYVPLGGVTIGDEIAATFDDKPYPGGLTYSGHPLATASAVATI
FT                   NAMAEEGMVDNAATIGDEVIRPTLEEFKAKHPSVGDVRGEGVFFAIELVRDRATREPLA
FT                   PYGGSSPAMNETVAALKKGGLLPFANYNRIHVVPPCNVSVEEAREGLAIIDEALNVADA
FT                   HTV"
FT   gene            472842..473333
FT                   /locus_tag="Tpau_0448"
FT   CDS_pept        472842..473333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0448"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_3139c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77089"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D5US22"
FT                   /inference="similar to AA sequence:KEGG:MAB_3139c"
FT                   /protein_id="ADG77089.1"
FT                   /translation="MPALKPVLPADLTPGNPGVYEFSVRSARPVEWVWGELTSDTPLHW
FT                   CNGIRKIEWTSPRPFAAGSTRTVTLGPGISADEIFYSWEESEQLCEKAFYVQSATAPGL
FT                   SRLAEKYRVEALPEGGSLFTWTLLIEPVGGAKVIGLSGLPVGLIVKWLQRDTEKYLGSA
FT                   "
FT   gene            473554..475011
FT                   /locus_tag="Tpau_0449"
FT   CDS_pept        473554..475011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0449"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="KEGG: sgr:SGR_1958 putative catalase; PFAM: Catalase
FT                   related subgroup; Catalase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77090"
FT                   /db_xref="GOA:D5US23"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR040333"
FT                   /db_xref="UniProtKB/TrEMBL:D5US23"
FT                   /inference="protein motif:PRIAM:1.11.1.6"
FT                   /protein_id="ADG77090.1"
FT                   /translation="MTDHRNYTTTDSGAPAGSDQHSLTVGAGGPIVLHDHYLIEQMAQF
FT                   NRERIPERQPHAKGSGAFGTFETTADVSDYTCAALFQPGVTTDMVARFSTVAGERGSAD
FT                   TWRDPRGFALKFYTDEGVYDLVGNNTPVFFIKDPLKFQHFIRSQKRRADNNLRDHDMQW
FT                   DFWTLSPESSHQVTWLMGDRGIPKSWRHMNGYGSHTYLWVNDAGVKHWVKYHFISDQGI
FT                   DYLTQDEADRLAGADGDYHVRDLFEAIRDGEHPSWTLKVQIMPFEDAATYRYNPFDLTK
FT                   VWPHSDYPLVEVGTMTLHTNPTDNHAQIEQAAFEPNNLVPGIGLSPDRMLLGRVFAYAD
FT                   AHRARLGANYKQIPVNAPRNEVRSYSKDGAMRIDPVRDPVYAPNSKGGPSADYPGQAEP
FT                   QWAADGEIVRTAYVDHAEDDDVSQPRTLIREVMDEAARERLVDNVAGHLLDGVSPPVLQ
FT                   RAFEYWTNIDPEIGGRIERAVAEAGTD"
FT   gene            complement(475018..475791)
FT                   /locus_tag="Tpau_0450"
FT   CDS_pept        complement(475018..475791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0450"
FT                   /product="methylthioadenosine phosphorylase"
FT                   /EC_number="2.4.2.28"
FT                   /note="TIGRFAM: methylthioadenosine phosphorylase; KEGG:
FT                   msm:MSMEG_0990 5'-methylthioadenosine phosphorylase; PFAM:
FT                   purine or other phosphorylase family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77091"
FT                   /db_xref="GOA:D5US24"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010044"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:D5US24"
FT                   /inference="protein motif:TFAM:TIGR01694"
FT                   /protein_id="ADG77091.1"
FT                   /translation="MSAPIAVIGGTGLYRFLGGETTTRTVDTPYGPTSAPITLGEAGGR
FT                   EVAFLPRHGAHHEYSPHTVPYRANLWALHSLGVRKVLAPCAVGSLDPALGPGTIVVPDQ
FT                   VVDRTTSRASSYFDGGGVHVSFADPYCPELRAAARPHADHDGATMVVIEGPRFSTRAES
FT                   RWYAAQGWELVNMTGLPEAALARELKLCYASLALVTDLDAGIEAGDGVHAEDVLEQFKV
FT                   NLPRLTTALTHTLTAIEPDAECSCAAGDHDLSPLR"
FT   gene            complement(475788..476099)
FT                   /locus_tag="Tpau_0451"
FT   CDS_pept        complement(475788..476099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77092"
FT                   /db_xref="UniProtKB/TrEMBL:D5US25"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77092.1"
FT                   /translation="MSDLSWPAARIVGRTAIRGYLELGDSHLRFRPAGLAAKMQGAPFA
FT                   VQLRHLAGAGVVETTGLLRRGKHRLCVTLGDASEQVFDVSRPDEVAAAIRERIPGGAA"
FT   gene            476177..476542
FT                   /locus_tag="Tpau_0452"
FT   CDS_pept        476177..476542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0452"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa26690 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77093"
FT                   /db_xref="GOA:D5US26"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:D5US26"
FT                   /inference="similar to AA sequence:KEGG:nfa26690"
FT                   /protein_id="ADG77093.1"
FT                   /translation="MVYLGPIILLLWVAALIDVIVADEYRVRHLPKFGWLIVVILIPLA
FT                   GSLIWFLLGRPVGAVNSAPTRTTGFPEYERRHRHIAQYPDDDDDFLRQCRERAEEQRRK
FT                   AKGLDARNLGEEPDPKD"
FT   gene            476594..477640
FT                   /locus_tag="Tpau_0453"
FT   CDS_pept        476594..477640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0453"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_0392c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77094"
FT                   /db_xref="GOA:D5US27"
FT                   /db_xref="UniProtKB/TrEMBL:D5US27"
FT                   /inference="similar to AA sequence:KEGG:MAB_0392c"
FT                   /protein_id="ADG77094.1"
FT                   /translation="MTGDEAEALRRRIDEQAVPLELIPIAPLGFRDLVVGAARALRTNP
FT                   RIMFGLTAVVVGVMGLVALIAQLSLVPGARATGVARADEDARQVLAALGVGSGVQVANS
FT                   ALSMVGTLLVTGMVTVVVARSVLRHRTRTAMAWSVAGRRLPALALLGVIEIGMILAPLT
FT                   AAVAAAILVAIAVGPSGVAGYVMLIGLLTVVAVFAMWPLFAMAAPAVVLERCGPVAALS
FT                   RAVDLIRPGYLRLLWRLLLVSATSYAVGLLIWIPFILLGRALSHADRGLVPSLFLVVGA
FT                   AIGQTVTLPFLAAMNTLLYTDQRIRLEEVAAELQRVADEAPSPDVAMVWQVTRPGADVA
FT                   PGTRSESQ"
FT   gene            477655..479139
FT                   /locus_tag="Tpau_0454"
FT   CDS_pept        477655..479139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0454"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   mmi:MMAR_4815 L-asparagine permease AnsP1"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77095"
FT                   /db_xref="GOA:D5US28"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:D5US28"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /protein_id="ADG77095.1"
FT                   /translation="MSTDQNVSADHALGAEDEGYQKSLTPRQLQMIAIGGAIGTGLFLG
FT                   AGGRLNSAGPGLFLVYGICGVFVFFILRAMGELVLHRPSSGSFVSYAREFYGEKAAYVA
FT                   GWMYFLNWAMTSIVDSTAIALYLHFWGPMRVIPQWAFALLALAVVLTMNLISVKLFGEL
FT                   EFWAALVKVVALTAFLVVGTIFLSGRFTIEGQRTGLSVISDNGGWFPHGILPLAVVTSG
FT                   VVFAYAAVELVGTAAGETENPRKVMPKAINTVIFRIAIFYCGSLLLLALLLPWSSYKDG
FT                   ESPFVTFFSKLGFSEAGSIMNLVVITAALSSLNAGLYSTGRILRSMSVNGSAPKFTSRM
FT                   SRNGVPYGGILLTCVFTLGGVLLNAFNPGQAFEIVLNISALGILGAWATIVLCQLKLYY
FT                   EAKAGRIDRPAYRLFGAPYTGYVTLAFLAIVLVLMAFDTPIGTWTVASLLVLIPMLIVG
FT                   WYAVRGRVAEAAAARDGYTGTFPVIAERPSPRDKRR"
FT   gene            479481..480554
FT                   /locus_tag="Tpau_0455"
FT   CDS_pept        479481..480554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0455"
FT                   /product="N-acetylmuramoyl-L-alanine amidase family 2"
FT                   /note="KEGG: cjk:jk0553 putative secreted protein; PFAM:
FT                   N-acetylmuramoyl-L-alanine amidase family 2; SMART: Animal
FT                   peptidoglycan recognition protein PGRP"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77096"
FT                   /db_xref="GOA:D5US29"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006619"
FT                   /db_xref="InterPro:IPR015510"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:D5US29"
FT                   /inference="protein motif:PFAM:PF01510"
FT                   /protein_id="ADG77096.1"
FT                   /translation="MRISRRSVMLAGATAAAITAGTGRRAAAAPAQAAGGAEYVSIDLT
FT                   RTRGQRVAIRVTLPGGRSVEIAVRRTTHGRDDRPLPNTSELIALPPDTLDLEVITDAGI
FT                   ALTPTRYRIATAPNFQTPVATHYGWGFPVVTRTGWGADPALQTWGDPEYTPAQVITVHH
FT                   TAQPRGDEYLDYRDAVRSIYRFHASPASDGGRGWGDIGYHLIIDPNGVIYAGRDTGADA
FT                   PVFAPGTSTLRPGAPVVTAGHVYQANSGNIGVCVIGDFTGSQPTPAARASLVQVLAALC
FT                   RQLGLNPQAAVRYVNPNNAVRATSWAISGHRDWAKIAGPTECPGDELWALLPALRSATE
FT                   FRASDDGAVPRSPVPGA"
FT   gene            480700..481929
FT                   /locus_tag="Tpau_0456"
FT   CDS_pept        480700..481929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0456"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bcj:BCAM1381 major facilitator superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77097"
FT                   /db_xref="GOA:D5US30"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5US30"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG77097.1"
FT                   /translation="MVSIGIVDTKAAAETPRRWTTVMLLVAVTAPQLGLSLLNPSIPQM
FT                   AVDLHTTVSAVQLTLSGYMAGYAVSMFAAGILADRFDARTVQALGLLLFAVGGVAAAAA
FT                   PSVAVLGAARFVQAIGGTSATVLCRLVIQRRYPADTRMQLLTSLSIVIAATPAISPFLG
FT                   SALVQVLAWRALFLGLAVVGVMLAVAFLLLVPAAPPEVPVSPTPRMVGRGIAEAVRERG
FT                   FRRHALVISLAWMGYFLFIEQSSFVLQELHGATELQYGLLLVVPAIGYIAGSVLVRRAP
FT                   AVVRAVRFGAVASLLGAAALVILAAVGVHNPAAVVVPLAVGFVGVGAAIPFSQAGLLEL
FT                   DLAAQGVGAGLFFFLQMASGAVYSVIVEGLRLRGSLSVSLAIALPLFCLAVTVAITTRA
FT                   RNRQGENANA"
FT   gene            481922..482686
FT                   /locus_tag="Tpau_0457"
FT   CDS_pept        481922..482686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0457"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: cgb:cg0540
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77098"
FT                   /db_xref="GOA:D5US31"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D5US31"
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /protein_id="ADG77098.1"
FT                   /translation="MHEYTVFDAHFHIIDHTFPVVENNRFLPDHFDVDAYRGHAERLRV
FT                   VGGAIVSGSFQEFDQSYLRDALQRLGPGFVGVTQLPASVTDEEIIDLDRVGVRAVRFNV
FT                   KRGGSESIGNLETFARRVHDVAGWHTELYVDAAHLGELTDVIGALPAVSVDHLGLSEAG
FT                   LPVLLDLVERGVRVKATGFGRVELDVRAAVRRIMDIDPTALMFGSDLPSTRARRPFEDA
FT                   DIDLLIDEVGEDDAEAVLRTNAERFYRIAGPR"
FT   gene            complement(482689..482762)
FT                   /locus_tag="Tpau_R0005"
FT                   /note="tRNA-Gly4"
FT   tRNA            complement(482689..482762)
FT                   /locus_tag="Tpau_R0005"
FT                   /product="tRNA-Gly"
FT   gene            complement(482836..484209)
FT                   /locus_tag="Tpau_0458"
FT   CDS_pept        complement(482836..484209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0458"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   nfa:nfa12290 putative amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77099"
FT                   /db_xref="GOA:D5US32"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:D5US32"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /protein_id="ADG77099.1"
FT                   /translation="MTDAPLRRGLTARHIRFIALGSAIGTGLFYGSAKAIQAAGPSVLL
FT                   AYVIGGLVIYLVLRALGEMAVRNPQGSFGDYASSSLGPRAGFMTGWMYVFEMVFVCIAD
FT                   VTAFGTYMGLWFPHVPKWIWVLAVILFIGALNMMRVKVFGEVEFWLTMVKITAIVAMIF
FT                   GGIAVLIFGFGMHDTSRGVSNLWGDGGFFATGFLGFLSCFVLVVFAFGGSEIIGLTAAE
FT                   AEDPERTIPKAINTVPVRIGLFYVLALAVIMAVIPWNQISSESSPFVQIFQALGVEPAA
FT                   HVLNVVVITAAISAINSDIYGAGRMMFGMAQRGQAPTIMQKVSRNGVPWMTVVIMAAAL
FT                   LVGVVLNAAIPENVFVVIASIATFATVFVWLMILFSQYRQRTAMSADEQSALTFPVPLW
FT                   PYGQLIAIAFLLFVTVLMAFQPDTRVALIVGFVWLAFLAAAYAVWVAPKAAVRSGSER"
FT   gene            484292..484861
FT                   /locus_tag="Tpau_0459"
FT   CDS_pept        484292..484861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0459"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /note="KEGG: rop:ROP_54420 deoxycytidine triphosphate
FT                   deaminase; TIGRFAM: deoxycytidine triphosphate deaminase;
FT                   PFAM: deoxyUTP pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77100"
FT                   /db_xref="GOA:D5US33"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:D5US33"
FT                   /inference="protein motif:TFAM:TIGR02274"
FT                   /protein_id="ADG77100.1"
FT                   /translation="MLLSDRDIRAQLDSGRLGIEPFDTQLVQPSSVDVRLDGLFRVFNN
FT                   TRYTHIDPAQRQDELTSLVEPDPGEPFVLHPGEFVLGSTLEVCSLPDDLAGRLEGKSSL
FT                   GRLGLLTHSTAGFIDPGFSGHITLELSNVANLPITLWPGMKIGQLCLFRLSSPADNPYG
FT                   SASTGSKYQGQRGPTPSKAYLNFQQD"
FT   gene            complement(484865..486556)
FT                   /locus_tag="Tpau_0460"
FT   CDS_pept        complement(484865..486556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0460"
FT                   /product="YibE/F family protein"
FT                   /note="PFAM: YibE/F family protein; KEGG: rop:ROP_55290
FT                   hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77101"
FT                   /db_xref="GOA:D5US34"
FT                   /db_xref="InterPro:IPR012507"
FT                   /db_xref="UniProtKB/TrEMBL:D5US34"
FT                   /inference="protein motif:PFAM:PF07907"
FT                   /protein_id="ADG77101.1"
FT                   /translation="MTDTDEHADHDHAAGVHSHSLSTISLGKWASRVVVGLLAVIGVAV
FT                   VIGVIALWPSQLRVSVPNAPESPTLYKGTVSEQVLGECDFSPRGNGQVSDTEPHPVSNP
FT                   DGGCLNSSVKITSGPDTNRWTQFSIGTMRVNFSSLPGQGPSSGSNGIDTSRPATPGTGQ
FT                   PDLTPGTKIMIAENGGGVAGAPSNYSFYDYSRGVSLWVWGLIFAAVIVAVAHWRGFRAL
FT                   VGLALSGVVIVLFALPSILDGHSAVWVALVASAVILYVVLYLAHGVSLRTSAALLGTLC
FT                   ALAVCAALAWAATVTTRVTGLSSDDATNLQAHASQLSISGVLLAGFVIGALGVLNDVTI
FT                   TQSSTTFELAKLSPKASRRRTFLSSMRVGRDHIASTVYTLVFAYVGSALPLLLLFSIAG
FT                   RPLGQVLTSDSVSVELVRSFVGGIGLALSVPLTTAIATLLAKPTRASVSPEAAQRYTHS
FT                   HPDADPSEIKVRQRRAAAPAVAEPALSAPAQAPAQQAPAPPATESPVTGQMPVQRPVRP
FT                   APPRPSEPIPAPPRPQPKPPVVPPAPPTQAPSEPEPRRRGRHAAPD"
FT   gene            complement(486567..487823)
FT                   /locus_tag="Tpau_0461"
FT   CDS_pept        complement(486567..487823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0461"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   rer:RER_13320 alanine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77102"
FT                   /db_xref="GOA:D5US35"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5US35"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADG77102.1"
FT                   /translation="MSRPHVPHIRTELKPLEQSAKLQNVLYEIRGPVVAQAARLEAQGH
FT                   RILKLNIGNPATFGFEAPDSIVRDMIHALPTSQGYSESQGIASARRAVVTRYEEVPDFP
FT                   YFDIGDVYLGNGVSELITMTLQALLNNGDEVLIPAPDYPLWTAMTSLSGGTPVHYLCDE
FT                   DNGWNPSVEDIEAKITPRTKAIVVINPNNPTGAVYSRETLQQIVEVARKHSLLVLADEI
FT                   YDRILYDDAQHISIAELAPDLLVCTFNGLSKAYRVCGYRAGWMVLTGPKDHASGFIEGL
FT                   TLLASTRLCPNVPAQHAIQVALGGYQSINDLILPGGRLLEQRDVAFEKLNAIDGVSCVK
FT                   PQGALYAFPKLDPNVHEIRDDEQLVLDLLNQEKILLVQGTGFNWPTPDHLRVVTLPWAR
FT                   DLSEALDRFGNFLSSYKQK"
FT   gene            complement(487870..488877)
FT                   /locus_tag="Tpau_0462"
FT   CDS_pept        complement(487870..488877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0462"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mjl:Mjls_0458 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77103"
FT                   /db_xref="GOA:D5US36"
FT                   /db_xref="UniProtKB/TrEMBL:D5US36"
FT                   /inference="similar to AA sequence:KEGG:Mjls_0458"
FT                   /protein_id="ADG77103.1"
FT                   /translation="MSKNHATLAAVFAGLAIAIPLIVLLFTAPAAKGAPHDLPIGVVGP
FT                   EAAVTQVSDRLDEQQPGGFDVKAYASADELIAAAENREVYGGIVLGAQPRAITATGASP
FT                   VVAPLITQLANAAAQGRTVQVTDVAPPSVDDPRGAGFGSMVMPVFLSGMVLALSTVMIG
FT                   GHPKIVAAALPIGAAVVGAAAVGAAMWIGVLPGGFGAQWLAMSAGMLAIGATVAGLVQL
FT                   LGTKGIAPAALLFMLVGMPLAGIAAPPEFLPHVWGVLGQSLPIGATGTALRGAAFFAPD
FT                   ALIGAGAGAAFAVLGAWIVVGYGLLTIGVARHRAQPSGAPSGERTPDAAVATPA"
FT   gene            488975..489556
FT                   /locus_tag="Tpau_0463"
FT   CDS_pept        488975..489556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0463"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bcv:Bcav_3630
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77104"
FT                   /db_xref="GOA:D5US37"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041678"
FT                   /db_xref="UniProtKB/TrEMBL:D5US37"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG77104.1"
FT                   /translation="MGTGRRAGASTAKADILEAARELFAEVGYDRATIRAIAARAGVDV
FT                   ALVSYYYGNKKGLFRGVMSMPVDPEAIFTAALDGPRDGVGERLLRAALTIWEGPETSEA
FT                   FRALLRAAADADEGAARTFGEFLSSVMIPTLTTHAGVGIETARVVASNLFGLAFLRYLI
FT                   AAPLFVAPSTEELIATYGAAVQRIIDADAG"
FT   gene            complement(489647..490231)
FT                   /locus_tag="Tpau_0464"
FT   CDS_pept        complement(489647..490231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0464"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmi:MMAR_2661 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77105"
FT                   /db_xref="UniProtKB/TrEMBL:D5US38"
FT                   /inference="similar to AA sequence:KEGG:MMAR_2661"
FT                   /protein_id="ADG77105.1"
FT                   /translation="MPEYVSYEEFGRRFFEIAVNEERVGSAFADIAGGDFTVGPIPSGP
FT                   GGVAKVWAKVQIDEPQLTRHVGELITFTVKIPLRIGLLIDLKVDRIRYDVAGLITLPLT
FT                   VRAAAPLELRIEVDAPKPKDVWVDVESHSIRGSIVRVVASVDSEIRRFIAQYVAEEIDK
FT                   PEVKKARIIDVSEELGRAFHNLGDEDAADSA"
FT   gene            complement(490277..493672)
FT                   /locus_tag="Tpau_0465"
FT   CDS_pept        complement(490277..493672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0465"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224 cysteine-
FT                   rich region domain protein; 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein; KEGG: nfa:nfa54200 putative
FT                   iron-sulphur-binding reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77106"
FT                   /db_xref="GOA:D5US39"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D5US39"
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /protein_id="ADG77106.1"
FT                   /translation="MDTDTLAAGAAETNALTLTLGTIGAIAFALGWVVFFRGALRMVRI
FT                   IAKGQPAPDRWTPFIPRAAEVVVEFLAHTKMIKNRTVGIAHWLVMIGFLAGAILWFEAL
FT                   PQTFDPSFHWPVIGSWPVYRLMDELLGIGTVVGIVVLIVIRQIKHPRNPELFSRFAGSK
FT                   FLPAYTIEAIVFVEGLGMILVKSSKIATYGDADPITDFFTRQVATLLPASPNLITVFAF
FT                   IKLMSGVMFLLLVGSNLTWGVAWHRFSAFFNIYFKRELGSRRALGAAKPMMSDGKVLEM
FT                   ETADPDTDAFGAGKIEDFSWKGWLDFTTCTECGRCQSQCPAWNTGKPLSPKLLIMGLRD
FT                   HGFAKAPYLLAGGSTDMGGDETGLVDADGNPDETKLGKIPAEARAEAARPLVGPAGEGD
FT                   DLGGVIDPEVLWSCTTCGACVEQCPVDIEHVDHIVDMRRYQVLIESEFPHELAGLFKNL
FT                   ENKGNPWGQNSSQRTAWIDEMDIDIPVYGEHTDSFDGYEYLFWVGCAGAYEDRAKKTTK
FT                   AVAELLDVAAVNFLVLGQGETCTGDSARRAGNEFLFQMLAQQNIEQLNEVFDGLPVNQR
FT                   KIVVTCAHCFNALGNEYPQVGGQYEVVHHTQLLNKLVREKRLVPVAPPSEDVTYHDPCY
FT                   LGRHNQVYEAPRELIGASGATLKEMPRHLERSMCCGAGGARMWMEEQLGKRINIDRVDE
FT                   ALETLSSTPEASPKKIATGCPFCRVMLSDGVTAQTADSDAPAPEVVDVAQMLLESVKRG
FT                   LPDGLVRGNPNRKTDGAAPAEVPTEAPAEVEEAPAATAAATTAEPAEKKDAKPTVGLGL
FT                   AGGGKRPGAPKKPGGAPKPGGAAPAAEAAEPAAPAAPAKPAVGLGLAGGAKRPGAPKPG
FT                   GAKPAAAAPAAETPAETAAETPAAPAAPAKPAVGLGLAGGAKRPGAKKPGAPKSPAAAA
FT                   PAEAPAAEPTAAPSAAPAADAPAEDRTLSTAGESKAAGFGIAAGAKRPGPKKPGAPKPA
FT                   AAAPAAPETAAPEAAAPEAPAAPAAEAPAAPAEDRTVTTAGESKAAGFGIAAGAKRPGV
FT                   KKLGGEIKEKVAEARTEVREHTEHKTEPEAPSAAEPEQPEAPETPAEAPKASSGDDRSL
FT                   AEKGESKAKGFGIAAGAKRPGGRK"
FT   gene            493808..494359
FT                   /locus_tag="Tpau_0466"
FT   CDS_pept        493808..494359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0466"
FT                   /product="protein of unknown function DUF218"
FT                   /note="PFAM: protein of unknown function DUF218; KEGG:
FT                   rer:RER_53690 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77107"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:D5US40"
FT                   /inference="protein motif:PFAM:PF02698"
FT                   /protein_id="ADG77107.1"
FT                   /translation="MAYVTRLRGAVAGLAGSGPLYSPDDAPPAPVAIAFGASVRGGRPG
FT                   SFVEGRLEAALRLYRIGKVQRILVSGNANGLSGDEIEVMTRWLRERGVPDEALLTDGAA
FT                   LDTYLSCVHARDRFGIDRVLLVSQFFHARRAVVLARHLGLDADAVRAEAGCSRRAWVRN
FT                   LAREYLLSRPKAALDIARNR"
FT   gene            494382..494711
FT                   /locus_tag="Tpau_0467"
FT   CDS_pept        494382..494711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0467"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77108"
FT                   /db_xref="GOA:D5US41"
FT                   /db_xref="UniProtKB/TrEMBL:D5US41"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77108.1"
FT                   /translation="MNRRVLGEVGRAIAVLAVIVAGGVVGFGSWALMFVQADARGMGVD
FT                   PGAGLALGFLGLIWSGVCLVAAGVAGDLLVYGESRRARLVGIGVMALILACTGLLLWCV
FT                   AKLSL"
FT   gene            494882..495841
FT                   /locus_tag="Tpau_0468"
FT   CDS_pept        494882..495841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0468"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; Polyketide
FT                   cyclase/dehydrase; KEGG: fal:FRAAL5132 TetR family
FT                   transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77109"
FT                   /db_xref="GOA:D5US42"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D5US42"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG77109.1"
FT                   /translation="MYRERGDERSIEIAAPPEAVWRVLMDFSAYPEWNPMVRTIAGTPR
FT                   VGERLDVEVNNNGSAIRFSPTVLGVDPDREFRWVGRVMVPGLLDGEHYFRLEPTATGTR
FT                   FTQGERFRWRAGPGGRRVDRCGRGLRRVQPCAPRPGAGYDRRVIPDEFDPLSALTPRAR
FT                   QIAGAARDLLEREGWDAVTMRVLADEIGIRAPSLYKHFANKDAVKSALVAVALAESGAA
FT                   LRPTTGVAELLGRYRAVARANPNLYRLATVGPLDRTSLPEGLEDWSGAPFVEVTGDPHA
FT                   AQALWAAAHGLAILEIDGRFPTGTAPDATWNDLARRFG"
FT   gene            496069..496563
FT                   /locus_tag="Tpau_0469"
FT   CDS_pept        496069..496563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0469"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcv:Bcav_3729 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77110"
FT                   /db_xref="InterPro:IPR032330"
FT                   /db_xref="UniProtKB/TrEMBL:D5US43"
FT                   /inference="similar to AA sequence:KEGG:Bcav_3729"
FT                   /protein_id="ADG77110.1"
FT                   /translation="MHALTQQQILDSFRGATKSEVKRVTFPQDVDEIRFDRLEFLGWHD
FT                   RKIARRAYVCVPMEEGPVTLLFTQAEAKPKAKAMCTWCRDVNITSQAVLFSVRRGGPAG
FT                   RKGDTMAVLVCEDFSCAANARKLPPAFHKATDLDAIREQNLAELRRRVTGFVAEVLSTE
FT                   E"
FT   gene            complement(496582..497451)
FT                   /locus_tag="Tpau_0470"
FT   CDS_pept        complement(496582..497451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0470"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /note="KEGG: fal:FRAAL1883 putative exodeoxyribonuclease
FT                   III; TIGRFAM: exodeoxyribonuclease III Xth;
FT                   exodeoxyribonuclease III; PFAM:
FT                   Endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77111"
FT                   /db_xref="GOA:D5US44"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR020848"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:D5US44"
FT                   /inference="protein motif:TFAM:TIGR00633"
FT                   /protein_id="ADG77111.1"
FT                   /translation="MRVATWNVNSVKQRHGRLLEWLDSRQPDVVCLQELKLTDDAFATL
FT                   IGPDLTERGYEFATAGQPQWNGSAVLSRVGLDDVVVGIPGAPAFDGTVEGRAISAVCAG
FT                   IRVHSLYTPNGREVGSDHYAYKLEWLAALRDQVSADSVPQLVCGDMNIAPTDEDVFDPA
FT                   AFAGHTHVTEPERDALRALEDLGLRDVVREHWPTDQVFSYWDYRAGMFNKNLGMRIDLI
FT                   LASGPVADRTAAAWIDRQARKGKGPSDHAPVMLDLDTAPDGDIGPMVPPPSAGRVAPRG
FT                   AKLPQSKD"
FT   gene            complement(497482..498531)
FT                   /locus_tag="Tpau_0471"
FT   CDS_pept        complement(497482..498531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0471"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rer:RER_53080 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77112"
FT                   /db_xref="UniProtKB/TrEMBL:D5US45"
FT                   /inference="similar to AA sequence:KEGG:RER_53080"
FT                   /protein_id="ADG77112.1"
FT                   /translation="MPHTLSTLAATLGTALFSATDSGRLAASRTPFAHHDVMVPHTDSR
FT                   LWGTTHFGVFVPDLPAPHRYVNTMTLIGAPGAEVFDQDYLAAPDARNTTTVLSSTAKDD
FT                   QHFYRAYDASTDCDFAPDGSSLHWGDELTITVDLPTVTVRGRYPGFDVDLTLQVTDQVS
FT                   YFVKTPLYDHFSLAAPYTGTVDGVQVSGLGTFEYARIRGMAQALTPRPVPAPLKLPIDF
FT                   FTYQIIDVDPSTQLLLTDVRARENVACRLLHVRRLGEPAQVYDDVALHVTEWESRVDEQ
FT                   GRSMRVPNRFTWAVCEGRDRVLEIDCVVDSPWRYGHGPGYVAAYSYAGTFESKPVRGSA
FT                   YIEWIDVRP"
FT   gene            498620..499429
FT                   /locus_tag="Tpau_0472"
FT   CDS_pept        498620..499429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0472"
FT                   /product="Squalene/phytoene synthase"
FT                   /note="PFAM: Squalene/phytoene synthase; KEGG:
FT                   krh:KRH_20840 phytoene synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77113"
FT                   /db_xref="GOA:D5US46"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR019845"
FT                   /db_xref="UniProtKB/TrEMBL:D5US46"
FT                   /inference="protein motif:PFAM:PF00494"
FT                   /protein_id="ADG77113.1"
FT                   /translation="MDSTERYTAAAVAASAVVIRQYSTSFSLASRMMPRRVRSHITSIY
FT                   GLVRVADEVVDGACPVDPRAHLDALEVATERAIETGFSTDLVVHAFANTARATGFGTEL
FT                   TRPFFASMRADLTPAPHTAESLAQYIYGSAEVVGLMCLRAYLHGAAPSDYEALASDAKR
FT                   LGAAFQKINFLRDLTDDELRLGRAYLPELTPDAYAAALADAREDLEQARRGIARLPGDV
FT                   RRGVRAAADLYSALLHRLEAAGLDGARAGRVRVPAASKLLAVVRGVR"
FT   gene            499506..500516
FT                   /locus_tag="Tpau_0473"
FT   CDS_pept        499506..500516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0473"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kra:Krad_2817 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77114"
FT                   /db_xref="GOA:D5US47"
FT                   /db_xref="UniProtKB/TrEMBL:D5US47"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77114.1"
FT                   /translation="MALDDWPERDRRWAARYILCLAVKQDVSYEASEARQAELIAAVES
FT                   AGLPAAELFGDPDEAAAADGADIRSSEPPPAPLLGGGRQDGIDAMGVAYLTVGVPAAIL
FT                   VPMVGGARVDVTVGTVALMAGIVIALFAGGAAWSAAAEGYPRRAMALGLTAVAAALFAA
FT                   SQVSWPNRADVLVAGLPSWIAVPAILAPGIVALVVARFVSNEPRQAEEYTDDQWFMRFR
FT                   DVLRSRWVSADVIDEHVRSLRADLPDVSTATEEYGDPVALARRLANDDSAADRRRWTWK
FT                   AAAFAVFAFLVLFGAITSLIGDGPSWGVLAPIAVVFLYAPTALKSWRSRPRKAGA"
FT   gene            500513..500854
FT                   /locus_tag="Tpau_0474"
FT   CDS_pept        500513..500854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0474"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: kra:Krad_2816 transcriptional regulator, PadR- like
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77115"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5US48"
FT                   /inference="protein motif:PFAM:PF03551"
FT                   /protein_id="ADG77115.1"
FT                   /translation="MSVAAWQRATLPLLILGVLESAPRHGYGISAALVDVGLHPIKGAQ
FT                   LYPALVKLENEGAIVATWEQSESGPARKVYELTATGRTQLATLREDWRTFTTAAAQLGA
FT                   AATTPSTRR"
FT   gene            complement(500923..501795)
FT                   /locus_tag="Tpau_0475"
FT   CDS_pept        complement(500923..501795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0475"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: cmi:CMM_2872
FT                   putative hydrolase/acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77116"
FT                   /db_xref="GOA:D5US49"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5US49"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADG77116.1"
FT                   /translation="MISTIAVNGRWARVRAEGDESKPTVLLLHGITRSLEDWDPQFESL
FT                   SGDFRLIATDLPGYGWSAPHPDGAGLPALARGVGETLDALKVTGPVHVVGNSLGGAVTM
FT                   TLLTQRPEQVATITLVDSAGFGKEVTPLLRLLGLPLIGKLMATTPSRLSAIIQERLIFA
FT                   DKSFATRARIDHAMKIARETDAGLTTWRTADSLGSVLGGVQQEWRDELQATIAKTPRPT
FT                   MVLWGDRDKILPPKHLSAARALIPHAEGHLIPGVGHMPQLECAPEFDALLTDFLERNAT
FT                   PELHPAASQ"
FT   gene            complement(501792..502688)
FT                   /locus_tag="Tpau_0476"
FT   CDS_pept        complement(501792..502688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0476"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mav:MAV_4120
FT                   hydrolase, alpha/beta fold family protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77117"
FT                   /db_xref="GOA:D5US50"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5US50"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADG77117.1"
FT                   /translation="MTDQTRFDVPTSDGLTLAGFRYGEHDPALPTVLAIHGYPDNHHVW
FT                   DGVAAALAGRANVYTYDVRGAGDSEAPAGKAGYRFDRLISDVSKVIDAVREQSGDRSKV
FT                   HLLGHDWGSIQGWHAVVDPAVADKTASYTSISGPNLNHAGEYLKGARRFADVPARLRQA
FT                   AGSTYIPFFLAPGLADALYRRGWGQKLIETLEKRGTGGRTAEGYERSDRDFTNGLNLYR
FT                   ANMPGPFLKPAAADTTVPVQVVTPEGDLFVTRPVQLAGLTHSPKSRDVSVPGGHWVVAQ
FT                   NPSPVADVTFEWIEANR"
FT   gene            complement(502698..503855)
FT                   /locus_tag="Tpau_0477"
FT   CDS_pept        complement(502698..503855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0477"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; Oxidoreductase FAD-binding domain
FT                   protein; oxidoreductase FAD/NAD(P)-binding domain protein;
FT                   KEGG: msm:MSMEG_3676 phenoxybenzoate dioxygenase beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77118"
FT                   /db_xref="GOA:D5US51"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D5US51"
FT                   /inference="protein motif:PFAM:PF00111"
FT                   /protein_id="ADG77118.1"
FT                   /translation="MTGAGIDPTKGRKSPSVFRPWGEPVTEVPPHLYGRWKRDPLLRFA
FT                   NAFFSTTIPAFAHLMKPRDLAEPDTSRQLRVIGREIVAHDKDVVALTLESADGTPLPRW
FT                   TPGAHLDLLLPSGRMREYSLCGDPADADTYRIAVRRIPTGGGGSVEVHETLHLGSTVTV
FT                   KGPRNGMPMAVPGHGSAAQHLRFVAGGIGITPILPMMIAAERLGLDWSMLYTGRSTDTI
FT                   PFISEVAKFGDKVEIRTDDVHGIPTADVLIGDTPGPTALYSCGPIPMLEALRIGLIGRT
FT                   DVELHYERFSAPPVVDGKPFTATLSETGTTVDVGAEETLLAAVLKARPDAPYSCRQGFC
FT                   GTCRVTVTEGTVDHRDQTLTPYEREQGQMLTCVSRAAGDHLTIDL"
FT   gene            complement(503852..504748)
FT                   /locus_tag="Tpau_0478"
FT   CDS_pept        complement(503852..504748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0478"
FT                   /product="Uncharacterized conserved protein UCP07580"
FT                   /note="PFAM: Uncharacterised conserved protein UCP07580;
FT                   KEGG: mjl:Mjls_2904 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77119"
FT                   /db_xref="GOA:D5US52"
FT                   /db_xref="InterPro:IPR016516"
FT                   /db_xref="UniProtKB/TrEMBL:D5US52"
FT                   /inference="protein motif:PFAM:PF10118"
FT                   /protein_id="ADG77119.1"
FT                   /translation="MSSRATAHEHEPAEVEIHARNVTFDWENTPLEWIPGEPVASDIIS
FT                   SILHSVLPEGERWFCEVYNEALPYVKDENLARTMRGFIGQEAMHAESHDRALSEYLARC
FT                   GIDTTPVARQFEYIFRKILAPRTYRSDRAQYNDMVQRLWLIAAVEHYTAILGVFALNND
FT                   WDKYGVDPTMADICRWHGAEEVEHRSVAHDVANYFDPSYFHRCRAMIVGVVFLVLALHR
FT                   TSGYMLRKDPNFSYSYPRLWWEYLRGSRKNILPKLRDVIKFTLIYFKPSFDPASIGSTA
FT                   QAVAYLATSPAARAANG"
FT   gene            504906..505250
FT                   /locus_tag="Tpau_0479"
FT   CDS_pept        504906..505250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0479"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="KEGG: fal:FRAAL3030 ArsR family transcriptional
FT                   regulator; PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77120"
FT                   /db_xref="GOA:D5US53"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5US53"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADG77120.1"
FT                   /translation="MVVDELAPDEVDRLFHALADRTRRDILAQVIDRERSVSELARGYE
FT                   MSFAAVQKHVAALEKAGLVTKLRRGREALVRPDITAVQRAQRLLRAYEDLWRGRVARMD
FT                   ALLDEPSMKE"
FT   gene            505254..505730
FT                   /locus_tag="Tpau_0480"
FT   CDS_pept        505254..505730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0480"
FT                   /product="Activator of Hsp90 ATPase 1 family protein"
FT                   /note="PFAM: Activator of Hsp90 ATPase 1 family protein;
FT                   KEGG: bcv:Bcav_2882 activator of HSP90 ATPase 1 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77121"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D5US54"
FT                   /inference="protein motif:PFAM:PF08327"
FT                   /protein_id="ADG77121.1"
FT                   /translation="MPVLSTTSDREALTFDLVAEFATSPERVWQLWEDPRLLEKWWGPP
FT                   TWPATFVRHELTPGGQSRYYMTGPDGTKAGGWWETVATDAPSTFVFRDGFAGEDGEPVD
FT                   PEDYSTNTVVLTRTGDVTRMNLTAAHRSLEQLDRVLEMGMTEAMNQIDALLAAV"
FT   gene            complement(505734..506516)
FT                   /locus_tag="Tpau_0481"
FT   CDS_pept        complement(505734..506516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0481"
FT                   /product="Nucleotidyltransferase, predicted"
FT                   /note="PFAM: Nucleotidyltransferase, predicted; KEGG:
FT                   tfu:Tfu_1072 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77122"
FT                   /db_xref="GOA:D5US55"
FT                   /db_xref="InterPro:IPR018775"
FT                   /db_xref="UniProtKB/TrEMBL:D5US55"
FT                   /inference="protein motif:PFAM:PF10127"
FT                   /protein_id="ADG77122.1"
FT                   /translation="MSDRKNVEYGDRDVALRDEILRSVVGSGVHGIAIAGTDDHDELGV
FT                   YLEPPASLLGVRQPRADYIWRTRPEGVRSGPGDTDLVLYSLRKYLRLAVKGNPTVLLPL
FT                   YAPDESLVKVTELGRSLRELRSAFLSRQSVERFLGYMHSQHQRMLGRASGVPNRPELVA
FT                   RYGWDVKYGSHALRLAYQGHEIASAGTLTLPLVPQQRERVLAVKRGEVAREEVSAEIAE
FT                   LEGAVRAVLDGDCPLPEHADIARIDAWAIAAQRSFWGW"
FT   gene            506585..507997
FT                   /locus_tag="Tpau_0482"
FT   CDS_pept        506585..507997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0482"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; KEGG: rop:ROP_04910
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77123"
FT                   /db_xref="GOA:D5US56"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR024026"
FT                   /db_xref="InterPro:IPR024740"
FT                   /db_xref="InterPro:IPR026610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038546"
FT                   /db_xref="UniProtKB/TrEMBL:D5US56"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ADG77123.1"
FT                   /translation="MQTDRVYLTISTTYAPATELGYLLHKHPDRVQEFRQPFGVATVFY
FT                   PEAGPDRCTAALLLEVDPIQLAKRRRASPDFSLGQYVNDRPYAASSLLAAALADVFRSA
FT                   RHGRAGSRQELADTAIPLQIEIPVLPCRGGAEVAERVFAPLGWDVDATPIELDGGFPEW
FT                   GQSRYVRLRLTGRMRLAEAINHLYVLLPVLDESKHYWQGPDEVDKLLRSGEGWLASHPD
FT                   RELITRRYLGRGPGLAAEALDRLAALDDAGPAAAEVDEAVDIAPAKPLNALRHDAVHRV
FT                   IVESGASTVIDLGCGPGQFVERLLATRGIERVAGCDVSTRSLQRAAQRLHLDDMTERQR
FT                   ERIDLFQAALTYEDERLSGYDAAVLMEVIEHVDPSRLGALEHVVFGGARPGTVIVTTPN
FT                   SEYNVLYPDLVGMRHTDHRFEWDRTEFIRWSTAIAERYGYAVRHEGIGEADPDRGTPTQ
FT                   MAIFTRKESADA"
FT   gene            507990..510482
FT                   /locus_tag="Tpau_0483"
FT   CDS_pept        507990..510482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0483"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: rop:ROP_04920
FT                   serine/threonine protein phosphatase PrpA"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77124"
FT                   /db_xref="GOA:D5US57"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR024028"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR032380"
FT                   /db_xref="InterPro:IPR032390"
FT                   /db_xref="InterPro:IPR041780"
FT                   /db_xref="UniProtKB/TrEMBL:D5US57"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ADG77124.1"
FT                   /translation="MPDTTVAVPARGLILLVGASGSGKSTFAREHFRATEVVSSDVCRG
FT                   LVADDENDQSATPDAFDLLHHLVGIRLRRGLLTVVDATNVQRPARASLVQLARDHDVLV
FT                   DAIVFDLPDEIAVERNRQRPDRNFGSQVVTRQGREMRKSLRGIKKEGFRRVHTLHTPDE
FT                   VAAVEITRERPWNDRTELTGPFDVIGDVHGCAAELRTLLTELGWTVRADGAEHPDGRTA
FT                   VFVGDLVDRGPDTPAVLRLVMGMVDAGTALCVSGNHEAKLVRALKGNRVTVAHGLQESL
FT                   DQLAAETEEFRTAATRFMDGLLSHYVLDRGRLVVAHAGLKQEYQGRASRRVRAFALYGD
FT                   TTGETDEFGLPVRYPWARDYRGSAAVVYGHTPVTEPQWLNNTLCIDTGAVFGGALTGLR
FT                   YPEREIVSVPAQSQWYEPARPEQVEQSDDRAGSVLRYDDVAGTRWLSTRTGGRVKVDAE
FT                   GAAAALEVMSRFAVDPRWLIYLPPTMSPASVSRHEDYLEHPVCAFDDFAGWGVERVICE
FT                   EKHMGSRAIAVIARDADVAAWRFGVADGSSGAVYTRTGRSFVEDSASLVDRIRGAVAPL
FT                   FDRLDTEWLALDCEILPWSAKAEGLIVDQYASVGAAAREALPVALAGLDAAAARGLDVA
FT                   GLRARTVRRQVNAVAFRDAYAAYCRPIDGLDGVTVAPFQVLAAEGRVLATESHEWHLDL
FT                   MGALEDPFLTHTRHRIVDLSSEADRAAAERWWTGLTDAGGEGMVVKPLGATGRKVQPGL
FT                   KVRGRDYLRIIYGPDYVDSLDVLRDRNLGRKRKMALAEHALGMDALASFVAGEPLWRVH
FT                   QSVFAVLAQDSEPVDPRL"
FT   gene            complement(510490..511971)
FT                   /locus_tag="Tpau_0484"
FT   CDS_pept        complement(510490..511971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0484"
FT                   /product="phytoene desaturase"
FT                   /note="KEGG: rha:RHA1_ro01107 phytoene dehydrogenase;
FT                   TIGRFAM: phytoene desaturase; PFAM: amine oxidase; FAD
FT                   dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77125"
FT                   /db_xref="GOA:D5US58"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR014105"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5US58"
FT                   /inference="protein motif:TFAM:TIGR02734"
FT                   /protein_id="ADG77125.1"
FT                   /translation="MHIGIIGAGLAGLSAALHLTGAGHRVTVVERDEQPGGRAGTTTAR
FT                   SADGRAHLVDPGASVLTMPELVFDALTAGGLTRADAESELDLLPVRPAYAGRFPALPGH
FT                   DRPSVLHVPDDIDTPEHFAWQRAMFDAAYPRFIAGDAALRSYANPRDLAALGRIIRLGA
FT                   LNSMQREVDRRVGDERARRMLTFQALYAGVSPTAARAVYAVISHMDVGLGVWYPRAGMG
FT                   RITEVMAEQVRRAGGTVLLGHEVLGLDGRRGRVTGLRARSGSAGGPERTERLAFDAVVV
FT                   TADAPVADRLLAPLGARPPRRRVRLSPSAVVAHLVVDPDLQQHWPTQAHHTLDFGAAWE
FT                   RTFAEITATRGRGRLMSDPSFLITRPAITTGESGPVSVLAPCPNLESAPLDWDSIGDEY
FT                   VHGVLGALAARGYRGIDRAEVLRIDTPADWARQGLSAGTPFAAAHTLTQTGPLRRPQRV
FT                   PGIGNAVLAGSLTHPGVGVPPALISGRLAAEAVTG"
FT   gene            512096..514141
FT                   /locus_tag="Tpau_0485"
FT   CDS_pept        512096..514141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0485"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="KEGG: cgt:cgR_0148 hypothetical protein; TIGRFAM:
FT                   heavy metal translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC;
FT                   cadmium-translocating P-type ATPase; PFAM: E1-E2
FT                   ATPase-associated domain protein; Haloacid dehalogenase
FT                   domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77126"
FT                   /db_xref="GOA:D5US59"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D5US59"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ADG77126.1"
FT                   /translation="MSAEHDHDSGHSARWEIGFAIASGVTYVSGMIAEYALDQPSVATF
FT                   FFLATYFFGGYFTIRSAIQSTLNGKFEVDFLMLVAAIGAASIGRFAEGAVLLFLFSLGH
FT                   ALEEYALARASKSIEALAELAPRTALVHTGGPSNLSGEFAEKSVDDLEVGDLVLIRPNA
FT                   RVSADGFVVDGRSAIDQSAVTGESMPVEKEPVGSPAAAAARPTNVPAEHRVFAGTVNGS
FT                   GALVVQATALAKDSTLSKVVELVASTDQAKSPTQRFLDKFQRIYVPAVIAFVIGVFLVG
FT                   YFALGNPFTDAFYLAMAVLVAASPCALALATPSAVLAGVARAARAGVLIKGGAPLETLG
FT                   RVSSIAFDKTGTLTWGEPQVTDTVAAPGVDLDDLLATTLAVEKLSDHPLAAAVTDGIAN
FT                   RTSTVLTATDLQSVTGRGVRATIDGDAVEIGNARLFTDADIALDEVAADIDRLQAAGRT
FT                   LMIVRRGGRFLGVIGVMDTPRREAGEVLDRLRESGMTDIVMISGDHQQVADAVGKEVGV
FT                   DRALGGLLPEDKVTQIRDMSGSKEEPAGTSGRRCAMVGDGVNDAPAMAQADVGIAMGAA
FT                   GSAVALETADVALMSDDLGRLPFAVRLSRQTSRIIRQNLIASLGIVVFLIIVTFLGMPM
FT                   GPVVFIHEGSTLIVVANALRLLRFDVGKEHDGVEHEARPEKVPAAA"
FT   gene            514723..516564
FT                   /locus_tag="Tpau_0486"
FT   CDS_pept        514723..516564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0486"
FT                   /product="chaperone protein DnaK"
FT                   /note="KEGG: nfa:nfa54090 molecular chaperone DnaK;
FT                   TIGRFAM: chaperone protein DnaK; PFAM: Heat shock protein
FT                   70"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77127"
FT                   /db_xref="GOA:D5US60"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:D5US60"
FT                   /inference="protein motif:TFAM:TIGR02350"
FT                   /protein_id="ADG77127.1"
FT                   /translation="MGRAVGIDLGTTNSCVAVLEGGDPVVIANAEGSRTTPSVVAFARN
FT                   GEVLVGQPAKNQAVTNVDRTIRSVKRHIGTDWSQKIDDKDYTSQEISARTLMKLKRDAE
FT                   AYLGEDVTDAVVTVPAYFNDAQRQATKEAGQIAGLNVLRIVNEPTAAALAYGLDKGEKE
FT                   QTILVFDLGGGTFDVSLLEIGDGVVEVRATSGDNNLGGDDWDQRIVDWLVEKFKAQHGI
FT                   DLTKDKMAMQRLREAAEKAKIELSSGQSTSINLPYITVDADKNPLFLDENLSRSEFQKI
FT                   TSDLLERTRSPFQAVIKDAGISVGDIDHVVLVGGSTRMPAVTDLVKELTGGQEPNKGVN
FT                   PDEVVAVGAALQAGVLRGEVKDVLLLDVTPLSLGIETKGGVMTKLIERNTTIPTKRSET
FT                   FTTADDNQPSVQIQVFQGEREIAAHNKLLGSFELTGIAPAPRGVPQIEVTFDIDANGIV
FT                   HVTAKDKGTGKENTIKISDGSGLSQEEIDRMIKDAEAHASEDKARREEAETRNQAESLV
FT                   NQTEKFLSENADKVPAENKEKVEAAIKEANEALQGTDIAAVKAAVEKLSTESQALGQAL
FT                   YAQAGAEAQAEGAEQAAQADDGVVDAEVVDEDPKDAK"
FT   gene            516564..517163
FT                   /locus_tag="Tpau_0487"
FT   CDS_pept        516564..517163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0487"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein; KEGG: rha:RHA1_ro05498 heat
FT                   shock protein GrpE"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77128"
FT                   /db_xref="GOA:D5US61"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:D5US61"
FT                   /inference="protein motif:PFAM:PF01025"
FT                   /protein_id="ADG77128.1"
FT                   /translation="MTTPENPVDPEEVNTEAEGVEAGTVTAAAEDSAAAAADEAGSTDA
FT                   PSDEVAELTADLQRVTAEYANYRKRTARDVVDARAAGKAAVVAELLVVLDDLDRARSHG
FT                   DLEAGPLKSVSDKLDGVLSGLGLAPFGAEGDEFDPSIHEAVQHEGDGADPVLGAVLRQG
FT                   YQIDGKVIRNAMVAVVDRPEPDASGQGATDADQDES"
FT   gene            517180..518382
FT                   /locus_tag="Tpau_0488"
FT   CDS_pept        517180..518382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0488"
FT                   /product="chaperone protein DnaJ"
FT                   /note="TIGRFAM: chaperone protein DnaJ; PFAM: chaperone
FT                   DnaJ domain protein; heat shock protein DnaJ domain
FT                   protein; DnaJ central domain protein; KEGG: rop:ROP_55740
FT                   chaperone protein DnaJ; SMART: heat shock protein DnaJ
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77129"
FT                   /db_xref="GOA:D5US62"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D5US62"
FT                   /inference="protein motif:TFAM:TIGR02349"
FT                   /protein_id="ADG77129.1"
FT                   /translation="MTQREWVEQDFYRELGVSSDASQDDIKKAYRKLAAELHPDRNPGD
FT                   AKAEERFKRVSEANSVLSDPAKRKEYDETRRLFGGGRFGSNGGGFGTGGFGNTGGGTGG
FT                   FSFSDIFDGATGGGGGGFGDIFEGLFNRGGGAPGGASGSGPQPSRPRRGNDLESEITLG
FT                   FRDATLGVTTPITLTSPSPCTTCHGSGAKPGTSPRVCQSCNGSGLVSRNQGAFSFSEPC
FT                   PDCRGTGSVIDDPCTDCSGTGVTVRTRTVNVKIPPGVKDGQRIRLAGQGQAGMRGAPSG
FT                   DLFVVVHVKADDVFTRSGDDLLVTLPVSFSELALGSTVTVPTLGQPVGVKIPAGTTDGR
FT                   TLRVRGRGVPKRSGGHGDLLVKVQVSVPGSLDEAAQAALRTYAEAEKASGFDPRSGWAG
FT                   A"
FT   gene            518382..518780
FT                   /locus_tag="Tpau_0489"
FT   CDS_pept        518382..518780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0489"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="KEGG: rop:ROP_55750 putative heat shock protein
FT                   HspR; PFAM: regulatory protein MerR; SMART: regulatory
FT                   protein MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77130"
FT                   /db_xref="GOA:D5US63"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D5US63"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ADG77130.1"
FT                   /translation="MTRPPEIPDDPDAHVFMISVAAQLAGMHAQTLRTYDRLGLVKPER
FT                   SAGGGRRYSTRDVDLLREVQRLSQDEGVNLAGIKRIIDLTNQVDALQRRVQELTAQVDA
FT                   AHRSGAELVHVPKSSALVVWQPRTRRRD"
FT   gene            518802..519062
FT                   /locus_tag="Tpau_0490"
FT   CDS_pept        518802..519062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0490"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_1837c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77131"
FT                   /db_xref="UniProtKB/TrEMBL:D5US64"
FT                   /inference="similar to AA sequence:KEGG:MAB_1837c"
FT                   /protein_id="ADG77131.1"
FT                   /translation="MSERIVFRRTDGGRTTVRHHPTDDGAGFRLAIIDGEVPDEATVDP
FT                   AALYFIDDYDPRSLVSDAGLVVSCGEPPHFGAWERLDAWPV"
FT   gene            519117..519878
FT                   /locus_tag="Tpau_0491"
FT   CDS_pept        519117..519878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0491"
FT                   /product="S1/P1 nuclease"
FT                   /note="PFAM: S1/P1 nuclease; KEGG: mab:MAB_1838
FT                   endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77132"
FT                   /db_xref="GOA:D5US65"
FT                   /db_xref="InterPro:IPR003154"
FT                   /db_xref="InterPro:IPR008947"
FT                   /db_xref="UniProtKB/TrEMBL:D5US65"
FT                   /inference="protein motif:PFAM:PF02265"
FT                   /protein_id="ADG77132.1"
FT                   /translation="MKRIASVLATATALTFVSIAPASAWGVEGHGIVGDVAAARLSPTA
FT                   SAEVAKLLQGEPNPTLAGVASWADEYRSTPDGAATAPWHFVNIAENDCVYAPEINGSGG
FT                   ANVIETIRNQSAILADKAKPADQRRDALKFLVHFVGDIEQPMHTGYAKDRGGNSVKLTY
FT                   NGRSTNLHAVWDSGLLDGSSAARVAALPAPQPGSTDPAQWAQESCRIAVGAYPSSSVIG
FT                   ADYTAKYRPVAEAQLRLAGERLGRLLTDTLG"
FT   gene            complement(519886..521034)
FT                   /locus_tag="Tpau_0492"
FT   CDS_pept        complement(519886..521034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0492"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein; globin;
FT                   KEGG: mkm:Mkms_0481 oxidoreductase FAD-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77133"
FT                   /db_xref="GOA:D5US66"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D5US66"
FT                   /inference="protein motif:PFAM:PF00175"
FT                   /protein_id="ADG77133.1"
FT                   /translation="MGSHSRHGLTQIAADLRPVSDDFTKRLFARLFALDPSLRELFPAS
FT                   MSSHREVFFRVLDHVFSAIPEADEHDELIEFLAQLGRDHRKYGLTEAHYTTMATALSAE
FT                   VRALYQPHGGLDAEDSAVLDQAVQMMTGVMRGGAHSDPTPARRSAEVVEVLRPHPGLTV
FT                   VRLIAEQPLLFRPGQYVETQIPQVPRQWRPFSLAMPPNTQGQMEFHVRAVPGGDLSSTI
FT                   HSETRPGDRWQFGQVHGLMRADGARPVTLIAGGTGLAPMKSILLAMAASAHNPETHLVM
FT                   GARSPGQLYDAESLAMLAATNPWLRITQVTDARRDPWWLTTPAPPARGLPLRHGSVVEA
FT                   MRALDLRGHRVLIAGPAGLVHAARNTALSAGAEPDQVLHDPI"
FT   gene            521301..522185
FT                   /locus_tag="Tpau_0493"
FT   CDS_pept        521301..522185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0493"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   ach:Achl_2886 lipolytic protein G-D-S-L family"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77134"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:D5US67"
FT                   /inference="protein motif:PFAM:PF00657"
FT                   /protein_id="ADG77134.1"
FT                   /translation="MAGLPGRKNLRRWGYGLALGVGIGLAPFAAANAAAEPAPAIADAP
FT                   APKAPAATTLAATKIAVLKDAAPAAAHQAAAPAAAAAAPSAHLPAARTVAQREYVQRPA
FT                   VQRPVEARSQAKQQRPADRRPIVVIGASISTGYGVSKTAAYPSRVSAETGRPVYVSAKT
FT                   GAGYADGSIARLATAAKLPARNPGLVVLQAGSNDVGASDAAIAGQVRQVVGTVRAQAPN
FT                   ARIAVVTVFPSVHSGPAANRTDATIIGAARSVDPSVAVISPLGEGWEYPAQKDGHPAAA
FT                   AHAQIADRISALA"
FT   gene            522331..524871
FT                   /locus_tag="Tpau_0494"
FT   CDS_pept        522331..524871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0494"
FT                   /product="ATP-dependent chaperone ClpB"
FT                   /note="TIGRFAM: ATP-dependent chaperone ClpB; PFAM: ATPase
FT                   AAA-2 domain protein; Clp ATPase-like; AAA ATPase central
FT                   domain protein; Torsin; ATPase associated with various
FT                   cellular activities AAA_5; Clp domain protein; KEGG:
FT                   rha:RHA1_ro05514 ATP-binding subunit of heat shock protein
FT                   ClpB; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77135"
FT                   /db_xref="GOA:D5US68"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:D5US68"
FT                   /inference="protein motif:TFAM:TIGR03346"
FT                   /protein_id="ADG77135.1"
FT                   /translation="MDSFNPTTKTQAALTSALQAASAAGNPEISPAHLLVALLDQTDGI
FT                   AAPLLKAVGVDPVTVRNRAQELVDRKPKASGSTTQPQLSRESLASITAAQKLATEMGDQ
FT                   YVSTEHVLYGLSEAAQVLGNAGATPQAIQEAFTAVRGSAKVTSQDPEGQYQALEKYSTD
FT                   LTARAREGKLDPVIGRDNEIRRVVQVLSRRTKNNPVLIGEPGVGKTAIVEGLAQRVVTG
FT                   DVPESLRGKTVISLDLGSMVAGAKYRGEFEERLKAVLDEIKASSGQIITFIDELHTIVG
FT                   AGATGDSAMDAGNMIKPMLARGELRLVGATTLDEYRQYIEKDAALERRFQQVLVGEPSV
FT                   EDTIGILRGLKERYEVHHGVRITDSALVSAASLSDRYITSRFLPDKAIDLVDEAASRLR
FT                   MEIDSRPEEIDAEERIVRRLEIEEMALSKETDAASVDRLEKLRGELADHKEKLAQLTSR
FT                   WQNEKGAIDSVRTLKEQLENLKGESDRAERDGDLGRAAELRYGQIPALEKELDEAVAAS
FT                   GAASDGEVMLKEEVGPDDVADVVSSWTGIPAGRMLEGETAKLLRMESEIGKRVIGQEAA
FT                   VEAVSDAVRRTRAGVADPNRPTGSFLFLGPTGVGKTELAKGLAEFLFDDERAMVRIDMS
FT                   EYGEKHSVARLVGAPPGYVGYEAGGQLTEAVRRRPYTVVLFDEVEKAHPDVFDVLLQVL
FT                   DEGRLTDGQGRTVDFRNTILILTSNLGAGGDKDHVMNAVRAKFKPEFINRLDDVLIFDS
FT                   LDSGQLTGIVDIQLDQLRKRLSQRRLDLQVSDEAKGWLAERGFDPLYGARPLRRLVQQS
FT                   IGDQLAKALLAGDVRDGDPVKVTVSEDGDRLIIN"
FT   gene            524969..526006
FT                   /locus_tag="Tpau_0495"
FT   CDS_pept        524969..526006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0495"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: hypothetical
FT                   protein ; K08726 soluble epoxide hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77136"
FT                   /db_xref="GOA:D5US69"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5US69"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADG77136.1"
FT                   /translation="MTITPHTVRTERHTTGYLASGPEDGPLLVFCHGWPELSYSWRHQL
FT                   TALGGLGFRCIAPDMRGYGASSVPAAKDAYRREEIVADMLELLAGVGREAAIWIGHDWG
FT                   APVVWNIATHHPGVVDAVASLNVPHFPSGGPGPVDLIDREKYPADEYPYGQWDYQVHYL
FT                   KHFDEVTAQFESDIPHFIAALFRVGEPSHLDRPAPTAVVSRNGGWFGGGAVPRVPIDPA
FT                   VLTTEDHAVYTAAFERNGMAGPNSWYVNGAADAEYAARELNHGRIDVPVLFLHGRYDAT
FT                   LETVRSSLADPMRAACANLTEVILDCGHWTAEEKPAEVSASLARWIATRVPGRWPAPAE
FT                   NHPAG"
FT   gene            526026..526406
FT                   /locus_tag="Tpau_0496"
FT   CDS_pept        526026..526406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0496"
FT                   /product="PPOX class putative F420-dependent enzyme"
FT                   /note="KEGG: rha:RHA1_ro00170 hypothetical protein;
FT                   TIGRFAM: PPOX class probable F420-dependent enzyme; PFAM:
FT                   pyridoxamine 5'-phosphate oxidase-related FMN- binding"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77137"
FT                   /db_xref="GOA:D5US70"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019965"
FT                   /db_xref="UniProtKB/TrEMBL:D5US70"
FT                   /inference="protein motif:TFAM:TIGR03666"
FT                   /protein_id="ADG77137.1"
FT                   /translation="MSAATVGSVADAKYVMLTTYRKDGSAVSTPLWAVRDGADLVMWTV
FT                   TDSWKVKRIRKNPAVLVQACDVRGKKTEGPQVAGVAEIVDGADAGQRIQRKYGILGFLT
FT                   VAGSKIRRGQGGTVGIRVRDAS"
FT   gene            526499..527356
FT                   /locus_tag="Tpau_0497"
FT   CDS_pept        526499..527356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0497"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mjl:Mjls_0128 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77138"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D5US71"
FT                   /inference="similar to AA sequence:KEGG:Mjls_0128"
FT                   /protein_id="ADG77138.1"
FT                   /translation="MRPTDVGIRSGDLVATATSHEIRTRYRQVYRGVRLPAGAVVGLVE
FT                   RIEAALLLYPHAVLCGWTAAALHGAGYTAGRPIEIWLPARRVRAGIVVRCGAMPDEDVV
FT                   VREAFPLTTGVRTAIDVVRYAEGDDAVAALDQCFRLDGYGRSVTSRDAVVDYLERHHNL
FT                   HRSTRVVRALRWADGRAESPPETFTRLLLHRAGLSMFVPQVPVDGGRFRLDLAAEEFQV
FT                   AVEYDGRDHSDPAQQSLDIARRNTLRHDYGWEVLPITASILRNGREAFLRQTRAALRDR
FT                   GWRG"
FT   gene            complement(527416..528567)
FT                   /locus_tag="Tpau_0498"
FT   CDS_pept        complement(527416..528567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0498"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; 3-
FT                   dehydroquinate synthase; KEGG: tfu:Tfu_2801 glycerol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77139"
FT                   /db_xref="GOA:D5US72"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:D5US72"
FT                   /inference="protein motif:PFAM:PF00465"
FT                   /protein_id="ADG77139.1"
FT                   /translation="MSDTVSTAIFASPSRYVQGRGALDALGEHVAKLGGTPLIVSDDTV
FT                   WGIVQDGVTASFDAAGLPVTRVPFKQFATPAAVDDLVATIGSGGHDVILGVGGGSAIDA
FT                   AKAAGHLAGIRWVSVPTAASSDAPTSTLAVIYTETGEFLEYRFFPRNPDLVLIDTQLVA
FT                   NAPVSLLVAGIGDALATWIEARATRRGRGSTMAGGRPTRAGTALAELSWDILWENAELA
FT                   IDAVRSKVVTPALEAVVEANTLLSGLGFESGGLAAAHAIHNGLTAAPQTHGLTHGQKVN
FT                   IGSITQLVLEGAPSVEIEDFVEFTTAVGLPNSLTEIGLTPDDTPELQAIAEAATAAAET
FT                   IHNLPSPVTPAQVVDALKAIETISRRVRIERGLPEPVKYVAKH"
FT   gene            complement(528633..528905)
FT                   /locus_tag="Tpau_0499"
FT   CDS_pept        complement(528633..528905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77140"
FT                   /db_xref="GOA:D5US73"
FT                   /db_xref="UniProtKB/TrEMBL:D5US73"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77140.1"
FT                   /translation="MTGPAPSSLAAERTQLARIRTLVALILVAALVGRLAMTARPLVAL
FT                   PVLAVVVVVVTLAFRLGRAPAGAGRALILSGAVVTLATVAAVSAL"
FT   gene            complement(528902..529288)
FT                   /locus_tag="Tpau_0500"
FT   CDS_pept        complement(528902..529288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0500"
FT                   /product="protein of unknown function DUF202"
FT                   /note="PFAM: protein of unknown function DUF202; KEGG:
FT                   mlu:Mlut_04300 predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77141"
FT                   /db_xref="GOA:D5US74"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:D5US74"
FT                   /inference="protein motif:PFAM:PF02656"
FT                   /protein_id="ADG77141.1"
FT                   /translation="MTPASVVAVRNLWPPRELTEGESPDARFTLANERTFLAWIRTALG
FT                   LVAAAVGLEAFAPDVVPAAVRTPLVVILLVVAAGLAGYAFRRWLSVEGAMRTGRPLRGS
FT                   PATVVLAAVIAVTGLILAATIAFT"
FT   gene            529410..529856
FT                   /locus_tag="Tpau_0501"
FT   CDS_pept        529410..529856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0501"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nfa:nfa54010 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77142"
FT                   /db_xref="GOA:D5US75"
FT                   /db_xref="UniProtKB/TrEMBL:D5US75"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77142.1"
FT                   /translation="MGGETRSRGPWLATVLSLLGIGVVGAGLAYSLHIASELGSVRRDA
FT                   APAVSSGVPVNQKVSGVAITPGREVIGAILSIDASALTVSSAPGGNTVDLRTDENTQVT
FT                   TTHGSKLTDLKVGDVVIIQVSADGETALAIYAGQISVAGTPSVG"
FT   gene            529889..530581
FT                   /locus_tag="Tpau_0502"
FT   CDS_pept        529889..530581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0502"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro05516 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77143"
FT                   /db_xref="UniProtKB/TrEMBL:D5US76"
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro05516"
FT                   /protein_id="ADG77143.1"
FT                   /translation="MSYVVFLILAVVCAALAAALVWYDRNHTPNVHSERAAWATSREFV
FT                   YRPSDESLRDEFHRGGMVMPGDPPVVDVAHGTYFGANAYVFDLAESATIAAVHRGSASG
FT                   ALMDLRPENAHPPVEAGMEPLGALGTRILYTNNADVARRVADRRMITFAEQVPAHIESL
FT                   WNEGPWTLGQMPLTDDPDDLDEALEAVRRFGDLLRVLPPEGHARVVTSGGPRDPGQPVP
FT                   VRGKEARR"
FT   gene            530578..531141
FT                   /locus_tag="Tpau_0503"
FT   CDS_pept        530578..531141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0503"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="TIGRFAM: orotate phosphoribosyltransferase; KEGG:
FT                   rop:ROP_55920 orotate phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77144"
FT                   /db_xref="GOA:D5US77"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D5US77"
FT                   /inference="protein motif:TFAM:TIGR00336"
FT                   /protein_id="ADG77144.1"
FT                   /translation="MTGPGAAATVDQAAKARLAELVRELAVVHGKVTLSSGIEADYYVD
FT                   LRRATLHHEASPLIGALLRELTADWDYAAVGGLTLGADPVATAVMHAPGRSIDAFVVRK
FT                   AAKAHGMQRQIEGPDVVGKRVLVVEDTTTTGNSPLTAVRALRDIGADVVGVATVVDRET
FT                   DAAKVIAAEGLEYRSVLGLADLGL"
FT   gene            531138..531836
FT                   /locus_tag="Tpau_0504"
FT   CDS_pept        531138..531836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0504"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   rop:ROP_56060 putative RNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77145"
FT                   /db_xref="GOA:D5US78"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D5US78"
FT                   /inference="protein motif:PFAM:PF00588"
FT                   /protein_id="ADG77145.1"
FT                   /translation="MTDPDAAAGAEAGPTEWITGVAGPHTVGLGPWEQEHPGVPLPVDP
FT                   RYDPDLLAQGDRRNVVDAYRYWTREAIVADLDSRRHPFEVAIENLGHDANIGTVVRTAN
FT                   AFGARTVHIVGRRRWNRRGAMVTDRYQHVQHHPDAESFAAWCAEHDLPIVAVDNQPGSV
FT                   PLERGSLPRRCVLLFGQEGPGVSGDARRVAGTTVSIAQFGSTRSINVGVAAGIAMHAWV
FT                   REHADLDAAW"
FT   gene            531924..533045
FT                   /locus_tag="Tpau_0505"
FT   CDS_pept        531924..533045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0505"
FT                   /product="alpha-1,6-mannanase"
FT                   /note="KEGG: rha:RHA1_ro05531 alpha-1,6-mannanase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77146"
FT                   /db_xref="GOA:D5US79"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR014512"
FT                   /db_xref="UniProtKB/TrEMBL:D5US79"
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro05531"
FT                   /protein_id="ADG77146.1"
FT                   /translation="MTTAVEWNQRAAAAQSAVVDRHVRPVWGIPGTRLGVPAYPPTRRD
FT                   ALLLSWNYWWQAHLLDVSVDAYIRDGAPSTRTLVVQLARGHRLRNLLRVTNSYYDDMAW
FT                   MGLALERAQRYAGVDAARRLRTLTDTFMKAWVPEAGGGIPWRTTGLFLNTPANGPAGIY
FT                   LARMGQTERAEQTADWIYRRLLDPETGLINDGVDGSYDDPENGKLYPEKYTYCQGVTLG
FT                   LDTELSADGDPRHAQRVARLIDAVSRRMTQGRVIAGGDGGDGGLFNGILIRYLALAAVQ
FT                   LRGGPGTDDVRDAAAEIVLASAEAAWRGAREVDGKVLFSADWTRDARIPGSTGQAAYFT
FT                   GGTVRSSETPERDLSVQIGGWMAMEAAAALARA"
FT   gene            533263..535311
FT                   /locus_tag="Tpau_0506"
FT   CDS_pept        533263..535311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0506"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cai:Caci_6901 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77147"
FT                   /db_xref="UniProtKB/TrEMBL:D5US80"
FT                   /inference="similar to AA sequence:KEGG:Caci_6901"
FT                   /protein_id="ADG77147.1"
FT                   /translation="MTVPVESPDLVWPLAGGRVRIDGETGSPVDFVHDQYPEVKYLLDD
FT                   SVDTWHSSEHRWGSGFVITPERGFRWNVPDRLVMREDSSVATFDLGGGLDLVVERRAGA
FT                   GLSERYTFRNRTDDELMLGSIGITVPFRDVYEDAEISLDRGVHAHVWPGGANSWVIAEP
FT                   MSGSRAALSLSTTEGELRAYSIDSRNQFTSSNVRGHIVVHPTDAARNPSAFGGQEQVVI
FT                   SPGGEWTIAWTVRWHESREAAFDAVAPSWSLDRYAAPIGEPITVRGSDSVRASAGVVVA
FT                   RGAEGATVTSEASGVQYIEIGRSQAAVLFHRPVRDIVTRRIGFIIERQRAVERGGIDAH
FT                   AFVPYDCRAGLTRSTCGWPDWSDGAERLAMPTLIQQARRRGWVGAEVDDVLHDWADFAR
FT                   ERLLDPSGAPLWGSVTHHSETRLYNAPWLVQFFADQFQIYARREDLDSAVRILERSIEL
FT                   GAESHLSIGHPEATLFVCELLDAADEHEDAEGFRQHLVASARHFAELGTRLPNHEVRYE
FT                   QSMVAPLVTLYAAALRIAPDQVAIRRRLPEAVRWMMAFGGRQPHVRLHEISIRHWDGYW
FT                   FGKNRQWGDVFPHHWSVLTAIALMQLASADRPRNSVDTATAIFAANLASFFDDGSATAA
FT                   FVLPSTVDGVPAYRADPLANDQDWALTLLLRTGLVDEKGVGLRAPAE"
FT   gene            complement(535339..536988)
FT                   /locus_tag="Tpau_0507"
FT   CDS_pept        complement(535339..536988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0507"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: rer:RER_45590 ABC transporter ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77148"
FT                   /db_xref="GOA:D5US81"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5US81"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG77148.1"
FT                   /translation="MTVLQARDLSVAYADRSLFSGLDLVIAPGDVVGLVGANGAGKSTL
FT                   LALLAGLHADGGPEVTGTVEKSPADAQVGYLAQEPERRPGETVAQFVARRTGVAAAEAE
FT                   MNAAAEALAVDPAEDRYTPALDRWLALGGADLDQRLTTILSEVGLPDPEAEMTGLSGGQ
FT                   AARAGLAAVLASRYDVLLLDEPTNDLDLAGLELLERFVVSSSAATALVLVSHDREFLAR
FT                   TVTTVVELDLAQQQIGVYGGGYEAYLVERDVARRHAREEYEQYAGKLSDLQDRAQMQRN
FT                   WMEHGVRNARRKMKNGDPDKAGRKARLESTEKQASKARQTERAIERLEVVEEPRKEWEL
FT                   RMEIAAAPRSGTVVATLSGATVRYPQLTVGPITAAVEYGDRILLTGPNGAGKSTLLALL
FT                   LGRRAPSAGTATLGSGVEIGEIDQARGRFLGDDALLDAFCAEVPETSPADVRTLLAKFG
FT                   LRGHHVLRPAASLSPGERTRAALALLQARGVNLLVLDEPTNHLDLPAIEQLEQAVESFD
FT                   GTVILVTHDRRMLDTVRATRRWRMEAGHMHEG"
FT   gene            complement(536988..537623)
FT                   /locus_tag="Tpau_0508"
FT   CDS_pept        complement(536988..537623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0508"
FT                   /product="SNARE associated Golgi protein-related protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   rha:RHA1_ro05534 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77149"
FT                   /db_xref="GOA:D5US82"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:D5US82"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ADG77149.1"
FT                   /translation="MLEFVQNAGPVMIWLVVAGFVFAECAFIIGLFLPGDSLLLTAGLA
FT                   MATTGHSAASVWGLALAAFLAAIAGNHVGYGIGEKMGDHVLAKQDGRYLNAHNLHRVKE
FT                   LMDKHGFFSVLIARWIPWVRTLCPLVAGAVGMDKRKFTIASVLGSLIWAPFLLLVGYYA
FT                   SSALQDYKWVLDWALRGMIVMLVVGTVVGIIGYRREMAKPNVSVDLED"
FT   gene            complement(537632..538351)
FT                   /locus_tag="Tpau_0509"
FT   CDS_pept        complement(537632..538351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0509"
FT                   /product="SNARE associated Golgi protein-related protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   rer:RER_14110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77150"
FT                   /db_xref="GOA:D5US83"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:D5US83"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ADG77150.1"
FT                   /translation="MYFTDLTLATSTTLQAFSISDITDPVAVLNAFGPIALVGLLLVVF
FT                   IESGVLFPVLPGDSLLFVAGLLTAAGTGAAVGEATYTGSAMSLPVLLIGVPIAAILGSQ
FT                   VGYFIGRFGGEKLFKPDARFLKTKYLDESHEFFEKYGPATLVLARFVPFVRTFAPVAAG
FT                   AAHMNYVKFVIWNAIGAIIWGDGILLLGVWLGQIDWVRDNIDKIFIGIVLVSVLPIVWG
FT                   VAKKYLSDRRANSSASA"
FT   gene            complement(538370..540241)
FT                   /locus_tag="Tpau_0510"
FT   CDS_pept        complement(538370..540241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0510"
FT                   /product="Na+/H+ antiporter"
FT                   /note="KEGG: art:Arth_3572 Na+/H+ antiporter; TIGRFAM:
FT                   Na+/H+ antiporter; PFAM: sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77151"
FT                   /db_xref="GOA:D5US84"
FT                   /db_xref="InterPro:IPR001607"
FT                   /db_xref="InterPro:IPR004705"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:D5US84"
FT                   /inference="protein motif:TFAM:TIGR00831"
FT                   /protein_id="ADG77151.1"
FT                   /translation="MELAVGLVALVATVLVVSAFCDRLGLAAPLVLTVIGIAASFVPAI
FT                   PDVPLHPDVVLLGLLPPLLYAAASRASLVDFKANIKPIGMLSVGLVLFTAAAVGVVTSW
FT                   LLDIPFAAGLALGAIVGPPDAVAATAVGRRIGLPRKVTTLLEGESLFNDATSIVLLRTA
FT                   IAAVAGTIGFWQVLGSFALSAVGGVVVGVIAAMLIRFALRRLTDPVLTTGITLISPWIA
FT                   YLPAEHIHASGVVAVVVAGLIVGYKAPTDQTAVGRMSARINWSTVQFLLENAVFLLIGL
FT                   QMRTIFEGADASPIGWPLILTTCAAVMITVILARMVFCAPAALIAVRVDETAERLNVGE
FT                   LTVLSWAGMRGVVTLAAAFILPLDFPDREVLLFAAMTVVAGSLLIQGSTLPALARALHV
FT                   RGPNARSDALQQAVVMRSAINAGLERLDQIEASPKNSVPGPVIDGIRERAISRERSFWE
FT                   RLGPDAHDTPAAQVREVRLQMLDAERAEVLRLRDSGQGDHEVLEQVLSMLDVEEAMLTV
FT                   SANRSERVAVAELLTPPWSSDECDHLRVSDSFGDPVPLSENCLECVAAGENPVALRLCL
FT                   TCGHVGCCDSSEGKHATAHHELTNHPVIRSFQPGESWRWCYIDELLK"
FT   gene            540292..541320
FT                   /locus_tag="Tpau_0511"
FT   CDS_pept        540292..541320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0511"
FT                   /product="fructose-bisphosphate aldolase, class II"
FT                   /note="KEGG: rha:RHA1_ro05536 fructose-bisphosphate
FT                   aldolase; TIGRFAM: fructose-bisphosphate aldolase, class
FT                   II; ketose-bisphosphate aldolase; PFAM: ketose-bisphosphate
FT                   aldolase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77152"
FT                   /db_xref="GOA:D5US85"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5US85"
FT                   /inference="protein motif:TFAM:TIGR01520"
FT                   /protein_id="ADG77152.1"
FT                   /translation="MPIATPEAYREMLDRARKGGYAFPAINCTSSETINAAIKGFADAG
FT                   SDGIIQFSTGGAEFGSGLGVKDMVTGAVALAEFAHVVAAKYDVTVALHTDHCPKDKLDG
FT                   LVRPLLEISQERVNNGQNPLFQSHMWDGSAVPLEENLEIAQELLAKCKAANIILEIEIG
FT                   VVGGEEDGVENEINDKLFTSNEDFAKTVDALGTDGYLLAATFGNVHGVYKPGNVKLRPS
FT                   VLRDGQAVAAQKQGLPEGSKPFSFVFHGGSGSLKSEIEESLSYGVVKMNVDTDTQYAFT
FT                   RPVAGHMFSNYDGVLKIDGEVGNKKTYDPRSYLKKAETSMAERVVEACNDLHSAGKSIS
FT                   AK"
FT   gene            541374..541706
FT                   /locus_tag="Tpau_0512"
FT   CDS_pept        541374..541706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0512"
FT                   /product="malto-oligosyltrehalose trehalohydrolase"
FT                   /note="KEGG: bvi:Bcep1808_5810 malto-oligosyltrehalose
FT                   trehalohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77153"
FT                   /db_xref="GOA:D5US86"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D5US86"
FT                   /inference="similar to AA sequence:KEGG:Bcep1808_5810"
FT                   /protein_id="ADG77153.1"
FT                   /translation="MTAAAAHSGPVSRGRALRGVAAGAGVAGSGAGAGAGAGAGAGCRG
FT                   AGACGCAGRIMVSALGAIGRCGPGCPGLAGLRGVRGGGTIRDEPRLICSVCDGACGWSG
FT                   VGGSSE"
FT   gene            complement(541855..543582)
FT                   /locus_tag="Tpau_0513"
FT   CDS_pept        complement(541855..543582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0513"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rop:ROP_56120 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77154"
FT                   /db_xref="GOA:D5US87"
FT                   /db_xref="UniProtKB/TrEMBL:D5US87"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77154.1"
FT                   /translation="MARDSYRRAFSRVRDQVAPRVSEGAKNAYTAYRNYRQSREANRPD
FT                   VRAASTAGSLGSAPGDAVTPSHSDSLAELVEQAAPPAAPSEAETTAFAATPKDDTATSK
FT                   TVGASDAETRVIPVAQRGGADADEAPADDAETPADADEDRTESGPAAPSEAETRAFAVV
FT                   QRDAVESPSDDATDDATDTPDEAASDEETAADASPSPLRTVGPVATTPPVEEGTDADSG
FT                   EADADAGDAPDDEAPADEADTEPDEDTAVDDEAATTEESGDDDAAPDDETTPEPAAPSP
FT                   LRTVGPTATAPPAADTPASDDADEADEVGAADEGEDSDDEPATEVIAVADTVSQDDADT
FT                   DADAATEAIPVAAPSNPDQAAIDTEQNELPDATPATETIPLTGAAAAAAAAAPTHQAPA
FT                   LPADNPTERSVPEYYAPTTQRPLPEQSGGNRWKWIAAGVVVVIAAIVGIVLLVSGGAGG
FT                   ADQTDPRVQAATSTTDFVGAINSGDLNALRAQTCGAAKQYYDRISTDEYQRVHDNAKAD
FT                   GLLPELDGLQAIDVNGDRAEVQVEVHYTGQPDAKVKNTLTLAKDEAGAWKVCTKMGDQ"
FT   gene            543687..544106
FT                   /locus_tag="Tpau_0514"
FT   CDS_pept        543687..544106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0514"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mav:MAV_4783 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77155"
FT                   /db_xref="InterPro:IPR014487"
FT                   /db_xref="UniProtKB/TrEMBL:D5US88"
FT                   /inference="similar to AA sequence:KEGG:MAV_4783"
FT                   /protein_id="ADG77155.1"
FT                   /translation="MTSFGDLLGPPPVLLDLDEEPELQLTKGRPAAEVAADFPTSSLAW
FT                   ATLAEAALADDQPVAAYAYARTGYHRGLDQLRRQGWRGFGPVPYSHENNRGFLRAVAAL
FT                   ARAATTIGEEDEYLRCLDLLNDSDPEAAGQLGLGD"
FT   gene            544066..545232
FT                   /locus_tag="Tpau_0515"
FT   CDS_pept        544066..545232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0515"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rer:RER_14150 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77156"
FT                   /db_xref="GOA:D5US89"
FT                   /db_xref="UniProtKB/TrEMBL:D5US89"
FT                   /inference="similar to AA sequence:KEGG:RER_14150"
FT                   /protein_id="ADG77156.1"
FT                   /translation="MTPKPPASSASATSRLRRRHNALPEVIQSRTRRLWSSKLPILQCA
FT                   LAAGLAWYIAKDVVGHVSPFFAPIAAVISLGLSLNQRLRRSLELVGGVTVGIGVGDLLV
FT                   SQIGTGPWQLALVVAIAMSVAVLADRGPLVPMQAASSAVLIATLLPPGSAASWNRMLDA
FT                   LIGGLVGVIIAALIPNNPARRPRKDAAKVLDTMRRVVASIAAGLTDGDRASLDWALETA
FT                   RSTQPDLDQLTADLAGGIEIAKVSPVFWSSRGRMDRLQAIADPLDNAVRNVRVMARRAI
FT                   ASNQEAEKIDPALVTEIGRLAESFKTLRDVVLADPGAKPDQADAARVLRSAARRANELD
FT                   IGDGAPLNEVVIYAQLRSTIVDLLQVAGLKRTSAIAVLRARPTPEQPR"
FT   gene            complement(545237..545872)
FT                   /locus_tag="Tpau_0516"
FT   CDS_pept        complement(545237..545872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0516"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa53740 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77157"
FT                   /db_xref="UniProtKB/TrEMBL:D5US90"
FT                   /inference="similar to AA sequence:KEGG:nfa53740"
FT                   /protein_id="ADG77157.1"
FT                   /translation="MSSVTQSTVVLRAPDVRIPAGLRDLETVTVDLDSVKAELKRKMPY
FT                   PRRLIVAGPDELLAAVIARLLAAERLDVEVAFAPTENSRASAIYPPGDPLTGVPRSVPL
FT                   IRDDRGFVLVGQARITGPDGGPLTGETFVDSEKLFTGQAKAIIVEPTGSGAGVRARLAK
FT                   GMRRKWLSGRAAQTGGLELVVTRDGRTDPSVVTRSTFYRHTDDWLLIS"
FT   gene            545957..547243
FT                   /locus_tag="Tpau_0517"
FT   CDS_pept        545957..547243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0517"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="SMART: adenylosuccinate synthetase; TIGRFAM:
FT                   adenylosuccinate synthetase; KEGG: rha:RHA1_ro05551
FT                   adenylosuccinate synthetase; PFAM: adenylosuccinate
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77158"
FT                   /db_xref="GOA:D5US91"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:D5US91"
FT                   /inference="protein motif:TFAM:TIGR00184"
FT                   /protein_id="ADG77158.1"
FT                   /translation="MPAIVLIGAQWGDEGKGKATDLLGEKLQWVVRYQGGNNAGHTVVL
FT                   PNGDKFALHLIPSGILTPGVKNVIGNGVVVDPSVLLQELDGLEARGVDTSNLLLSADAH
FT                   LLMPYHVAIDKVTERFLGNKKIGTTGRGIGPCYQDKIARVGVRAQDVLDESILTQKVEA
FT                   ALEFKNQVLTKIYNRRALDPRQVVDETLELAESFKHRIADTRLELNKALERGETVLLEG
FT                   SQGTLLDVDHGTYPFVTSSNPTSGGASVGSGIGPTRITTVLGILKAYTTRVGSGPFPTE
FT                   LFDEWGEYLAKHGGEVGVTTGRARRCGWFDAVIARYATRVNGITDYFLTKLDVLSSIEN
FT                   VPICVAYEIDGVRYDEMPTTQSQVHHATPIFETMPGWWEDISECRTFEELPKNAQNYVL
FT                   RLEELSGAHISCIGVGPGRDETIVRRPIV"
FT   gene            547457..549109
FT                   /locus_tag="Tpau_0518"
FT   CDS_pept        547457..549109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0518"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_6766 PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77159"
FT                   /db_xref="UniProtKB/TrEMBL:D5US92"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77159.1"
FT                   /translation="MKLKSIRSGALTSVLAVATVVGVVGAQLAVPPTAERSSPGVEYVL
FT                   TAGDPSDGSASSGSDSSGSGSAAGESNDAPTAAGSASGTETGSPTATDTAAEKSGTAGT
FT                   ATGAQTTGTASAGTANGAAATGTQTTGTATGSAPEQPTATTTPTGTTEAAPTTAVAPAT
FT                   TQAGTAAPSAAVVPSATAPSATASSEPSPSGASTSATATPKTATGQSDAQQPTVAPSAS
FT                   PRTDTASPGGDTTVPAAPSSPFVQLARDIGGALGGLIGTGTGGLVGVVGGADFATPART
FT                   LGSSIGSAIAAVAAGAAEGAASELLGWNHGLDLIGGGLGIAGATVKGAATELGRSLPGL
FT                   GGAVLTSAEQVVVPLSKTVAGATGTAVGGAIGTSLAAVASAAATATGVGVVLVPFLAAG
FT                   LPYAGARIGGSIGGVVGDVVGDALTGGFRGAAAGGGIGGIIGGAYDSATTGTPLLAALR
FT                   ASAEAGLQGAASAGPAGAVVGAATGFPSLGAAIGELIGKVGASPFDVPGLPRIVGPTAE
FT                   LLGRTIGGGIGGAANLAIGTIGGLIGVTLGKDK"
FT   gene            549109..549738
FT                   /locus_tag="Tpau_0519"
FT   CDS_pept        549109..549738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0519"
FT                   /product="Lipoprotein LpqT, predicted"
FT                   /note="PFAM: Lipoprotein LpqT, predicted; KEGG:
FT                   mjl:Mjls_5766 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77160"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="InterPro:IPR019674"
FT                   /db_xref="UniProtKB/TrEMBL:D5US93"
FT                   /inference="protein motif:PFAM:PF10738"
FT                   /protein_id="ADG77160.1"
FT                   /translation="MRRTLFALLTTAAVLVAAGCSGSSDEAPATTTTAATDMTLDEYLK
FT                   SHGVAVVAQTAADLKGVRIAVQQPPNWFVDSAFQLPNTFAVIADTRATSEGFTPNATVL
FT                   VHRLTGDIDPAEAVRRGPVDTTRYPGFRQDSVQIGTRDGDPSSTIRGSYDDGKGRRLAV
FT                   SSTYVIHSGAQQRLAVQLLVTTTEKQAQTLRGDVQTLVEGLKITDV"
FT   gene            549786..550460
FT                   /locus_tag="Tpau_0520"
FT   CDS_pept        549786..550460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0520"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: cai:Caci_5788 two component transcriptional
FT                   regulator, winged helix family; PFAM: response regulator
FT                   receiver; transcriptional regulator domain protein; SMART:
FT                   response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77161"
FT                   /db_xref="GOA:D5US94"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D5US94"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADG77161.1"
FT                   /translation="MRVLVVEDELFLAEAVRDGLRLEAIAADIAGDGDTALEMLSVNSY
FT                   DIAVLDRDIPGPSGDEIAANIVASGTGMPILMLTAADRLDDKESGFELGADDYLTKPFE
FT                   LRELVLRLRALDRRRAHSRPPVREIAGLRLDPFRREVFRNGKYVALTRKQFAVLEVLVA
FT                   AEGGVVSAEELLERAWDENADPFTNAVRITVSALRKRLGEPGIVATVPGVGYRIDAGAC
FT                   DD"
FT   gene            550453..551580
FT                   /locus_tag="Tpau_0521"
FT   CDS_pept        550453..551580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0521"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: fre:Franean1_7134 integral membrane sensor
FT                   signal transduction histidine kinase; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; histidine kinase HAMP region domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; histidine
FT                   kinase HAMP region domain protein; histidine kinase A
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77162"
FT                   /db_xref="GOA:D5US95"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5US95"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADG77162.1"
FT                   /translation="MTRPPGLSARLKLTLSYAGFLMVAGGLLLAVVWVFLLRYVPEVIA
FT                   VPDLGPREPGSGAGPQLMGIPNRADLQAAFAPKATLVLGLLLIFGLVGGWLLAGRMLAP
FT                   LNRITHATRLAAEGSLAHRIHLEGRADEFRELADAFDAMLARLEAHVAEQQRFAANASH
FT                   ELRTPLAITQTLLDVARSDPERDDDELVSRLQFVNARAIDLTEALLLLSRADRRSFTRE
FT                   SVDLSLIAEEAVETLLPLAEGRGVVLEAVGGLTPTTGSPALIQQVATNLVHNAIVHNLP
FT                   GGGTVRVRTETVADGAQLTVENTGAPLSPQVVATLTEPFQRGTGRISGGHAGVGLGLAI
FT                   VDRIVRAHDGALTLTPRPDGGLRVTVRLPAATGSP"
FT   gene            complement(551638..552270)
FT                   /locus_tag="Tpau_0522"
FT   CDS_pept        complement(551638..552270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0522"
FT                   /product="D-Ala-D-Ala dipeptidase"
FT                   /EC_number="3.4.13.22"
FT                   /note="KEGG: cai:Caci_5792 peptidase M15D VanX D-ala-D-ala
FT                   dipeptidase; PFAM: peptidase M15D vanX D-ala-D-ala
FT                   dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77163"
FT                   /db_xref="GOA:D5US96"
FT                   /db_xref="InterPro:IPR000755"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:D5US96"
FT                   /inference="protein motif:PRIAM:3.4.13.22"
FT                   /protein_id="ADG77163.1"
FT                   /translation="MNTDFVYVDEHVPGVRWDAKYATWDNFTGKPVDGYLANRIVGTRV
FT                   LCAGLRLAQRHAATLGYGLLLWDGYRPQRAVDRFVAWSRQPENGRTKQRHYPNIARADM
FT                   FELGYVATRSGHSRGSTVDLTLYHLDSGDLADMGGDHDLMDPVSHHGAPGIGEPAARNR
FT                   ARLATIMEDAGFLRYDSEWWHYTLHDEPFPTTYFDFPITLAAGSRAA"
FT   gene            complement(552270..553304)
FT                   /locus_tag="Tpau_0523"
FT   CDS_pept        complement(552270..553304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0523"
FT                   /product="D-alanine/D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="TIGRFAM: D-alanine/D-alanine ligase; KEGG:
FT                   sco:SCO3595 D-alanine:D-lactate ligase; PFAM:
FT                   D-alanine--D-alanine ligase domain protein; ATP-dependent
FT                   carboxylate-amine ligase domain protein ATP- grasp; protein
FT                   of unknown function DUF201"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77164"
FT                   /db_xref="GOA:D5US97"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D5US97"
FT                   /inference="protein motif:TFAM:TIGR01205"
FT                   /protein_id="ADG77164.1"
FT                   /translation="MSRIRIGVLFGGASEEHPVSVKSAREVARNLDPDRYEAHWIGITR
FT                   DGAWRLCAGPENDWESGSVPAMLSPDRGDHGLLVREAGRYRVVELDVILPVLHGRFGED
FT                   GAVQGLCELSGVDYIGCDVPSSAICMDKSLAYVISSAAGIATPEFRIVAGHEAPDPAEL
FT                   AYPVFVKPARSGSSFGVSKVTAPDDLPAAIEAAREYDSKVLIERAVAGSEVGCAVLGDG
FT                   RGLTVGEVDHIALSHGFFRIHQEDSPETGSENSTPIVPADIPAESRARVQQTARAIYRA
FT                   LGCSGLARVDMFLTPGGEVVLNEVNTLPGLTSYSRYPRMMSAAGISLAEVLDRLVCLTR
FT                   TGGS"
FT   gene            complement(553301..554299)
FT                   /locus_tag="Tpau_0524"
FT   CDS_pept        complement(553301..554299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0524"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; KEGG: fre:Franean1_7138 D-isomer specific
FT                   2- hydroxyacid dehydrogenase NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77165"
FT                   /db_xref="GOA:D5US98"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5US98"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ADG77165.1"
FT                   /translation="MTQTTIAPLAARAPRPTGITVYGCADDEAALFRKAAPRWGIPLII
FT                   TELPLSEENVMLAFGRRTISVGHRTPVTHPVLLALSRIGVRYVSTRSAGFDHIDVEYAA
FT                   QLGITVGNVDYSPDSVADYTLMLMLMAIRDAKAVMRRTDSHDYRLSRHRGRELRDLTVG
FT                   VIGAGRIGSAVVERLTGFGCRVLTADTRPGDDHVSLDHLLASSDIITLHTPLTADTHHL
FT                   LDAARIHRMRPGAIVVNTGRGALIDTDALVDALEAGHLGGAALDVLEGEHGIFYTDRRD
FT                   RPVQNSALLRLQHLPNAIISPHAAYFTDHALRDTVHNSLLNCLTFEENENS"
FT   gene            complement(554366..555316)
FT                   /locus_tag="Tpau_0525"
FT   CDS_pept        complement(554366..555316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0525"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: kse:Ksed_20450
FT                   sugar kinase, ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77166"
FT                   /db_xref="GOA:D5US99"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D5US99"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ADG77166.1"
FT                   /translation="MTDRTLCLGEALVDVVLRDGAEPVEHVGGSLFNVACGLAALGDPA
FT                   SILSWWGRDERGARITGAAAGAGVEIVAGTEDAPATPLAYAHLDAEGRASYEFDLQWRV
FT                   PETGDLERYGHLHTGSFAATLGPGADGVRDVAARIRDHATVSYDPNIRPALMGTPAEVL
FT                   PRITELIGLADVVKASDEDISWLHPGEPVEDVMRRWVAAGPALVVVTRGPWGAYALLAG
FT                   NRDMLHVDQLTVEVADTVGAGDSFMAGLISGLLDAGYLGSRYAARRLRGARWSDVQPAL
FT                   HRAVITSALTVSRAGAYGPSMTEVETVRARDTTLR"
FT   gene            complement(555318..556691)
FT                   /locus_tag="Tpau_0526"
FT   CDS_pept        complement(555318..556691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0526"
FT                   /product="sugar transporter"
FT                   /note="KEGG: emi:Emin_0368 sugar transporter; TIGRFAM:
FT                   sugar transporter; PFAM: General substrate transporter;
FT                   major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77167"
FT                   /db_xref="GOA:D5USA0"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5USA0"
FT                   /inference="protein motif:TFAM:TIGR00879"
FT                   /protein_id="ADG77167.1"
FT                   /translation="MKALVIRSAVVASLGGLIFGFDTAVISGAEKQIQELFQLSDAMLG
FT                   FTVTTALIGTIIGALVTGRPADRFGRKKVLYLIGLLYVVGALGSALAGSVEALMLFRFI
FT                   GGLGVGASSVCAPIYTAEVSPPAHRGRLVGLVQFNIVLGILAAYAANAIIRAIDDGPDA
FT                   WRWMLGVMAVPAALFLVLLATVPETPRWLAAHGRIDEARSTSERLCTTPEEADVQMAEI
FT                   EESLAAEAGTRGVKFFTRGHRKVIMLAVAIAFFNQMSGINAILYYAPRVMEDAGASSNA
FT                   AYLMSIAVGVVNLVATMAALTVIDKLGRRRLMLIGSVGYLFSLGFLAAVMFLYDGAYDG
FT                   TSAILILVGLAVFIASHAFGQGAVIWVFISEIFPNRIRGRGQALGSFTHWMWAAIVTFA
FT                   FPPIVGALGGGVAFSIFFVVMILQLVWVIRVMPETKGVPLEEMEAALDIDDAAAAKGH"
FT   gene            556800..558572
FT                   /locus_tag="Tpau_0527"
FT   CDS_pept        556800..558572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0527"
FT                   /product="phosphoribosylglycinamide formyltransferase 2"
FT                   /note="KEGG: rop:ROP_19590 glycinamide ribonucleotide
FT                   transformylase PurT; TIGRFAM: phosphoribosylglycinamide
FT                   formyltransferase 2; PFAM: ATP-dependent carboxylate-amine
FT                   ligase domain protein ATP-grasp; Phosphoribosylglycinamide
FT                   synthetase, ATP-grasp (A) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77168"
FT                   /db_xref="GOA:D5USA1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005862"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D5USA1"
FT                   /inference="protein motif:TFAM:TIGR01142"
FT                   /protein_id="ADG77168.1"
FT                   /translation="MMDPMTNLTETGGNPRIGTALTPGATKVLLLGSGELGKEVLIAFQ
FT                   RLGVETIAVDRYANAPAMQVAHRSHVVDMTDADAVRRVIEQEKPRYVVPEIEALATEAL
FT                   IAVEEEGVAEVIPTARAVSLTMDREGIRKLAAEDLGLPCSPYAFASSVEELRTGAREVG
FT                   FPCVVKPVMSSSGKGQTVVRTPDEIDGAWEAAVTGGRVRNERVIVEGFVDFDYEITLLT
FT                   VRVFDSERGKVITRFCEPIGHRQQGGDYVESWQPQPMSQTAYDSATSVAGRITTALGDG
FT                   GTGGRGVFGVELFVKGDDVYFSEVSPRPHDTGLVTLGSQRLSEFELHARAILGMPVDSS
FT                   LMSPAASAVIYGTKDSSSVAFDNVARALDIPETDIRLFGKPEGYAKRRLGVVVATADTV
FT                   EVARANAQEAANRVQVVDSSDPVDPGAPATVAVPIQRPQVQEDMSTRAIPTQRPAPQAP
FT                   PSPPAHPGPAAPPPASAPPTSASPVVRPKQAPPAAPPTAASPVVRPGAGRVAPPAPQAP
FT                   RSGDGAADVPSGPTAMHPVATRRPAQPRPIQPQRRPAVSSPTAPEADSQQVAEEYDHNP
FT                   PTSMGMAPQRPHQD"
FT   gene            complement(558576..559337)
FT                   /locus_tag="Tpau_0528"
FT   CDS_pept        complement(558576..559337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0528"
FT                   /product="rRNA (adenine-N(6)-)-methyltransferase"
FT                   /note="PFAM: ribosomal RNA adenine methylase transferase;
FT                   KEGG: cjk:jk1436 23S rRNA methyltransferase; SMART:
FT                   Ribosomal RNA adenine methylase transferase- like"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77169"
FT                   /db_xref="GOA:D5USA2"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5USA2"
FT                   /inference="protein motif:PRIAM:2.1.1.48"
FT                   /protein_id="ADG77169.1"
FT                   /translation="MPTYRGGRHEHGQNFLTDRRIIASILNIIAESDGPILEIGPGAGA
FT                   LTVPLANLGRPLTVVEIDEKYVHALRRTRLDATIVHGDFLRHRLPDEPATVVGNLPFHL
FT                   TTAILRKLLHAPHWTDAVLITQWEVARRRAGVGGSTLMTAQWLPWYEFRLIRRLPATAF
FT                   TPRPGVDAGLLTVTRRPDPLMPWSARRAYAAFAHAVFTGRGRGLAAILAGITRRDRATV
FT                   ERWVAAQGWRGAPLPRDLDAAQWVDAFTRFG"
FT   gene            complement(559527..560249)
FT                   /locus_tag="Tpau_0529"
FT   CDS_pept        complement(559527..560249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0529"
FT                   /product="FAD-binding 9 siderophore-interacting domain
FT                   protein"
FT                   /note="PFAM: FAD-binding 9 siderophore-interacting domain
FT                   protein; Siderophore-interacting protein; KEGG: nfa:nfa7590
FT                   putative siderophore-interacting protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77170"
FT                   /db_xref="GOA:D5USA3"
FT                   /db_xref="InterPro:IPR007037"
FT                   /db_xref="InterPro:IPR013113"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR039374"
FT                   /db_xref="UniProtKB/TrEMBL:D5USA3"
FT                   /inference="protein motif:PFAM:PF08021"
FT                   /protein_id="ADG77170.1"
FT                   /translation="MGRGVTGLILKAMRADDYVFTVLSTEAVGEHYHRIRFDGGTFLTQ
FT                   NPWFPTMWVRLWVPKNGEATTDEDDGTLAQRGYTIIDPEGSEFTIEFAIHDGPAPRWAR
FT                   DAEPGDRIAATMMGADLAVPDNPAPSEYILVGDAASIPAINSLLTTATAPCRVFLEYQH
FT                   AAERDLPVRSENVTWVPREGRGATLVSAVTKAAIPHDAFLFVAAETKATREITKAAKKD
FT                   FGLTKDRIKSQAYWLQRG"
FT   gene            complement(560438..560956)
FT                   /locus_tag="Tpau_0530"
FT   CDS_pept        complement(560438..560956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0530"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dae:Dtox_2326 drug resistance transporter,
FT                   EmrB/QacA subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77171"
FT                   /db_xref="GOA:D5USA4"
FT                   /db_xref="UniProtKB/TrEMBL:D5USA4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77171.1"
FT                   /translation="MTNPDDPTRRYQQQSYPTQQQPGYQQAPTPDGPPPEVWARYAGGM
FT                   FVLGLLAVGVLWVMNLLANVVGNAVSSNWWTHNLTSSAYWFAIGLTIVAGVIYALLFVV
FT                   VPRNTVGRYWSAFGAIAVIGAFLSPLVPGIDSTNWGEALYLITLRVPVVILIVSLTGVN
FT                   GSSLTARQR"
FT   gene            561341..562009
FT                   /locus_tag="Tpau_0531"
FT   CDS_pept        561341..562009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0531"
FT                   /product="peptidase S1 and S6 chymotrypsin/Hap"
FT                   /note="PFAM: peptidase S1 and S6 chymotrypsin/Hap; KEGG:
FT                   cgt:cgR_0900 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77172"
FT                   /db_xref="GOA:D5USA5"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR033116"
FT                   /db_xref="UniProtKB/TrEMBL:D5USA5"
FT                   /inference="protein motif:PFAM:PF00089"
FT                   /protein_id="ADG77172.1"
FT                   /translation="MLASTCTVAFVAERPDGRRVALTAGHCGKRGQAVGAPVPGKPDAL
FT                   VRVGTFAQSSNPPARTTPEGYVLPEDLTAPDWGVIDLRPTTKSAAERGPVRPTRVGEAR
FT                   VGDRVCQQGVTSGWRCGVVRVVSPTQISTDITSRPGDSGGPLIRLSDGAALGIVSGGTA
FT                   AEAPRDVPRMTFYWSLRDALAQGGGLRLVTAGTPAAQRVSSPEVREVITVDGTVPVGVF
FT                   "
FT   gene            562157..562525
FT                   /locus_tag="Tpau_0532"
FT   CDS_pept        562157..562525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77173"
FT                   /db_xref="UniProtKB/TrEMBL:D5USA6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77173.1"
FT                   /translation="MHALRWVAMMGAAVAVSMSPLAASASPVGSPFGDDECRMFEEKPG
FT                   YECRAGTWQHDYAPPREGKACSIGDTAPGLRCRGGRWQDRSTGIPETGEKCTAVGAQRV
FT                   GIGGMLTCTHGPFGFTWQ"
FT   gene            complement(562619..564007)
FT                   /locus_tag="Tpau_0533"
FT   CDS_pept        complement(562619..564007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0533"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: rha:RHA1_ro02240 ferredoxin--NADP(+)
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77174"
FT                   /db_xref="GOA:D5USA7"
FT                   /db_xref="InterPro:IPR021163"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5USA7"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADG77174.1"
FT                   /translation="MTEQNRPLRVAIVGAGPAGIYAADALMKSDEAKDPGVSIDLFEKM
FT                   PAPFGLIRYGVAPDHPRIKGIITALHKVLDKPQVRLLGNLDFGKDFSLAEVRKHYDAVI
FT                   FSTGAVADRNLDIPGIDLDGSYGAAEFVAWYDGHPDFSREWPLEAEKVAVLGVGNVGLD
FT                   VARVLAKTADELLPTEIPPNVYEGLKQNKATEVHVFGRRGPAQVKFTPLELKELDHSQT
FT                   IEVVVSPEDIEYDEGSAKARRESKITDQVAVILENYAIREPNNRPHKLFIHLFESPVEI
FT                   LGEDGKVVGLRTERTELDGTGNVKGTGKFTDWELGAVYRAVGYLSNDLPEIPFDDQAGV
FT                   IPNEAGRVIDAGEHIPGVYTTGWIKRGPVGLIGHTKGDANETIACLLEDFHAGKLNQPA
FT                   DPSLEGVTNWLDDHETPYTTWDGWYRLDEHERSLGEAEGRERVKVVERDDMLAASEPSK
FT                   VQPS"
FT   gene            564156..564623
FT                   /locus_tag="Tpau_0534"
FT   CDS_pept        564156..564623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0534"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_0686 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77175"
FT                   /db_xref="GOA:D5USA8"
FT                   /db_xref="InterPro:IPR024267"
FT                   /db_xref="UniProtKB/TrEMBL:D5USA8"
FT                   /inference="similar to AA sequence:KEGG:Mvan_0686"
FT                   /protein_id="ADG77175.1"
FT                   /translation="MTADKDTPDQGDARGTTATPFLIALVIAVIAIGGILTWNFIRPSE
FT                   QRVPDSGQISQTVGQYYGALNHGRYADLVANTCAKDRSAPDFPQEAGFADARKAAVERE
FT                   GDATLDENGIKNVQVNGDSATADLVIKYSKAPEKTEQAKFVREDGKWKKCS"
FT   gene            564605..565033
FT                   /locus_tag="Tpau_0535"
FT   CDS_pept        564605..565033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0535"
FT                   /product="Rhodanese domain protein"
FT                   /note="SMART: Rhodanese domain protein; KEGG: rop:ROP_19530
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77176"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D5USA9"
FT                   /inference="protein motif:SMART:SM00450"
FT                   /protein_id="ADG77176.1"
FT                   /translation="MEEVLVTYAGDITPAQAWQLLHDDPNAVLVDCRTEAEWNYVGIPD
FT                   LTVLRRAVVLVEWQTYPDGALNATFVDELRRKGVTDDAPVAFLCRSGHRSIGAAEAATA
FT                   AGIQRAFNVLDGFEGGLDAEGHRGAVGWRAEGLPWRQF"
FT   gene            565043..566245
FT                   /locus_tag="Tpau_0536"
FT   CDS_pept        565043..566245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0536"
FT                   /product="O-succinylhomoserine sulfhydrylase"
FT                   /EC_number="4.4.1.1"
FT                   /note="TIGRFAM: O-succinylhomoserine sulfhydrylase; KEGG:
FT                   mab:MAB_4242c O-succinylhomoserine sulfhydrylase; PFAM:
FT                   Cys/Met metabolism pyridoxal-phosphate- dependent protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77177"
FT                   /db_xref="GOA:D5USB0"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006234"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5USB0"
FT                   /inference="protein motif:TFAM:TIGR01325"
FT                   /protein_id="ADG77177.1"
FT                   /translation="MTEFNALPDGVHPETIGVRGGLLRSNHEETSEALYLNSGYTYDSA
FT                   EAAEAAFNGDIDRFVYSRYGNPTVAMFQERLRLLEGAEACFATASGMSAVFTALGALLQ
FT                   AGDRLVAARSLFGSCYVVCNEILPRWGIETVFVDGEDLAQWEEALSVPAQAVFFETPAN
FT                   PMQGLVDVRAVADLAHAAGAQVVLDAGFTPVGYQDCFGLGADVIVHSSTKSMDGQGRVM
FT                   GGAILGAFDYIDGPVKQLMRHTGPAMAPFNAWVLVKALETLDLRAERISANAQKVAEFL
FT                   DADPRVSKVLYPFLPSHPQHELATRQMKAGGTVITLELADSDVRGKDRAFQFLNRLQVI
FT                   DISNNFGDAKSLITHPATTTHRATGPEGRAKIGLTDSMLRLSVGLENVDDLIADLDRAL
FT                   G"
FT   gene            complement(566271..566960)
FT                   /locus_tag="Tpau_0537"
FT   CDS_pept        complement(566271..566960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0537"
FT                   /product="CutC family protein"
FT                   /note="PFAM: CutC family protein; KEGG: sgr:SGR_3189
FT                   putative homeostasis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77178"
FT                   /db_xref="GOA:D5USB1"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/TrEMBL:D5USB1"
FT                   /inference="protein motif:PFAM:PF03932"
FT                   /protein_id="ADG77178.1"
FT                   /translation="MRREYSDVVTGLLEVIALTAADAVAAQEGGADQVELVADMAADGL
FT                   TPEAPTVTAVLGAVDIPVRVMLRLSAGFAVGDVDELLRRANMLHDAGADEFVLGFLAPD
FT                   GSPDLATIERIVHELHGAPWTFHRAIDHCSNRDDLRASISGLTGLDAILTAGAADGVDA
FT                   GIDVLLTEEPGPQRILVGGGLRIDHLPRLRAAGIDGFHVGSGARPNGWCSPVSAPAVRL
FT                   WRNAIDD"
FT   gene            complement(566950..568164)
FT                   /locus_tag="Tpau_0538"
FT   CDS_pept        complement(566950..568164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0538"
FT                   /product="HNH nuclease"
FT                   /note="SMART: HNH nuclease; KEGG: mbt:JTY_3094 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77179"
FT                   /db_xref="GOA:D5USB2"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:D5USB2"
FT                   /inference="protein motif:SMART:SM00507"
FT                   /protein_id="ADG77179.1"
FT                   /translation="MEVEDVSSSAAGGEVIAGLGELERLRARVVFNQYRLIVELLRTRV
FT                   CERIAAGVAQERWEAGVASEVALALRVSPHRATAMLSRAKTLERDLPATLSRLRDGDIS
FT                   PEAVEVIVAGVSHLEPRLKGEADTVLCGEGFAASGLGLKRLQDRVKEVSYQLDAQATVD
FT                   RAALAAKDRRVTIRPAPDCMARVSILLPVAQAVGLYAAVKTAADSVFGTPGESRSRGQI
FT                   MADTAFARITGRDAADGVPVTVNLTMPATVLLGEESGIAHLTGGGTLPAEIARHLVGRA
FT                   SEKAIGWVKRLYVQPDSGAVVGLDSRSRLFPAGLAELIAARDRYCRTPYCDAPIAHTDH
FT                   ITAHAHGGATSLHNGQGLCAACNYAKEAAGWSSRTVDDPSGRHTVETRTPTGHLHRSTA
FT                   PPHAA"
FT   gene            568288..568965
FT                   /locus_tag="Tpau_0539"
FT   CDS_pept        568288..568965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77180"
FT                   /db_xref="UniProtKB/TrEMBL:D5USB3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77180.1"
FT                   /translation="MRSQKAENVRSHTERASSKRDLAGIQRPTAADIAEFDAAWTRILG
FT                   DTPLRAIDLRGVHNSRWVRLHSLPGSKRYADTEEEYAELLRRYFAVLDELRGDEEILTV
FT                   VTCSFSFAMSPRPVRRSSLLTGLLPRPRYWRSVSEGEDEGEEQAWAHLYVHRVHRHAPA
FT                   LRELFRAVADERAFDVMVTDSAVSWVHHPYDGGSDLILATPAERDRVSELFAQWRSPWD
FT                   HGL"
FT   gene            568975..569499
FT                   /locus_tag="Tpau_0540"
FT   CDS_pept        568975..569499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0540"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   cms:CMS_0876 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77181"
FT                   /db_xref="GOA:D5USB4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D5USB4"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADG77181.1"
FT                   /translation="MDDLNLCRPTEADVADLHVIVSDPRVWTHYPSLRPSSIDQTRSLV
FT                   NRWMMQWEVDGLGPSIVRNRDSIIGYGGCDRRRGAFWNLGYRLAADVQGRGLATMIAQA
FT                   AVDAARRHDDSLPVVAYLVEHNRASARVAEKVGLSLVHRAPDAGNPDPTVIRLVFADRP
FT                   LTAEELSAVVE"
FT   gene            complement(569593..570171)
FT                   /locus_tag="Tpau_0541"
FT   CDS_pept        complement(569593..570171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0541"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: rer:pREL1_0102
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77182"
FT                   /db_xref="GOA:D5USB5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:D5USB5"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG77182.1"
FT                   /translation="MPRTVDHGERRSELTDAVARIAARDGLQAVTMRAVAAEAGVSLRL
FT                   VQYYFENKHGLLIGAMRRLEEQSNARWRARLSNTADPRAMLHAFISEALPTDPESTDFY
FT                   RVSAAFGELARTDTELAAEPLAGGLTRLRSTVLDTFRAADLPPDADPEAETDALISLCN
FT                   GLSTAVLLGHHTADRAVAIASYHLDRVFR"
FT   gene            570239..571583
FT                   /pseudo
FT                   /locus_tag="Tpau_0542"
FT   gene            571798..572964
FT                   /locus_tag="Tpau_0543"
FT   CDS_pept        571798..572964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0543"
FT                   /product="protein of unknown function UPF0027"
FT                   /note="PFAM: protein of unknown function UPF0027; KEGG:
FT                   art:Arth_3119 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77183"
FT                   /db_xref="GOA:D5USB6"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:D5USB6"
FT                   /inference="protein motif:PFAM:PF01139"
FT                   /protein_id="ADG77183.1"
FT                   /translation="MEKISKSLVSWASILDEKTREQAITTAKLPFIYPHIALMPDAHLG
FT                   KGATVGSVIPSLGAVIPAAVGVDIGCGMIAVRTQFTKSDLPDDRATVREAIERAVPLSP
FT                   GRYNTKVVATAEPRIAELIALAERAEFDPAQYAGNWALQLGTLGGGNHFIEISLDEDDT
FT                   VWAFLHSGSRGVGNKIAQQHIAVATRLCRQWWIDLPDPDLAYLVEGTPEFRRYIAELKW
FT                   AQHFALLNREEMMDRVIRQLGEWVGTPVSEAERINCHHNFTKREKHFGKEVWVSRKGAI
FT                   EAAEGKLGLIPGSMGTASYIVEGRGFPPSLNSSPHGAGREYSRSAARRTFTHEQLREAM
FT                   AGIEFRDSADFVDEIPQAYKPIDRVMTDAAELVTVRAVLRQIVNVKGQ"
FT   gene            complement(573034..573819)
FT                   /locus_tag="Tpau_0544"
FT   CDS_pept        complement(573034..573819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0544"
FT                   /product="HAD-superfamily hydrolase, subfamily IIA"
FT                   /note="KEGG: rop:ROP_19480 putative NMP phosphatase;
FT                   TIGRFAM: HAD-superfamily hydrolase, subfamily IIA; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77184"
FT                   /db_xref="GOA:D5USB7"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D5USB7"
FT                   /inference="protein motif:TFAM:TIGR01460"
FT                   /protein_id="ADG77184.1"
FT                   /translation="MEQWHYLMDMDGVLIHEDHLIPGADAFLAELTANDTPYMVLTNNS
FT                   IRTPRDLRARLLATGLDIPERRIWTSALATAKFLQEQRPGGTAYVVGESGLTTALHEVG
FT                   YVLTENDPDYVVLGETRNYSFEAITTAIRLIERGSRFIATNPDPTGPSKEGSLPATGAV
FT                   AALIREATGRSPYYVGKPNSLMMRSALRALGAHSEDTLMIGDRMDTDIVCGLEAGLQTV
FT                   LVLTGISSRESVTLYPYRPTRIIDSVADLVGGTDTPFPA"
FT   gene            complement(573838..574311)
FT                   /locus_tag="Tpau_0545"
FT   CDS_pept        complement(573838..574311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0545"
FT                   /product="Ferritin Dps family protein"
FT                   /note="PFAM: Ferritin Dps family protein; KEGG:
FT                   nfa:nfa43820 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77185"
FT                   /db_xref="GOA:D5USB8"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:D5USB8"
FT                   /inference="protein motif:PFAM:PF00210"
FT                   /protein_id="ADG77185.1"
FT                   /translation="MSNPITSTLSDEAQKVAGDALQGSLVDLIDLGLIAKQAHWNVVGS
FT                   QFRSVHLQLDELVTDSRTFVDEVAERAAAIGVSPDGRAETVAKTAATVGFEAGWQQDDA
FT                   VVGAIVKNLAAVVAALRSRIEATESADPVTQDLLISITARLEQLHWMWQAQQA"
FT   gene            574659..575948
FT                   /locus_tag="Tpau_0546"
FT   CDS_pept        574659..575948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0546"
FT                   /product="Cysteine desulfurase"
FT                   /EC_number="2.8.1.7"
FT                   /note="KEGG: mab:MAB_0512 aminotransferase/cysteine
FT                   desulfurase; PFAM: aminotransferase class V; aromatic amino
FT                   acid beta-eliminating lyase/threonine aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77186"
FT                   /db_xref="GOA:D5USB9"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:D5USB9"
FT                   /inference="protein motif:PRIAM:2.8.1.7"
FT                   /protein_id="ADG77186.1"
FT                   /translation="MTTILDRTCPAPTLASPERSAGPLAFGPIARVTGADEFVPLADGA
FT                   TVRYANFDYAASAPALVAVQEAVATALTEYASVHRGAGYLSQRSTARYEAARDIVADFI
FT                   GARGDDHVIFTGNTTDSLNLLAACVPGEVVVLDCEHHANLLPWKRIGARVVSAPLSIEG
FT                   TLKAVEAELARRPAALLSVTGASNVTGEVLPIRRLAALAHRHGARIAVDGAQLVPHRRI
FT                   SLRDSGVDYLAFSGHKLYAPFGSGVLVGRADWFDEAEPYRCGGGASYEVIGTPVAKSVE
FT                   VAWHTGPARHEAGSPNVLGAVAIGAACEAIAALGESEIARHEHYLTDLLLGSLTRLDGV
FT                   RPLRIWADSTDRVGIVAFTVDGYTPREVAEFLSSRYGIGVRDGKFCAHPVVNRLGCYDG
FT                   AVRASLGLGTAENDVHRLVRALEDLTALPK"
FT   gene            575974..576363
FT                   /locus_tag="Tpau_0547"
FT   CDS_pept        575974..576363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0547"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rer:RER_05550 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77187"
FT                   /db_xref="GOA:D5USC0"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D5USC0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77187.1"
FT                   /translation="MTATASRPALVIVVDGEPAATELTRVRAADLRLAQKQRDYLRAEA
FT                   ARAGREPDAVALEVDVVIDEHAAQARASYAGLGATADGVTYVGTPSGLKSLIEDVYAAE
FT                   VADAVVLRPVGGDRTQQLIASLLAA"
FT   gene            576391..576882
FT                   /locus_tag="Tpau_0548"
FT   CDS_pept        576391..576882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0548"
FT                   /product="YbaK/prolyl-tRNA synthetase associated region"
FT                   /note="PFAM: YbaK/prolyl-tRNA synthetase associated region;
FT                   KEGG: bcv:Bcav_3926 YbaK/prolyl-tRNA synthetase associated
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77188"
FT                   /db_xref="GOA:D5USC1"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:D5USC1"
FT                   /inference="protein motif:PFAM:PF04073"
FT                   /protein_id="ADG77188.1"
FT                   /translation="MTDADQSSFSRRTEAVRAALVAAGHPDTVRVVPGGAATAAEAAAA
FT                   LGCEVGAIANSLIFLADGAPLLVLSSGRHRVDTAGLAERLGHCRISRATPDDVVAATGQ
FT                   VIGGVSPVGHPSALRTVIDESLRDYPDLYAAAGTHDTLFRTDFDALVALTGAAIVRTSA
FT                   "
FT   gene            576991..577464
FT                   /locus_tag="Tpau_0549"
FT   CDS_pept        576991..577464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0549"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="KEGG: sen:SACE_0389 MarR family transcriptional
FT                   regulator; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77189"
FT                   /db_xref="GOA:D5USC2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5USC2"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADG77189.1"
FT                   /translation="MTDDERAERIEDLVRVIADLTRLKERHAAMTRHAVAPDGVELAAY
FT                   SALFALVKDGPMRSSVLAEQIHTDPSTASRYVTTLTNQGYAERTPDPSDRRAALVAATQ
FT                   AGRDKVAFIREQRNIRLRPLLQEWSDEEIEQFVKLGSRALDQFEQALRLLRED"
FT   gene            577465..580653
FT                   /locus_tag="Tpau_0550"
FT   CDS_pept        577465..580653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0550"
FT                   /product="tRNA-guanine transglycosylase, various
FT                   specificities"
FT                   /EC_number="2.4.2.29"
FT                   /note="TIGRFAM: tRNA-guanine transglycosylase, various
FT                   specificities; drug resistance transporter, EmrB/QacA
FT                   subfamily; KEGG: rha:RHA1_ro04399 major facilitator
FT                   superfamily multidrug transporter; PFAM: major facilitator
FT                   superfamily MFS_1; Queuine/other tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77190"
FT                   /db_xref="GOA:D5USC3"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:D5USC3"
FT                   /inference="protein motif:TFAM:TIGR00449"
FT                   /protein_id="ADG77190.1"
FT                   /translation="MTATTLENQSPEQAAGVPSGPLTHKQILYILAGLMTGMFLAALDQ
FT                   TIVSTAIRTIADDLSGYQLQVWVTTAYLITSTIVTPLYGKLSDIYGRKPFFMFAITVFV
FT                   LGSLLCSFSTSMYELAAFRAVQGLGAGGLMSLALTIVGDIVPPRERARYQGYFLAVFGT
FT                   SSVLGPVLGGVFSGADSILGITGWRWVFLVNVPIGVIALLVVYRVLQLPHTRREGVRID
FT                   WVGAFMLAVGIVPLLIVAEQGREWGWGSTKSITCYAVGAGGVLAFIIIEKMMGEDAIIP
FT                   LRIFRNRIFAQGVLISVVVGAAMFGGISLLPQYFQVVRGASPTVAGFMMLPMVLGLMMG
FT                   SILAGQMISRTGRYRIYPIIGAVLLTVGMWALHYVTADVRLAAVMAGAALIGFGLGNLM
FT                   QPLTLAMQNILPPQDMGVSTAAATFFRQIGGTLGVAVFLSVLFSEMPKNMQSRLTDAAA
FT                   DPDYTAALQRAAAGHDGQAAQEFANKLAARDSSAVSGIMSDTSALQKLPSTLVHPFKAG
FT                   FADSMDTVFLAVTVLSAIGLLLVLFWKSVPLRTAPAMETIEEEVVGAVLAGGPVAEPEP
FT                   AAAADTAPVSPAPVGAHPPGTTGVGTASRAVARQTRAPGPRTVEPVPPDDDRTAPVRVD
FT                   PALAEIAELRSQNAELAAELAELRTGYRAIAGHTRLRAVGASDPTGFRIEVQGPGAART
FT                   GTLSTPHGEIATPAYLPVAARGAVAGITPEMLAALGVQAVTVDLHELYLQPGTAMIEGA
FT                   GGIGRAMAWAGPVLGDTGITAVAAAKKTRVTDEGIAFRSRLDGGAHRWDPEEAVRVAHR
FT                   IGVDIAFAMADPVAATAPRAQLEAGVNRSQQWAARALVEHSWQTADRGDRQSLWAVVTG
FT                   GADAGLRRAAARGLRRLSEQDVQSGGLGFGGYRIDGVRSAAAEALQLRAATEELDRERP
FT                   RHLATVATPADLFAAIEAGIDLFDGTAAAEAGREGRVFTRDGVLDLTDPQLRADFRPID
FT                   PGADRRGPANPADEFTRAYVNHLFAANEGLAVTLCTLHNEHFFATLAADARRALTDGRY
FT                   PAFTESFLRRFAKV"
FT   gene            580690..581367
FT                   /locus_tag="Tpau_0551"
FT   CDS_pept        580690..581367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0551"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fra:Francci3_3820 alkaline phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77191"
FT                   /db_xref="UniProtKB/TrEMBL:D5USC4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77191.1"
FT                   /translation="MRRFDPVRFSSVLAGAAVGGLVLAACGNGGGGDAAPSSTADGPSP
FT                   AASKALVQADLPEGFTVTTVPADTALMSSLQAVQQMKDVEITPAGCKDKNVAAQQEVAD
FT                   TVKFGTQQNVARAQQVAYGVNFLPAEAKLSVFEAAGTGECAAVRLGAVEQTTTRKDLPT
FT                   GTGAQGFVLEFARSVGDQKAESANAYFSKGGVTAMVFANPGADGTLDRTGFEDMVKRVA
FT                   AKL"
FT   gene            complement(581437..581937)
FT                   /locus_tag="Tpau_0552"
FT   CDS_pept        complement(581437..581937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0552"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="KEGG: rer:RER_06170 inorganic pyrophosphatase; PFAM:
FT                   Inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77192"
FT                   /db_xref="GOA:D5USC5"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:D5USC5"
FT                   /inference="protein motif:PRIAM:3.6.1.1"
FT                   /protein_id="ADG77192.1"
FT                   /translation="MEFEVTVEIAKGSRNKYEVDHKSGRLKLDRYLYTSFGYPTDYGYI
FT                   EDTLGEDGDPLDALVLLPESVIPGSLVDCRAIGMFKMEDEKGGDDKVLVVPAGDPRWDA
FT                   IQDLEHIDKFELDAIEHFFVHYKDLEPGKFVKGSTWVGKAEAEKEIAASIARAEAAAEG
FT                   IDS"
FT   gene            582051..583421
FT                   /locus_tag="Tpau_0553"
FT   CDS_pept        582051..583421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0553"
FT                   /product="D-alanyl-D-alaninecarboxypeptidase/D-alanyl-D-al
FT                   anine-endopeptidase"
FT                   /note="KEGG: rer:RER_06180 D-alanyl-D-alanine
FT                   carboxypeptidase; TIGRFAM: D-alanyl-D-alanine
FT                   carboxypeptidase/D- alanyl-D-alanine-endopeptidase; PFAM:
FT                   peptidase S13 D-Ala-D-Ala carboxypeptidase C"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77193"
FT                   /db_xref="GOA:D5USC6"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D5USC6"
FT                   /inference="protein motif:TFAM:TIGR00666"
FT                   /protein_id="ADG77193.1"
FT                   /translation="MPRSRIRRTLVRLAVTVIVLALVVVGVLAAALGYAAYRDSRDLDA
FT                   QVPPRPAEQAYTPAIAPVAATSAPTAAGVRAQIAAALQNPDLGDFTGVIADAASGGVLW
FT                   ERDAARPRTPASTTKVLTAAAALLTLPADKRITTTVVAGAQPGEVVFVGAGDPTLRAGS
FT                   DSMFTDAPKISDLAAQLRRGGTKITRVVVDTALFTGPDLARGWERADIAGGDVTPMQAL
FT                   TADAGRIRPGEDYSPRVPDPAVSAGRALATALGLPPTAVSTGTAPSGAAQLASVRSAPL
FT                   DVRLRDAMIHSDNVLAESIGREVAAAGGQPLSFDGSARAVTAALRNAGFDLTGVELSDV
FT                   DGLSTLNRISAKVLDEILTAAAGNGKPQLRPLLDMLPVGGSSGTLADRYVTANRPGAGY
FT                   VRAKTGSLSGVSTLSGFVADREGSIITFTLMSSGTPVDVARPAMDAVTAALRGCGCR"
FT   gene            583428..584465
FT                   /locus_tag="Tpau_0554"
FT   CDS_pept        583428..584465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0554"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rop:ROP_43180 hypothetical protein; TIGRFAM:
FT                   conserved hypothetical protein; PFAM: Protein of unknown
FT                   function DUF2342"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77194"
FT                   /db_xref="InterPro:IPR018766"
FT                   /db_xref="InterPro:IPR022454"
FT                   /db_xref="InterPro:IPR042271"
FT                   /db_xref="UniProtKB/TrEMBL:D5USC7"
FT                   /inference="protein motif:TFAM:TIGR03624"
FT                   /protein_id="ADG77194.1"
FT                   /translation="MATRRHRSPQVDWSLAAAAARRLAGGGPATTAYTRDRAAAQLIGF
FT                   AAEAERHVRDVTGLATGARIPAARTVDRREWVDAAARSMAALLDGDHSGRPGIGARIAG
FT                   LQAGGMLGFVSGSILGQYDPFGTSDGELLLVVPNVLRVERALGLDPDDFRMWVCLHEVT
FT                   HRVQFAANPWLRDHMRDNVAALTGDGDSGTVADLLHRVNAALRGGKRHDGVIGLLQIAA
FT                   PAEQFAAIENLLILGTLLEGHADHVMDAAGPTVVPTVATIRAAFDRRRASPANPLQRVL
FT                   RALLGVDAKIAQYVRGKKFVDAVVADVGMDRFNTVWSGPDTLPRDEEFDEPARWMARVL
FT                   GAPAP"
FT   gene            584462..585400
FT                   /locus_tag="Tpau_0555"
FT   CDS_pept        584462..585400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0555"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="KEGG: mgi:Mflv_1411 tRNA(Ile)-lysidine synthetase;
FT                   TIGRFAM: tRNA(Ile)-lysidine synthetase; PFAM: PP-loop
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77195"
FT                   /db_xref="GOA:D5USC8"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:D5USC8"
FT                   /inference="protein motif:TFAM:TIGR02432"
FT                   /protein_id="ADG77195.1"
FT                   /translation="MSRPGPAALQIRRAVQHWAARYGAPSTVAVAVSGGPDSLALLAGA
FT                   VAAGLEPVALVVDHGLQPDSAATAARAAGQARSAGARRADVLTVIVDAAGGPEAAARTA
FT                   RYRALDAHRDGLPVLLGHTLDDQAETVLLGLGRGSGARSLAGMAAWAEPYGRPLLGVRR
FT                   AVTRQACAELGLDPWDDPHNTDARYTRVRLRHEVLPLLEEVLGGGVAQALARTAASLRD
FT                   DNDALDALTPAPSGDELPVADIEHLPPALRRRALRAWLAGRGARALTAAHLAAVDALVS
FT                   DWHGQGPAAVPGGSAGRRLQVHRTGGILSAW"
FT   gene            585397..585963
FT                   /locus_tag="Tpau_0556"
FT   CDS_pept        585397..585963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0556"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="TIGRFAM: hypoxanthine phosphoribosyltransferase;
FT                   KEGG: mjl:Mjls_5161 hypoxanthine phosphoribosyltransferase;
FT                   PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77196"
FT                   /db_xref="GOA:D5USC9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D5USC9"
FT                   /inference="protein motif:TFAM:TIGR01203"
FT                   /protein_id="ADG77196.1"
FT                   /translation="MNGTGELYAGDIASVVLSEEQIKQRIAELAAQIAEEYGDRETDLL
FT                   LITVLKGAVMFVTDLARALPVPTQLEFMAVSSYGSSTSSSGVVRILKDLDRDIAGRDVL
FT                   IVEDIIDSGLTLSWLLRNLATRQPNSLEVVTLLRKPDAVRVDVDVKWVGFDIPNEFVVG
FT                   YGLDYAERYRDMPYIGILEPKVYSE"
FT   gene            585960..587270
FT                   /locus_tag="Tpau_0557"
FT   CDS_pept        585960..587270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0557"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: rha:RHA1_ro04406 amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77197"
FT                   /db_xref="GOA:D5USD0"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:D5USD0"
FT                   /inference="protein motif:PFAM:PF01425"
FT                   /protein_id="ADG77197.1"
FT                   /translation="MTLLTAAATADGVREGRHTAVETTREALARIGDDEVNGWRVLRPA
FT                   EALAEAAAVDARPDRYALPLAGVPIAIKDNVAVSGHRILDGVSAECGAGLPVERSDHPV
FT                   VKRLRAAGAVVVGLTRVPELCLWAMTDDAEAVVANPHRPGRTPGGSSGGSAAVVAAGHV
FT                   ALAHGNDGLGSLRGPAAAAGIVTIKPGRGVVPAELGPTNWFGMAENGPMTRTVGDAALG
FT                   LSVMAGRPELAQIGEGAGLRIGLGLNRPTPATVTSRTIAAAVRDATAVLTAREHSVHEV
FT                   RVPYPASPLPLLARWVAAAATDADDIVARGATAALLQARTRRHAALGRVVTARGLVRPA
FT                   DAAAIESELERFFANERIDVLVTPTLARRPAQARRYSALPWVASAAASLNYAPYPSLWN
FT                   LLGWPAMSVPFRGEGVQLIARPGGEADLLAVAAKLEA"
FT   gene            complement(587274..587711)
FT                   /locus_tag="Tpau_0558"
FT   CDS_pept        complement(587274..587711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0558"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mva:Mvan_4969 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77198"
FT                   /db_xref="GOA:D5USD1"
FT                   /db_xref="InterPro:IPR024399"
FT                   /db_xref="UniProtKB/TrEMBL:D5USD1"
FT                   /inference="similar to AA sequence:KEGG:Mvan_4969"
FT                   /protein_id="ADG77198.1"
FT                   /translation="MTDPQYPQAPVAAPSPTWNSRFDFYNTYGHPSASAHGAAAFKQLS
FT                   FGERFRLTANGPAFFFGPIYFAIKGPWRKGLSLFGVAVAISALIGVIELAFDISFPAAG
FT                   FGAAIGVLYSTAANWAYYQHVAYGSTSWNPFEGVPLLRARK"
FT   gene            587870..590275
FT                   /locus_tag="Tpau_0559"
FT   CDS_pept        587870..590275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0559"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.6.4.3"
FT                   /note="SMART: AAA ATPase; TIGRFAM: ATP-dependent
FT                   metalloprotease FtsH; KEGG: nfa:nfa3980 putative cell
FT                   division protein; PFAM: peptidase M41; peptidase M41 FtsH
FT                   extracellular; AAA ATPase central domain protein; ATPase
FT                   associated with various cellular activities AAA_5"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77199"
FT                   /db_xref="GOA:D5USD2"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D5USD2"
FT                   /inference="protein motif:TFAM:TIGR01241"
FT                   /protein_id="ADG77199.1"
FT                   /translation="MKRKSLIRTLAIIAGFVLLIWAFTMVNSKDRDYTPVSTGLVLSQL
FT                   QANNVTDVQIDDREQTLRVTIDKPIDGVEGKKIFAKYPAGTSRDILADVQDAKTPDGKP
FT                   LQDYTTNVTAESIWQSVLFMLLPILLLVGLFFFLMNRMQGGGRGGVMGFGKSKAKQLTK
FT                   DMPKTTFADVAGADEAVEELYEIKDFLQNPARYQALGAKIPKGVLLYGPPGTGKTLLAR
FT                   AVAGEAGVPFFTISGSDFVEMFVGVGASRVRDLFEQAKENSPCIIFVDEIDAVGRQRGA
FT                   GMGGGHDEREQTLNQLLVEMDGFGDRQGIILIAATNRPDILDPALLRPGRFDRQIPVSN
FT                   PDMAGRKAILEVHAKGKPLADDVDLSGLAKRTPGMSGADLANVINEAALLTARENGSQI
FT                   TAPILEESVDRVVGGPRRKNRIISEHEKKVTAYHEGGHTLAAWATEGLDPVYKVTVLAR
FT                   GRTGGHALAVPENDKGMYTRNEMIGRLIFAMGGRAAEELVFAEPTTGASSDIDQATKIA
FT                   RGMVTEYGMSARLGAVRYGQDDGDPFVGRGIGSGAQYSEAVASQIDEEVRSLVEAAHTE
FT                   AWAILNEYRDVLDVLAGELLEKETLVRKDLERIFASVEKRPRITQFDDFGTRTPSTKPP
FT                   IKTPKEIAIENGDPWPPVDEEAERKKAEQAALAAAAAPSGQNGQVNGQGPQAQPWPVPG
FT                   GQPGYGQGYGQPGYQWGGQSQGYPGPQYPNQPYPGQSGGYPPAPNPYPQPGQYGQPPAG
FT                   GSRPDYGAPAGWSAPGWPPQGQPGQQPGQAPQGQDPEQKSGPDRSSES"
FT   gene            590277..590873
FT                   /locus_tag="Tpau_0560"
FT   CDS_pept        590277..590873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0560"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="TIGRFAM: GTP cyclohydrolase I; KEGG: mjl:Mjls_5155
FT                   GTP cyclohydrolase I; PFAM: GTP cyclohydrolase I/Nitrile
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77200"
FT                   /db_xref="GOA:D5USD3"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:D5USD3"
FT                   /inference="protein motif:TFAM:TIGR00063"
FT                   /protein_id="ADG77200.1"
FT                   /translation="MAAGDGAAIAPFDHERAVAAVRELLIAVGEDPEREGLKKTPERVA
FT                   RAFQEVFGGLHTDPDSVLDTTFGEDHDELVLVKDIPMYSTCEHHLVSFHGVAHVGYLPG
FT                   PSGRVTGLSKLARVVDLYAKRPQVQERLTAQIADAVVRKLDPRGVIVVIEAEHLCMAMR
FT                   GIRKPGASTTTSAVRGAFKDSATSRAEALELILRR"
FT   gene            590870..591742
FT                   /locus_tag="Tpau_0561"
FT   CDS_pept        590870..591742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0561"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="TIGRFAM: dihydropteroate synthase; KEGG:
FT                   rha:RHA1_ro04409 dihydropteroate synthase; PFAM:
FT                   dihydropteroate synthase DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77201"
FT                   /db_xref="GOA:D5USD4"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:D5USD4"
FT                   /inference="protein motif:TFAM:TIGR01496"
FT                   /protein_id="ADG77201.1"
FT                   /translation="MNAASRAAAPPARPGGATLIMGVVNVTTDSFSDGGRYLDLDAALA
FT                   HARELVAEGAAVVDVGGESTRPGAHRVPAEVERDRVVPVITALAAEGIAVSVDTMRASV
FT                   AAAALDAGAAIVNDVSGGRADPAMAGVVAGSSAPWILMHWRPSPGAPGADTWSGIHHGV
FT                   TDYTDVVTEVRDELLHQADAAIAAGIAPERIVLDPGLGFAKNGDHNWALLRGLNTLQDT
FT                   GFRVLVGASRKRFLGELLGGRAPAGREVATAAISALAAREGVWGVRVHDVRATADAIAV
FT                   ARAWKKGGI"
FT   gene            591742..592125
FT                   /locus_tag="Tpau_0562"
FT   CDS_pept        591742..592125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0562"
FT                   /product="dihydroneopterin aldolase"
FT                   /EC_number="4.1.2.25"
FT                   /note="TIGRFAM: dihydroneopterin aldolase; KEGG:
FT                   msm:MSMEG_6102 dihydroneopterin aldolase; PFAM:
FT                   dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77202"
FT                   /db_xref="GOA:D5USD5"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:D5USD5"
FT                   /inference="protein motif:TFAM:TIGR00525"
FT                   /protein_id="ADG77202.1"
FT                   /translation="MADRIELTGLRVRGNHGVFDHERRDGQEFIVDLVLWLDSRPAATS
FT                   DDLADTVDYGALAQLAHDIVAGEPRNLIETVAAEIADGIAADPRVYATEVTVHKPSAPI
FT                   PLTFADVAVVARRSRAGARGVPQ"
FT   gene            592122..592610
FT                   /locus_tag="Tpau_0563"
FT   CDS_pept        592122..592610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0563"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridin
FT                   epyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="TIGRFAM:2-amino-4-hydroxy-6-
FT                   hydroxymethyldihydropter idinepyrophosphokinase; KEGG:
FT                   rop:ROP_43270 2-amino-4-hydroxy-6-
FT                   hydroxymethyldihydropteridine pyrophosphokinase; PFAM:
FT                   78-dihydro-6-hydroxymethylpterin- pyrophosphokinase HPPK"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77203"
FT                   /db_xref="GOA:D5USD6"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:D5USD6"
FT                   /inference="protein motif:TFAM:TIGR01498"
FT                   /protein_id="ADG77203.1"
FT                   /translation="MTRAVLSIGANLGDAETAVRGAITALGPALVAASPLYRTPPWGGV
FT                   EQDDFINATVLADDPSRTAAGWLDFARDQEAAADRIRDVRWGPRTLDVDVIAVWDAEVP
FT                   IRSDDPELTLPHPRAHQRAFVLVPWRAVDPAAELPGHGTVDDLLAALPAGEVAEVTPL"
FT   gene            592664..593134
FT                   /locus_tag="Tpau_0564"
FT   CDS_pept        592664..593134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0564"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rop:ROP_43280 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77204"
FT                   /db_xref="GOA:D5USD7"
FT                   /db_xref="InterPro:IPR021517"
FT                   /db_xref="UniProtKB/TrEMBL:D5USD7"
FT                   /inference="similar to AA sequence:KEGG:ROP_43280"
FT                   /protein_id="ADG77204.1"
FT                   /translation="MRSTGWIELVVIVLGVGLGTYILVKDLVPPIPIWAGAMLYGIAAA
FT                   DLWIAQLIRSRLAKGQVGMGPGRLHPIAVARAVALAKASAYLGAVSLGFFGGALAFLLT
FT                   KGSELTATHADRPGAWIGLVGAGLLLASALWLEQCCRTPDDPDEQPADTSPA"
FT   gene            593236..594381
FT                   /locus_tag="Tpau_0565"
FT   CDS_pept        593236..594381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0565"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mgi:Mflv_1422 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77205"
FT                   /db_xref="GOA:D5USD8"
FT                   /db_xref="UniProtKB/TrEMBL:D5USD8"
FT                   /inference="similar to AA sequence:KEGG:Mflv_1422"
FT                   /protein_id="ADG77205.1"
FT                   /translation="MMDPGNRKRAPRRSNAGAGQWMLGAVIVLAVAGTGMWIFSDDKRW
FT                   GLLALILLVWGLVIAAFLIARNARDIRSAESKESGLKAVYELQLEREISARREYELQLE
FT                   HDLRSELRHESNEELTALKAEVLALRANLEELLGRDLGPSYTELYAAAEQRAIDAQRAK
FT                   SVFEDDDRFRAQQDFAGVPPPVPDVDSYYGAASAVNDVPDFPAAAEQPVDAPSAPNRPQ
FT                   EDTPTAVFEAVVDPQSPAAAPPVDAEPVDVEHIDHIDGDEPFVPLAPQSGYRPPFPPRR
FT                   FTPDAAQQQPPQFAQYAPPERAPQQPAPADQVHSIPTVPPFPAAEPTPAAPLQETRPED
FT                   DDVHEQDSTRGQHSSGSTVAELIARMNADTERSGGRRRKPE"
FT   gene            594493..595434
FT                   /locus_tag="Tpau_0566"
FT   CDS_pept        594493..595434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0566"
FT                   /product="Domain of unknown function DUF2520"
FT                   /note="PFAM: Domain of unknown function DUF2520; Putative
FT                   oxidoreductase/dehydrogenase, Rossmann-like domain; KEGG:
FT                   rop:ROP_43300 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77206"
FT                   /db_xref="GOA:D5USD9"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018931"
FT                   /db_xref="InterPro:IPR019665"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037108"
FT                   /db_xref="UniProtKB/TrEMBL:D5USD9"
FT                   /inference="protein motif:PFAM:PF10728"
FT                   /protein_id="ADG77206.1"
FT                   /translation="MPEFQDSPDLLAGIPNPPAPARLSVGVVSAGRVGTALGAAFERAG
FT                   HIVTATAARTHRSRTRAGLRLPEARIETPAVIAEKAELLILAVPDTDLPALVDDLAVAI
FT                   NPSAIVLHTSGALGVGVLAPLARLGCTTIAFHPAMTFVDDPEDTARLASSCIGITAADE
FT                   VGHAVGQALALEIGAEPVRVPEISRPLYHAALAHGANHLVALVDDAVLALRAALAGGVG
FT                   LDTVGGPEAGLAERVLAPLARAALDNALRTGPAALTGPAARGDAEAVARHLAALDTVDP
FT                   LITDAYRGQSRRAAAQSGTSAMIDPVLEKEDR"
FT   gene            595431..596357
FT                   /locus_tag="Tpau_0567"
FT   CDS_pept        595431..596357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0567"
FT                   /product="pantoate/beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /note="TIGRFAM: pantoate/beta-alanine ligase; KEGG:
FT                   rha:RHA1_ro04415 pantoate--beta-alanine ligase; PFAM:
FT                   Pantoate-beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77207"
FT                   /db_xref="GOA:D5USE0"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/TrEMBL:D5USE0"
FT                   /inference="protein motif:TFAM:TIGR00018"
FT                   /protein_id="ADG77207.1"
FT                   /translation="MSAPTRPYTPGQLTVHHDPAQLTRVTSALKSTGRQIAFVPTMGAL
FT                   HNGHLELVHAAKLTGAVVVVSIFVNPLQFGAGEDLDAYPRTLDADVEKLRAAGVELVFA
FT                   PSAAAMYPNGPRTTIHPGPAGQGLEADSRPTHFAGMLTVVNKLLNIVRPHTAYFGEKDY
FT                   QQLVLVRQMVTDLDMDVKIVGVPTVREPDGLAMSSRNVYLDEAQRDAATALSAALLAGA
FT                   YSAQGGETAILAAAGEVLASRPDVQVEYLELRAPDLGPAPAHGDGRLLVAARLGTTRLL
FT                   DNVGVAIGTGFLSEPEPEPAGAIGGEA"
FT   gene            596360..596767
FT                   /locus_tag="Tpau_0568"
FT   CDS_pept        596360..596767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0568"
FT                   /product="aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /note="TIGRFAM: aspartate 1-decarboxylase; KEGG:
FT                   ami:Amir_0326 aspartate 1-decarboxylase; PFAM: aspartate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77208"
FT                   /db_xref="GOA:D5USE1"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:D5USE1"
FT                   /inference="protein motif:TFAM:TIGR00223"
FT                   /protein_id="ADG77208.1"
FT                   /translation="MLRTMMTSKIHRATVTEANLHYVGSVTVDADLLDAANLLEGEQVA
FT                   IVDVTNGARLETYTIAGERGSGVIGINGAAAHLVSPGDIVILIAYGQLDERELKTYAPS
FT                   VVFVDAENKPVELSTDAARVPDGYGLVTGRI"
FT   gene            596767..597624
FT                   /locus_tag="Tpau_0569"
FT   CDS_pept        596767..597624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0569"
FT                   /product="putative transcriptional acitvator, Baf family"
FT                   /note="KEGG: rha:RHA1_ro04417 transcriptional regulator;
FT                   TIGRFAM: transcriptional activator, Baf family; PFAM: Bvg
FT                   accessory factor"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77209"
FT                   /db_xref="GOA:D5USE2"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:D5USE2"
FT                   /inference="protein motif:TFAM:TIGR00671"
FT                   /protein_id="ADG77209.1"
FT                   /translation="MLLAIDAGNTSVTVGLFAAGTDGGAGELLGTWRLRSDPRMTSDEL
FT                   ALVIRGFLTGPGTEPGFDPAAVTGVTALSTVPELLRSLRAMAPRYYPGAQHVILEPGVK
FT                   TGVPLHVDNPREVGTDRVANAAGAFEVCGRSAGTPCIVVDFGTSTRVDVVSAKGEFLGG
FT                   AIAPGVGSALDALAERTVALRRVELVPPRSVVGKNTVEALQSGIIYGFAGLVDALVRRA
FT                   LETVPDARVIATGGYDDGVAAECATITDRRADLTLQGLRAVYLREIASRATRAERKAHP
FT                   RDSV"
FT   gene            597786..598160
FT                   /locus_tag="Tpau_0570"
FT   CDS_pept        597786..598160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0570"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa4100 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77210"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D5USE3"
FT                   /inference="similar to AA sequence:KEGG:nfa4100"
FT                   /protein_id="ADG77210.1"
FT                   /translation="MHPVHFTPADDAILVDLRDQSERSRDGILPGAVALDAAAVIARLV
FT                   PGLSTSLAAAGPDTRWLLVSGNGATAAAIATRLRDRGVQASSVDGGFRALSLGVTGGTG
FT                   TGTGSESYRRAVAQFAAHEA"
FT   gene            598195..599991
FT                   /locus_tag="Tpau_0571"
FT   CDS_pept        598195..599991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0571"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="TIGRFAM: lysyl-tRNA synthetase; KEGG: sma:SAV_4749
FT                   lysyl-tRNA synthetase; PFAM: Lysyl-tRNA synthetase class
FT                   1c"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77211"
FT                   /db_xref="GOA:D5USE4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002904"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR023386"
FT                   /db_xref="InterPro:IPR042078"
FT                   /db_xref="UniProtKB/TrEMBL:D5USE4"
FT                   /inference="protein motif:TFAM:TIGR00467"
FT                   /protein_id="ADG77211.1"
FT                   /translation="MTVAPVNAPLDDWVTRLADEAVAFAEQNDAPVKVASGISPSGPIH
FT                   LGNLREVMVPHLVADELRRRGRTVEHIISWDDFDRFRKVPTIDGVDETWEQHIGKPLTR
FT                   VPAPYGSDAANWAEHFRRELETALVELGVTYRGISQTQMYSSGAYIDQVLHAMAERQRI
FT                   DAILERYRTLDKAKKGGVTVDQPEADAEAADAASGSADEADGSGDSGYYPYKPYCSVCG
FT                   TDFTTVIGYDDESTALKYQCRCGHTETVILREHTDGKLVWKVDWPMRWAFEKITFEPSG
FT                   VDHQSPGSSFAVGKDVAPIFGWRRPLGPMYAFVGIRGMAKMSSSKGGVPTAAIALRYLE
FT                   PPLLRWLYGRKKPNQSFDVALDGELPRTYDEWDALTRKVAGDKAQPGDIAAYARAASVA
FT                   DPVEGQVRALALTPRTMPYRTLASVVDITTGDDEQTLRILGALEPDEPLTGLDVLRPRL
FT                   DKATTWVAEQMPAQERTVVRTAPDTDLLRGLTDDERAALRLLLDGSGTPAPEGLGRLED
FT                   DWTLAGITHQVYGVAKVQRGLGADQIVKGDKELGAAQRAFFVLLYRLLVGGDTGPRLPT
FT                   LLLAIGAKRVRELVASDRIQPN"
FT   gene            600131..600475
FT                   /locus_tag="Tpau_0572"
FT   CDS_pept        600131..600475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0572"
FT                   /product="Lsr2 protein"
FT                   /note="KEGG: msm:MSMEG_6092 Lsr2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77212"
FT                   /db_xref="InterPro:IPR024412"
FT                   /db_xref="InterPro:IPR042254"
FT                   /db_xref="InterPro:IPR042261"
FT                   /db_xref="UniProtKB/TrEMBL:D5USE5"
FT                   /inference="similar to AA sequence:KEGG:MSMEG_6092"
FT                   /protein_id="ADG77212.1"
FT                   /translation="MARKVTVTLVDDVDDTQTADETVEFGLDGVTYEIDLSAKNAAQLR
FT                   ESLDTWIASARRSGGRKRGARAASAPRGRTPIDRSQSAAIRDWARGAGLKVNDRGRISQ
FT                   DVIDAYNEAN"
FT   gene            600786..603353
FT                   /locus_tag="Tpau_0573"
FT   CDS_pept        600786..603353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0573"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="KEGG: nfa:nfa4150 putative Clp protease; PFAM:
FT                   ATPase AAA-2 domain protein; Clp ATPase-like; AAA ATPase
FT                   central domain protein; UvrB/UvrC protein; ATPase
FT                   associated with various cellular activities AAA_5; Clp
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77213"
FT                   /db_xref="GOA:D5USE6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:D5USE6"
FT                   /inference="protein motif:PFAM:PF07724"
FT                   /protein_id="ADG77213.1"
FT                   /translation="MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVA
FT                   AKALESLGISLEGVRSQVEEIVGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIG
FT                   TEHILLGLIREGEGVAAQVLVKLGADLNRVRQQVIQLLSGYQGKEGGEPAGAGARASSG
FT                   GEAGTPSTSLVLDQFGRNLTAAAAQGKLDPVIGRSKEIERIMQVLSRRTKNNPVLIGEP
FT                   GVGKTAVVEGLAQAIVNGNVPETLKDKQLYTLDLGSLVAGSRYRGDFEERLRKVLKEID
FT                   TRGDIILFIDELHTLVGAGAAEGAIDAASILKPKLARGELQTIGATTLDEYRKYIEKDA
FT                   ALERRFQPVQVGEPSVEHAIEILKGLRDRYEAHHRISITDSALVAAATLADRYINDRFL
FT                   PDKAIDLIDEAGARMRIRRMTAPPDLRQFDDKIADARREKESAIDEQDFEKAASLRDKE
FT                   KQLIGERAEREKQWRAGDLDVVAEVDEEQIAEVLGNWTGIPVFKLTEEETTRLLRMEDE
FT                   LHKRIIGQEDAVKAVSKAIRRTRAGLKDPKRPSGSFIFAGPSGVGKTELSKALANFLFG
FT                   EDDALIQIDMGEFHDRFTASRLFGAPPGYVGYEEGGQLTEKVRRKPFSVVLFDEIEKAH
FT                   SEIYNTLLQVLEDGRLTDGQGRTVDFKNTVLIFTSNLGTGDISKAVGLGFTQGDSDGAN
FT                   YDRMKQKVNDELKKHFRPEFLNRIDDIVVFHQLTQPQIIEMVDLMLSRVAVALKNKDME
FT                   IEVTDQAKSLLAKRGFDPVLGARPLRRTIQREIEDNLSEKILFGELGPGQIVVVDVEGW
FT                   DGEGKGEDAKFVFSGKPKPAPVESESSDDAVPALAGESPSESA"
FT   gene            603501..603611
FT                   /locus_tag="Tpau_0574"
FT   CDS_pept        603501..603611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0574"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77214"
FT                   /db_xref="GOA:D5USE7"
FT                   /db_xref="UniProtKB/TrEMBL:D5USE7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77214.1"
FT                   /translation="MSNRTFRQSLLYYLRVFVSLCALTVPGSTVGFVLAD"
FT   gene            603690..604478
FT                   /locus_tag="Tpau_0575"
FT   CDS_pept        603690..604478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0575"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_4531 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77215"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:D5USE8"
FT                   /inference="similar to AA sequence:KEGG:MXAN_4531"
FT                   /protein_id="ADG77215.1"
FT                   /translation="MLTDAQVEDFIRNGFVRLDGAFSAATAAAARAILWDELTATAGCR
FT                   PDAPSTWVQPVVRLGDHGEEPFRVAATAPAISEAANRLVGSGRWLPRVSLGTFPVRFPS
FT                   DEDPVDTGWHIDASFPGEDPGNFLRWRVNHRSDGRALLMLFLFSDTGPDDAPTRIRVGS
FT                   HLRMAAALQRYGDTGVEVFGMRDEYEATEDLPEAHATGSAGDVYLCHPFLVHAAQPLRP
FT                   GRGRGPRFLAQPPLLPRYRTDLDRRRTAHTPVERAILLGT"
FT   gene            604551..605117
FT                   /locus_tag="Tpau_0576"
FT   CDS_pept        604551..605117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0576"
FT                   /product="flavin reductase domain protein FMN-binding
FT                   protein"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: mul:MUL_4138 oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77216"
FT                   /db_xref="GOA:D5USE9"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D5USE9"
FT                   /inference="protein motif:PFAM:PF01613"
FT                   /protein_id="ADG77216.1"
FT                   /translation="MTVAGPDEPEFDARTFRHVMGQFCTGVTIIGTTSADAKPVGFACQ
FT                   SFAALSLDPPLVLFCPMKTSRTWKHIEASKTFSVSVLGQAQESVSAAFGRPVDDKFEGL
FT                   DWSPSPLGNPTIDGSLTWMDCTLESVLDGGDHHIAIGRVHALGDVSEEKPLLFYRGAYL
FT                   STEHPRLHPASSLESFLTWDAGAWL"
FT   gene            605216..605902
FT                   /locus_tag="Tpau_0577"
FT   CDS_pept        605216..605902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0577"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xca:xccb100_2218 flagellar hook-length control
FT                   protein FliK"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77217"
FT                   /db_xref="UniProtKB/TrEMBL:D5USF0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77217.1"
FT                   /translation="MEGKGDGALSIRQRTLGEIAAAADLTAADVVALSGISRSTIWRLW
FT                   SDAGWLGKISGANANLLAAVVPGVRPYAARAADSVAVQRSAEVCEQAGLEVDWVRVGEM
FT                   VDNGAAARDLVPAMTAAVAMAGGTRDAAQALARCWGKSADGVCDAIFRPADDGGVFVDP
FT                   TAVLQGAERIVDGPANDEPRAVIGRGMALHRLTRNCGYEHAPTEQRNGFPLSSAFKHRG
FT                   AVTGGC"
FT   gene            605896..606276
FT                   /locus_tag="Tpau_0578"
FT   CDS_pept        605896..606276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0578"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77218"
FT                   /db_xref="UniProtKB/TrEMBL:D5USF1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77218.1"
FT                   /translation="MLIGDADVLSHYRALLVREPSLQWAEIWSLASYSKDLSPAAAAPV
FT                   RLPPGRLRGTAEQVLADLDATHAAYQEYLLACAVPLLIQADPRFGNRESQLVTAVSERV
FT                   DSIPAARAALAAIRRYGYRSKR"
FT   gene            complement(606421..606570)
FT                   /pseudo
FT                   /locus_tag="Tpau_0579"
FT   gene            complement(606748..607974)
FT                   /locus_tag="Tpau_0580"
FT   CDS_pept        complement(606748..607974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0580"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   abb:ABBFA_001634 NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77219"
FT                   /db_xref="GOA:D5USF2"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5USF2"
FT                   /inference="protein motif:PFAM:PF00724"
FT                   /protein_id="ADG77219.1"
FT                   /translation="MTESLLSESLVLPCGQALSNRIAKAAMSEQLAKRDGTASDELRRL
FT                   YAVWASGGAGLLLSGNIMIDRDALTEPGNVILDDARGLDQIRAWTGATNGTEAKIWAQI
FT                   NHPGKVAVSPFNRRPIAPSARRSTVPGYNIRKPRELSSSEIGRMIAKYARTAELAVAGG
FT                   FDGVQVHAAHGYLLSQFLSPLSNQRNDEWGGDETRRMRALLETVAAVRAAVGTGIPVSV
FT                   KLNSTDFLRGGFDSDQALTVALALGEAGIDLLEISGGGYEQPAMTGVAAGQETGADGRG
FT                   YFFEFAQRIRAASTVPIMLTGGLRNPVAMEEILAGGVVDVIGVGRPLTFLPDYPRQLLN
FT                   GRAPALPKSAPRVGYRPADGYLELAWHNNQLHRIAAGNTPQRRPGIRTLAQSLSRITVA
FT                   AGKQMSIPR"
FT   gene            complement(607980..608744)
FT                   /pseudo
FT                   /locus_tag="Tpau_0581"
FT   gene            complement(608741..609541)
FT                   /locus_tag="Tpau_0582"
FT   CDS_pept        complement(608741..609541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0582"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; NAD-dependent epimerase/dehydratase; KEGG:
FT                   abb:ABBFA_001631 short chain dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77220"
FT                   /db_xref="GOA:D5UST3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5UST3"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADG77220.1"
FT                   /translation="MSLPNPTPDSRIVVTGASSGIGEALAESFARRGHSLILVARREDR
FT                   LRTLAERLAARYVVQADVEPCDLADAAQRTELIRRLGKVDISGLCLNAGFATYGSILEL
FT                   DADREREQVEVNVVAVHDILVGLLPALVARGSGVVLITGSTAGNQPSPNNATYAASKAF
FT                   ANTLSESLHGELAGSGVTCTLLAPGPVRTEFAEVSNLGAIEQHLPGFAWVSAAAAAEAA
FT                   VRGATAGRRRVVPGATAKLQDFGGKYTPRTILNPILRKAYGDFR"
FT   gene            complement(609538..610887)
FT                   /locus_tag="Tpau_0583"
FT   CDS_pept        complement(609538..610887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0583"
FT                   /product="flavin-containing monooxygenase FMO"
FT                   /note="PFAM: flavin-containing monooxygenase FMO; KEGG:
FT                   cyc:PCC7424_4856 flavin-containing monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77221"
FT                   /db_xref="GOA:D5UST4"
FT                   /db_xref="InterPro:IPR000960"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5UST4"
FT                   /inference="protein motif:PFAM:PF00743"
FT                   /protein_id="ADG77221.1"
FT                   /translation="MDNRRDRVCVIGAGYVGNGVAGALKRAGVPYDQIEATDRIGGNWS
FT                   HGVYDSTHLISSKSSTQYVEFPMPADYPTFPSRAQMLAYLQSYVDHYGLTEHIEFDTEV
FT                   VDVRPVDANGMAGWFVRLASGEERRYRAVVVANGHYWERNLPQYPGEFTGTQLHSKDYK
FT                   QPADFAEGGRVLVVGAGNSASDIAVEASATFGSADISMRRGYWFIPKAMFGIPVSELDR
FT                   VWWPMPLQRAGFKVMLRLSYGDYKRYGLKRPDHKLFTRDVTVNTSLMYALQHGKVRPRP
FT                   EIERFDGATVHFTDGTSADYDTVVWATGFHTRFPMLDESMFVWENGDPLLIEHVLAPRF
FT                   ANIYLMGLVAPRSGAGRIISHGSAFLAEAIPAQAHFAEPLSDVVARWIPAHSSMLAGSA
FT                   EILGRIRLLRQALRLLVAASVLRPRTPGLRTSAPPATAPVDSTPKESIPS"
FT   gene            611083..611706
FT                   /locus_tag="Tpau_0584"
FT   CDS_pept        611083..611706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0584"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: msm:MSMEG_2368
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77222"
FT                   /db_xref="GOA:D5UST5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D5UST5"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG77222.1"
FT                   /translation="MTDAVKSEARRPYAPRMTPADRREQLLDAVLRVVVERGVHKVSIE
FT                   SVAEAAGVTRPVVYKHFDDSAALLRASLAREEGRALAQCYAAGARAKEQVVEPDFVVAL
FT                   YANLLEMFEASPDLWSAILQLVDSATPEFRRTVERGRDQAAAMVADVVTANTDTGVGGG
FT                   DPELYARMIVALVIESGRLLLARPDVFPRERLVLGAREMLARLR"
FT   gene            complement(611784..612470)
FT                   /locus_tag="Tpau_0585"
FT   CDS_pept        complement(611784..612470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0585"
FT                   /product="protein of unknown function DUF308 membrane"
FT                   /note="PFAM: protein of unknown function DUF308 membrane;
FT                   KEGG: nfa:nfa31070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77223"
FT                   /db_xref="GOA:D5UST6"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="UniProtKB/TrEMBL:D5UST6"
FT                   /inference="protein motif:PFAM:PF03729"
FT                   /protein_id="ADG77223.1"
FT                   /translation="MTTKSLLREDIETKTKQAWWSLLALGALSILFGVVVLVWPGPTTL
FT                   VAGIMFGIFLIVGGIVQVVAGIIGDTENRWLSVISGALSLVLGAFCFRDDIANSVAVLG
FT                   IFIGIGWIFGGVWQITAGIAGKHLPNRTWTVIAGILTLIGGFVLIASPWDSMIILMVVT
FT                   GIFAIAIGIVEIIGAFRLRSTAKQVGQGVDDVTGAVSQKVDAVTGRVQDAKDRVRGTEG
FT                   DQPTAE"
FT   gene            complement(612551..612877)
FT                   /locus_tag="Tpau_0586"
FT   CDS_pept        complement(612551..612877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0586"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   rha:RHA1_ro04436 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77224"
FT                   /db_xref="GOA:D5UST7"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D5UST7"
FT                   /inference="protein motif:PFAM:PF03992"
FT                   /protein_id="ADG77224.1"
FT                   /translation="MKINAIHVPEAAGPELEKRFAARAHAVENSPGFLGFQLLRPVKGD
FT                   DRYFVVTHWESEDAFTAWREGPAREAHAGRHDPNGGEERKPVSTGADLLEFDVVLDFPA
FT                   KSAP"
FT   gene            612912..613688
FT                   /locus_tag="Tpau_0587"
FT   CDS_pept        612912..613688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0587"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; PGAP1 family
FT                   protein; KEGG: mgi:Mflv_1435 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77225"
FT                   /db_xref="GOA:D5UST8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5UST8"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADG77225.1"
FT                   /translation="MFVDECVGLRDWGGHGDGRPIVLLHGLMGRGRTWRRQIPWLRRYG
FT                   RVFTFDAEFHRGTGLPVPGGDVSTERFVADVAEILTVLDQGPAVLVGHSMGGLHAWCTA
FT                   AEYPELVDALVVEDMSPEFTGQSTDTWAPWFASWPDRFATQGQCEELFGAVAGRYFYEA
FT                   FDDGVLHGDLETFRAIADHWGLRDHWDQWRAVAVPTLLIEAEFSVVPSGVGDRMVRDYA
FT                   GPDLRYVRFDGAGHLAHDDAPDRYRGAVEAFLSGLD"
FT   gene            613691..614476
FT                   /locus_tag="Tpau_0588"
FT   CDS_pept        613691..614476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0588"
FT                   /product="DNA glycosylase/AP lyase, H2TH DNA-binding
FT                   protein"
FT                   /note="PFAM: DNA glycosylase/AP lyase, H2TH DNA-binding;
FT                   Formamidopyrimidine-DNA glycosylase catalytic domain
FT                   protein; KEGG: rer:RER_20980 DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77226"
FT                   /db_xref="GOA:D5UST9"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:D5UST9"
FT                   /inference="protein motif:PFAM:PF06831"
FT                   /protein_id="ADG77226.1"
FT                   /translation="MPEGDTLHNLAARLRPVLAGRVLTGCDLRVPRYATVDLTGRTVDD
FT                   VSARGKHLLIAAGDLTLHSHLKMEGQWHVYRPGERWRRPGHTARAVLAVDGAQVVGFSL
FT                   GFLEVLRTAAVDDALAHLGPDPLGPQWDPERAAENLAATPARPVGLALLDQRNLAGIGN
FT                   VYRNELCFVRGVHPAMEVAACGDLRGWVDDAARLLRANAGRSVRVTTGVDRNGLRAFVY
FT                   DRARRPCLRCGTAISAGSLGADGEAERTIWWCPRCQDAN"
FT   gene            614555..615490
FT                   /locus_tag="Tpau_0589"
FT   CDS_pept        614555..615490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0589"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: rsa:RSal33209_1125 short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77227"
FT                   /db_xref="GOA:D5USU0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5USU0"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADG77227.1"
FT                   /translation="MYQVSDQSGKTFVITGSNSGTGKEAAKRLAAAGAKVVMAVRTPAK
FT                   GEAARAEIRAAVPGADIEVRRLDLADLTSVQAFADGILADRVAIDVLVNNAGVMTPPER
FT                   FETADGFELQFGSNFLGPFALTNLLLPVLLESAAPRVTTMSSGVANFGRIDFADPQSVR
FT                   RYSPARAYAQSKLADLLFANHLAAVSDRRRWGLLSDAAHPGYTQTNLQTAGASLGKDRE
FT                   RESIITRFGSRILPSQQPEQGAEPLLFAASDPQARNGEYYGPQRRFGLVGPTGVTKKNS
FT                   RMRDAEVAAKLWKYAAEVTGTDLPSDAARA"
FT   gene            615474..616043
FT                   /locus_tag="Tpau_0590"
FT   CDS_pept        615474..616043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0590"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sco:SCO4008
FT                   TetR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77228"
FT                   /db_xref="GOA:D5USU1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041467"
FT                   /db_xref="UniProtKB/TrEMBL:D5USU1"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG77228.1"
FT                   /translation="MPPAPRQQRDAAATKARLLDAATAEFAEYGLAGARVDRIATAAEA
FT                   NKQLIYAYFGNKRQLFDAVIEFRVADLLETVPFTADDLSGYAVRLRAFNRAHPELMRLV
FT                   LWHTLECPGELAELELASGSNAKKIAALQAAQDAGTVTAGTPAPTLLIEILALIHGDIL
FT                   TAGGDVAALALDDAALAAAVEKLTAP"
FT   gene            complement(616044..616760)
FT                   /locus_tag="Tpau_0591"
FT   CDS_pept        complement(616044..616760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0591"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: sma:SAV_6393
FT                   protein dithiol-disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77229"
FT                   /db_xref="GOA:D5USU2"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5USU2"
FT                   /inference="protein motif:PFAM:PF01323"
FT                   /protein_id="ADG77229.1"
FT                   /translation="MRVDVWTDINCPFCYIGKARFDKALATFEHASDVQVIHRSFELDP
FT                   SAAEGSSEPVVPMIAKKYGISEAEAAANERGLGAQAQELGLQYQVAGRDAGNSFDMHRL
FT                   LHWALELGRQEELLDALYAANFASPEPAFGDRNRLVAIAESAGFDGAAARAVLDDETAY
FT                   ADAVRADEATASRIGVGGVPFFVFDGKYAVSGAQLPSVFTEALDRAWADRPEPLTVIGG
FT                   DDAACGPDGCELPPRG"
FT   gene            complement(616806..616970)
FT                   /locus_tag="Tpau_0592"
FT   CDS_pept        complement(616806..616970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0592"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77230"
FT                   /db_xref="GOA:D5USU3"
FT                   /db_xref="UniProtKB/TrEMBL:D5USU3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77230.1"
FT                   /translation="MSPLKTSGDRVNADPEDDLDPWPDPMVTAITALTAILVGALLVIL
FT                   YLASSLNLW"
FT   gene            complement(617059..617904)
FT                   /locus_tag="Tpau_0593"
FT   CDS_pept        complement(617059..617904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0593"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; Male
FT                   sterility domain; KEGG: nfa:nfa10990 putative short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77231"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5USU4"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADG77231.1"
FT                   /translation="MTTPTYVVTGANGGLGQVVTRRLAATGGRVVMACRDIDGARRIAD
FT                   GIDGDITVGKLDLGDLDSVRAFADSVGDVDVLVNNAGLMNIPLKRTKQGFEMQFGVNHL
FT                   GHFLLTGLLLDRLTDRVVAVSSVAHRQNFRWRMDDPNYEHRKYLRSEAYGQSKLANMMF
FT                   ARELQRRFEAAGSDKRAYYVHPGVSPTGLFTRTETPLDRVARQAVALLSNPPEQAAEAL
FT                   VLAATDRDLDPHPWWGPSQLFQTRGKVGKCSTTAESKDKTKWAELWDVSERLTGFTYPV
FT                   "
FT   gene            complement(617914..618891)
FT                   /locus_tag="Tpau_0594"
FT   CDS_pept        complement(617914..618891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0594"
FT                   /product="Protein of unknown function DUF2236"
FT                   /note="PFAM: Protein of unknown function DUF2236; KEGG:
FT                   rer:RER_04190 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77232"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:D5USU5"
FT                   /inference="protein motif:PFAM:PF09995"
FT                   /protein_id="ADG77232.1"
FT                   /translation="MKLSDGPLRVTDQGFFGPESPTWKVWASPTALIGFQRSVVLEHFD
FT                   PNLTAAVADSAGIYTDPFGRLDRTLAYFLLVATADSKTAIEASEHLMDVHRKATGIEPI
FT                   TGKRYSANNPASQLWIHVTGWHSVLTCYETYGPGPLTPTEEAQYWRDCVLAAELQTCDP
FT                   AEVPTSRDEVRAYFDRVRPGLALTERARRGMHYLLRPRDRGARLRIGGSLIAPATIATL
FT                   PRWMREMGGFDQPRMADAAYPRVVRLAVRAASARHAAGTVALGTLVAPMTGAILRRHFA
FT                   QRAEPAAGVVTPAQARERYGRTASDNADATHSVASSEAPFLTPK"
FT   gene            complement(618937..619848)
FT                   /locus_tag="Tpau_0595"
FT   CDS_pept        complement(618937..619848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0595"
FT                   /product="HhH-GPD family protein"
FT                   /note="KEGG: nfa:nfa4290 putative A/G-specific adenine
FT                   glycosylase; PFAM: HhH-GPD family protein;
FT                   helix-hairpin-helix motif; iron-sulfur cluster loop; SMART:
FT                   HhH-GPD family protein; iron-sulfur cluster loop"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77233"
FT                   /db_xref="GOA:D5USU6"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:D5USU6"
FT                   /inference="protein motif:PFAM:PF00730"
FT                   /protein_id="ADG77233.1"
FT                   /translation="MQRSHDPGPKIDSDFTSVLHWFDRTERDLPWRADGVTPWQILMSE
FT                   VMLQQTPVVRVEAMWREWVRRWPTPADLAAATGADAVRAWGKLGYPRRAMRLHACAQAI
FT                   VAEHAGVVPETVEELLALPGIGDYTARAVACFAFGQDVPVVDINVRRVLARAVAGDSDA
FT                   AAPSARRDLAAATEVLETVPAQRRPRLSAALMELGALVCTARSPRCGECPVHAGCAWLA
FT                   AGAPEGTVAPRKVQKYEGTDRQARGRLLDVLRAADGAVPRAALDLAWERDTAQRDRALD
FT                   SLLLDGLIEQTDDGRFALSGEA"
FT   gene            619867..620520
FT                   /locus_tag="Tpau_0596"
FT   CDS_pept        619867..620520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0596"
FT                   /product="carbonic anhydrase"
FT                   /note="PFAM: carbonic anhydrase; KEGG: rop:ROP_43660
FT                   carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77234"
FT                   /db_xref="GOA:D5USU7"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:D5USU7"
FT                   /inference="protein motif:PFAM:PF00484"
FT                   /protein_id="ADG77234.1"
FT                   /translation="MPTSTPPGAWRALRDGNRRFVDGKSIHPNQGHARIAELAAGQSPT
FT                   AVLFGCGDSRVAAEVIFDQGLGDMFVVRTAGHIIDSAVLGSIEYAIEVLNVPLIAILGH
FT                   DSCGAVAATVNSIDTGTVPPGFIRDIVERLTPSILAGRREGLTEVNEFTAQHVQETAQL
FT                   LQERSRIIADHVADGRVAIVGLTYELAEGKVHLRSVVGDIGEAPTTPFQAVDAS"
FT   gene            620581..621375
FT                   /locus_tag="Tpau_0597"
FT   CDS_pept        620581..621375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0597"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro04450 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77235"
FT                   /db_xref="GOA:D5USU8"
FT                   /db_xref="InterPro:IPR020481"
FT                   /db_xref="UniProtKB/TrEMBL:D5USU8"
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro04450"
FT                   /protein_id="ADG77235.1"
FT                   /translation="MLEPNGPLPPEIYWRRRVLAAALAALAVLVVVLLIVFVGGGKDSS
FT                   EPAAADSSSATQTDLPSSQPPSSGESGAPGGGSAAGQSGAPQSGASPSGAPQSGAQSSG
FT                   APQSGGGVPTPGAVVAGGPCPDTNISVVVAADKPSYAVGEQPTFEATVTNAGSVPCSRD
FT                   IGTGQQQLAVLTLDGSKQLWSNFDCTFQPEIKNEVLQPGQQIRYKLQWAGTTSAPGCQA
FT                   QRVPVAPGAYQVVAQFGAKRSAPVTFNVTKPAPPAPVPAPGG"
FT   gene            complement(621372..622454)
FT                   /locus_tag="Tpau_0598"
FT   CDS_pept        complement(621372..622454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0598"
FT                   /product="protein of unknown function DUF147"
FT                   /note="PFAM: protein of unknown function DUF147; DNA
FT                   integrity scanning, DisA, linker region; KEGG:
FT                   rer:RER_06820 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77236"
FT                   /db_xref="GOA:D5USU9"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="UniProtKB/TrEMBL:D5USU9"
FT                   /inference="protein motif:PFAM:PF02457"
FT                   /protein_id="ADG77236.1"
FT                   /translation="MDLDVADRAFAGNAALRETVTRVAPGTGLRDGIERILRGRTGALI
FT                   VLGYDDTVERICDGGFHLDVEFAPTRLRELSKMDGAVVLSTDGSRIVRANVQLVPDPAI
FT                   PTQESGTRHRSAERTAIETGFPVISVSASMSIVHAYVAGVRHVVEDAAPILSRANLAIA
FT                   TLERYRHRLDEVLGELSRAEIEDVVAVREVAHVVQRLELVRRLAIEIEQSVLELGTSGR
FT                   QIALQLEDLLGEAVSLRDPVLRDYLPGDADVGEVVARIDGLSDADLLTASTVAAALGFS
FT                   DTVEAQDQPVSPRGYRLLGSIPRLQRHQIEALVAAFGSLQTLLAASAADLQGVPGIGAV
FT                   WARQVREGLSRLSELSVERY"
FT   gene            complement(622465..623850)
FT                   /locus_tag="Tpau_0599"
FT   CDS_pept        complement(622465..623850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0599"
FT                   /product="DNA repair protein RadA"
FT                   /note="KEGG: rop:ROP_43750 DNA repair protein RadA;
FT                   TIGRFAM: DNA repair protein RadA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77237"
FT                   /db_xref="GOA:D5USV0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:D5USV0"
FT                   /inference="protein motif:TFAM:TIGR00416"
FT                   /protein_id="ADG77237.1"
FT                   /translation="MAKPKVQYTCSECGHTVAKWVGRCPSCGAWSTMEEGAPARVGGGS
FT                   GPTAHVGLTLPSTPAVPITRIDPNSTRALPVGIGELDRVLGGGIVPGSVILLAGEPGVG
FT                   KSTLLLDVVHRWASTGRGKSLYVTGEESAGQVRLRAERTGALSDELYLAAESDLGTVLG
FT                   HVEQISPTLMVVDSVQTLSASGVDGVHGGVTQVRAITATLTSLAKASGIAVILVGHVTK
FT                   DGAVAGPRSLEHLVDVVLSFEGDKHSTLRMVRGIKNRFGASDEVGCFEQRESGIAQVTD
FT                   PSGLFLHHRDQAAAGTAVTVGLDGKRPMLGELQALVTPTPLPQPRRAVSGLDSARVAMI
FT                   LAVLTKHGGIENLAQKDVYAATVGGMKITEPAADLALALAIASGAADTALRPNTVVLGE
FT                   VGLAGEVRRVTGVERRLAEAHRMGFTHAIVPPAQERLRVGDMRIAEAATVAEAVRLSRQ
FT                   RKG"
FT   gene            complement(623892..624482)
FT                   /locus_tag="Tpau_0600"
FT   CDS_pept        complement(623892..624482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0600"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro04458 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77238"
FT                   /db_xref="UniProtKB/TrEMBL:D5USV1"
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro04458"
FT                   /protein_id="ADG77238.1"
FT                   /translation="MSARTVSTRRTLTAAAGALLATGALLSVSACGAGQISQTANQVAA
FT                   INGANHNFVDQKKVLSDVHVLYPVTAGQGKLAFVLSNIDPDNKNGGDRLVAITDQNGRN
FT                   ATISGDTSLPAGGSLYGAAPQGSDDNADLTRLKVTLPVDGSWRPGLTNELTFHLQKSGA
FT                   LKIAVPLDAGALPASAAGVTVTGGAEGEKKGGH"
FT   gene            624817..625305
FT                   /locus_tag="Tpau_0601"
FT   CDS_pept        624817..625305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0601"
FT                   /product="transcriptional regulator, CarD family"
FT                   /note="PFAM: transcription factor CarD; KEGG: nfa:nfa4350
FT                   putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77239"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:D5USV2"
FT                   /inference="protein motif:PFAM:PF02559"
FT                   /protein_id="ADG77239.1"
FT                   /translation="MIFKVGDTVVYPHHGAALIEAIEIKTIGGREREYLVLKVAQGDLT
FT                   VKVPAENAEVVGVRDVVGQEGLDKVFQVLRAPHTEEPTNWSRRYKANLEKLASGDVNKV
FT                   AEVVRDLWRREQDRGLSAGEKRMLTKARQILVGELALAEATDDGKAESLLDEALAAAS"
FT   gene            625302..625964
FT                   /locus_tag="Tpau_0602"
FT   CDS_pept        625302..625964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0602"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="KEGG: rha:RHA1_ro04460 2-C-methyl-D-erythritol 4-
FT                   phosphate cytidylyltransferase; TIGRFAM:
FT                   2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase;
FT                   PFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77240"
FT                   /db_xref="GOA:D5USV3"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:D5USV3"
FT                   /inference="protein motif:TFAM:TIGR00453"
FT                   /protein_id="ADG77240.1"
FT                   /translation="MTVVALVPAAGQGTRLGLNRPKAFVTLQGRSLLERAVDGLFASGA
FT                   VDEVVVMVPADLVDDARALVPRARVVVGGAERTDSVRAGLAAAGDADLVLVHDAARPLT
FT                   PGPMIHRVVAALREGASAVIPVLPVADTIKRVDAGGAVAATVDRADLRAVQTPQGFTAQ
FT                   ALRAAYDAAPNESATDDAGLVERAGGTVATVTGDPLAMKITTAFDLRIAEVLAQEHK"
FT   gene            625961..626434
FT                   /locus_tag="Tpau_0603"
FT   CDS_pept        625961..626434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0603"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /note="TIGRFAM: 2C-methyl-D-erythritol 2,4-
FT                   cyclodiphosphate synthase; KEGG: mjl:Mjls_5124
FT                   2-C-methyl-D-erythritol 2,4- cyclodiphosphate synthase;
FT                   PFAM: MECDP-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77241"
FT                   /db_xref="GOA:D5USV4"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:D5USV4"
FT                   /inference="protein motif:TFAM:TIGR00151"
FT                   /protein_id="ADG77241.1"
FT                   /translation="MIIPRVGIGTDVHPVEPGRECWMLGLLFDGDGCSGHSDGDVAVHA
FT                   LCDALLSAGGLGDLGTVFGVGRSDNVGITGAEMLTHVRTLLSEAGFAVGNAAVQLIGNR
FT                   PKVGPRRDEAQQVLSELLGAPVSVSATTTDGLGLTGRGEGIAAVATALIYAAS"
FT   gene            complement(626419..627342)
FT                   /locus_tag="Tpau_0604"
FT   CDS_pept        complement(626419..627342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0604"
FT                   /product="RarD protein, DMT superfamily transporter"
FT                   /note="KEGG: kse:Ksed_21390 RarD protein; TIGRFAM: RarD
FT                   protein, DMT superfamily transporter; PFAM: protein of
FT                   unknown function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77242"
FT                   /db_xref="GOA:D5USV5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:D5USV5"
FT                   /inference="protein motif:TFAM:TIGR00688"
FT                   /protein_id="ADG77242.1"
FT                   /translation="MTDRDVSEATRGTAMGVAAYLLWGLFPLYFDALKPTGPWEILAHR
FT                   ILWTLVLCGAALVILRDLGWIRPVLRQPRLLAGVTIAALLISTNWIVYIVAVTSGHTSD
FT                   AALGYFLNPLVTVALGVVVLRERLRPLQWVAVGIGVLAFIYLAVVAGTFPVTALALAFS
FT                   FGLYGLVKNRVGVHLNALQGLTLETAILAPIAAAVLVGIGIWGGGLDFARHGAGHAALL
FT                   AFAGVATAVPLLLFAAAARRIPLVTIGLIQFATPIMQLLCAVLFLDEHVSPERWVGFGI
FT                   VWVALILLTLDTVLALRRTRSGQLAA"
FT   gene            627428..628825
FT                   /locus_tag="Tpau_0605"
FT   CDS_pept        627428..628825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0605"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="TIGRFAM: cysteinyl-tRNA synthetase; KEGG:
FT                   rha:RHA1_ro04462 cysteinyl-tRNA synthetase; PFAM:
FT                   Cysteinyl-tRNA synthetase class Ia ; Cysteinyl-tRNA
FT                   synthetase class Ia DALR; tRNA synthetase class I (M)"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77243"
FT                   /db_xref="GOA:D5USV6"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:D5USV6"
FT                   /inference="protein motif:TFAM:TIGR00435"
FT                   /protein_id="ADG77243.1"
FT                   /translation="MTLRLYDSLTREVRDFVPLVEGKAGIYLCGATVQGVPHIGHIRSG
FT                   VAFDVLRRWLLATGLDVAFVRNVTDIDDKILRKAAEAGRPWWEWAATHEREFTRAYDAL
FT                   GVLPPSAEPRATGFITQMVTYMERMIERGHAYASAGDVYFSVRSLPDYGALSRQKVDDV
FT                   QQGETLAAGKRDPLDFTLWKAAKPGEPSWPSPWGDGRPGWHLECSAMATSYLGGQFDIH
FT                   CGGMDLVFPHHENEIAQAHGAGDPFANYWLHNGWVTMSGEKMSKSLGNVVSIPNLLTQV
FT                   RAVELRYYLGSAHYRSMQEYSAGALAEAATAYGRIESFVQRTVERTGEVPVGQWSAGFA
FT                   AALDDDLGVPSALAEVHAAVRAGNAALEAGDLDEARRLAGAVRAMTSILGVDPLDPHWV
FT                   TENAGDGAAMDALGVLVQAELERRAAARAEKNWAEADAARDRLHAAGIDVTDGADGSSW
FT                   TLAKKTQ"
FT   gene            628840..629814
FT                   /locus_tag="Tpau_0606"
FT   CDS_pept        628840..629814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0606"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="KEGG: nfa:nfa4390 putative tRNA/rRNA
FT                   methyltransferase; TIGRFAM: RNA methyltransferase, TrmH
FT                   family, group 3; PFAM: tRNA/rRNA methyltransferase (SpoU);
FT                   RNA 2-O ribose methyltransferase substrate binding"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77244"
FT                   /db_xref="GOA:D5USV7"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:D5USV7"
FT                   /inference="protein motif:TFAM:TIGR00186"
FT                   /protein_id="ADG77244.1"
FT                   /translation="MAGNSQRRGAVRKSGTKKGQVTGSGGVRRRGLEGRGATPAAKDRP
FT                   YHPAHKKARAAAKAAANPQRRPQKVAGRAAEDGPEYVLGRNPVVECLRADVPATALYVA
FT                   VGAQNDERLTESVRMAADKGISILEVQRAELDRMSENGLHQGIALQIPPYSYAHPEDLL
FT                   RRAADRGEAPMIVALDNITDPRNLGAVIRSAAAFGGHGVVIPSRRSAAITAVTWRTSAG
FT                   AAARLPVAQAPNLNRTLADYAAAGLQIVGLDAGGDVTLDDYRADTGVVVVVGSEGKGLS
FT                   RLVRENCDSILSIPIASSVESLNASVAAGVVLADFARQRRNRN"
FT   gene            629868..630452
FT                   /locus_tag="Tpau_0607"
FT   CDS_pept        629868..630452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0607"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /note="KEGG: rop:ROP_63290 putative TetR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77245"
FT                   /db_xref="GOA:D5USV8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D5USV8"
FT                   /inference="similar to AA sequence:KEGG:ROP_63290"
FT                   /protein_id="ADG77245.1"
FT                   /translation="MDSLEQRQHARRRTMLDAGVGLLGGPDGATVSVRAVCRSTGITER
FT                   YFYEAFGNRDEFVRAVYDDVSHRAQDALRETVRGTASLPDLPAAAVAAYVELVIDQPEL
FT                   GRVLLLAPYRETALAEYGRGHMAGFFDVVGAALPQNIDAQSRRLASVGMVGALTALFTE
FT                   FLSGHLAVSREDLVSYCVDLLNTYAGPITRA"
FT   gene            complement(630461..631222)
FT                   /locus_tag="Tpau_0608"
FT   CDS_pept        complement(630461..631222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0608"
FT                   /product="LamB/YcsF family protein"
FT                   /note="PFAM: LamB/YcsF family protein; KEGG: rer:RER_07000
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77246"
FT                   /db_xref="GOA:D5USV9"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D5USV9"
FT                   /inference="protein motif:PFAM:PF03746"
FT                   /protein_id="ADG77246.1"
FT                   /translation="MTQRIDLNADCGESYGAWRLGDDDALLGIVSSANVACGFHAGDPS
FT                   TLRATCARAVEQGVRIGAQVGYADVRGFGRRFIEVPPADLTADVIYQIGALQAIARSVG
FT                   GEVTYVKPHGALYNAIVGHTSQARAVVDGVLACTSGLPVLGLPGSEFLRIAAEQGLHPV
FT                   AEAFADRAYTPEGTLVPRSHPGSVLHDPDEIAARVVRMVFDDTVEAIDGTEVELHADSV
FT                   CLHGDNPEAVRVAARLRTVLEGAGAEIAPFN"
FT   gene            complement(631233..632117)
FT                   /locus_tag="Tpau_0609"
FT   CDS_pept        complement(631233..632117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0609"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein; KEGG: rop:ROP_44050 putative
FT                   ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77247"
FT                   /db_xref="GOA:D5USW0"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D5USW0"
FT                   /inference="protein motif:PFAM:PF00950"
FT                   /protein_id="ADG77247.1"
FT                   /translation="MDRLRHFFDIDLTAELLAQPFVQQALLAAALLAILAGIMGPLIVS
FT                   RQMAFSVHGTSELSLTGASFALLMGWSVGSGALAGALIAGLLFGLLGVYARERDSVIGV
FT                   IMSFGLGLSVLFLALYPGRQGTAFALLTGQIVAVGMSGVTLMAITTVVVLVILAFIYRP
FT                   LLFLSTDPDVAAARGVPAKTLSVVFAMLVGAAAAQGVQIVGALLVMSLLITPAAAAARV
FT                   TSSPGKATLLSLAFAMTAAVGGIVLSLAPALPVSVFVTSISFLIYVVCRIIGQRGRRGT
FT                   EAPEEVHDHRHAH"
FT   gene            complement(632118..632864)
FT                   /locus_tag="Tpau_0610"
FT   CDS_pept        complement(632118..632864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0610"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: nfa:nfa4440 putative ABC transporter ATP-
FT                   binding protein; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77248"
FT                   /db_xref="GOA:D5USW1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5USW1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG77248.1"
FT                   /translation="MTEPVVSLRGAALAYRDRTLWDGLDLDVAPGEFVAVLGPNGAGKT
FT                   SLLRVLLGQAALSAGTVDVRGRLGYIPQQRALDAAVPLRGRDLVGLGYDGASWGIGLRR
FT                   RAERRSAVDAALAQVDAQPFADAPVGSLSGGEQQRLRVAQALASDPAVLLCDEPLLSLD
FT                   PGHQQLAVALIERRRREHDTAVLFVTHEINPVLPHCDRVLYLVDGRFEVGATAEVMTSE
FT                   TLSRLYRAPVDVLHVRDRLVVVGGEG"
FT   gene            complement(632861..633757)
FT                   /locus_tag="Tpau_0611"
FT   CDS_pept        complement(632861..633757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0611"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   rop:ROP_44070 putative ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77249"
FT                   /db_xref="GOA:D5USW2"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:D5USW2"
FT                   /inference="protein motif:PFAM:PF01297"
FT                   /protein_id="ADG77249.1"
FT                   /translation="MRIRNRLAQAVAVTAVATLTLTACGQASSEPADGKPSVVASTDVY
FT                   GAVAKAVAGDHATVTSLFSNPTGDPHEFEPSAQDTLAVKRAAVIVYNGGHYDAYIEKAA
FT                   EGATGAKVDAVSQQEPRGENEHVFYDLPTIQKVATAIAKALSAKDSANTTDYEAKAAAF
FT                   NSRLDVVIDRAREIGRANPGAKVAATEPVAGYLLTLAGLTDATPPRYTAAIESGTDPAP
FT                   ADIAAATALVTGKQVRAVILNAQTESPVTTAFATSAQSAGVPVVRITESLPEGVDDYVA
FT                   WQDKNVTQLADALKPRP"
FT   gene            complement(633836..634261)
FT                   /locus_tag="Tpau_0612"
FT   CDS_pept        complement(633836..634261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0612"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mgi:Mflv_3147 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77250"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:D5USW3"
FT                   /inference="similar to AA sequence:KEGG:Mflv_3147"
FT                   /protein_id="ADG77250.1"
FT                   /translation="MQEFRDAVLAKDPEAMERTLADDVRFTSPVAFKPYEGRHITAAIL
FT                   RGVLRVMGGDDFRYVREIASADGRDHALVFTTTLDGKEVNGCDFLHLNDDGKIDEFTVM
FT                   VRPLSAAQALAAAMGAQFDRIATEAAEAARAEAAPQS"
FT   gene            634359..634916
FT                   /locus_tag="Tpau_0613"
FT   CDS_pept        634359..634916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0613"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: Transcriptional regulator PadR-like;
FT                   transcriptional regulator PadR family protein; KEGG:
FT                   mav:MAV_0135 transcriptional regulator, PadR family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77251"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR018309"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5USW4"
FT                   /inference="protein motif:PFAM:PF10400"
FT                   /protein_id="ADG77251.1"
FT                   /translation="MALRHAILATLLVVEEASGYDLAKEFDGARAHFWTATPQQLYREL
FT                   DRMEADGAIVARTVEQEKRPNKRVFRVTADGRTELAAFSERSPKPMAIRDDFLVMVQGA
FT                   QAGDVAAICANLRLRRDAAAAKLAHYERVRARWLEGRTEAGLLADHRLGGPYLTLLRGL
FT                   RFEQENLDWYDLALPVLEARLP"
FT   gene            634921..635544
FT                   /locus_tag="Tpau_0614"
FT   CDS_pept        634921..635544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0614"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   chl:Chy400_0736 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77252"
FT                   /db_xref="GOA:D5USW5"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:D5USW5"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ADG77252.1"
FT                   /translation="MSSPLFAAAGFGLAVLPICLTPGVSFTLVTDRALTSGPRAAGSVI
FT                   LGTVLGLLTHALLAAAGLSAVVMASAEAFLVVKLLGAGYLVGLGLWMIRTSLRGAPASA
FT                   PAVPWHRGGDVVRGYLGNVLNPKAAAVYLTLAPQFLDPGVPVAPQLLWLWMAHAVVAAG
FT                   WLLVWGGVVTAIRRRVDLRRFRRRITGFGGVVMVGLGVRSAVAR"
FT   gene            635625..636392
FT                   /locus_tag="Tpau_0615"
FT   CDS_pept        635625..636392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0615"
FT                   /product="protocatechuate 3,4-dioxygenase, beta subunit"
FT                   /note="KEGG: ach:Achl_3854 protocatechuate 3,4-
FT                   dioxygenase, beta subunit; TIGRFAM: protocatechuate
FT                   3,4-dioxygenase, beta subunit; PFAM: intradiol
FT                   ring-cleavage dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77253"
FT                   /db_xref="GOA:D5USW6"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012785"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="InterPro:IPR024756"
FT                   /db_xref="UniProtKB/TrEMBL:D5USW6"
FT                   /inference="protein motif:TFAM:TIGR02422"
FT                   /protein_id="ADG77253.1"
FT                   /translation="MDDDQRAISAEIAELSEAYRVGAAPESTARRDYPPYRSSLLRHPT
FT                   KRLHPADPEGVEMLSPVFGQQDVHPLESDLTIHHGGEPLGERITVSGHVLDGAGRPVAG
FT                   QLVEIWQANASGRYVHKRDQHPAPIDPNFTGVGRCLTGPDGSYRFTTVKPGAYPWRNHH
FT                   NAWRPAHIHFSLFGTDFTQRLITQMYFPGDPLIALDPICQSIVDPAARDRLIADYDHEA
FT                   STPEWSLGYRWDIVLGGAGRTWTENEAFGGADR"
FT   gene            636389..636988
FT                   /locus_tag="Tpau_0616"
FT   CDS_pept        636389..636988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0616"
FT                   /product="protocatechuate 3,4-dioxygenase, alpha subunit"
FT                   /note="KEGG: art:Arth_4077 protocatechuate 3,4-
FT                   dioxygenase, alpha subunit; TIGRFAM: protocatechuate
FT                   3,4-dioxygenase, alpha subunit; PFAM: intradiol
FT                   ring-cleavage dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77254"
FT                   /db_xref="GOA:D5USW7"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012786"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:D5USW7"
FT                   /inference="protein motif:TFAM:TIGR02423"
FT                   /protein_id="ADG77254.1"
FT                   /translation="MTARSRTPDQTIGPFFGDGLSLPGAEHLIAPGHPRAIRLSGTVFD
FT                   GAGDPVPDCLLEIWQPDEQGRPARPAALIPRDGHSLQGWVRDPHDFAGWGRAATGHTGR
FT                   FGFTTVEPGPAQPGAAPFISVAVFARGLLTGLFTRVYPPEATAALAADPLLSTLPTDRR
FT                   STVIAQRGDDGSLRWDIRLQGERETVFLDFVGAGAR"
FT   gene            636985..638325
FT                   /locus_tag="Tpau_0617"
FT   CDS_pept        636985..638325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0617"
FT                   /product="fumarate lyase"
FT                   /note="PFAM: fumarate lyase; KEGG: art:Arth_4076
FT                   3-carboxy-cis,cis-muconate cycloisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77255"
FT                   /db_xref="GOA:D5USW8"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="UniProtKB/TrEMBL:D5USW8"
FT                   /inference="protein motif:PFAM:PF00206"
FT                   /protein_id="ADG77255.1"
FT                   /translation="MTGDVGLLEPVAAGRACEATDDTAVIGALLEAEVAWIGVLDGVES
FT                   ERAAALVVESRRSAGAFDPTRLASAARSGGNPVIPLVAELREYLGSAMPVHRGLTSQDV
FT                   MDTALMMLARRVADEVAEDLAAVSAALARLADEYADTSQVGRTLGQFAVPITFGAKVAG
FT                   WRQGIDGAARRLAAAGTPVQCGGAAGTNAAVVAMGVDPVQAGAQWARKLALTPSEPWHT
FT                   SRGPVAELGDALAAVCAAAGRIANDVIQASRPEVGELAESAVDRGGSSTMPHKRNPVLS
FT                   VLIRAAALSAPGHAGVLQLAAGQAEDERSTGAWHAEWPALRSLLRLALGTAESLRELCE
FT                   HLRVFPDRMAQRVTAAAPLLVSERLMIVLAERARGGRAAVQAAIDAAVAAPVDDRAAVL
FT                   REGISGAVPGLTAAELDELLAVDGYLGTAPQRARSARPRSSTNGEAQ"
FT   gene            638322..639524
FT                   /locus_tag="Tpau_0618"
FT   CDS_pept        638322..639524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0618"
FT                   /product="4-carboxymuconolactone decarboxylase"
FT                   /note="KEGG: nca:Noca_1011 4-carboxymuconolactone
FT                   decarboxylase; TIGRFAM: 4-carboxymuconolactone
FT                   decarboxylase; PFAM: Carboxymuconolactone decarboxylase;
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77256"
FT                   /db_xref="GOA:D5USW9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5USW9"
FT                   /inference="protein motif:TFAM:TIGR02425"
FT                   /protein_id="ADG77256.1"
FT                   /translation="MIPRLVATAPTCRPPGHRELLVLGPSLGTSAAIWQTVAELLGDRY
FT                   DMLAWDLPGHGGSPSPDGAFDLGELADAVLALVDSHDPGVAFHYAGDSVGGAVGAELAL
FT                   RAPDRVRSLAMVCSAARFGDPGVWRDRAATVRAQGTTAMIPGAKQRWLSNHFLVRSPAV
FT                   AEDLFAGLASVSDAGYAAVCEALAGYDVRDRLPSLQIPFLAVGGELDVVCPPREVRALA
FT                   DAVPQGRHEVLAGVAHLAPVEAPHLVAAALADHCAAATARAVRSATVTARQRYDAGMAV
FT                   RRQVLGDAHVDRATVRGFGSDFQEFITRTAWGDVWTGTELTRRERSIAVLTALLALGHW
FT                   NEFAMHVRAALRNGLGRDEIEAVLMQSAIYCGVPAANAAFGIARRVFAEIDAEEGKNAD
FT                   A"
FT   gene            639517..640740
FT                   /locus_tag="Tpau_0619"
FT   CDS_pept        639517..640740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0619"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.174"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; KEGG:
FT                   aau:AAur_4039 beta-ketoadipyl-CoA thiolase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77257"
FT                   /db_xref="GOA:D5USX0"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D5USX0"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ADG77257.1"
FT                   /translation="MPDAFVYDALRTPFGRYGGALSGIRPDDLAAHVVRRLVDRAPGLA
FT                   ASDGAAIDEVILGNANGAGEDNRNVARMAALLAGLPVTVPGTTVNRLCGSSLDAVITGS
FT                   RQIEVADAEIVLAGGVESMSRAPWVLPKPDRAFPSGDQALASTTLGWRLVNPRMPAEWT
FT                   VSLGEATEQLRQAHGITRQRQDDFAARSHRAAHRAWEEGVYADLVDPVPGTDLDRDESI
FT                   RPGTTVEALSALRPSFRPAAPEPEGGTVTAGNASPLSDGAAAVLLGSAGAEETIGAAPT
FT                   ARIAGRGASAGAPQSFGAAPIEAADRALRRAGIEWSDVGAVELNEAFAAQALVCLDAWG
FT                   IEPGIVNRFGGAIALGHPLGASGARLIGTLAHTLRVTRQRWGVAALCIGVGQGLALVLE
FT                   NVDVTGDL"
FT   gene            640740..641402
FT                   /locus_tag="Tpau_0620"
FT   CDS_pept        640740..641402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0620"
FT                   /product="3-oxoacid CoA-transferase, A subunit"
FT                   /EC_number="2.8.3.6"
FT                   /note="TIGRFAM: 3-oxoacid CoA-transferase, A subunit; KEGG:
FT                   ach:Achl_3848 3-oxoacid CoA-transferase, A subunit; PFAM:
FT                   coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77258"
FT                   /db_xref="GOA:D5USX1"
FT                   /db_xref="InterPro:IPR004163"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D5USX1"
FT                   /inference="protein motif:TFAM:TIGR02429"
FT                   /protein_id="ADG77258.1"
FT                   /translation="MIVEFARNPLDAVQGVRDGATVMVGGFGDAGQPFELIDALLEGGA
FT                   GDLTIVNNNAGQGDRGLALLIQKGRVRKVICSFPRQSDSWHFDEAYRAGRIDLELVPQG
FT                   NLAERIRAAGAGIGGFFTPTGFGTVLAEGKETRIIDGRGYVFEAPLHADIALIKALKAD
FT                   RVGNLVYRKTARNFGPIMAAAARRTVAQVSEIVPTGAIDPEVVVTPGIYVNTIVEVQ"
FT   gene            641402..642061
FT                   /locus_tag="Tpau_0621"
FT   CDS_pept        641402..642061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0621"
FT                   /product="3-oxoacid CoA-transferase, B subunit"
FT                   /EC_number="2.8.3.6"
FT                   /note="TIGRFAM: 3-oxoacid CoA-transferase, B subunit; KEGG:
FT                   art:Arth_4071 butyryl-CoA:acetate CoA transferase; PFAM:
FT                   coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77259"
FT                   /db_xref="GOA:D5USX2"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D5USX2"
FT                   /inference="protein motif:TFAM:TIGR02428"
FT                   /protein_id="ADG77259.1"
FT                   /translation="MEQVAYTRSEPLARGEMAAMVAADIQRGAFVNLGIGLPTTIADHL
FT                   RPEQRVTLHTENGMLGMGPAAVGDRIDPDLINAGKAPVTELPGASYFHHADSFAIMRGG
FT                   HLDVCVLGAFQVSAAGDLANWHTGAEDAIPAVGGAMDLATGAREVWVMMTLQDKTGGPK
FT                   LVQHCTYPVTGLSCVTRVYTERAVFLLSPDGVRVRESFGCTVDDLRGIVEVVLQGD"
FT   gene            642115..642921
FT                   /locus_tag="Tpau_0622"
FT   CDS_pept        642115..642921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0622"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="TIGRFAM: beta-ketoadipate pathway transcriptional
FT                   regulators, PcaR/PcaU/PobR family; PFAM: Transcriptional
FT                   regulator IclR ; regulatory protein IclR; KEGG:
FT                   ach:Achl_3846 transcriptional regulator, IclR family;
FT                   SMART: regulatory protein IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77260"
FT                   /db_xref="GOA:D5USX3"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR012794"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5USX3"
FT                   /inference="protein motif:TFAM:TIGR02431"
FT                   /protein_id="ADG77260.1"
FT                   /translation="MSPDRSEDVRPQAGDQYVQSLARGLEVIRAFDAEHQAMTLSEVAS
FT                   RTGLTRATARRFLLTLVELGYVRSDDRDFGLTPLVLQLGYAYLAGQPLPELAQPILERL
FT                   SHREQESTSLAVLDGTDIVYLTRVHTRRIMTVGISPGTRFPAYATSMGRVLLAAADGDE
FT                   LDDYFARATLDPLTPRTLTTRAALEAELARVRTQGYAMVDQELEVGLRSLAVPVPGRDG
FT                   RPRAAINMALSARLDGADEPTVEHRVAALSAAAADIAEAARAAGID"
FT   gene            643089..644366
FT                   /locus_tag="Tpau_0623"
FT   CDS_pept        643089..644366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0623"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; General
FT                   substrate transporter; KEGG: sco:SCO7435 transmembrane
FT                   transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77261"
FT                   /db_xref="GOA:D5USX4"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5USX4"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG77261.1"
FT                   /translation="MASTPLTPAAADAALRSVGSPRAWGALLCWMVVVFEGYDLVSLGA
FT                   AIPALLDTGHLGMTASDLRAVATVSLVGVGIGAAVTGAISDRYGRRGPLVACVLLFSVF
FT                   TLLVPVMPTVWALAAVRFIAGLGMGGCMPVALTAMQEAAPERKSNASAVTMTGYHVGAV
FT                   LASLIALLAGNSWQWLFYGGGILGLLLVPVIALRMPETAVVAGTAKPIAAQRADRASVL
FT                   QAPYLRTTLMLFVAAFLGLLVVYGLNTWLPQLMRGAGYPVSTALVMLLVLNVGAVAGLM
FT                   IGGRVADRLGAQRVTVLWFAAASVMLALLSIKVANQVVLDVVIFVTGFFVFTAQVLLYG
FT                   LIGYLYPRTKVGTAMGLVSAVGRLGAIAGPWVTGSLVVAGIGYPWGFYFFAVAAGLAAL
FT                   AVVAVPRPAREEQAADSAAEQAARVA"
FT   gene            complement(644373..645344)
FT                   /locus_tag="Tpau_0624"
FT   CDS_pept        complement(644373..645344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0624"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein; KEGG: mva:Mvan_0099
FT                   pirin domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77262"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D5USX5"
FT                   /inference="protein motif:PFAM:PF05726"
FT                   /protein_id="ADG77262.1"
FT                   /translation="MPAVTADTLTLPHIAAATAGETDRPVRKITTGPRGYEGEGFPVVR
FT                   AFAGVHPRDLDPFVHMDQMGEVEYEPGEPKGTSWHPHRGFETVTYMIDGLFQHQDSHGG
FT                   GGLISDGATQWMTAGSGILHIETPPAELVESGGTFHGIQLWVNLPASEKFSTPAYQNLE
FT                   GGQTKLVTTPDGGALIRIVAGEVDGHQGPGSTRTPINFVHATVAPGAEASLPWNRDFNA
FT                   LVYVLSGRGTVGPVGHPIHEGQLAQLGPGDRITVRADESQDANRPALEVLILGGQPIRE
FT                   PVVQYGPFVMNTKAELIQAMEDFNAGKFGHIPPDALMPHVVR"
FT   gene            645623..646222
FT                   /locus_tag="Tpau_0625"
FT   CDS_pept        645623..646222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0625"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77263"
FT                   /db_xref="InterPro:IPR018958"
FT                   /db_xref="UniProtKB/TrEMBL:D5USX6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG77263.1"
FT                   /translation="MDTETMVEELQELIADLARERVRAGEEDGDGLEIRLDLDPDGQVI
FT                   ATAAPAPPATEAEIAQAEAALGRPYPPELRALLGVANGFPGYFYGDTLLGTSGVGTAGV
FT                   AGYPAQFPASIWGIAREYIDEWYAAEVGRLEFSPEDPLDCIPLASDPDASGAAFVVAGS
FT                   GPGWDAGTVVELEGGVHRYENVREYLRARLALVREA"
FT   gene            646239..647093
FT                   /locus_tag="Tpau_0626"
FT   CDS_pept        646239..647093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0626"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: rop:ROP_17460
FT                   putative non-heme haloperoxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77264"
FT                   /db_xref="GOA:D5USX7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5USX7"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADG77264.1"
FT                   /translation="MTRACGFAVGADGTEIFYIDYGTAYADTVDPTKPAYLLIHGWSAS
FT                   GDSWGLPLVDELTAAGHRVVTVDNRGHGRSSVPSSFTTEDFAGDVRAVRELLGLDEVYL
FT                   VGWSYGGLIIADHLTVYGTDGVLGVGLIGAITSIGGTKEGQFPAGVTGPAMNGALPAAL
FT                   SAKPGTAIPALASVRMLPKGFDQETLGPVAQRVFGHSLSTPPAVRGGLFRRTVDHDADL
FT                   ATWTFPVLIQHGRDDEVVAPVTAEHHAVVLPHSTLSWWDGGGHAPFIVDPARCARELLD
FT                   LRG"
FT   gene            647104..648420
FT                   /locus_tag="Tpau_0627"
FT   CDS_pept        647104..648420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0627"
FT                   /product="UDP-N-acetylglucosamine"
FT                   /note="KEGG: rer:RER_16170 glycosyltransferase MshA;
FT                   TIGRFAM: UDP-N-acetylglucosamine; PFAM: glycosyl
FT                   transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77265"
FT                   /db_xref="GOA:D5USX8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR017814"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/Swiss-Prot:D5USX8"
FT                   /inference="protein motif:TFAM:TIGR03449"
FT                   /protein_id="ADG77265.1"
FT                   /translation="MPIGKSAAAVTPRRIAVLSVHTSPLAQPGMGDAGGMNVYIWQTSL
FT                   ELAARGIEVEIFTRATSSSDAPIVEAAPGIRVRNVVAGPFEGLDKTDLPAQLCAFAAGV
FT                   QRAEAREEPGYFDLIHSHYWLSGQVGWLARDRWGVPLVHTAHTLAAVKNRALAEGDTAE
FT                   PQARIIGEQQVSDEADRLIVNTEVEASQLADLHDVPLDRIDVVYPGADLATYTPGDGAG
FT                   ARRELGIAPDELVLTFVGRIQPHKAPDLLLRAAAPLIHAHPDRRIRILVVGGPSGTGLE
FT                   RPDALIALARELGIEHAVTFEPPRPPAGLAEVYRASDLVVVPSYSESFGLVAVEAQACG
FT                   TPVVAAKVGGLSVAVADGVSGRLIDGHDPQEWTAVLDELTANAELRTELAAGATEHARR
FT                   FSWARTADGLLNSYAKAIEARQEATQTVRRRRRRAGVRA"
FT   gene            648429..648941
FT                   /locus_tag="Tpau_0628"
FT   CDS_pept        648429..648941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0628"
FT                   /product="Protein of unknown function DUF2596"
FT                   /note="PFAM: Protein of unknown function DUF2596; KEGG:
FT                   rha:RHA1_ro02072 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77266"
FT                   /db_xref="InterPro:IPR019660"
FT                   /db_xref="UniProtKB/TrEMBL:D5USX9"
FT                   /inference="protein motif:PFAM:PF10770"
FT                   /protein_id="ADG77266.1"
FT                   /translation="MTPEQLETALTERELDFTRKEETGKDVSHFIVELPGEKKLKTTTM
FT                   ITLGVHGARVEAFVCRHPDENFEGVYRYLLRRNRRLYGVAYTIDRTGDIYLTGRFAEFT
FT                   EDELDRVLGQVLEAADGDFNTLLELGFSTAIRREFEWRIARGEPLWNLKPFEHLLPEFP
FT                   DLPEQQK"
FT   gene            complement(648883..650382)
FT                   /locus_tag="Tpau_0629"
FT   CDS_pept        complement(648883..650382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0629"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rha:RHA1_ro10372 major facilitator superfamily multidrug
FT                   resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77267"
FT                   /db_xref="GOA:D5USY0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5USY0"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG77267.1"
FT                   /translation="MQLPSNPMTDNLRRNRPADGVLIAVLCLGGLLASLMQSLVVPIVG
FT                   QLPHLLDTTTDNAAWVITATLLASSVAMPIAGRLGDMYGKRLVLLTSLLSLITGSLICA
FT                   LSHTLLLTVVGRSFQGFAMGLVPVGISLMRDELHARKIPGAVALMSAMLGVGGAIGIPF
FT                   GAYISEHFDYHTLFWFSLALGVVTLGLVFVVVPESPNRHPGTFDVVGTVGLTVGLVSVL
FT                   LSITKGQSWGWTSAATLGCAIGGALVLIAWGFWETRTRDSLVDLRISARRPILLTNLAS
FT                   IMVGFAMFSLMLTMPQLLQIPEATGYGLGQTMLNAGLWMVPGGLVMMALSPVSALLTKR
FT                   IGARLTLAIGATMSAIGYFALLGLTDATWKMSIGSMIVFGGVGVAYSAMPALIMANVPD
FT                   TESAAANGLNSLMRSVGTAISSAVMATILTRSTITLLAGTPREVTLPAEDAFTSGFVIA
FT                   GVVAAVAAVVALAIPRATKGGETTSAAPEDREIQEAGARTA"
FT   gene            650517..650984
FT                   /locus_tag="Tpau_0630"
FT   CDS_pept        650517..650984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tpau_0630"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rce:RC1_2365 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tpau_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ADG77268"
FT                   /db_xref="GOA:D5USY1"
FT                   /db_xref="UniProtKB/TrEMBL:D5USY1