(data stored in ACNUC30630 zone)

EMBL: CP001977

ID   CP001977; SV 1; circular; genomic DNA; STD; PRO; 2495334 BP.
XX
AC   CP001977; ABZW01000000-ABZW01000016;
XX
PR   Project:PRJNA31005;
XX
DT   25-MAR-2010 (Rel. 104, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Propionibacterium acnes SK137, complete genome.
XX
KW   .
XX
OS   Cutibacterium acnes SK137
OC   Bacteria; Actinobacteria; Propionibacteriales; Propionibacteriaceae;
OC   Cutibacterium.
XX
RN   [1]
RP   1-2495334
RA   Harkins D.M., Madupu R., Durkin A.S., Torralba M., Methe B., Sutton G.G.,
RA   Nelson K.E.;
RT   ;
RL   Submitted (16-MAR-2010) to the INSDC.
RL   J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850,
RL   USA
XX
DR   MD5; 9136aa71d11914d8e9b8bc3e413daf12.
DR   BioSample; SAMN00000718.
DR   EnsemblGenomes-Gn; EBG00001194903.
DR   EnsemblGenomes-Gn; EBG00001194904.
DR   EnsemblGenomes-Gn; EBG00001194906.
DR   EnsemblGenomes-Gn; EBG00001194907.
DR   EnsemblGenomes-Gn; EBG00001194908.
DR   EnsemblGenomes-Gn; EBG00001194909.
DR   EnsemblGenomes-Gn; EBG00001194910.
DR   EnsemblGenomes-Gn; EBG00001194911.
DR   EnsemblGenomes-Gn; EBG00001194912.
DR   EnsemblGenomes-Gn; EBG00001194913.
DR   EnsemblGenomes-Gn; EBG00001194914.
DR   EnsemblGenomes-Gn; EBG00001194915.
DR   EnsemblGenomes-Gn; EBG00001194916.
DR   EnsemblGenomes-Gn; EBG00001194917.
DR   EnsemblGenomes-Gn; EBG00001194918.
DR   EnsemblGenomes-Gn; EBG00001194919.
DR   EnsemblGenomes-Gn; EBG00001194920.
DR   EnsemblGenomes-Gn; EBG00001194921.
DR   EnsemblGenomes-Gn; EBG00001194922.
DR   EnsemblGenomes-Gn; EBG00001194923.
DR   EnsemblGenomes-Gn; EBG00001194924.
DR   EnsemblGenomes-Gn; EBG00001194925.
DR   EnsemblGenomes-Gn; EBG00001194926.
DR   EnsemblGenomes-Gn; EBG00001194927.
DR   EnsemblGenomes-Gn; EBG00001194929.
DR   EnsemblGenomes-Gn; EBG00001194930.
DR   EnsemblGenomes-Gn; EBG00001194931.
DR   EnsemblGenomes-Gn; EBG00001194932.
DR   EnsemblGenomes-Gn; EBG00001194933.
DR   EnsemblGenomes-Gn; EBG00001194934.
DR   EnsemblGenomes-Gn; EBG00001194936.
DR   EnsemblGenomes-Gn; EBG00001194937.
DR   EnsemblGenomes-Gn; EBG00001194938.
DR   EnsemblGenomes-Gn; EBG00001194939.
DR   EnsemblGenomes-Gn; EBG00001194940.
DR   EnsemblGenomes-Gn; EBG00001194941.
DR   EnsemblGenomes-Gn; EBG00001194942.
DR   EnsemblGenomes-Gn; EBG00001194943.
DR   EnsemblGenomes-Gn; EBG00001194944.
DR   EnsemblGenomes-Gn; EBG00001194945.
DR   EnsemblGenomes-Gn; EBG00001194946.
DR   EnsemblGenomes-Gn; EBG00001194947.
DR   EnsemblGenomes-Gn; EBG00001194948.
DR   EnsemblGenomes-Gn; EBG00001194949.
DR   EnsemblGenomes-Gn; EBG00001194950.
DR   EnsemblGenomes-Gn; EBG00001194951.
DR   EnsemblGenomes-Gn; EBG00001194952.
DR   EnsemblGenomes-Gn; EBG00001194953.
DR   EnsemblGenomes-Gn; EBG00001194954.
DR   EnsemblGenomes-Gn; EBG00001194955.
DR   EnsemblGenomes-Gn; EBG00001194956.
DR   EnsemblGenomes-Gn; EBG00001194957.
DR   EnsemblGenomes-Gn; EBG00001194958.
DR   EnsemblGenomes-Gn; EBG00001194959.
DR   EnsemblGenomes-Gn; EBG00001194960.
DR   EnsemblGenomes-Gn; EBG00001194961.
DR   EnsemblGenomes-Gn; EBG00001194962.
DR   EnsemblGenomes-Gn; EBG00001194963.
DR   EnsemblGenomes-Gn; EBG00001194964.
DR   EnsemblGenomes-Gn; EBG00001194965.
DR   EnsemblGenomes-Gn; EBG00001194966.
DR   EnsemblGenomes-Gn; EBG00001194967.
DR   EnsemblGenomes-Gn; EBG00001194968.
DR   EnsemblGenomes-Gn; EBG00001194969.
DR   EnsemblGenomes-Gn; EBG00001194970.
DR   EnsemblGenomes-Gn; EBG00001194971.
DR   EnsemblGenomes-Gn; EBG00001194972.
DR   EnsemblGenomes-Gn; EBG00001194973.
DR   EnsemblGenomes-Gn; EBG00001194974.
DR   EnsemblGenomes-Gn; EBG00001194975.
DR   EnsemblGenomes-Gn; HMPREF0675_3018.
DR   EnsemblGenomes-Gn; HMPREF0675_3134.
DR   EnsemblGenomes-Gn; HMPREF0675_3244.
DR   EnsemblGenomes-Gn; HMPREF0675_3246.
DR   EnsemblGenomes-Gn; HMPREF0675_3296.
DR   EnsemblGenomes-Gn; HMPREF0675_3478.
DR   EnsemblGenomes-Gn; HMPREF0675_3532.
DR   EnsemblGenomes-Gn; HMPREF0675_3543.
DR   EnsemblGenomes-Gn; HMPREF0675_3580.
DR   EnsemblGenomes-Gn; HMPREF0675_3601.
DR   EnsemblGenomes-Gn; HMPREF0675_3607.
DR   EnsemblGenomes-Gn; HMPREF0675_3609.
DR   EnsemblGenomes-Gn; HMPREF0675_3611.
DR   EnsemblGenomes-Gn; HMPREF0675_3719.
DR   EnsemblGenomes-Gn; HMPREF0675_3840.
DR   EnsemblGenomes-Gn; HMPREF0675_3904.
DR   EnsemblGenomes-Gn; HMPREF0675_4017.
DR   EnsemblGenomes-Gn; HMPREF0675_4030.
DR   EnsemblGenomes-Gn; HMPREF0675_4131.
DR   EnsemblGenomes-Gn; HMPREF0675_4132.
DR   EnsemblGenomes-Gn; HMPREF0675_4133.
DR   EnsemblGenomes-Gn; HMPREF0675_4134.
DR   EnsemblGenomes-Gn; HMPREF0675_4275.
DR   EnsemblGenomes-Gn; HMPREF0675_4323.
DR   EnsemblGenomes-Gn; HMPREF0675_4343.
DR   EnsemblGenomes-Gn; HMPREF0675_4386.
DR   EnsemblGenomes-Gn; HMPREF0675_4388.
DR   EnsemblGenomes-Gn; HMPREF0675_4400.
DR   EnsemblGenomes-Gn; HMPREF0675_4411.
DR   EnsemblGenomes-Gn; HMPREF0675_4412.
DR   EnsemblGenomes-Gn; HMPREF0675_4453.
DR   EnsemblGenomes-Gn; HMPREF0675_4455.
DR   EnsemblGenomes-Gn; HMPREF0675_4456.
DR   EnsemblGenomes-Gn; HMPREF0675_4478.
DR   EnsemblGenomes-Gn; HMPREF0675_4644.
DR   EnsemblGenomes-Gn; HMPREF0675_4654.
DR   EnsemblGenomes-Gn; HMPREF0675_4681.
DR   EnsemblGenomes-Gn; HMPREF0675_4684.
DR   EnsemblGenomes-Gn; HMPREF0675_4690.
DR   EnsemblGenomes-Gn; HMPREF0675_4692.
DR   EnsemblGenomes-Gn; HMPREF0675_4693.
DR   EnsemblGenomes-Gn; HMPREF0675_4700.
DR   EnsemblGenomes-Gn; HMPREF0675_4708.
DR   EnsemblGenomes-Gn; HMPREF0675_4945.
DR   EnsemblGenomes-Gn; HMPREF0675_4951.
DR   EnsemblGenomes-Gn; HMPREF0675_4952.
DR   EnsemblGenomes-Gn; HMPREF0675_4953.
DR   EnsemblGenomes-Gn; HMPREF0675_5022.
DR   EnsemblGenomes-Gn; HMPREF0675_5025.
DR   EnsemblGenomes-Gn; HMPREF0675_5026.
DR   EnsemblGenomes-Gn; HMPREF0675_5027.
DR   EnsemblGenomes-Gn; HMPREF0675_5122.
DR   EnsemblGenomes-Gn; HMPREF0675_5203.
DR   EnsemblGenomes-Gn; HMPREF0675_5215.
DR   EnsemblGenomes-Gn; HMPREF0675_5245.
DR   EnsemblGenomes-Gn; HMPREF0675_5257.
DR   EnsemblGenomes-Gn; HMPREF0675_5259.
DR   EnsemblGenomes-Gn; HMPREF0675_5266.
DR   EnsemblGenomes-Tr; EBT00001773006.
DR   EnsemblGenomes-Tr; EBT00001773008.
DR   EnsemblGenomes-Tr; EBT00001773009.
DR   EnsemblGenomes-Tr; EBT00001773010.
DR   EnsemblGenomes-Tr; EBT00001773011.
DR   EnsemblGenomes-Tr; EBT00001773013.
DR   EnsemblGenomes-Tr; EBT00001773014.
DR   EnsemblGenomes-Tr; EBT00001773015.
DR   EnsemblGenomes-Tr; EBT00001773017.
DR   EnsemblGenomes-Tr; EBT00001773019.
DR   EnsemblGenomes-Tr; EBT00001773021.
DR   EnsemblGenomes-Tr; EBT00001773022.
DR   EnsemblGenomes-Tr; EBT00001773024.
DR   EnsemblGenomes-Tr; EBT00001773025.
DR   EnsemblGenomes-Tr; EBT00001773027.
DR   EnsemblGenomes-Tr; EBT00001773028.
DR   EnsemblGenomes-Tr; EBT00001773031.
DR   EnsemblGenomes-Tr; EBT00001773032.
DR   EnsemblGenomes-Tr; EBT00001773033.
DR   EnsemblGenomes-Tr; EBT00001773034.
DR   EnsemblGenomes-Tr; EBT00001773036.
DR   EnsemblGenomes-Tr; EBT00001773037.
DR   EnsemblGenomes-Tr; EBT00001773038.
DR   EnsemblGenomes-Tr; EBT00001773041.
DR   EnsemblGenomes-Tr; EBT00001773042.
DR   EnsemblGenomes-Tr; EBT00001773043.
DR   EnsemblGenomes-Tr; EBT00001773045.
DR   EnsemblGenomes-Tr; EBT00001773046.
DR   EnsemblGenomes-Tr; EBT00001773048.
DR   EnsemblGenomes-Tr; EBT00001773049.
DR   EnsemblGenomes-Tr; EBT00001773051.
DR   EnsemblGenomes-Tr; EBT00001773052.
DR   EnsemblGenomes-Tr; EBT00001773053.
DR   EnsemblGenomes-Tr; EBT00001773055.
DR   EnsemblGenomes-Tr; EBT00001773056.
DR   EnsemblGenomes-Tr; EBT00001773058.
DR   EnsemblGenomes-Tr; EBT00001773059.
DR   EnsemblGenomes-Tr; EBT00001773061.
DR   EnsemblGenomes-Tr; EBT00001773062.
DR   EnsemblGenomes-Tr; EBT00001773064.
DR   EnsemblGenomes-Tr; EBT00001773065.
DR   EnsemblGenomes-Tr; EBT00001773066.
DR   EnsemblGenomes-Tr; EBT00001773068.
DR   EnsemblGenomes-Tr; EBT00001773069.
DR   EnsemblGenomes-Tr; EBT00001773072.
DR   EnsemblGenomes-Tr; EBT00001773073.
DR   EnsemblGenomes-Tr; EBT00001773074.
DR   EnsemblGenomes-Tr; EBT00001773077.
DR   EnsemblGenomes-Tr; EBT00001773078.
DR   EnsemblGenomes-Tr; EBT00001773079.
DR   EnsemblGenomes-Tr; EBT00001773080.
DR   EnsemblGenomes-Tr; EBT00001773082.
DR   EnsemblGenomes-Tr; EBT00001773083.
DR   EnsemblGenomes-Tr; EBT00001773084.
DR   EnsemblGenomes-Tr; EBT00001773086.
DR   EnsemblGenomes-Tr; EBT00001773087.
DR   EnsemblGenomes-Tr; EBT00001773088.
DR   EnsemblGenomes-Tr; EBT00001773090.
DR   EnsemblGenomes-Tr; EBT00001773091.
DR   EnsemblGenomes-Tr; EBT00001773092.
DR   EnsemblGenomes-Tr; EBT00001773093.
DR   EnsemblGenomes-Tr; EBT00001773095.
DR   EnsemblGenomes-Tr; EBT00001773096.
DR   EnsemblGenomes-Tr; EBT00001773097.
DR   EnsemblGenomes-Tr; EBT00001773099.
DR   EnsemblGenomes-Tr; EBT00001773100.
DR   EnsemblGenomes-Tr; EBT00001773102.
DR   EnsemblGenomes-Tr; EBT00001773104.
DR   EnsemblGenomes-Tr; EBT00001773105.
DR   EnsemblGenomes-Tr; EBT00001773107.
DR   EnsemblGenomes-Tr; HMPREF0675_3018-1.
DR   EnsemblGenomes-Tr; HMPREF0675_3134-1.
DR   EnsemblGenomes-Tr; HMPREF0675_3244-1.
DR   EnsemblGenomes-Tr; HMPREF0675_3246-1.
DR   EnsemblGenomes-Tr; HMPREF0675_3296-1.
DR   EnsemblGenomes-Tr; HMPREF0675_3478-1.
DR   EnsemblGenomes-Tr; HMPREF0675_3532-1.
DR   EnsemblGenomes-Tr; HMPREF0675_3543-1.
DR   EnsemblGenomes-Tr; HMPREF0675_3580-1.
DR   EnsemblGenomes-Tr; HMPREF0675_3601-1.
DR   EnsemblGenomes-Tr; HMPREF0675_3607-1.
DR   EnsemblGenomes-Tr; HMPREF0675_3609-1.
DR   EnsemblGenomes-Tr; HMPREF0675_3611-1.
DR   EnsemblGenomes-Tr; HMPREF0675_3719-1.
DR   EnsemblGenomes-Tr; HMPREF0675_3840-1.
DR   EnsemblGenomes-Tr; HMPREF0675_3904-1.
DR   EnsemblGenomes-Tr; HMPREF0675_4017-1.
DR   EnsemblGenomes-Tr; HMPREF0675_4030-1.
DR   EnsemblGenomes-Tr; HMPREF0675_4131-1.
DR   EnsemblGenomes-Tr; HMPREF0675_4132-1.
DR   EnsemblGenomes-Tr; HMPREF0675_4133-1.
DR   EnsemblGenomes-Tr; HMPREF0675_4134-1.
DR   EnsemblGenomes-Tr; HMPREF0675_4275-1.
DR   EnsemblGenomes-Tr; HMPREF0675_4323-1.
DR   EnsemblGenomes-Tr; HMPREF0675_4343-1.
DR   EnsemblGenomes-Tr; HMPREF0675_4386-1.
DR   EnsemblGenomes-Tr; HMPREF0675_4388-1.
DR   EnsemblGenomes-Tr; HMPREF0675_4400-1.
DR   EnsemblGenomes-Tr; HMPREF0675_4411-1.
DR   EnsemblGenomes-Tr; HMPREF0675_4412-1.
DR   EnsemblGenomes-Tr; HMPREF0675_4453-1.
DR   EnsemblGenomes-Tr; HMPREF0675_4455-1.
DR   EnsemblGenomes-Tr; HMPREF0675_4456-1.
DR   EnsemblGenomes-Tr; HMPREF0675_4478-1.
DR   EnsemblGenomes-Tr; HMPREF0675_4644-1.
DR   EnsemblGenomes-Tr; HMPREF0675_4654-1.
DR   EnsemblGenomes-Tr; HMPREF0675_4681-1.
DR   EnsemblGenomes-Tr; HMPREF0675_4684-1.
DR   EnsemblGenomes-Tr; HMPREF0675_4690-1.
DR   EnsemblGenomes-Tr; HMPREF0675_4692-1.
DR   EnsemblGenomes-Tr; HMPREF0675_4693-1.
DR   EnsemblGenomes-Tr; HMPREF0675_4700-1.
DR   EnsemblGenomes-Tr; HMPREF0675_4708-1.
DR   EnsemblGenomes-Tr; HMPREF0675_4945-1.
DR   EnsemblGenomes-Tr; HMPREF0675_4951-1.
DR   EnsemblGenomes-Tr; HMPREF0675_4952-1.
DR   EnsemblGenomes-Tr; HMPREF0675_4953-1.
DR   EnsemblGenomes-Tr; HMPREF0675_5022-1.
DR   EnsemblGenomes-Tr; HMPREF0675_5025-1.
DR   EnsemblGenomes-Tr; HMPREF0675_5026-1.
DR   EnsemblGenomes-Tr; HMPREF0675_5027-1.
DR   EnsemblGenomes-Tr; HMPREF0675_5122-1.
DR   EnsemblGenomes-Tr; HMPREF0675_5203-1.
DR   EnsemblGenomes-Tr; HMPREF0675_5215-1.
DR   EnsemblGenomes-Tr; HMPREF0675_5245-1.
DR   EnsemblGenomes-Tr; HMPREF0675_5257-1.
DR   EnsemblGenomes-Tr; HMPREF0675_5259-1.
DR   EnsemblGenomes-Tr; HMPREF0675_5266-1.
DR   EuropePMC; PMC3316620; 22479553.
DR   EuropePMC; PMC3663185; 23631911.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01746; mraW.
DR   RFAM; RF01747; msiK.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001977.
DR   SILVA-SSU; CP001977.
XX
CC   Propionibacterium acnes is the most common gram-positive, non-spore
CC   forming, anaerobic rod encountered in clinical specimens. The
CC   causative agent of acne, it typically grows as an obligate
CC   anaerobe. Some strains are aerotolerant, but still show better
CC   growth as an anaerobe. It has the ability to produce propionic
CC   acid, as its name suggests. It also has the ability to produce
CC   catalase along with indole, nitrate, or both indole and nitrate.
CC   Propionibacterium resembles Corynebacterium in morphology and
CC   arrangement, but is non-toxigenic. It is a common resident of the
CC   pilosebaceous (hair follicle) glands of the human skin. The
CC   bacteria release lipases to digest a surplus of the skin oil,
CC   sebum, that has been produced. The combination of digestive
CC   products (fatty acids) and bacterial antigens stimulates an intense
CC   local inflammation that bursts the hair follicle. Since acne is
CC   caused in part from an infection, it can be suppressed with topical
CC   and oral antibiotics such as clindamycin, erythromycin, or
CC   tetracycline. Some other forms of therapy include chemicals that
CC   enhance skin removal or slow the production of sebum.
CC   This is a reference genome for the Human Microbiome Project. This
CC   project is co-owned with the Human Microbiome Project DACC. Source
CC   DNA provided by Martin Blaser, New York University School of
CC   Medicine, OBV 6 A606, 550 First Avenue, New York NY 10016, USA
CC   (Martin.Blaser@nyumc.org). Funded by National Institute of Allergy
CC   and Infectious Diseases on behalf of the NIH Roadmap Human
CC   Microbiome Project (U54-AI-084844-01).
CC   Finishing comments       The chromosome contains two unresolved
CC   homopolymer indels at the following locations: 2023501 and 2060638.
CC   ##Genome-Assembly-Data-START##
CC   Finishing Goal           :: Finished
CC   Current Finishing Status :: Finished
CC   Assembly Method          :: Newbler Assembler v. 1 1.03.24-64-7
CC   Genome Coverage          :: 22.4x
CC   Sequencing Technology    :: 454
CC   ##Genome-Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2495334
FT                   /organism="Cutibacterium acnes SK137"
FT                   /strain="SK137"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:553199"
FT   gene            241..1743
FT                   /gene="dnaA"
FT                   /locus_tag="HMPREF0675_3000"
FT   CDS_pept        241..1743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="HMPREF0675_3000"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="identified by match to protein family HMM PF00308;
FT                   match to protein family HMM PF08299; match to protein
FT                   family HMM TIGR00362"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3000"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00916"
FT                   /db_xref="GOA:D4HEF9"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEF9"
FT                   /protein_id="ADE00916.1"
FT                   /translation="MSDTPFGDADHPRPAPIHPDAVLPPPMSSQSADNDPTEALNEAWT
FT                   NILTKVSKPNRAWLSNTTPVTMHSSTAMVAVPNEFARDRLESKMRYELEELLSDHFHKA
FT                   IHLAITIDPDLELALGAPDHEDEEEEVPPAQFVPKVTVGVTEPSARPTTTIDDDEGNRL
FT                   NPKYTFDSFVIGASNRFAHAAAVAVAEAPGKSYNPLLIYGGSGLGKTHLLHAIGRYVMS
FT                   YYDNVKVKYVSTEELTNDFINAIGTNRTTEFRRSYRDVDVLLVDDIQFLQSKIQTQEEF
FT                   FHTFNTLHNAQKQIVMTSDRPPKLLEALEPRLRSRFEWGLLTDIQPPDLETRIAILRRK
FT                   VAAEKITVEPDVLEFIASRIQTNIRELEGALIRVTAFASLNQQPVDISLAEVVLKDLIP
FT                   EGRETPVTPERIIAETADYFDISADDLLGTSRAQTLVTARQIAMYLCRELTDLSLPKIG
FT                   AEFGGKDHTTVMHADRKIRALMGEQRQIFNQVSEITNRIKQY"
FT   gene            2131..3375
FT                   /gene="dnaN"
FT                   /locus_tag="HMPREF0675_3001"
FT   CDS_pept        2131..3375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="HMPREF0675_3001"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00712;
FT                   match to protein family HMM PF02767; match to protein
FT                   family HMM PF02768; match to protein family HMM TIGR00663"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3001"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99972"
FT                   /db_xref="GOA:D4HEG0"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEG0"
FT                   /protein_id="ADD99972.1"
FT                   /translation="MGVPTVGKHGYDQHAGTMECETPNQGDAVEIRLERDVMAEAVAWA
FT                   ARSLPNRPTVPILAGLLVRAEGDSVVMSASDNETSAQITLSAQVDEPGESLVSGKLLAD
FT                   IACSLPNKPVQITTDPAKMDLVCGSARFTLQALPVDEYPDLPQMPAATGTVDASVFSRA
FT                   VAQVVVAAGRDELLPVFTGVRVEINGETLSLLATDRYRMALKEITWNPSATDAEATALV
FT                   PAKVINETARSMTSGEHVTMNLSSGDSGEGLVGFEGDGANGVRRMTTRLLSGEFPKVRH
FT                   LMDIKATRSVRARTDELINSVRRVSLVAERNTPLRMVINDDSVALSAATGDQAQASEAI
FT                   EAVVTNHVDGEPTITAAGFNPHYLSDALGALDTPYVHFSFTAPGKPCLVTGLNDFDGKP
FT                   ETDYRHVIMLMRLPS"
FT   gene            3512..4165
FT                   /locus_tag="HMPREF0675_3002"
FT   CDS_pept        3512..4165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3002"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3002"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99579"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEG1"
FT                   /protein_id="ADD99579.1"
FT                   /translation="MTTIADVRTGVNRVFDALGAPSWSNPHADHSVAAEEEYSRVTDPE
FT                   RYHVLMLRLQAWQTVLAKLCDVDVDTMAKGRGRLQQRWSSPHSDTLPLYVSVVTFDQVP
FT                   FVGLSATSDADPFDIIPDCACDACDHGSEDLLRVLDADLAAVVDGSLVVVTGPVVNGEP
FT                   TFHLVGTGQGCASTWGGDEVGPLAEPEAVIDAIRSGDDPLLPPGCTVLHGRPWL"
FT   gene            4202..5407
FT                   /gene="recF"
FT                   /locus_tag="HMPREF0675_3003"
FT   CDS_pept        4202..5407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="HMPREF0675_3003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="identified by match to protein family HMM PF02463;
FT                   match to protein family HMM TIGR00611"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3003"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00928"
FT                   /db_xref="GOA:D4HEG2"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEG2"
FT                   /protein_id="ADE00928.1"
FT                   /translation="MWSEGVRMFVERLELVDFRSYVRADVPMAAGATTFIGSNGQGKTN
FT                   LVEAVEYLSTLSSHRVSNDTPLVRLGADQAVVRGRVRAGTDDARSLLLEVEINARRANR
FT                   ARINRAPLTRPRDILGVLRTVVFSPNDLAVVRGDPSDRRAFLDGLVVTRWPRMAAVKSD
FT                   YERVLKQRNALLKSLSGKGRSAGAEIGATMDIWDNELATIGAELLSARLDTLSAVMPLT
FT                   SAAYREIAPVNDLTTASYKSTIDLEGLWSPPQERESSTPIDRKELANRFLDTLAKRRAD
FT                   ELIRGVTLVGPQRDDIILHIGEMPAKGYASHGESWSLALALRLGSFQLLRDDGIEPVLV
FT                   LDDVFAELDATRRDRLASSVVQADQVLVTAAVASDVPEILRGERFDVGGGQVLAYEGNN
FT                   DD"
FT   gene            5400..5993
FT                   /locus_tag="HMPREF0675_3004"
FT   CDS_pept        5400..5993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3004"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05258"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3004"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00586"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEG3"
FT                   /protein_id="ADE00586.1"
FT                   /translation="MTDGLDEGPTEEDRRLAADHDDEGVDVALAIARAARGEPAGTPRH
FT                   DDDGEVLLPPPRRSAARKRRRRPSTPSWSGPKADGRDPMALGDAFTHLVQSKGWGRQVN
FT                   LHLVLSRWPELVGPTNAEHSRPVKYQGTVLTVRTEATVWATSLRTIAPQLVAELNRRLG
FT                   EGTVTRVVIEGPSAPSWKHGPRSVPGRGPRDTYG"
FT   gene            complement(6057..6731)
FT                   /locus_tag="HMPREF0675_3005"
FT   CDS_pept        complement(6057..6731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3005"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3005"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01209"
FT                   /db_xref="GOA:D4HEG4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEG4"
FT                   /protein_id="ADE01209.1"
FT                   /translation="MSFTYSTSSTGYRWNGSSNFFSCLMMRDLLGAACRLMLGLLRPTI
FT                   GDVRVNGISTRDLDLNQFYESVAYVSQDPPVFDGTIRENLLLQDTQDDKRALEVLNTLG
FT                   LGEFLERGRGLDSEVGERGSMVSGGERQQLAIARILIHPKPLIILDEATSAMDSISEER
FT                   SMAVIQQVASDSILIIVSHKLKTLATADEIIVLESGQLTERGPLAELVNDDGVFNRLWE
FT                   RQ"
FT   gene            complement(6484..7617)
FT                   /locus_tag="HMPREF0675_3006"
FT   CDS_pept        complement(6484..7617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3006"
FT                   /product="ABC transporter, permease/ATP-binding family
FT                   protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3006"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99475"
FT                   /db_xref="GOA:D4HEG5"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEG5"
FT                   /protein_id="ADD99475.1"
FT                   /translation="MRKQVIGKSLSGSLANAVSASGRLFTVCMVLGVMRSFMENLGLNR
FT                   FQAVLDQVSHNHVSVMTVAVYGGLTVDACVIAYLDEIPKTKLRQGIYYHFKLEAMKKAT
FT                   LVDFSSAKSYGTGALLQRIEAGASAGRQMICDFWLRALREVLPDIIFGLWFISRMDFRI
FT                   ALAVLLGYVVLLATTNLMLRRLYALKRNAVVDDELINRSISRIIMEFVSVRILGLGSRE
FT                   LAKTRRLCSENTNRSAKVVATHEFFFAFFTLLIIIAKIATIVLFSFGKLSLSVGGLVAL
FT                   LLYMDRVYNPIAILNVLYVQYKLDRVSLERLEQFLLLPNDEGLTGGGMPSDAGAFATDH
FT                   RRRSRQRYQHARSRPEPVLRICGVRIPGSTRIRWHNS"
FT   gene            8300..9487
FT                   /gene="manA"
FT                   /locus_tag="HMPREF0675_3007"
FT   CDS_pept        8300..9487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manA"
FT                   /locus_tag="HMPREF0675_3007"
FT                   /product="mannose-6-phosphate isomerase, class I"
FT                   /EC_number="5.3.1.8"
FT                   /note="identified by match to protein family HMM PF01238;
FT                   match to protein family HMM TIGR00218"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3007"
FT                   /db_xref="EnsemblGenomes-Tr:ADD98937"
FT                   /db_xref="GOA:D4HEG6"
FT                   /db_xref="InterPro:IPR001250"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016305"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEG6"
FT                   /protein_id="ADD98937.1"
FT                   /translation="MRALTGQVQHYDWGSADAIPAILGTRPDGTPWAEYWLGAHPKAPS
FT                   ALPDGTPLDQWLTHHPDELGAGSREAFGDRLPFLLKILSANHALSIQAHPSREQAEKGF
FT                   AAENEAGVPLDAPNRIFRDDWPKPEMIVALTDFDALCGFRDPSSSLVLLSGLGEVDGLN
FT                   EVLTPLSQNDGLATLVAAVLSGDDDVTPVVKRVVSASRAYLNDGADEDVRSLATTAVEL
FT                   WEDHPGDPSILVALLMNRVRLAPGQQIHLCAGSMHAYLGGTGVEIMANSDNVLRGGLTS
FT                   KYIDVKALLDHANMTPEPCVGEYAQQISPGVGVYHTTFPEFRLWGLEGHNDVLDLPATE
FT                   LGRILLVTEGQLVAHCGTDDCELSRGQSVWLPAGDEVKVTGQGRGFLASAGVGDS"
FT   gene            9729..11801
FT                   /gene="gyrB"
FT                   /locus_tag="HMPREF0675_3008"
FT   CDS_pept        9729..11801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="HMPREF0675_3008"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by match to protein family HMM PF00204;
FT                   match to protein family HMM PF00986; match to protein
FT                   family HMM PF01751; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR01059"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3008"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99758"
FT                   /db_xref="GOA:D4HEG7"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEG7"
FT                   /protein_id="ADD99758.1"
FT                   /translation="MSQPEMPESVTDGDTPEDLLIDATDHPDGLDSELPPTAVDGSYDA
FT                   GQITVLEGLEAVRKRPGMYIGSTGERGLHHCVYEIVDNSVDEAMAGYCDTIQVELLDDN
FT                   WCQVTDNGRGIPVKEHPVEHIPTVTLVLTKLHAGGKFGNGGYKVSGGLHGVGSSVVNAL
FT                   AAHFIVEVRRDGYHWRQSFSLGEPDGPLEQLEALGPDDHEGTTVRFQPSDEIFDAIVFD
FT                   YQTLSNRFREMAFLNKGLRIVLTDRRADHADEDGNPVHEDFLYKEGLKDYVRFLTGTRD
FT                   VINPTIISLESHRPEEGMGLEIAMQWNTSYATSVHTFANAINTIEGGAHEEGFRAALTN
FT                   TVNRWGETWGLIKKREDRVSGDDIREGLTAVVSIKLTEPQFEGQTKTKLGNAEAKSFVQ
FT                   KALNEKLSDWFEENPNEGKSIVRKSQAAAQARVAARKARDLARNRKGLLGSTSLPGKLK
FT                   DCSSTSPEECEIFIVEGDSAGGSASQGRDPRIQAILPLRGKILNVEKARLDRALGSETI
FT                   ESIINALGTGVHEDFDLDKLRYHKIILMADADVDGAHIRTLLLTLLFRFMRPVIDAGHV
FT                   YLAQPPLFRLRWTNSPHELAYSDEERDLLREDGLTHGKKLPQVNPIQRYKGLGEMDAED
FT                   LWDTTMDPDKRLLLQVTLEDAALADQMFSILMGEDVEQRRSFIQRNAKDVRFLDI"
FT   gene            11843..14518
FT                   /gene="gyrA"
FT                   /locus_tag="HMPREF0675_3009"
FT   CDS_pept        11843..14518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="HMPREF0675_3009"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by match to protein family HMM PF00521;
FT                   match to protein family HMM PF03989; match to protein
FT                   family HMM TIGR01063"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3009"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00537"
FT                   /db_xref="GOA:D4HEG8"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEG8"
FT                   /protein_id="ADE00537.1"
FT                   /translation="MADDEKPDEQNQADRQGLVTGRHVGIQPVEIRDEIQNAYLDYAMS
FT                   VIVGRALPDVRDGLKPVHRRVIYAMYDGGYRPDRGWNKCSRVVGDVMGKYHPHGDSAIY
FT                   DTLVRLAQPWAMRYKLVQGQGNFGSQGNDGAAAMRYTECKMAPLAMEMVRDIDQDTVDF
FT                   QPNYDNKETEPVVLPSRFPNLLVNGSSGIAVGMATNIPTHNLREVNEAVQWSLAHPNAS
FT                   HEELLEACMERIKGPDFPGGALIVGRQGIEDAYRTGRGSVTMRAVIDMEEDKKGRQCLV
FT                   VTELPYMCNPDNLATKIADLVNSGRINGIADIRDDSSARTGQRLVIVLKRDAQPRVVMN
FT                   NLYKHTALQDTFGCNMLALVDNVPRTLRLDQFISYWIDHQMEVIRRRTEYRLAQAEKDA
FT                   HIQRALVKALDMLDEVIALIRRSPNTEAASTGLQELLDIDEIQARAILDMQLRRLAALE
FT                   RQKIIDRLEELERLIADYKAILASEDRQREIISTELAEIVDKYGDERRTRIIAADGDFS
FT                   EEDFIPDDDVVVTITRGGYAKRTRTDLYRVQKRGGKGVRGASLRADDEVAQLFTTTNHQ
FT                   WILFFTNMGRVYRTKVWQLPEAGRDARGGHVAGLLSFLPDEKIAQVMTLRSYDDAEYLL
FT                   LATRKGMVKKTALKAYDSSRQAGVIAVNFRTEDDELIGAEQCSAADDVLLISRKGQAIR
FT                   FSAGDDQLRPMGRATSGVTGMKFRGDDELLSMSIIHSDMPEDDRFVFTATGGGYAKRTA
FT                   VSEYRQQGRGGVGIKAMALSEERGSLVGGLVVSEADEIIAIKTSGQITRSAVSEVPAKG
FT                   RSTMGVKFVSVRGGDAVSIIAVNPEHTVEEEVADESVETVEGDATQAQSGEVVRRSDTV
FT                   DGDRAVDTAGNDMKPEDNGE"
FT   gene            14511..15137
FT                   /locus_tag="HMPREF0675_3010"
FT   CDS_pept        14511..15137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3010"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00741"
FT                   /db_xref="GOA:D4HEG9"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEG9"
FT                   /protein_id="ADE00741.1"
FT                   /translation="MSDEKKVTHPGPDDPEAIHWTAGDARRTFHEKGEERPDPRQESDR
FT                   KRTTASTPVRRTDSRGAQGEKAPNQQHRSPQAHQPARAPRRTRKARLRLTRVDPWSVMK
FT                   TSLLFGVAGAVIFFIATWIIWGIIGASGAFDSMNKVVNDLISSPSSTSKFELSDYVNTG
FT                   RVLGLTALIGAINAVLFTAISTLFSFLYNLAAQIMGGLEVTLAED"
FT   gene            complement(15236..16204)
FT                   /locus_tag="HMPREF0675_3011"
FT   CDS_pept        complement(15236..16204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3011"
FT                   /product="lactate/malate dehydrogenase, NAD binding domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00056;
FT                   match to protein family HMM PF02866"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3011"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99323"
FT                   /db_xref="GOA:D4HEH0"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEH0"
FT                   /protein_id="ADD99323.1"
FT                   /translation="MSIAPHLVVIGIGHVGSDVVTNAAALGLFSRISLIDVDKKVRDGQ
FT                   ALDNHQATAVAPAMTTTITAADYDACRSADVIIVSAGPSVLPDSYGGGHDSRNSLAQVN
FT                   SKVIREVMGNICQYTHSAPIILITNPLDVNVHIAATEFDYPTNLVVGTGTALDSARLRR
FT                   HLADWAGVSPDSVQAFMLGEHGATAFPYLSHASIGGLTLAEATTALGLQPLSPEQVGNS
FT                   VVQSAFDVLEGKGWTSSGISKAAVSLARAMLLDQRSIHPVCTLADGVLGFHGEVSLSLP
FT                   TVVSGHGVEHHLNIVLDEWEQEKLLVSAKAVREVYESVRPA"
FT   gene            16721..17872
FT                   /locus_tag="HMPREF0675_3012"
FT   CDS_pept        16721..17872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3012"
FT                   /product="sugar-binding domain protein"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3012"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99349"
FT                   /db_xref="GOA:D4HEH1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEH1"
FT                   /protein_id="ADD99349.1"
FT                   /translation="MTHKPTIKDVARLAGVSLGTASRVLNGSSATSEASRSAVHNAAHE
FT                   LGYLSNAHARSLRSSHSGVIGLVVPDIRNPYFAELASVVENACLAHGWATLLCNADESP
FT                   DQFNRYVNTLRRQRVDGAIVTPTGSGGQAVKDLVDDGVQVVCVDREITGSPLPAVTSDP
FT                   WNGMRQAVHHLVDHGHRRIGFITGPQQTSTGLERYQAYRQLLAEHGLEVDEDLVVEGDF
FT                   QEESGRMGARRLLDGGATAIFASDSLMSMGALRTCIDQGVRIGDEIDLVGFDDLPVFSL
FT                   TNPALTVVAQDIDVMGKVAVDLLNRAMSGEPTSSARLDTHLIVRASTRMVKENQWQQYF
FT                   DSTTSLRLSDPSRSSKTYRWTSFLAGCASCSVKTEPESPPSSR"
FT   gene            17869..19230
FT                   /locus_tag="HMPREF0675_3013"
FT   CDS_pept        17869..19230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3013"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3013"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99519"
FT                   /db_xref="GOA:D4HEH2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEH2"
FT                   /protein_id="ADD99519.1"
FT                   /translation="MMSGIYHPDSGSVVIDDTPVELPTVKAAEARGIATIHQELNLVPQ
FT                   MSVAENIMLGRTPSRGGLVNWGLMRAQARAALERIGLDVSPDRLVGSLSTAHQQLVEIA
FT                   RALSMDARVLILDEPTAALTRKESGQLFEVMDDLKTKGVAMVFISHHLDEIPRVGDDVS
FT                   VLRDGTLVGEVPARTSERELVTMMVGRDIDDQFPRHRGEVGEVLLSVTGLSRERAFQDV
FT                   GFDLHAGEVLGLAGLVGAGRTEVLRAIAGADKYDSGTVRVRGKELPKGKISRAIVDGIG
FT                   HVPEERKSQGLVLDASVNENLGYATMKSTSHAGLVDRSGQRRRAQNVAEKLRVRMASLD
FT                   QPVRNLSGGNQQKVVIGRWILADLSILLLDEPTRGVDVGAKVEIYQLINAVTDAGGAVL
FT                   MVSSELPEVIGMSDRILVMSHGRAMGILDAKTATEDAVMELAVASVDPVDEKTG"
FT   gene            19289..20290
FT                   /locus_tag="HMPREF0675_3014"
FT   CDS_pept        19289..20290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3014"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   permease protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3014"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01206"
FT                   /db_xref="GOA:D4HEH3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEH3"
FT                   /protein_id="ADE01206.1"
FT                   /translation="MIWKGKIIVTTTSTATTQRPSVGRKVGSWALDHGALVGLIILCIA
FT                   LFIATPVFLTVPNIINIGIQAAVVAIMAFGMTFVIVTSGIDLSVGSVAALSAMVSAWMF
FT                   SNAGLPGWLTLIIGLLIGLLAGAVSGLAIAYGKLPAFIATLAMMSVARGLTLVISGGTP
FT                   IATSDAVNQLGADVGPIPVPVIMLALAGVVCWFMLSRTVLGRSLYAIGGNEEAARLSGI
FT                   PVRRILVTVYALAGVFAGLAGLVLAGRLSSAQPQAGFGYELDAIAAVVIGGASLSGGSG
FT                   KASGTFIGAVLLAVIRNGLNILNVSSFWQQVVIGCVIALAVGFDVFRSKKES"
FT   gene            20339..21280
FT                   /locus_tag="HMPREF0675_3015"
FT   CDS_pept        20339..21280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3015"
FT                   /product="sugar-binding domain protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   premature stop; identified by match to protein family HMM
FT                   PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3015"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00873"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEH4"
FT                   /protein_id="ADE00873.1"
FT                   /translation="MKFKSTKVLATAVAATIIATGVAGCNRDGGAGSSASGTVVFAVST
FT                   QTNPFFVQLVDGAKKEAKAKGVNLQVQDASDDAATQANQLANAVSTSAKVVIVNPTDSD
FT                   AVAPSVKALNKAKIPVITVDRSSCSGDVASFIASDNIAGGIDAAKKLAEIMGDKGEVIH
FT                   LQGTPGASASRDRGKGFSEEIAKHPGIKVVARQTANFDRSKALDVTTNLMQAHSKATGI
FT                   FAENDEMAIGAISALGSKAGQSVKVVGFDGTADGIKAVKAGTMGATIAQQPALLGKTAM
FT                   DQAADILAGKQVSKTTPIKVVLVTKDNAKDYE"
FT   gene            21277..22206
FT                   /locus_tag="HMPREF0675_3016"
FT   CDS_pept        21277..22206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3016"
FT                   /product="putative ribokinase"
FT                   /note="identified by match to protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3016"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99039"
FT                   /db_xref="GOA:D4HEH5"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEH5"
FT                   /protein_id="ADD99039.1"
FT                   /translation="MSGATAKVTVVGSINADMRVGVERFPGPGETLAGGEATLTTGGKG
FT                   ANQALAAARCGVQVAMVGAVGKDPTAETALSLLSESVGLDGVVRRDVLTGTAVVMVADS
FT                   GENSIIVVAAANGTVDAQTVQAQAERIQDADVVVCQGEIPPDGIAEAARGAKRFVFNLA
FT                   PVVDVDPEVIRMADPLVVNEHEAALVALALGSTTSRLEDDPDAALRELLNLGCRSVVIT
FT                   LGSAGCIVGGPEGFDAVAAATVKAVDTVGAGDAFVGALAAELARGRTLVEGCRFATAVA
FT                   TLTVTKPGAQASYPSADEVESIRRGEHA"
FT   gene            22203..22586
FT                   /locus_tag="HMPREF0675_3017"
FT   CDS_pept        22203..22586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3017"
FT                   /product="RbsD/FucU transport family protein"
FT                   /note="identified by match to protein family HMM PF05025"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3017"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00390"
FT                   /db_xref="GOA:D4HEH6"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023064"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEH6"
FT                   /protein_id="ADE00390.1"
FT                   /translation="MKKSGLLNPQLCAAVARLGHTQTFVVADAGLPIPHEVPVIDLAVV
FT                   LGTPRFQEVFDAILDEVVVEGATIAHEALGHEPESWVRERIEEVHTVSHEDLKKALPNV
FT                   SFVVRTGETTPYSNVIVRCGVPF"
FT   gene            22681..22754
FT                   /locus_tag="HMPREF0675_3018"
FT   tRNA            22681..22754
FT                   /locus_tag="HMPREF0675_3018"
FT                   /product="tRNA-Ile"
FT   gene            22905..23039
FT                   /locus_tag="HMPREF0675_3019"
FT   CDS_pept        22905..23039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3019"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3019"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00881"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEH7"
FT                   /protein_id="ADE00881.1"
FT                   /translation="MKADYTDQVVRPALGEWVDESMATTRGSSVLLLFIFQPFQKQLL"
FT   gene            complement(23191..23667)
FT                   /locus_tag="HMPREF0675_3020"
FT   CDS_pept        complement(23191..23667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3020"
FT                   /product="phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system, EIIA 2"
FT                   /note="identified by match to protein family HMM PF00359"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3020"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99346"
FT                   /db_xref="GOA:D4HEH8"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEH8"
FT                   /protein_id="ADD99346.1"
FT                   /translation="MSVLLNTDLISVNIEAPDRNQVLTVMADKLNGVRVAKEGFLDALL
FT                   KREETYPTGLPISGGVAIPHTDPQYVTRDALAVTTLHTPVLFGQMGGSEEDEVPVSVVI
FT                   LMALSNADDHLNMLQNIVKSIQDDNLMQTIRSATKPEEVVSIVRPMIPADTEDS"
FT   gene            complement(23724..24272)
FT                   /locus_tag="HMPREF0675_3021"
FT   CDS_pept        complement(23724..24272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3021"
FT                   /product="hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3021"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99773"
FT                   /db_xref="GOA:D4HEH9"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="InterPro:IPR013853"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEH9"
FT                   /protein_id="ADD99773.1"
FT                   /translation="MTRQPWQGVLVMGMGIATVLVLLPRMVSVMMEGLSTVGEGAKTFM
FT                   KRLGKNKDGSERELSIGMDVALALGDPAAITITVLMIPLCIAFAFIIPGMNYFPVGMLT
FT                   VIVYMMPMICLACNGNMFRSLIIGAIYMFFVEWGASFFAPEATAMMHATGVHVSGSVTD
FT                   AFFGYNLPNVIISAIHRMF"
FT   gene            complement(24269..24979)
FT                   /locus_tag="HMPREF0675_3022"
FT   CDS_pept        complement(24269..24979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3022"
FT                   /product="hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3022"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00441"
FT                   /db_xref="GOA:D4HEI0"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="InterPro:IPR013853"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEI0"
FT                   /protein_id="ADE00441.1"
FT                   /translation="MSIIKGILDVGAVVILPIVMLILCLIFRMPFGKSLKAGLMIGIGF
FT                   SGLSLVIGFLMTSVQSAVDYYRHMGGGFTTVDVGWAAVGAASFGVPFAAPAILLVVLIN
FT                   VVMILAKMTNVLNVDIWNFIRFLVPGTLAYALTNNAWIGLGVVLVLSVIDLIVAQHIAP
FT                   KWQEYYGLTGTTCSTLSYITSAWPIAIGLNWVIDKIPGVRKIDISMEKFGDRLGFFGDT
FT                   AFIGLIVGIFLWDS"
FT   gene            complement(25000..25302)
FT                   /locus_tag="HMPREF0675_3023"
FT   CDS_pept        complement(25000..25302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3023"
FT                   /product="PTS system, Lactose/Cellobiose specific IIB
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF02302"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3023"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00779"
FT                   /db_xref="GOA:D4HEI1"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEI1"
FT                   /protein_id="ADE00779.1"
FT                   /translation="MESEVKVLVACGSGIATSTVAQEKVKEILRDAKIPAKITKGTVGQ
FT                   LPVLQDGVDVIMLTTRYGKPLNKPIIQVFGLISGINEDAVAEEIISTCRDVLNQS"
FT   gene            complement(25292..25675)
FT                   /locus_tag="HMPREF0675_3024"
FT   CDS_pept        complement(25292..25675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3024"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00114"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEI2"
FT                   /protein_id="ADE00114.1"
FT                   /translation="MAEMMNAALMYGPGDIRVEQMPKPTCPPGGFVLRVDAVGLCGSDI
FT                   RNLTTDSRKGDYPFIYGHFGATSVQVQKAFELIIDDKFPAEQVISKVLPLSRINDAIEL
FT                   TRTGEAMKVVLVPDRKESEHHGK"
FT   gene            25946..27457
FT                   /locus_tag="HMPREF0675_3025"
FT   CDS_pept        25946..27457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3025"
FT                   /product="HTH domain protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   premature stop; identified by match to protein family HMM
FT                   PF08279"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3025"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99741"
FT                   /db_xref="GOA:D4HEI3"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEI3"
FT                   /protein_id="ADD99741.1"
FT                   /translation="MIRFSQRQALLLQLLSEVDHPIKETDLAGLLGVSTRTLRYDIARI
FT                   NGISRDNIIESTTNGYSVEQSVYTGVVARNSEFSTQLEHHERILLYLLDTPDTTIYDVM
FT                   RDCYLSESVIKASLKRLKPQFEDHSLHLSLRGSSIHLDGNEIYFRNFLGSLVNTAMDAV
FT                   VGQNDKVNRYLPDVRLGDIENLVVESLRDYYLEIDDIRLSNMVVNIAICVQRYSFPIGD
FT                   NAATDLMMSNQSEMLCDQLLVGLRKLYPERPLSSADDAYLRSIVGATLGFGHGELDHHS
FT                   DSCDIYSTVSRCLDDTVEHFGLVIAKEELYGSVSKHVGRLMAHAPSMPYFRNTLRESLR
FT                   SRSPFLYDAAVYLTDKLSRLLGIFFTDDEIGLLAVYIGLYSEPAPNPNLVTAVVVCPRY
FT                   QALRDVLLAGLVDHFANRMRIVDIVSSVAEVDMCDGDIVISTTEEPSHHHTCVPISALM
FT                   SDLDLSAIDSALLRAGEKKSRIATASAMKRFLDPTLFFTGRSFDS"
FT   gene            27668..27838
FT                   /locus_tag="HMPREF0675_3026"
FT   CDS_pept        27668..27838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3026"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99872"
FT                   /db_xref="GOA:D4HEI4"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEI4"
FT                   /protein_id="ADD99872.1"
FT                   /translation="MSLVLLLAINEGDYDDFVRFYQPLISVLYDRELFTELRSMSSYHE
FT                   FMKFLDKQISM"
FT   gene            28765..28980
FT                   /locus_tag="HMPREF0675_3027"
FT   CDS_pept        28765..28980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3027"
FT                   /product="hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3027"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99315"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEI5"
FT                   /protein_id="ADD99315.1"
FT                   /translation="MPAAAEFVLAPQTMVARRFDVFDPVVVASGHATVASTLRACPSQG
FT                   RYRLLKLLSEVAVGVACAHGVTAEYI"
FT   gene            29408..29611
FT                   /locus_tag="HMPREF0675_3028"
FT   CDS_pept        29408..29611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3028"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3028"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01009"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEI6"
FT                   /protein_id="ADE01009.1"
FT                   /translation="MAPGHEIFGVLDGAAEVEQGHVPEISGAEDAFSVGVGSELVAERV
FT                   GAELIGVRAGGMQERKNAAGGY"
FT   gene            complement(29806..29958)
FT                   /locus_tag="HMPREF0675_3029"
FT   CDS_pept        complement(29806..29958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3029"
FT                   /product="hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3029"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00562"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEI7"
FT                   /protein_id="ADE00562.1"
FT                   /translation="MDVTTLQTQGERAVATSAHTIEPPVHDGAGRWPLSIVLMPPPPAE
FT                   SVLAA"
FT   gene            complement(29982..30125)
FT                   /locus_tag="HMPREF0675_3030"
FT   CDS_pept        complement(29982..30125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3030"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99572"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEI8"
FT                   /protein_id="ADD99572.1"
FT                   /translation="MEDSASGLAAARSAGTVVVAVGGRRDADVVCHDLVDLHRLLVQIR
FT                   SK"
FT   gene            30168..30389
FT                   /locus_tag="HMPREF0675_3031"
FT   CDS_pept        30168..30389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3031"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3031"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99020"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEI9"
FT                   /protein_id="ADD99020.1"
FT                   /translation="MEVTVGCRLAMLDVLEGDQEWWVDGGCAESGERESPRRVGDDAPR
FT                   DAVGVEPDEEFPAADRRLYAVELCALLV"
FT   gene            30496..30651
FT                   /locus_tag="HMPREF0675_3032"
FT   CDS_pept        30496..30651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3032"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3032"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00914"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEJ0"
FT                   /protein_id="ADE00914.1"
FT                   /translation="MGMLFRSAQADQTDSTATVESTSVPSMSKRTAWKSASRGSVRVIV
FT                   ISVLPG"
FT   gene            30743..31501
FT                   /locus_tag="HMPREF0675_3033"
FT   CDS_pept        30743..31501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3033"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="identified by match to protein family HMM PF00455;
FT                   match to protein family HMM PF08220"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3033"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99406"
FT                   /db_xref="GOA:D4HEJ1"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEJ1"
FT                   /protein_id="ADD99406.1"
FT                   /translation="MIKLFRQKMIINSLGTSPTSVDTLVELTGASPATIRRDLTDLEGH
FT                   GQLRKVHGGAVAVNLRGTPMPYSLRSAENAESKTAIAQLVSRLVTDDMSVIIDNGSTMV
FT                   AVAQALQERPITALCLSLRAALPLGGGGVATVSTPDGTLMPESLRYEAASCLRALGEFR
FT                   ADVAIVGTCSASPAMSLTVTTHQDAQVKRAILASSARVVLAATGDKLSRTSSFRFGDIE
FT                   DIDDLVTTRDAPQVTLDAFRVAGSRVYVAD"
FT   gene            complement(32118..32855)
FT                   /locus_tag="HMPREF0675_3034"
FT   CDS_pept        complement(32118..32855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3034"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00036"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEJ2"
FT                   /protein_id="ADE00036.1"
FT                   /translation="MVKEQRPCIIGTVAISTTLHLAPNDIGAFTDTDELRILMESAESH
FT                   GYFDPPPLENREYLIERPIGVVVSDTSQPEYLTLRLDCNPERHILGRPGMKIMLVLADA
FT                   LRLIGLSTPQSIDVECVYFDPRDWDLLNPDPEDHIHMIGTLSREVCRWMSPHLTHTWHT
FT                   TATTNPDLDPHLAQNTINRWFPPDFEYPWLGHTPQAHQETLTWHMPDDITALGWLFDLI
FT                   TLLQGQPPQHIHATPNEQKIRPW"
FT   gene            33522..34580
FT                   /gene="hisC"
FT                   /locus_tag="HMPREF0675_3035"
FT   CDS_pept        33522..34580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisC"
FT                   /locus_tag="HMPREF0675_3035"
FT                   /product="histidinol-phosphate transaminase"
FT                   /EC_number="2.6.1.9"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM PF00266; match to protein
FT                   family HMM TIGR01141"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3035"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00410"
FT                   /db_xref="GOA:D4HEJ3"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024892"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEJ3"
FT                   /protein_id="ADE00410.1"
FT                   /translation="MSQDRRDVVRGLPLYKQGASHGENAVKLSSNENPFEPLPSVIEAV
FT                   TRTLPRFNRYPSMSAEEVRSSIAGHFGVDVSQVAVGAGSTEVASQLMHAFAGAGDEIIF
FT                   PWRSFEAYPILTQVAGATPVPAPLTKDLRHDLDAMSAAITDRTRLIFLCTPNNPTGTVL
FT                   HTDEVVEFLARVPQNVVVVMDEAYYHFNRDDAAVDGLTLPNDHPNVVVLRTFSKAYGLA
FT                   GLRIGFAISAPEISDDLRRVATPFTVTTLAQQAAIASLAAEDELNERVNRIVAERTRVF
FT                   DELTRQGWKIVPSQANFLWLVTGDDTDRIDEVMVSHGVFARCWSGEGIRLSIGLDAEND
FT                   RAIEALSQAVKG"
FT   gene            complement(34584..35615)
FT                   /locus_tag="HMPREF0675_3037"
FT   CDS_pept        complement(34584..35615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3037"
FT                   /product="phospholipase, patatin family"
FT                   /note="identified by match to protein family HMM PF01734"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3037"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01108"
FT                   /db_xref="GOA:D4HEJ4"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR037483"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEJ4"
FT                   /protein_id="ADE01108.1"
FT                   /translation="MPQPFQVFLDEGTDLNLPDLCRAVTRGNVARSSHAPIIACPRQLT
FT                   TWQAGPMTTSIDGTALVLEGGGMRAAYTSAVIVKMLGLGWKFPHVSGISAGSSLTANYI
FT                   SRDPERTRLSFTDFVADPRFGNLGTWLAGRGYFDGEYIYQRTAEPHQALPFDFLTFCAS
FT                   SQAFRIGATRTSDGGQEWFTREDMKTMNDLMVRVRASSTMPGFMPPVTIEGVEYVDGAL
FT                   GDSGGIPIDGAQLDGYDRFFVVCTQPRDYVKNEIKRPQVLRQLFRRRPSVAEAAIARPA
FT                   KYNATREMLRDLEADGKAYVFYPRVMPVTNKEKNVTKLRQAYALGMAQVNAELPQWRDF
FT                   LGV"
FT   gene            35607..36080
FT                   /locus_tag="HMPREF0675_3036"
FT   CDS_pept        35607..36080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3036"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3036"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99058"
FT                   /db_xref="GOA:D4HEJ5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEJ5"
FT                   /protein_id="ADD99058.1"
FT                   /translation="MWHWNVEVVDPQWKQWDGPYFGPDDDRSFAEFAEEWRSGLMSGHR
FT                   AVVTVDGRRAGFVSRFEEPPAGGGWWEVGIVVFRPTLWGRGVGCRALRLWTEATFATTD
FT                   AQVVTLTTWSGNGRMIHCAGAVGYRECGRIPQARSWQGRRWDLVTMALLRDDL"
FT   gene            36094..36753
FT                   /locus_tag="HMPREF0675_3038"
FT   CDS_pept        36094..36753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3038"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99497"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEJ6"
FT                   /protein_id="ADD99497.1"
FT                   /translation="MRRGVVTSVLLACTLVSGCSTLKPLTEPQPTPTVSASKVPQGIDA
FT                   HPAWAVPVARSGKKLGHFGDDRIRIEVDQAAIAKAPEDSIMVNPQDGTPVVSKGSSIVL
FT                   VRYIVTNVSQEPINLGLGTVTITARYPDWTWRQPLVSVLAPRADAAHKIVTTPFAPGTA
FT                   RPPYVLGLGESFMVGANYPYETAEQLDVTATVVVCDTAGAVDPGLGWTITGKVHLA"
FT   gene            37006..37644
FT                   /locus_tag="HMPREF0675_3039"
FT   CDS_pept        37006..37644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3039"
FT                   /product="SAF domain protein"
FT                   /note="identified by match to protein family HMM PF08666"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3039"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00223"
FT                   /db_xref="GOA:D4HEJ7"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEJ7"
FT                   /protein_id="ADE00223.1"
FT                   /translation="MSVTTTPISARATTPSPRLRRSPRLIVIGVLCACLGGLGGAVAWH
FT                   RASHADQVLVMTRAVGQGDIVRNADIGLTSVAVDRAVATIPASQLDKIVGRHALVDLSP
FT                   GQLLGSHSVGELRVAPGRARIGLKLAAGRLPTVSLPAGARVTVIETSPDKDTGTVSNLS
FT                   TADAVVVAAPKATNDHGNWLVDVEVDSGNAARLADLASLDRIALVERGQ"
FT   gene            37641..38462
FT                   /locus_tag="HMPREF0675_3040"
FT   CDS_pept        37641..38462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3040"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99405"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEJ8"
FT                   /protein_id="ADD99405.1"
FT                   /translation="MMSIILLTSPGGAPGLTTTALGQALTWPRDVVLVDADPCPGHVIE
FT                   SGYLTGRIPPRPGLIGLTTAFRDGADPVQTMWEETIPLPHDSGDRMVRLLSGYGHLGQA
FT                   SLMGAAWSSLASAMIDLGQAGVDVIVDAGRLGPETLPGSLVSRASLIGIVTGSRLRQLA
FT                   GLSMRAEEVEAMSSATTGTVGLVIVGPGRPYNSREIGHQFGLPVFGDVVFNAHAAAVLS
FT                   DGEPAGKRWSRGRYVTSMQSMAESMRERIRRADQAITGPEILSTSAMGVAS"
FT   gene            38459..39937
FT                   /locus_tag="HMPREF0675_3041"
FT   CDS_pept        38459..39937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3041"
FT                   /product="type II/IV secretion system protein"
FT                   /note="identified by match to protein family HMM PF00437"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3041"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00033"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEJ9"
FT                   /protein_id="ADE00033.1"
FT                   /translation="MTIDHAVSRYAQDAPVVPLDDGKDLAGVLSRISPSPHVSPAAVSP
FT                   RPNPRRFEAKDIDWRTVVSFRRKASERISSERASHRERTGVDLSGDDVRMLGRSIVRQA
FT                   VESHAEKLTAEGQALWSAQTKDAYVRAVMDAIFGYGRLQPLFEIQDAENIEINGCDRVF
FT                   VQYGDGRREPGPVVADDDAELVEAIRFLGESANPPRPFDDAHPTMTVALGSQYRLHAIG
FT                   FGLSYRPSVVIRHHTLTRVTIDDLVNTAMMPHHVGVLLRAAVLARRSIVIAGDQGAGKT
FT                   TLLRALVDAIPPTERFGTLETDYELLTHLNPDRDNMVAFQATVGLGEKVDGHCVGELTV
FT                   ADLVPEALRQNLSRLVVGEVRGAEAAAMFEAMQAGAGTMSTTHSHSATSTMDRLAGRVA
FT                   MGGVMTIEEAYRQIAHNITFLVHVTLVDDTWRGGTRTRYITEVRQLTGALENGRPVTHL
FT                   TYAAPTPISPGVFHPDSALVAELSRYEPEVTRWV"
FT   gene            39934..40809
FT                   /locus_tag="HMPREF0675_3042"
FT   CDS_pept        39934..40809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3042"
FT                   /product="bacterial type II secretion system domain protein
FT                   F"
FT                   /note="identified by match to protein family HMM PF00482;
FT                   overlaps another CDS with the same product name"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3042"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00132"
FT                   /db_xref="GOA:D4HEK0"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEK0"
FT                   /protein_id="ADE00132.1"
FT                   /translation="MNTAIAALLGGLLVGGVVMVGIGIAPIHQLSTGQSTSLWTRVDNW
FT                   FSRLPRRSRVHGLTGLGIGVVGYVVTGWAVVLVIVPVLAVVVPALLADPPRHDLDVMRA
FT                   LERWVRLVSGSASTGKSVIDAIRATRRQAPELLIEPLTRVVARLDSRWDTRAALQGLAD
FT                   DLDSADADQVIAAIMMAAERGGTGATGTLDALAASLQERIRAAREIRVERAKPRVVVRQ
FT                   VSIIIGVVLAGALILGREYLVPYRTGVGQLLLCCYAGLYLAGLIALSRRSKPRRRARIL
FT                   LRRAGEANYG"
FT   gene            40802..41704
FT                   /locus_tag="HMPREF0675_3043"
FT   CDS_pept        40802..41704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3043"
FT                   /product="bacterial type II secretion system domain protein
FT                   F"
FT                   /note="identified by match to protein family HMM PF00482;
FT                   overlaps another CDS with the same product name"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3043"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00596"
FT                   /db_xref="GOA:D4HEK1"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEK1"
FT                   /protein_id="ADE00596.1"
FT                   /translation="MAESTVILAAICGALLACAPVFVVSGRRNAPLRLSDALAGLSDYG
FT                   RQDAVVGPVAEGGRLERWGTRAAIRWPRMVSERSRRTLILQGRTPGDLVIEKAVMAMGG
FT                   MLVPALARAVAAACGDTLPVTPVGLAVVLAVVGWFIPDTRIRSRSKAVRQDAAEAVLVY
FT                   VDLVTLARLANQSAPRALVEAAQMSDHPVLARIRMTLERSRLEQQSPWAGLDELSDELD
FT                   LPELAELVEVLRLDDQGASLAGALRARVHEMRDAHLNQEKVEAQTASESLTIWMVIPVL
FT                   VLGLVLITPPLLIMAGVAS"
FT   gene            41774..41986
FT                   /locus_tag="HMPREF0675_3044"
FT   CDS_pept        41774..41986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3044"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3044"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00329"
FT                   /db_xref="GOA:D4HEK2"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEK2"
FT                   /protein_id="ADE00329.1"
FT                   /translation="MTKEVAMKHVNTVASVVLPMIAGIPPLVEKRDERGLSQSTENAIL
FT                   LVGAVSIATVVVTVIKGYVSSNLPK"
FT   gene            42055..42363
FT                   /locus_tag="HMPREF0675_3045"
FT   CDS_pept        42055..42363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3045"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99224"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEK3"
FT                   /protein_id="ADD99224.1"
FT                   /translation="MWPVVLLVVVAVIQTAVVLQARATVTEAARAAVRVQALRGSHAGE
FT                   AEATARDVAQTSKVTDVTVTVSTTDSLVRVDVEGRAAALFGAVVAVRGHAVAVEEGT"
FT   gene            42360..42869
FT                   /locus_tag="HMPREF0675_3046"
FT   CDS_pept        42360..42869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3046"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00319"
FT                   /db_xref="GOA:D4HEK4"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEK4"
FT                   /protein_id="ADE00319.1"
FT                   /translation="MIRPFHGRALLPQDRIDQIRYRRCNACQNRRHWCCRGAVAVEAAL
FT                   ILPALLMIAAVATGSWRISEVKADAQSAAQVAARAGSVASSVGEGIAVGQRVGLAELAG
FT                   TRCSNPAIAVDSSDLTLPVGFAGTASARVSCTIKLSDLLVPGMPGSFHIESVAHSTLDS
FT                   HRERYS"
FT   gene            42866..45628
FT                   /locus_tag="HMPREF0675_3047"
FT   CDS_pept        42866..45628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3047"
FT                   /product="LysM domain protein"
FT                   /note="identified by match to protein family HMM PF01476"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3047"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01254"
FT                   /db_xref="GOA:D4HEK5"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEK5"
FT                   /protein_id="ADE01254.1"
FT                   /translation="MKISPVRARIHGALAMVALLLLVVGSPAALVAWGHLDATTVLSPA
FT                   GWLAPDDGSIFLTVVTVIGWAAWTVFCVCVVAEAVGMATSQRHHVKLPGLGAIQGIAAG
FT                   LLVASLTVLSPLTRSAVPPAPVSLVATAAAAPQPAPEAQVDSDSRHDEDVMTVTVGPHD
FT                   DLWTLAETWYGDGTSWRRIVAANPDVDVDHLVVGQRLALPGATVTVPAGHTGAGRPIDT
FT                   EQLNQIAPPSEMSKIRTITVEQGDTLSGIAQTQLGDASSWPAIWHLNEGIIADPDHIEP
FT                   GWELVLPDSPTVDKRASDQHTNEQGGKWEKSTPAETPTTESTPPVLPEGGGDTTATVNE
FT                   TKVEPHTAAGADQEVSVAEVGQSPAEILRTALAGLSLFLAGGVAGTVTTRRRQQLFTRP
FT                   LGRRIPPVSGEPRRAKRVLDAAADQLDESASSRDTAALAMTPTTVVLGTCDPQTPVVVD
FT                   LADVGGVLAVNAARDLATAMVASISLSLVAAPWSGGIDIVAVGEDLAWLAHTGSDDVQL
FT                   ADEDEIVEGLAGLSNEASEYPATITRVVLSLSPLNLPSPASLAAAGIVIVMPGVGGQKI
FT                   TVTDCDHAEFHGQSFTPQIVTSPMRRAVVELLETTARSDTEPAPWWEPRRGDEEGSDPP
FT                   PVMDKPCAVLPPSDAHLTVEEETVLTSTMTSDVAHLPATGGQVPSPILRLLGPVDLLGA
FT                   RGNPPTKARRQCLEYCAWLLCHPGARSVQMADALMVAEPTRRSNVSRLRRWLGTDDAGR
FT                   AYLPEGYDGSLRLADAVTSDWERLELLVSGGVSTAPLANLVSALDLVRGAPLADAAPGQ
FT                   WHWAEEWRIDMIQMVRDIGVEVARRAMEIRDVELASRALARATVACPEDEVLLVARIKL
FT                   ADELDDRGEVERLVYVLSRQARRLGVDLSEETITVLQEVMEGHARARVV"
FT   gene            complement(45675..47018)
FT                   /locus_tag="HMPREF0675_3048"
FT   CDS_pept        complement(45675..47018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3048"
FT                   /product="transporter, major facilitator family protein"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3048"
FT                   /db_xref="EnsemblGenomes-Tr:ADD98919"
FT                   /db_xref="GOA:D4HEK6"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEK6"
FT                   /protein_id="ADD98919.1"
FT                   /translation="MFWQNLRHLWRRRDFRKILGVRVATQAADGTLQVGMASYVLLSPE
FT                   QQPDAWSIAMVLAITLLPFSIIGPFVSVVLDRWSRQRILVYTDGLRCLIAVGLGILVWN
FT                   GARDKPSHLALLIGLLIAMSLNRFLLTALVAGLEYTIDKRDYLTASSIMPTIGPLGLMI
FT                   GAVVAAAVRMIAGRHIPVHHADTIIFCISAALFAVSVALGLQFSRRELGPPPVDRSRTM
FT                   RAVAGDVVDGFRYLGKVPLVGHSLTLIGAQRVLFGVYSVAMILGYRNRFHVQSDINGAM
FT                   ADMTVWAVAMGAGFVLSAGFMPVLVHRLGMRRALMALLTATAVIQAFPGATPNRWGLLV
FT                   AGFFVGLFAQSLKAGVDTICQAHITDGYKGRVFIAYDMVYNAMFVAGSALAALVLPIQG
FT                   LSGPHIVGLAIAYAVVAVVFALTTRAHGNDVFDKGSALGGLPAANPEE"
FT   gene            47388..49097
FT                   /gene="fhs"
FT                   /locus_tag="HMPREF0675_3049"
FT   CDS_pept        47388..49097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhs"
FT                   /locus_tag="HMPREF0675_3049"
FT                   /product="formate--tetrahydrofolate ligase"
FT                   /EC_number="6.3.4.3"
FT                   /note="identified by match to protein family HMM PF01268"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3049"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00550"
FT                   /db_xref="GOA:D4HEK7"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEK7"
FT                   /protein_id="ADE00550.1"
FT                   /translation="MIGAMTMKSDLEIAREAHLDPIEKVAARAGIDEKYLEPYGRGVAK
FT                   VDLDVVTHNRDHSCGKYVVVTAMTPTPLGEGKTTTAVGLAQGLEKIGKHSVLALRQPSM
FT                   GPTFGIKGGAAGAGYSQVLPMEKLNLHLTGDFHAIGAAHNLLAAMIDNHLHQGNELDIE
FT                   PHSISWRRVVDINDRALRNTIVGLGSRVDGVPRETGFDITAASEVGVILSLATSLSDLR
FT                   ARLGRIVIGYNRSKEPVSAEDLHAAGSMAVILKDALKPNLLQTTENSPVLVHAGPFGNI
FT                   ATGNSSVIADRVGIGCGDYLLTEAGFGADMGAERFFNIKCRIGGMRPDAAVLVATVRAL
FT                   KTHAGRYKVIPGKPLPPAMLEDNPDDVLAGAANLRKHIEIVREFGVSPIVALNVFPTDH
FT                   PDEIDAVRKVAEAAGAHFASSTHVVDGGDGAVDLAHAVVAACDHKADFRYTYDLEDSLV
FT                   EKLTKVATKVYGADGIDIAPAAAKELAHFEDLGYGTFPVVIAKTHLSLSHDPSLKGAPT
FT                   GWRLPVREVRAAVGAGYIYAICGDMRTMPGLGRHPAAERIDIDDNGETIGLF"
FT   gene            49203..49616
FT                   /locus_tag="HMPREF0675_3050"
FT   CDS_pept        49203..49616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3050"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99228"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEK8"
FT                   /protein_id="ADD99228.1"
FT                   /translation="MPYPQLVTSKRAEDARLRIEFEERARRQEAVQAQRLIDDFLVMAR
FT                   AQGMTPVPLRAQLMDGHEARTDKRGWYLNAKHSLAIGENGEYYHLVVTGGFAERLRGVK
FT                   LHPSLPPMHIGRGGRDGETGELKEFLTWLIDSR"
FT   gene            complement(49613..50143)
FT                   /locus_tag="HMPREF0675_3051"
FT   CDS_pept        complement(49613..50143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3051"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01197"
FT                   /db_xref="GOA:D4HEK9"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEK9"
FT                   /protein_id="ADE01197.1"
FT                   /translation="MRRMLFAVTKFKRVMALLGVIYLVTVGGLYFVLADRSDNFIHDGQ
FT                   IIQGTVTAVYSHRSVSTGATKYLMHAEGGNVALISYTYDGATDTVWSNPYRDIKKYHVG
FT                   QKVDLVIRATPNHPDDAIVTVRDHTILGLRLIPWGFLASAVIMTAWFGRDYLRSKRRRR
FT                   LGGQRHAPAAVEA"
FT   gene            complement(50159..50623)
FT                   /locus_tag="HMPREF0675_3052"
FT   CDS_pept        complement(50159..50623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3052"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99223"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEL0"
FT                   /protein_id="ADD99223.1"
FT                   /translation="MALIQAILPTLVTIANRDHQACLDDYIGEAWVVIVTFPLSRTNKV
FT                   CTNVALDCLHAISSRRQHSSPETPAESIDISAPEMQEPGQVASDLLSAAEELGIITPTS
FT                   APVLRSVWVEALDCTTAAQRHNTSPTAVRARCSRASRAMRQHRDELLAAS"
FT   gene            complement(51031..53502)
FT                   /locus_tag="HMPREF0675_3053"
FT   CDS_pept        complement(51031..53502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3053"
FT                   /product="efflux ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3053"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99592"
FT                   /db_xref="GOA:D4HEL1"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEL1"
FT                   /protein_id="ADD99592.1"
FT                   /translation="MFTEALRELRHHPGRLVATLIAIAVSVGFLVGISMFVRTQGVALG
FT                   KEQAVATSKADVVVDTGGAVADPDEVTRTIKETQGVAAVDTVLSTSMPAAHGHDSVMID
FT                   LHQVPAEPFRWSTVKDGSWPSKADEVALSEDAAKRLQASIGDTVAFSGHDLKVVGITDD
FT                   PSALQTAPAYVGQLPGQTPDTWVVKAKDGTAPGQLVTNLEKTLPKIKDAPQFNKDDAGA
FT                   TISTADSFQKKTINSLTEDFDVTKYMLMVFGAIALLVGAIIITTTFLILLAQRRRQIGL
FT                   MRAVGASSGQVRRRVLAEAIVLGVLGSMLGVVLGILLTVAGTAYTGALAFGLAWPWGDI
FT                   IVEFLIGIVITVLAAFLPALRATRVAPLEALRPVPTVEQKRRIGIARIVVCSLLAVAGI
FT                   ALSVGAIVGTGTSIITMAILSAMCLSLTLLIATPLYVPWLIRAMGFLLRPLGPTARLST
FT                   SNANRNPTRTSLTAVALMLAIGLSVTLQVGISTTRTTVMDQINEHFPIDLTLTNRPSYD
FT                   PNTGQETASTLDTSALKTVQDLPNVKDSIVLKGGFAESDLSPHAHMLSGNPDEIAKVAP
FT                   SIAKEMKPGVALITSIDNPPQTMTFTSSKGKVTLKVTKVHGLSEGDVVVNQEDLKRIVP
FT                   SVTDQSIWVHLDDRSNLASTLTVMMSMSSSSSQHMDIGGGALIGGIVELILKVLLMVMT
FT                   ALLGVAVLIALIGVANTLSLSVLERRRESALLRAMGMQRRGLRLMLLYESIQVGMAGVI
FT                   VGIVAGFYFAWLGIRSVFRVASDTIPVHFSIDWPWTLSLIAICLVAACLASVLPGRRAA
FT                   KAIPTEALADE"
FT   gene            complement(53502..54536)
FT                   /locus_tag="HMPREF0675_3054"
FT   CDS_pept        complement(53502..54536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3054"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3054"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00560"
FT                   /db_xref="GOA:D4HEL2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEL2"
FT                   /protein_id="ADE00560.1"
FT                   /translation="MKGIMSDHDRPYESDEPQHSLDHAIPSEPGSFEPPRYGTSSEWSG
FT                   DSLRPIGEQDRELGQPWGLQAPAPQPPHTAKPFPAHPFNTATPAQRGGLAPGLLNTPIE
FT                   TDAAAGMQLIKIFGEGETRVTALNSISVRFTRGTFTAIMGPSGSGKSTLMHCLAGLDRI
FT                   TSGQVFLAGMEISNLPDAKLTTLRRDNVGFIFQSFNLLPMLTAEENILLPLDLAGRKPD
FT                   RALWGQLITGLGISDRLKHRPSELSGGQQQRVACARAMITKPHVVFADEPTGALDSKSG
FT                   ANLLGYLRHCVDDLGQTIIMVTHDAKAASYADRALMLLDGRIVDDIASPTAESVSEAMA
FT                   GLEG"
FT   gene            complement(54644..55300)
FT                   /locus_tag="HMPREF0675_3055"
FT   CDS_pept        complement(54644..55300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3055"
FT                   /product="response regulator receiver domain protein"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00196; match to protein
FT                   family HMM PF08281"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3055"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00929"
FT                   /db_xref="GOA:D4HEL3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEL3"
FT                   /protein_id="ADE00929.1"
FT                   /translation="MPDPIRVILVDDQSLVRSGFRMLIESEDDMEVVSEASNGLEALDV
FT                   LRRMPVDVALMDIRMPQMDGVEATRRITASPLDTKVLILTTFDLDEYVYAALKAGASGF
FT                   LLKDARPTELLSAIRNVADGDAVVAPSATRRLLDHVVPTLPNDPKAADKRLSVLTDREK
FT                   EVLVEIAKGATNAEIAQTLYMAEGTVKTHIGRLLSKLECRDRVGLVLFAHEVGLL"
FT   gene            complement(55319..55837)
FT                   /locus_tag="HMPREF0675_3056"
FT   CDS_pept        complement(55319..55837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3056"
FT                   /product="hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3056"
FT                   /db_xref="EnsemblGenomes-Tr:ADD98960"
FT                   /db_xref="GOA:D4HEL4"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEL4"
FT                   /protein_id="ADD98960.1"
FT                   /translation="MKYYYAVLTHGITRKLDILLLTVAVALGFFGLDAWVILPESHTPL
FT                   VKSLGIPAASWLVALILGLILRPFPTKLTGKVDANAMEAAIAKKTIMAFCGMTWPALIL
FT                   FVLAFLLYLPRSFVLLAMIAHGATLFLLLHSTDQRLEQFAETWCGDHYDPANPEIDTFL
FT                   HGTRSVSFD"
FT   gene            complement(56002..56820)
FT                   /locus_tag="HMPREF0675_3057"
FT   CDS_pept        complement(56002..56820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3057"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3057"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00963"
FT                   /db_xref="GOA:D4HEL5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEL5"
FT                   /protein_id="ADE00963.1"
FT                   /translation="MHIGAFFRHLFLILGGLISLFPFYWMFVLASRPSSVIYKYPPVLT
FT                   PGNRLGENVHTITDKVNIWAAMANTALVATTVSVLVLLISSLAAFAFAKFDFPGRNVLF
FT                   VIVLATFLLPTQLATIPQFVLMSKIGWVGDLKAVIVPSLASSFGVFWLRQYATNAIPKE
FT                   LLEAATLDGCGFWHQYVHVCLPIIRPAMAFLGIFTFIGSWNDFMWPLIVLNDPSKLTLQ
FT                   VALSQLKTAHGTDYGMLMASSLIAVVPLLVVFVIGAKQLIAGISEGAVKS"
FT   gene            complement(56829..57794)
FT                   /locus_tag="HMPREF0675_3058"
FT   CDS_pept        complement(56829..57794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3058"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3058"
FT                   /db_xref="EnsemblGenomes-Tr:ADD98945"
FT                   /db_xref="GOA:D4HEL6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEL6"
FT                   /protein_id="ADD98945.1"
FT                   /translation="MSSPHTVTATPTDELHHPSVGRRMRKALPIYAALSPYFFFFLVFA
FT                   AIPMIFTLLLAFTDWSGLGSAHFVGLENFTYLISDHLFYKSLGNTLILWAMGTIPTLII
FT                   ATIVALMLNKTMRFSTTYRVIYLVPNITSMVAMGILFSSIFSSQFGLANAVRNLLGQEN
FT                   IAWLQNEWGIKIAISSLTVWSFVGYNALLILAGLQAIDKTQYEAAAIDGANGWQTFFHV
FT                   TLPQLRAIVLFITLMSTIGSLQSFTEAQVLTSSQSAGAASAGGVNNSGLTMVLYFYSVA
FT                   FQENRYGYGATIAWGVFVVVLFFSIINWLVTREHDRKVAR"
FT   gene            complement(57810..59114)
FT                   /locus_tag="HMPREF0675_3059"
FT   CDS_pept        complement(57810..59114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3059"
FT                   /product="ABC transporter, solute-binding protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3059"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99691"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEL7"
FT                   /protein_id="ADD99691.1"
FT                   /translation="MNLSRRHLLSGGFAGLGVLGVSALTGCSTSTEPKSDTGAGDAKKL
FT                   VLWMWPEGFDKQTLATVAKAQPSYNVRQDIIGGDFKQKLTTTFTAGSGLPDLTGVKGED
FT                   IAFFRDHAGYFVDLNTLGAKDIESDYLGWKWAQATTTDGKQLGIPSDIGPTALFYRADI
FT                   FEQAKLPSDPDQVAAQMTTWDAFIEFGTKLLAAKKKTYLVRNAAGLFGTIWPQSGKGFI
FT                   DEKKTFIGDQDHIRNAWDITVKALKAGIIATIQSDTSDAAAAVNEGRLPADFGASWHLA
FT                   DLMVDAPQTKGKWRVCAHPGPAINQGGSFLSIPAGASDSKASFAAIRELLSVKSQIREY
FT                   VHNGNFPVSPKAYDDPKVSGPVDFLGGQHAAKVFGKAAESVRPLFEDSNSGAVSAPFAA
FT                   QLERVESSGKNPETAWHDAVSEAKRIARQLHLTVR"
FT   gene            59461..60219
FT                   /locus_tag="HMPREF0675_3060"
FT   CDS_pept        59461..60219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3060"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="identified by match to protein family HMM PF00455;
FT                   match to protein family HMM PF08220"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3060"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99893"
FT                   /db_xref="GOA:D4HEL8"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEL8"
FT                   /protein_id="ADD99893.1"
FT                   /translation="MGHMLKAARHDAIVELLRDRPAMRTVDVARNLNVSMATARRDCIA
FT                   LENKGIIERSWGGIQLVTSVDDHFGDVMNHHTQAKAAIARKATELIHDGDTIIMDIGTT
FT                   VHHLSGLLTGRSITVLTASLPVFETLRTAPDVTVVVLGGVWSERYQCFDGQFVADALTR
FT                   HQADLAFLGCSGVSANGRVRDTSRSQAYIKQAIIAAASRSYLLVDSEKFPGVGAHSPFT
FT                   LEEVSGVITTGPLPPDFDAHCESTVEVITA"
FT   gene            60216..61604
FT                   /locus_tag="HMPREF0675_3061"
FT   CDS_pept        60216..61604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3061"
FT                   /product="family 4 glycosyl hydrolase"
FT                   /note="identified by match to protein family HMM PF02056"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3061"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00425"
FT                   /db_xref="GOA:D4HEL9"
FT                   /db_xref="InterPro:IPR001088"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022616"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEL9"
FT                   /protein_id="ADE00425.1"
FT                   /translation="MKLTILGGGGFRVPLVFKALAHDTSPQRVTELRLYDTDPLRLGVI
FT                   ETVVAQLARALPHAPSVVATTDLPTALAGTDFIFSAIRVAGTHGRALDESMCLARGVIG
FT                   QETVGAGGISYALRGIPVVLDLVEQITRYAPDAKVINFTNPAGVMTEVMQRRLGDQVVG
FT                   ICDSPVGLARRILTTLQRAGLAPADLGSLFDGDGRIHIGYSGLNHLGWLTSLNVDGVDV
FT                   LPRLLERPDLIESFEEGRLFGADLVQALGAVPNEYLHYYYYSRDDLAADRKAEAPRGAF
FT                   LEAQQNRFYTQAQHTDDVAGLWEATRLEREETYMATNREVSGEFERDEADLETGGYDKV
FT                   ALAIMHAIANDVPAELILNVANHGALPDLPDEAVVEVPCRVDGAGIHRLPTPALPDHAR
FT                   GLVVNAKYVEQRTIDAAVNHSRTAALLALSHHPLVDSVHVAEQLLDDFADAFDGLEYLK
FT                   DAHA"
FT   gene            61597..64725
FT                   /locus_tag="HMPREF0675_3062"
FT   CDS_pept        61597..64725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3062"
FT                   /product="glycosyl hydrolase family 38 N-terminal domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01074;
FT                   match to protein family HMM PF07748; match to protein
FT                   family HMM PF09261"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3062"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00902"
FT                   /db_xref="GOA:D4HEM0"
FT                   /db_xref="InterPro:IPR000602"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR011682"
FT                   /db_xref="InterPro:IPR015341"
FT                   /db_xref="InterPro:IPR027291"
FT                   /db_xref="InterPro:IPR028995"
FT                   /db_xref="InterPro:IPR037094"
FT                   /db_xref="InterPro:IPR041147"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEM0"
FT                   /protein_id="ADE00902.1"
FT                   /translation="MHDHTELIQDRIGHLKERLEREITEKICPLQVTAWQVPGEPVSFK
FT                   EAAAANYQPFPPGTWWGAPWSTWWLHVTGTLPASHAGEEVDLSMDLGFVGDWAGNQSEA
FT                   MVYTANGRPLKALNPRNHRIGLNHGALAARFTKEGEPLIGADGDVELWVEAAGNPDMTQ
FT                   HLGGPTELGDRRTAGHEPLWQFKGAELSVRRNEVWGLWLDIDVLDGLMRQLPAESTHRA
FT                   RLLRGLEQAADEVDHQGIVAGAGPARQILAGYLDSGANSSAQQMTAIGHAHIDSAWLWP
FT                   LRETRRKVVRTFSNVVALAQEYPDFHFACTSAQHYAWLQESSPELFERVQEAIERGQWH
FT                   PVGGMWVESDANLPSGESLVRQFTSGLRWMREHLGVRPDCLWLPDSFGYTGALPQIARL
FT                   AGMRWFFTQKLSWNTANTLPHHTFWWEGIDGTRIWTHFPPVDCYDCVVSAQEVKKAEAN
FT                   FKEKGVARRSILPFGYGDGGGGPTAEQVERARRFADLEDAPQVRLGSPDDYFDQAQEDH
FT                   PQASVWRGEMYLEFHRGVYTSAHPLKNGNRRAEVGLAAAEWLAVMAARTGHPYPYQQLE
FT                   QLWQRTLLLQFHDILPGSSIAWVNQEAIAEFTAIRAELNQLMDDAWQALLQASGGETVG
FT                   VSLVNPSQADRREVLTVSDRPVLVQVPAMAAKSLTDAVVDPEHPVHVQRGRDAIRMTNG
FT                   LVDVCIDTRDGLVNSIVDLVSDRELLLSGQRANRLVLHPDYPDCFDAWELQQQYRHSGD
FT                   PVDRVTDLRVTESLLRAQVRVERHADQSSFVQTITLDADSRAVEFSVDVDWAERARVLK
FT                   VDFPLDVAARSSRDEIQFGHIGRPIEANTSWDDAHFESCGQQWMLLAEPRYAVALVNQS
FT                   SYGHDVSPAGGDEHTPTMGVMARLTLLRSPQSPDPHPDQGCHHLVYSLLTDARVESAHV
FT                   EAARLNQPLQVRSGTVELPSTARIEPVHGTAVIDAVKQAFDGSGDLVIRIHEAEGARSR
FT                   VRLLLDRDGCVSEVDLLEDPIDEPTQQLPASTCSRVELTLRPFQILTLRASQR"
FT   gene            64722..65777
FT                   /locus_tag="HMPREF0675_3063"
FT   CDS_pept        64722..65777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3063"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01216"
FT                   /db_xref="GOA:D4HEM1"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEM1"
FT                   /protein_id="ADE01216.1"
FT                   /translation="MKLLLVCIDGLRLDIALPEALQRDPGFTHPDHPADPRFVRGVGQG
FT                   EPVPEHPAPALDHTLPVDRAPKNLAPTLARLVRGDDRSQGTIIPMWMTPPTDSAPGWTT
FT                   ILTGATHEQCNVWWNEFVGHDLARHPDILSQVFFANPSARTLAAATWDAFVSPYGPGPI
FT                   IHQRVDQQRTGQHQLFGPDLSQGIDRADEQVSSWAAWHLLHEGPDAAVVYFEGVDHAGH
FT                   SFGADSEQYQQAVGHVDELTRHLVKAVAERHEQLGEQWLVAVTTDHGHKPEGGHGEDEV
FT                   EVRRSFLAAHHIGGTLPEPLLRTAALRSHEVTPLLLQAMGVHPGHMDASDVGVLRDVEP
FT                   IGPSREMDFEW"
FT   gene            65771..66415
FT                   /locus_tag="HMPREF0675_3064"
FT   CDS_pept        65771..66415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3064"
FT                   /product="HAD hydrolase, family IA, variant 3"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01509"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3064"
FT                   /db_xref="EnsemblGenomes-Tr:ADD98939"
FT                   /db_xref="GOA:D4HEM2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEM2"
FT                   /protein_id="ADD98939.1"
FT                   /translation="MVTMYPPQQVDAVLFDMDGTLLNTLSAWCVASEHLWGTSLADADS
FT                   AKVDGGTVDDVVELYLRDHPQADPQATVERFMDILDANLAGNTEPMPGADRLVKRLSGH
FT                   VPIAVVSNSPTRLVRDGLASQGWLELFDTVLGVDEVAAGKPAPDPYLTAARRLGADPSR
FT                   CVVIEDSSFGLRAGRAAGAWVLTVGRRLKGQGDMWVSGLDDERVTSWEPHR"
FT   gene            66412..67707
FT                   /locus_tag="HMPREF0675_3065"
FT   CDS_pept        66412..67707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3065"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06824"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3065"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00340"
FT                   /db_xref="GOA:D4HEM3"
FT                   /db_xref="InterPro:IPR008313"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEM3"
FT                   /protein_id="ADE00340.1"
FT                   /translation="MRACELTPALRQRLDEIGAKISQGVGKGLDEAMGRQAASRFVAWM
FT                   TDTWTRTMSRDEHGVFVVTGDIPAMWLRDSSAQLWPFLIMCDLPEVTRQIGDVIARQWH
FT                   CIDVDPYANAFNSGPTGAHFDADDLDVADELWERKYEVDSLAFPVDLAWRYWQATGSPE
FT                   HLNGAVHQGCIRIIDVWSLEQDHARSTYRHVRPAEPSDTLGRDGSGTPVGHTGMTWSGF
FT                   RPSDDACRYGYNIPAQFMAMRALRQIREFCRVWDDEDLVERATKLADEIDAGVRQFGIV
FT                   EDHLAYEVDGLGSVLEMDDANMPSLLSLPLTSDLGRDDPLYQSTRRWVLSAANPYLFSG
FT                   PAARGIGSPHSPKGYIWHIGLAVQGLTGDDAEARDCLETILATDGGTGWTHESFDPTDP
FT                   TRFTRGWFSWSNSMACLLMMNVAGIDAIIGAN"
FT   gene            complement(67691..69229)
FT                   /locus_tag="HMPREF0675_3066"
FT   CDS_pept        complement(67691..69229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3066"
FT                   /product="glycosyl hydrolase family 20, catalytic domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00728"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3066"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99673"
FT                   /db_xref="GOA:D4HEM4"
FT                   /db_xref="InterPro:IPR015882"
FT                   /db_xref="InterPro:IPR015883"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025705"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEM4"
FT                   /protein_id="ADD99673.1"
FT                   /translation="MPTNDTLIRGLCPQPRQVQLTEGQFPLPSVLTWTGPDEVINAVTI
FT                   LTERLAPALDVVRATSHTDDASLTVIVDPALEAEGYRIDIDAQVRITVGSPSGARWAVQ
FT                   TLLQLLTPWVYGPGPLALKHLCLPKGVIVDAPHHSWRGAHLDVSRHFMPTSFIMNFLDV
FT                   LAVHKLNRLHLHLTDDQGWRLPVPGWPRLTTVGAWRPGTVRGHQPPPDDNGCDDVAEHD
FT                   HIPHGGAYTVDQLRAIDERAQLLGITVVPEVDLPGHTESVVAAYPELGCGAPISHPRTA
FT                   FGVSEHHINLTDAALGFCRDVLDAVMEIFPNSPIHIGGDECPGKEWFGHKPTRTRLAEL
FT                   GITTPHQAQAWFERQICGHVVAAGRQVIAWDEVLEAGAPEEVTVMVWRDADDIARAAAA
FT                   GHDVIAAPARHTYLDHGMETGPQAPVTIDAPMTMNDVAGLHDVLAAVNSPHLLGGQFQL
FT                   WTEYLCTPAQVEDAAFPRGTSIAEQLWTGNPARPLSELEAQTRRLTAMGVNWHR"
FT   gene            69335..70270
FT                   /locus_tag="HMPREF0675_3067"
FT   CDS_pept        69335..70270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3067"
FT                   /product="kinase, PfkB family"
FT                   /note="identified by match to protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3067"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99233"
FT                   /db_xref="GOA:D4HEM5"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEM5"
FT                   /protein_id="ADD99233.1"
FT                   /translation="MSVNRHPRLLTAGITFRDLVISGIDELPGLGEERYGTDFVTTWGG
FT                   VANTARIGASLGARVQLLTGLGDDPNSEMCRRELTEWGIDLTPSPINPGWTLPVTMSQA
FT                   CGTERAMTTVETALPAPLPAPNLDGVDVIVTHVSVPADAWLHDAADAGIPVIADHGFEE
FT                   GYEPGLLDAVSGCTCYTPNAAEAMHLTGVDDPVRAARALAERVPVVVVTCGGDGIVGVD
FT                   SRTGEEVHVPAVNINPVNTTGAGDAALAGLAWCWGWQVPLARKLDVAALVGAIVTSRVH
FT                   GTAGPLTPEDVLAWVPRAPERLGFLPELLG"
FT   gene            complement(70289..71659)
FT                   /locus_tag="HMPREF0675_3068"
FT   CDS_pept        complement(70289..71659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3068"
FT                   /product="histidine kinase"
FT                   /note="identified by match to protein family HMM PF02518;
FT                   match to protein family HMM PF07730"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3068"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00665"
FT                   /db_xref="GOA:D4HEM6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEM6"
FT                   /protein_id="ADE00665.1"
FT                   /translation="MEDTGSQTLPTENRSTGSRGAGVRARLNRFNPSRNNVPQINIPGM
FT                   EEVLDPKLDDGRPADTERAWWGDVTLTLIMAVVTIAPYLVSLVEWPRPEYIAALLSSMV
FT                   MVASLPMRREHPLLMMTLVAIGAAIQFFFVPFPVLSIFVVPIASYSVARWVDGHQSRWV
FT                   LWVGAVGSVIGPMRWIPTIAAGYDPSSGTPWVLLVLAMTVCAGLVLTPYAVGRRLRESA
FT                   LIDSQQRIVKAQRYRAILAEREQQARVAEERTRNEIARELHDIVAHSLSVMIVQAEGGK
FT                   ALATKKPEKAPEVLETIAETGREALLEMRRIVGVLRQDTDAEFSPSPSLAEIPDLVDKS
FT                   GVKVELKVTGEEPVVSQALGLVIYRVVQEALTNVLKHAGPSAHATVTLAYSPTAIYVEI
FT                   LDDGYGAAVQGDGRGHGLQGMRERVTSMGGQLSAGPRKEGGFRVMAKLPVQADSRQR"
FT   gene            71839..72828
FT                   /gene="galE"
FT                   /locus_tag="HMPREF0675_3069"
FT   CDS_pept        71839..72828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE"
FT                   /locus_tag="HMPREF0675_3069"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /EC_number="5.1.3.2"
FT                   /note="identified by match to protein family HMM PF01073;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF02719; match to protein family HMM TIGR01179"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3069"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99461"
FT                   /db_xref="GOA:D4HEM7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEM7"
FT                   /protein_id="ADD99461.1"
FT                   /translation="MKILITGGAGYIGSTVGSACEEAGHEVVVLDDLSAGRREFVRDRT
FT                   FYEGDIADQDLLDRVFSENQIDAVVHCAAKIIVPESVDEPLTYYGNNVGKTVALLKGME
FT                   RNGVHRILFSSSASIYATDEEFKVTEESALDPGSPYATTKFMVEFILRDAAHASDLKAL
FT                   SLRYFNPIGSDPKLRTGQQIEHPTHVLGKMIDAWMEGSTFTVTGVDWPTRDGSGIRDYI
FT                   HVWDLARAHVAALEHLDEVTTDDPYQVFNIGTGSGVTVKELVKAFEEGTGKSLNVVYGP
FT                   PRPGDVAGAYTVSRRAKDLLGWSAELTQADGIRDAIAWLPERKKILGY"
FT   gene            complement(72901..73533)
FT                   /locus_tag="HMPREF0675_3070"
FT   CDS_pept        complement(72901..73533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3070"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3070"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99957"
FT                   /db_xref="GOA:D4HEM8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEM8"
FT                   /protein_id="ADD99957.1"
FT                   /translation="MTTTSDTPPISARRAATQARLADAAVAVFARKGVPGSTVEEICEE
FT                   AGFTRGAFYSNFTSKDDLCTTVLRRYAEKNLATLGSSLDFPNDGHEALRDRIHGIIALF
FT                   ASTVGSDPLTAMAILEITIEAARNPRLRQAYRQVGDAITPALCHMVEQALREHAATATI
FT                   AVSDLVEVTQAVFDFRVLAAMASGRQADIDRMTNQLTMMVLTFVHPM"
FT   gene            73650..76382
FT                   /locus_tag="HMPREF0675_3071"
FT   CDS_pept        73650..76382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3071"
FT                   /product="MMPL family protein"
FT                   /note="identified by match to protein family HMM PF03176"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3071"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99446"
FT                   /db_xref="GOA:D4HEM9"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEM9"
FT                   /protein_id="ADD99446.1"
FT                   /translation="MMSSLLHDLGVWCFRRAKTVVALWLVLLALLGVGVAALDGDYDDF
FT                   FTIPGAPSQVAYDKLQVAFPQASALSANVVVTVPDGTNISSKLIRSRIEKGVDELKDLP
FT                   LVTGATSPWNKYVTGMVNKDHTAAVIQVELGQNNAVTFPDSGRHDLIRVGNEIQSDLPS
FT                   GSHVYVGGQAFEATLPSLSITEVIGVGVALVVLSVTLGSLVAAGMPIVTAVLGVGVTYS
FT                   GMAILTRFTTVNSVTPMLAVMLGLAVGIDYALFILSRHRDQLRDGAEVQESAARAVATS
FT                   GSAVVFAGATVVIALIGLSIARIPFLTVMGIFAAIGVALAVVIALTMLPAFMGLMGERL
FT                   RPRRSRADTKARTAGEKERSGGIFGWWVRTVTRVPLVTILVVVVGLGALAVPMKDLHLS
FT                   LPTAAELPASNTARQTYDVLEQKFGPGFNGPVIVTADVVSSHDPMRIVNGLKADIEKIP
FT                   GVDTVALAVPNRNADSAMIQVLPTTGPADEATNNLVRTLRDHETQWRDTYGVDTAVTGL
FT                   TAIKLDVSQRLGAALLPFGIFVVGLCLVLLTLVFRSIAVPIKATVGYLLSVLAAFGVSQ
FT                   LVFNRGIGLQVVNLDRLVPIISFMPIVVMGILFGLAMDYEVFLVSRMREEYVHTGDAKG
FT                   AVTRGFIGSGKVVTAAAVIMISVFVFFIPEGMNAIKEIALALAVGILTDAFLVRMTLVP
FT                   AVMALLGDKAWWLPGWLDRRLPRLDIEGEGIAHEEKLAAWPTADHTEALHAEGIGVEGL
FT                   FEGLDLHVEPRQVQAVVGSQNSVSAVLLAIGGRLPLDHGRMRSGGLLLPERASRVRRVT
FT                   WFLDASAPDFVDELRSAMTVLTHLPRRPSKRPRLFLIDHADRIVDPITRDLLESLVREA
FT                   GEAAVILGAQRRGRIDWLSPQIIHNLAEHHFESSSGGTR"
FT   gene            76379..78748
FT                   /locus_tag="HMPREF0675_3072"
FT   CDS_pept        76379..78748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3072"
FT                   /product="YhgE/Pip domain protein"
FT                   /note="identified by match to protein family HMM TIGR03061"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3072"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01086"
FT                   /db_xref="GOA:D4HEN0"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR023908"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEN0"
FT                   /protein_id="ADE01086.1"
FT                   /translation="MMTERSHSTIRLRWPAVVVLVLVPLLVVAGLVGTTWHTTDRLGRV
FT                   KAAVVNEDKAVKVRGQLVPMGRQLTAALMDSGSHTTDGHTVDWTLTDAQGAAEGLRDGT
FT                   YSVMVTIPESFSADATSFSANDVNKAKQALIDVTASQNSPVTDTTIAELTAQVARRSLN
FT                   TTLTSKYLENVYVGFNRFAEQMARMAGAAAKLDDGATKLADGTKRSSAGAATLASGMTK
FT                   LSGGAQRLSANGGKLTDGVSQLSGGLTTLSHKGQQLSQGADGLASGVATYTDGTGKVVD
FT                   GIGQLSAGLTTMDEKIAAATGKIDPSQLDKLAGGAGQLADGIDQFTGNLVGYRTEIRQY
FT                   ASGKKTAELSKEALSRGEADFLRRCMRSHTAQECHDLVPIVRDAMTDGYALGVRAGSGV
FT                   AVKAMAIKDPNSGKSIDDGIDELADGSSRLSRGVNEFTTQLRTGLPKMVRQVTRLHEGI
FT                   HQAATGAQALASRSQQLKAGGVKLSSGAATLAHGVDAYTAGVSKAAGSTPKLQNGVNQY
FT                   VDGVDRLSDGLAKAATGAGTFASGMTKLDSGARKLTKGTGVFSSQLAAGAKKVPTYSQN
FT                   DRTKLADVVSAPVNGDGPAIATSVAVVAVLLVLGAWIAALATWLVARTVPSGALTSSRS
FT                   TLGLLARTMSVGAVVSVAVSGGLAVIGGTALGLSVPRSIGLGSLLLLVGVMFGLVNHSL
FT                   AAWLHGLGRLISVVLVTATVAAGLASTVPAPVRWADAVSPLNPALRAVQAVVAGQNPAF
FT                   GSLVAVVAWAVVALVASMGAVGRRRQTSAKALLGSG"
FT   gene            complement(78935..80380)
FT                   /locus_tag="HMPREF0675_3073"
FT   CDS_pept        complement(78935..80380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3073"
FT                   /product="efflux ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3073"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99402"
FT                   /db_xref="GOA:D4HEN1"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEN1"
FT                   /protein_id="ADD99402.1"
FT                   /translation="MTMTPPIEPGTADQKIPSLTVPEPLGAMSGRPTTVAILSMILRTS
FT                   AADHSTWRLPVVAFGVIATIVLDVTGGAVMMWHLPGDNSGFYKLTSTIAVILLVLPLMT
FT                   LAASAARLSARRRDDRLSSLRLVGASSHLLRVVALTEAGLQALVGSILGITGYVLCLPL
FT                   LGQLSFNGGKVGADSILLRPIPVAGVILTLVLLALVSSAIGLRKVDVSPLGVRMRSQPR
FT                   SVSWVRLAIGGAIVLLIVFSKAVLGFLGHQTGMVGVYVFIAVILAAVVELANIIGPKLL
FT                   AMYFQHRLQRAKDATDLVAARQVLENPRAAWTQVASLGAVCVVGMLGGTGAAMMQTINN
FT                   DPPATKSARIVGGDLQTGVILLIIFAFTTVACSVGVNQASAILDRRSVEVGLDVVGMDL
FT                   QTQDKVRRITVISPMRFAMVTGIIATGLLLVPATGIALITRPATVLVTVATIVAGAGMV
FT                   RLGLWATRPTLRRVLDNGLARTE"
FT   gene            complement(80383..81144)
FT                   /locus_tag="HMPREF0675_3074"
FT   CDS_pept        complement(80383..81144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3074"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3074"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01236"
FT                   /db_xref="GOA:D4HEN2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEN2"
FT                   /protein_id="ADE01236.1"
FT                   /translation="MDAMLTTTRPHPRAADTTIRGAHLRALGLTKTYGMTRALDHIDIA
FT                   IPAGQSVAVMGPSGSGKTTLLHCLSGILSPDSGSIELALPDRTVNVENLSNEGRAKLRR
FT                   QSLGFVFQQGMLVPELTAVENTALPLMLNGVSRTDAVRYATQWLESMGLGGMEDRRIGQ
FT                   LSGGQAQRVAIARSQVIDPSIVFADEPTGALDSATAVEVMAILLSATTGRGRTLVIVTH
FT                   DEDVARRCQRILHLHDGRIVSDDVRHSDGRW"
FT   gene            81422..82219
FT                   /locus_tag="HMPREF0675_3075"
FT   CDS_pept        81422..82219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3075"
FT                   /product="methyltransferase domain protein"
FT                   /note="identified by match to protein family HMM PF08241;
FT                   match to protein family HMM PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3075"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00407"
FT                   /db_xref="GOA:D4HEN3"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEN3"
FT                   /protein_id="ADE00407.1"
FT                   /translation="MEIIDYFGLWEHDRSCDPQRRTLEEEREFWRCYARVYDQHAGETG
FT                   GSLAQIAAVTEIVEPGSSVLDVGGGTGRFAIPLAQRGCRVTVLDRSEDMLSVLESSAEE
FT                   KDVEIDVVHQEWPADLGCQFDSVIAAWSLYWNLDLQASLQAMVRQTKKHLIIIDTTGSP
FT                   TVWDHALAVARGGGIVASQARHLLFAGGLAQLGIPAEIRVLEEYRVIGETELEREIDAH
FT                   GGSKVAAMEYLDTHAVRIRSGWRYKRTVGLIHAQGKNIPARNL"
FT   gene            82440..83450
FT                   /locus_tag="HMPREF0675_3076"
FT   CDS_pept        82440..83450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3076"
FT                   /product="periplasmic binding protein"
FT                   /note="identified by match to protein family HMM PF01497"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3076"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99729"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEN4"
FT                   /protein_id="ADD99729.1"
FT                   /translation="MVRKRVRMTALIAAMAMPIFSLVGCGSAVTDPSISKASTVTSSVK
FT                   QGHTSYPLTVTSCGVSQVFESAPKRAVTLTSTATETMLELGLEKRMVGTAYQRNRPIGS
FT                   QYKKVYDSIPILASGQPSMEKLLSVNPDFVYSGYPDGFSKSNGHTREDLKKLGIKTHLS
FT                   PVGCSDQVKTLEDETKEIRTIGQIFDVNDKAEKAVLRFNSKVSSVKNSVKGKDRPKVFL
FT                   YNSGIEAPITVGGWAYASVMIDAAGGENIFAHEPLRWGKMSWEQVAKADPDMILIYDYK
FT                   TPSVDQKIKTLKSIPALKDTKAVKNNAFPVISLSLAQPGPRSAEGIEQLAKQFHS"
FT   gene            83450..84619
FT                   /locus_tag="HMPREF0675_3077"
FT   CDS_pept        83450..84619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3077"
FT                   /product="iron chelate uptake ABC transporter, FeCT family,
FT                   permease protein"
FT                   /note="identified by match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3077"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99088"
FT                   /db_xref="GOA:D4HEN5"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEN5"
FT                   /protein_id="ADD99088.1"
FT                   /translation="MLDPHSEGDDTSVRSMSDQGDLVAILNRVPARSLEDVTSYQSDLR
FT                   RGRSVVLILVFVAVLLFVLGIALSIGSVQVPFTMVWKVVAHRVFPEGVIPVEWTPAIDR
FT                   IVADTRLPRVLLAAVAGMALTTVGTTVQALLRNPLASPTILGASSGAATGAIAVMRFGL
FT                   LIGGTVSLGLAAFGGAFLTLLLVIMVARQRQTMTAGTLILTGTAVSALLSAVNNFMVLT
FT                   SPDPQLASQVLFWSLGGFGAAKWENFLFPSGVLAIGIILCLAQASNLNILLAGEESAGS
FT                   LGLNVNRFRTWMFAVAAAIVGVTVAVCGVVGFIGLVMPHITRLCVGADHRRTLPTGLLL
FT                   GAIFTVLADLGARMVIRPQELPVGIVTALVGAPFFLFLLRRNGGRRKDD"
FT   gene            84594..85379
FT                   /locus_tag="HMPREF0675_3078"
FT   CDS_pept        84594..85379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3078"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3078"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00766"
FT                   /db_xref="GOA:D4HEN6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEN6"
FT                   /protein_id="ADE00766.1"
FT                   /translation="MAGDGKMIKGAKLVVDNLGVDIDGHCIVDGVNFCAQPGDVVGILG
FT                   PSGSGKSTILRSIFHSRKPTRGSVTLDGVDVWSRDAKWSAQHICVVLQETPAEFPLTCG
FT                   EIVRMGRAPHKRSWQSLGAGDLELCHAAMEVMEVDNLAGSSFSRISGGERQRVTIARAL
FT                   AQQTGMIVMDEPTNHLDIHHKLKLMRLLRRLNATTVIALHDINLAGRFCDTLVLMSGGS
FT                   CVACGAPSTVLSPNVLDDVYHVKTDVVRQPNGTVHVTIL"
FT   gene            85462..86919
FT                   /locus_tag="HMPREF0675_3079"
FT   CDS_pept        85462..86919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3079"
FT                   /product="succinate-semialdehyde dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3079"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00104"
FT                   /db_xref="GOA:D4HEN7"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEN7"
FT                   /protein_id="ADE00104.1"
FT                   /translation="MMTNDRSLPSDLPTQLLIDGEWVDAEASRTFDVINPATEKPLVAI
FT                   ADASVDQGTDALDAAVRAQHSWADTAPRERAEILRKTFNLVTERKDDFARLMTLEMGKP
FT                   LAESYGEVTYGSEFLRWFSEEAVRIRGDYGLLPEGNIRQLVTKRPVGPCLFITPWNFPL
FT                   AMGTRKIAPALAAGCTVVIRPASATPLTTLLLAKTFLEAGLPAGVLNVITGLDHAVTDA
FT                   ILEDPRLRKLSFTGSTGVGANLLGKAAKHVLRTSMELGGNAPFIVFDDADLDQAIIGAK
FT                   GAKMRNMGEVCIAANRFIVHESVAEEFTDKMIEMMSGLVVGDGLDEKSEVGPMITERDR
FT                   EKVDGLVRSAIEAGATLRCGGEIPEGKGWFYPPTVLSGVPADAEIMQTEIFGPVAPITT
FT                   FRTEEEALALANSVPVGLAGYVFTGDTARILRMGQKLEAGMVGANLGVFSNAAAPFGGV
FT                   KESGLGREGSYQGIEEFLETIYVALPA"
FT   gene            86964..88250
FT                   /locus_tag="HMPREF0675_3080"
FT   CDS_pept        86964..88250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3080"
FT                   /product="chloride transporter, ClC family"
FT                   /note="identified by match to protein family HMM PF00654"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3080"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99353"
FT                   /db_xref="GOA:D4HEN8"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEN8"
FT                   /protein_id="ADD99353.1"
FT                   /translation="MATSRIRFVAAVVLTGLASGLIGGLTSELSHLIEVCAFGVPFSSS
FT                   TTGVGEVVMWRRLVAPIMGALIAGLTWRWLRPFPSGSITSVRQAIDSPTRLRPVETIVD
FT                   ALAQLVVVGSGSSLGREAAPRQMAALAAQGLSDTFRVDVATRRVVLASAAGAGLASVYN
FT                   VPVAGALYALELTVRPDLRTKRGWGQVGIAGVISVLSTVTAWLLNHDRPIYRSPAATVT
FT                   GPGLGWMVLVVAVSTVVGAGMGVLFGEMKRRVPVTSRLWWTVLLGSAGVTVIALAAPQV
FT                   VGNGQVIVNLVLAHPVAPASLVILLVGKILATTVALRSGAAGGLLTPSLSAGALVGALV
FT                   AVVAGIDAPSQIAMMVIVGAGCVLSMTQRAPLFAAAFALELTRAGALGIPVVVAAVMLG
FT                   WTGFVLVSRRGLGLHGRIGRAPGHTSDPR"
FT   gene            88305..90671
FT                   /gene="glgP"
FT                   /locus_tag="HMPREF0675_3081"
FT   CDS_pept        88305..90671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgP"
FT                   /locus_tag="HMPREF0675_3081"
FT                   /product="phosphorylase, glycogen/starch/alpha-glucan
FT                   family"
FT                   /EC_number="2.4.1.1"
FT                   /note="identified by match to protein family HMM PF00343;
FT                   match to protein family HMM TIGR02093"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3081"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99118"
FT                   /db_xref="GOA:D4HEN9"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEN9"
FT                   /protein_id="ADD99118.1"
FT                   /translation="MTQDLASAIAFQVRSTSGRSVTASTPMEVWQGLSACVVGRIADDW
FT                   QATDAAYKAERQEHYFSAEFLMGRALLNNLSNLGLVNETREALAGFGIDLSEVLEQEPD
FT                   AALGNGGLGRLAACFLDSCATLELPVTGYGILYRYGLFKQLFDNGFQTEHPDPWMEEGY
FT                   PFVIRREEQQRIVRYADMWVRAIPHDMPITGYGTRNVGTLRLWKAEPMEQFDYQAFNSQ
FT                   RFTDAIVERERTSDISRVLYPNDTTFEGKVLRARQQYFFCSASLQEIVDNYIEHYGEDL
FT                   TGFAKYNSIQLNDTHPVLSIPELMRILLDEHGMGWDEAWEVVTHTFAYTNHTVLAEALE
FT                   KWEMQIFDRLFPRISEIVREIDRRFREDMNKRGVDGQTIEYMAPVSGNQVRMAWIACYA
FT                   SYSINGVAAIHTEIIKRETLKEWYAIWPQRFNNKTNGVTPRRWLNQCNPRLASLLTEVT
FT                   GSDAWVKDLSVLANYTDSVDESVYDRINEIKHANKVDFAAWVAEREGVKIDPDAIFDVQ
FT                   IKRLHEYKRQLLNAFYVLDLYFRIKDDPSLNVPKRVFVFGAKAAPGYIRAKAIIKFINE
FT                   VARLVNNDEDINGRIKVVFIHNYNVSPAEHIIPAADVSEQISMAGKEASGTSNMKFMMN
FT                   GALTLGTLDGANVEILDAVGDDNAYIFGATEEQLPSLKRDYDPRWHYENVPGLKRVIDT
FT                   LTDGTLDDNGSGWFHDLRQSLMEPGWEGPDVYYVLGDFASYRDVKDKMAADHADARGWA
FT                   RKAWVNVTKSGRFSSDRTIRDYAEQVWKLEPVRAE"
FT   gene            complement(90735..91127)
FT                   /locus_tag="HMPREF0675_3082"
FT   CDS_pept        complement(90735..91127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3082"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01220"
FT                   /db_xref="GOA:D4HEP0"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEP0"
FT                   /protein_id="ADE01220.1"
FT                   /translation="MAVTMRIVAALLVIAAVWGGKYVVSLIFRAAGVRAGGDTGLLRGG
FT                   LWIGYLERLGIVIAILTSYPAGIAVILGVKTLARYAELKSQPTPGSDAAQANKESSAAI
FT                   EQFIIGTMASALWSVLLTVTAKALWG"
FT   gene            complement(91112..91747)
FT                   /locus_tag="HMPREF0675_3083"
FT   CDS_pept        complement(91112..91747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3083"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00663"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEP1"
FT                   /protein_id="ADE00663.1"
FT                   /translation="MLAWVILADQVDSRRHNDEVPHLLAALTSPGLLVSPTGYTVGTPQ
FT                   WVLPPERTSGDEVQALTTDPASLIHAVWTSGSGPWRIGVSHGEVDTPLPDSTRAARGPA
FT                   YISAREAIDECRRRRAAIHVFADGTDGMRRFSQVAQVVVDLARRLRPAARDVAKFYDLS
FT                   MSSDETARALGISTSAVSQRLTRARWEYLVGIRQLAVDLAQEAQWPSP"
FT   gene            complement(91935..94151)
FT                   /gene="gnpA"
FT                   /locus_tag="HMPREF0675_3084"
FT   CDS_pept        complement(91935..94151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gnpA"
FT                   /locus_tag="HMPREF0675_3084"
FT                   /product="1,3-beta-galactosyl-N-acetylhexosamine
FT                   phosphorylase"
FT                   /EC_number="2.4.1.211"
FT                   /note="identified by match to protein family HMM PF09508;
FT                   match to protein family HMM TIGR02336"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3084"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99899"
FT                   /db_xref="GOA:D4HEP2"
FT                   /db_xref="InterPro:IPR012711"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035080"
FT                   /db_xref="InterPro:IPR035356"
FT                   /db_xref="InterPro:IPR035363"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEP2"
FT                   /protein_id="ADD99899.1"
FT                   /translation="MSSSTSQTTSRAGRLTLPVEKGMDAQVAELLERLQADAVRNSDGT
FT                   ELPEIVNKLATKIYQTYFVGRGDQDWAQTHPRELTRIYLMSERTPALADGELSIDLMTN
FT                   WFVDQVYPDTDCDVERWWQVIDRTTGDVIAPGAWHVDPADLSVTMDQAQAGHVYTVGFL
FT                   AVQRWDPTQMYNYLTNGWADDPQRIKESPYDIRYPQTWQHVRHALDQWLADNPQVDVVR
FT                   FTTFFYHFTLVYGSDGTERFVDWFGYSASVSVPAMEAFEKRFGYPLQAEDFIDEGWYNS
FT                   PFRVPRKSFRDWVSFQHEFVTSRMAELVEQVHAAGREAMMFLGDNWIGTEPYGPHFAHT
FT                   GIDAVVGSVGSGATCRMISDIPGVRYTEGRLLPYFFPDVFYPGGDPVTEANASWLAARR
FT                   AIVRSPLDRIGYGGYLSLAVQHPEFVDRMEEIVNEFRAIHAAAAGQRPIATGPRVAIVN
FT                   CWGALRSWQTHMVAHALHYRQAYSYLGVLESLSGLPLQVDFLSFDDIRNGVPEGVEVLI
FT                   NVGAAGTAFSGGSEWADERVTSAVRRFVAAGGGLVGVGDPTAHPARGAVYQLSDVLGVD
FT                   RELGWGLSTHRPMHTSDHHFVTLDLSSRLDVGEGTPDVFCASATTTVLVAHHEQVDLAV
FT                   NQFGCGRAVYLAGLPYSSQNARLLHRALAWAGHREDAFTTWTSSDVRAEVAVYPHSDRL
FT                   LVINNSLDQVTTTVSTPTTVREVHMEAAGHLWFDLELHPLDIPG"
FT   gene            complement(94281..95492)
FT                   /locus_tag="HMPREF0675_3085"
FT   CDS_pept        complement(94281..95492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3085"
FT                   /product="ROK family protein"
FT                   /note="identified by match to protein family HMM PF00480"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3085"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99307"
FT                   /db_xref="GOA:D4HEP3"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEP3"
FT                   /protein_id="ADD99307.1"
FT                   /translation="MHSAVVGAERIDHGTMRTINLALLLGTLRSGPISRAELSRRTHLS
FT                   KASITSLAAELAARGLVREGSPDRNGTVGRPGTMLTLEGARVCGVGLEINAEYLAVCVV
FT                   DLCGTVLYDRAQPFDVASLPISDVLDEVAGIMRDTLEQLHSARRHVAQVMVSAPGVIKQ
FT                   PAGTVHLASNLGWRDVPLRSQLLQRLDADISLQVENDAKLAAVAEYRRYEDSDVRDLVY
FT                   LSGDIGVGAGIIAAGQLMRGWSGFSGEVGHLHLDPRNLPCHCGRTGCWEARVGLPEFLA
FT                   HTGDRLGAQPIDRLLTQIQDRATRGDQQVLNALDDLATSLAEGLSVVIDMLNPRVVVLG
FT                   GYFSWFTDFLIPPIAADLTARRLDPGAGALLAGAQLGMVSSAHGAALTALDSVFVNPLS
FT                   VPQC"
FT   gene            complement(95555..95689)
FT                   /locus_tag="HMPREF0675_3086"
FT   CDS_pept        complement(95555..95689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3086"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3086"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00434"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEP4"
FT                   /protein_id="ADE00434.1"
FT                   /translation="MRGDAAAIGESFETIPDRKIVRGSDGITSTIYQRATSDRKRQSS"
FT   gene            95746..97200
FT                   /locus_tag="HMPREF0675_3087"
FT   CDS_pept        95746..97200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3087"
FT                   /product="carbohydrate ABC transporter,
FT                   carbohydrate-binding protein"
FT                   /note="identified by match to protein family HMM PF01547;
FT                   match to protein family HMM TIGR03850"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3087"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00054"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR022387"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEP5"
FT                   /protein_id="ADE00054.1"
FT                   /translation="MTSITFRAKLLMTGSAGSQRGDPEHSLRPHVRARGLPMQLTRRAF
FT                   MVGLAASAATVPLAACSPGSRTTASTSGGAGKASGVIKVAAFENAYGAAIYKQVAEAFE
FT                   KATGAKVELTVSKTIDQELTPQVAAGNFPDVVFMGVGGKTGFTDKFVQNKSLEPLNDIL
FT                   KITNKGETTTIGDKLLPGMVGNLTTNPYDDDRLMLAPTFMAPAGLVYNKTLFTKNGWTL
FT                   PATWDEFFALGDEVKAKGVSLFTYPTAGYFDTFFFALLSSIGGDDYFKKVMSYEKNIWT
FT                   GSEATQALNLVGKLLTQYTLPQTVGYANNQDYTKNQAALMADKALFCPDGSWVAGEMKD
FT                   APRSAGFAWGLTTVPAMKKEDRHLTSFIESVWIPSGAKNKASAKTFIAWLYSDKATGLF
FT                   AKAGAAMPTKTGTKGLPAEVAPFYTVYDEPGLKSTIGGFKSAKAVPGIDMKTALLDSVD
FT                   SVASGKLSVKDWQAKVNEASNKLGGY"
FT   gene            97301..98179
FT                   /locus_tag="HMPREF0675_3088"
FT   CDS_pept        97301..98179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3088"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3088"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99109"
FT                   /db_xref="GOA:D4HEP6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEP6"
FT                   /protein_id="ADD99109.1"
FT                   /translation="MGGGGPFAALCILPALVLYVLFLVYPTLNVFRMSLFDWNGLGNAP
FT                   SFIGLDNFAALIHDPAFVRAFENTLFILVVVKIVTICSSIFIAAVLTRETLVGAGWYRF
FT                   VLYLPSVLSIVVVAAIFSAIFDQNNGLVNGLLQALGLGHGPVWLGDQNVVMYSVAIAMV
FT                   WQSLGYYVVLYMAGMSSVPVEIYESASLDGAGRMTQLGSITIPLIWSNIRTTLTFFVLS
FT                   SVNLAFVLVKALTDGGPNGSLEVLLNYMYKQAFTNSAYGYGMAIGVVTFLFSFLVAMLI
FT                   SHVTRREVLQY"
FT   gene            98179..99060
FT                   /locus_tag="HMPREF0675_3089"
FT   CDS_pept        98179..99060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3089"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3089"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01042"
FT                   /db_xref="GOA:D4HEP7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEP7"
FT                   /protein_id="ADE01042.1"
FT                   /translation="MSAVPTPSRADRRYRLAAHALLVIISILIIVPVAWVVMAAFKTKP
FT                   EFFGSPWRLPDGLHWQNFVDAFITAKMGIYFTDSLFVTVLGLVFSLSVAIPAAYAIARV
FT                   PFRGRALVEGFLMAGLFINVNYIVVPIFLMLLGWDQALASWLPNGFFIDNLAVLALVYA
FT                   ATSLPFTVYLLVSFFRTIPAIYEEAAALDGSSRLRTMLSIMVPIARPAISTVILFNFLS
FT                   FWNDFIISLTLIPGEHKTLQVGLLNLFQAQRAAADYGRLYAGMVIVMVPVLLLYATIQK
FT                   RLVTGIGGGGLK"
FT   gene            99057..100319
FT                   /locus_tag="HMPREF0675_3090"
FT   CDS_pept        99057..100319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3090"
FT                   /product="sugar-binding domain protein"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3090"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99364"
FT                   /db_xref="GOA:D4HEP8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEP8"
FT                   /protein_id="ADD99364.1"
FT                   /translation="MRGIGNPCLTRCLKCSGGWRLRWYWAHASSSWWRCALRDGSRQES
FT                   WLLPWASSSPCSVSTTADTCDMSASGFSPPLTGRAPTMADVAKRAAVSPQTVSRVVRGQ
FT                   TNVSEVTRLKVELAIDELGYRRTGIARALVTGHTMTLGVLTQGSVAYSRAAYVDAMTSA
FT                   ARRHGYYVAAASVTSTAPEAVCQSIEHLRQQGVDGIVVAVPVYDVDALAQAARGLPAVV
FT                   FGGSSSEAVPDGFSDGTGHHAVCIDQEQIGVLATEHLLELGHDTVWHVAGPSTWADASG
FT                   RQAGWAATLAKHGRPEPPVLIGDWSAESGWRLGTLLARMEEVTAIFAASDDMAFGILRA
FT                   LVDRGRRVPEDVSVVGADDVPLAAFAPVALTTVRQPFQALGTAAIDLLVDMVERPDREH
FT                   HGVLMEPELVLRSSTAPRHAG"
FT   gene            100309..102498
FT                   /locus_tag="HMPREF0675_3092"
FT   CDS_pept        100309..102498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3092"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3092"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99728"
FT                   /db_xref="GOA:D4HEP9"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR016518"
FT                   /db_xref="InterPro:IPR027414"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEP9"
FT                   /protein_id="ADD99728.1"
FT                   /translation="MLAESWRLHYRSPAAEWEAYGLPIGNGRLGAVLRGDIARDVVQFN
FT                   ENSLWAESNNYDNGLCGVADDVFDTSMHGFGCYLDFGRVTISFADLDESTVSGYERALD
FT                   LRHAVAYACFDAGGVRHQRSAFASRETDVIVLRYSASAPFGCTVRLESAQGVPSRVAGD
FT                   TSVVFDGVLGNGLRYCASLVLLECDGRSIAHGDRIVVEDATTLALVLDAGTDYALSAVA
FT                   GWRGVNPRPVVDERICSATALGWERLHDAHVTKFSAVMDRCRLRWGRPVPELDAQPTDE
FT                   RLRRYRDGAADVGLEQLAVVLGRYLLVSSSRAEGLPANLQGLWNDSNDPAWGSDYHTNI
FT                   NVQMNYWGAEVTGLGEEHMALLNFVEEVAVPSRSATRAMCGPDVPGWTARTSQSPLGGN
FT                   GWQPNTVASAWYAHHVYEHWAFTRDDEWLRTRGLPMLAEICRFWEHQLVERDDGMIVAP
FT                   AGWSPEHGPREDGVAYDQQIVWDLFTNLLECSRALGVEDDLYYRVERLRDRLAPNQVGC
FT                   WGQLQEWQDDRDDPTELHRHTSHLFAVYPGRQITTDTPELQAAALVSLKARCGEPPPVA
FT                   GAPTVAPFRAEMVVGDSRRSWTWPWRAALFARLGDGYRAGEMVRGLLTYNMLPNLWTTH
FT                   PPFQVDGNLGLVGAVAEMLLPSHDGRIRLLPALPPAWEAEGEAIGLRARGGYRVSMQWR
FT                   DGQVIWFEIVADRGHAEDVIVVVNGREHRIRPDKR"
FT   gene            102753..103985
FT                   /locus_tag="HMPREF0675_3093"
FT   CDS_pept        102753..103985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3093"
FT                   /product="Phosphofructokinase"
FT                   /note="identified by match to protein family HMM PF00365"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3093"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00502"
FT                   /db_xref="GOA:D4HEQ0"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012829"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEQ0"
FT                   /protein_id="ADE00502.1"
FT                   /translation="MAVVTVTHMIATVDRSVVGAIHGRMGTTRHRSGVVMSKKKKVGIL
FT                   TAGGDCPGLNAAIRGFGKAAIRQHDMELIGIQDGFLGLAGNRTISLDPRALSGILTVGG
FT                   TILGTSRDKVNHMIIDGEERDMVPTIVENYEKLGLDALVTLGGGGTAKNAYKLAKAGLN
FT                   VLHLPKTIDNDIVGTDDSFGFSTALEIATEAIDRLHSTAHSHHRIILAEIMGHRAGWLA
FT                   LGSGIAGGADVILLPEVPYKLDSIVQAVENRQKQGLNFSVIAVAEGARDEADSAAMAGA
FT                   QALVDASKTSETKAAAKKAKKDLEHSMRDNTLKLATQLEEATGLESRVSILGYVQRGGI
FT                   PCAHDRLLATRLGTVGAKLVDDGEFGIMVAAQGGDAATVPLKDVAGKVKYVPADHPWVK
FT                   AARQVGTGLGD"
FT   gene            complement(104023..104604)
FT                   /locus_tag="HMPREF0675_3094"
FT   CDS_pept        complement(104023..104604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3094"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="identified by match to protein family HMM PF01022"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3094"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00734"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEQ1"
FT                   /protein_id="ADE00734.1"
FT                   /translation="MSTRHDDTASLVDPGSQKRIDEVADALRRRGGSATSAELASDLGI
FT                   HPSTARFHLDRLVEQRRVEATRRHRATRGRPHTVFTLVSDEGPRAYRLLAQMLVDEVAI
FT                   SNNPTAMAMRIGQRWGRHRRGDLIAVLDDMGFSPAAEEGGIVLRHCPFLDLARDHPQVV
FT                   CSLHCGVVEGVTGQAATIDANPGVRCVVHT"
FT   gene            complement(104601..107342)
FT                   /locus_tag="HMPREF0675_3095"
FT   CDS_pept        complement(104601..107342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3095"
FT                   /product="putative nitrite reductase, copper-dependent"
FT                   /note="identified by match to protein family HMM PF07732"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3095"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99056"
FT                   /db_xref="GOA:D4HEQ2"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEQ2"
FT                   /protein_id="ADD99056.1"
FT                   /translation="MPEITSAPVGRKPDTNKRSWHRKASRPVSGWLVALLIVAVANPWI
FT                   PQSRWLLVHMVTLGVATTSIMVWGQYFTEAILHNNLTDTDRSRQVLRIRLLAVGIVITC
FT                   IGMVVTWPWITVTGAAVIGSTLTWYAFALGHQVRHALPGRFDSTVWFYCAAACLLPLGA
FT                   TLGAIMAFSPTEPWRTRLLVAHQALNLLGFVGLTVVGALITLWPTVLRTKMQPAQDRHG
FT                   KISLCVMFVAVAATTTGALCGLWWLAALGVTAHIVGICIVLGDLVACSVHRPPRDFPGF
FT                   TMGAAICWMLVWLVWLAWKLASNGTRLLADDIFTLSVPVIVGFLLQLLIGAMSYLMPMV
FT                   MGGGPKIVRATNAKMHAYGALRATITNAGLLLWVLAMGTWTRRIGMVLTVVGLATFLPA
FT                   TAAMVRTGVPMLKEKGRQMAARKAASEIGEAPDPDNGPAQAAPVASLDRSATSKPAEPA
FT                   PTAPPNRRSFVGAFAGLATALTAAAVGHHLDQTTPTDDTNGSAAVVGHVAPTGHTTTVN
FT                   ITAKGMKYHPSTITVPAGDQLVVEITNKDPNQVHDLQFANGAHSPRLAPGDHATVKVGV
FT                   ITGPTEGWCTIVGHKSMGMVLDVQVAGMSGVHDRDDHVDSADPRRRIDLTKAPGKDFRT
FT                   RDAVLPPLMTGRVHRMTLIAQESVQEIAPETTIDAMTYNGRYMAPVIHARIGDEMRVHL
FT                   VNRGTMGHSLDFHAGTVSPTRVMRTIAPGQELDYNFTLHRAGIWLYHCSTAPMSAHIAA
FT                   GMFGAVIVPPHDLPRADREFYLVQSETYLSEHNGAEVNTAKIANETPDLTMFNGHANQY
FT                   VFEPLKARVGERVRIWVLAAGPSRGCSFHVVGTQFDTVFKEGAYTLKRGNPEGGGCQAL
FT                   DLASAQGGFVEMVFEEPGRYTFVNHFFVEMERGAKGFIEVTT"
FT   gene            complement(107335..108468)
FT                   /locus_tag="HMPREF0675_3096"
FT   CDS_pept        complement(107335..108468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3096"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3096"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01038"
FT                   /db_xref="GOA:D4HEQ3"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEQ3"
FT                   /protein_id="ADE01038.1"
FT                   /translation="MPTSSAGSHRAWLMVGACISLLAGLDGALLLLGVWSPVMSTRLSK
FT                   WHGPLMVLGFVGTVICLERAVALGHRLAYLVPAMSGFGVIVLLAPLPFDSARAGLALLT
FT                   LAQLGLLTIYVPLWRRSHDDAVVIQGAGAFCAAGAAALLTTGAHVSQIVGWLACYMILT
FT                   ICGERLELSRLTMARNRALSALCLAVVAALLVSVVSPAIGWRVLGVVLIGLAVWLCRHD
FT                   VARGGLRRGGQAAYIGTLLMIGYLWLATAGIVCTIQGPPTSRNGYDAVVHSLFLGFTIG
FT                   MILGHAPIILPAVLQVRLEWTTWFWLPAFLLEASLLVRIGIGDGLDRSAAVQAGGTVNV
FT                   LSLLTLVAVIATHIQPRTRARTHLKSTPRSRSGEDHA"
FT   gene            108899..110371
FT                   /gene="aspA"
FT                   /locus_tag="HMPREF0675_3097"
FT   CDS_pept        108899..110371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspA"
FT                   /locus_tag="HMPREF0675_3097"
FT                   /product="aspartate ammonia-lyase"
FT                   /EC_number="4.3.1.1"
FT                   /note="identified by match to protein family HMM PF00206;
FT                   match to protein family HMM TIGR00839"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3097"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99478"
FT                   /db_xref="GOA:D4HEQ4"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004708"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEQ4"
FT                   /protein_id="ADD99478.1"
FT                   /translation="MTEIRIEEDLLGKREISNEHYYGIHTLRALENFQISRGCMNDEPD
FT                   FIRGMVQVKKATTLTNKQLKVLPSDVADAIVAACDAILDDGRCMDQFPTDSFQGGAGTS
FT                   INMNTNEVVANLALEMLGYPKGTYDVIHPNDDVNKSQSTNDAYPTGFRLGVYALLEGLK
FT                   RAVADLADSFDAKAEEFADVLKMGRTQLQDAVPMTLGEEFDGYAHNIRAELDRLDIGSD
FT                   LLVEVNLGGTAIGTRINTPDGYAELAAEKLAEVTGYPIRPSTNLMESSYDNGAYIAVHS
FT                   IIKRLAAKISKICNDLRLLSSGPRAGLKEINLPEMQAGSSIMPAKVNPVIPEVVNQICF
FT                   KVFGNDVTVCFAAEAGQLELNVMEPALSQAMFESIHLLTNACDTLRSKCIDGITANVER
FT                   CREYVTNSIGIVTYLNDVIGHHQGDLIGEEAARTGKSVREVVLEHDLIPEERLDEIMST
FT                   QNFLHPRYSGRTYEPSDRGLPEDPRTFVSERC"
FT   gene            110377..111675
FT                   /locus_tag="HMPREF0675_3098"
FT   CDS_pept        110377..111675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3098"
FT                   /product="transporter, anaerobic C4-dicarboxylate uptake
FT                   (Dcu) family"
FT                   /note="identified by match to protein family HMM PF03600;
FT                   match to protein family HMM PF03605; match to protein
FT                   family HMM TIGR00770"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3098"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99621"
FT                   /db_xref="GOA:D4HEQ5"
FT                   /db_xref="InterPro:IPR004668"
FT                   /db_xref="UniProtKB/TrEMBL:D4HEQ5"
FT                   /protein_id="ADD99621.1"
FT                   /translation="MMLFIQLAVVLLFIFLGARKGGLGIAYAGGAGVIVLGLLGCKVDP
FT                   GTGIPWDVIGVIISVISCVAAMEVAGGLELLVMLSERILRHNPKRITFLAPTVTFFMTV
FT                   LCGTGHVAFATLPVIAEVAKEQKVRPSRPLSIAAVASQIGICASPISAAMVAMAAIVGP
FT                   LGVSYPKLVLVSIVGGYVGSMIGAVVSSKLGCELELDPVYLQRLGKGQISHREAGNYNI
FT                   KPYARRSLIIFVVSLVVVMAYAAAITAVDKPPLPRGAAIMTFMMTAALVIATLCKVPLN
FT                   EITSQATYKSGTSAAICVMGVAWLGNTFVSSNIDTIKAAGSGVIHSAPWLLFVVLFLAA
FT                   SLLYSQAATTVTFMPVAAALGLPASVLVGCFAAASALFLLPTYPTVVAAVEMDDTGTTR
FT                   IGKYIFNHSFLIPGIVSISAACLASYGVMLVVG"
FT   gene            complement(111776..112066)
FT                   /locus_tag="HMPREF0675_3099"
FT   CDS_pept        complement(111776..112066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3099"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00451"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031165"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF38"
FT                   /protein_id="ADE00451.1"
FT                   /translation="MGCMSETTVTKNDQQSRYEAYIGGELAGFAEFRREGDVIVMPHTE
FT                   TFEAFSGKGVGSALARFALDDIACQNLSVRPDCTFIKGWLDKHPDHPVNVI"
FT   gene            112195..113646
FT                   /locus_tag="HMPREF0675_3100"
FT   CDS_pept        112195..113646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3100"
FT                   /product="catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="identified by match to protein family HMM PF00199"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3100"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00084"
FT                   /db_xref="GOA:D4HF39"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF39"
FT                   /protein_id="ADE00084.1"
FT                   /translation="MPIDPSKPSTNTNGSPAPSDEYSLTVGADGPVVLHDAHLIDTLAH
FT                   FNRENIPERKPHAKGSGAFGHLEVTADVSEYTKASFLQKGRETPMLARFSTVAGELGSP
FT                   DTWRDVRGFSLKFYTDEGNFDMVGNNTPVFFMRDPMKFPHFIRSQKRLPNSGLRSPNMM
FT                   YDYWSLSPESAHQVAYLMGPRGIPLSYRTMNGYSSHTYSWVNAEGKITWVKYHFISDQG
FT                   VHNMTADRAKAIVGDHPDIHREDLFNHIADGDYPSWTVKVQLMPYDEAKDYRFNPFDIT
FT                   KVWPHKDYPLHTIGKFTLDRNPENFFAQIEQAAFSPSNTVEGTGLSPDRMLLGRVFAYN
FT                   DAARNRLGVNYEQLPVNRPTTPINQYTFDGQMAFEHSGSAPTYAPNSYGRDFATGYRTG
FT                   SEATWEADGELVRSAQTRHAEDDDFGQAHALVHDVFSDAERDELVDTLVDLMTNFDMEE
FT                   PVIGNALSYWRNIDAGIAEATEGRI"
FT   gene            complement(113684..115429)
FT                   /locus_tag="HMPREF0675_3101"
FT   CDS_pept        complement(113684..115429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3101"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3101"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99709"
FT                   /db_xref="GOA:D4HF40"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF40"
FT                   /protein_id="ADD99709.1"
FT                   /translation="MSTPRSLPLATAAQVRQEVHRAARGVRGYFIGAIVVITAASLLDL
FT                   TVPVATGWIIDAAKAHRPTSALLTPALVMAAAVIGSGICNGAAQSLTPSFFTTIITRLR
FT                   ESMIAVGLGLDQQRVEKAGTADLVSRASDDVTAVRDAANGALPRLVNTMIMVIVSVGAL
FT                   ASLHPLFFVPVLLAGVLYGLAIREFLRTAPPVYRAERNASTTQSQRILSTIHGVDVVRA
FT                   FGLENLRTRAVANGSWQAIRWNLRGRSLGNTLVVRLLAGEAVATIGVAWTGYLLVTTDR
FT                   LSVGAAATAVLVLLRLFSPVRFLLMFLNNLQAAWVCLQRVVGVIQARHDKPAVSERYQR
FT                   EPTSIHVDQVSFGYQDGPDVLHTVSLDIPAGHTVVLVGESGAGKSTLAALVAGLLEPRQ
FT                   GSITMTSGHARTVLISQEIHTFSGTLFDDVALGLAGQAKDWPDERVRDAVLAALERVGA
FT                   DWVEQLPHGVDTVVGRLGIRLSPAQAQQVALARALLADPPVIILDEATAEAGSSGATAL
FT                   DRAAAEAVRGRTALVVAHRLSQVTMADEVAVMDNGRIVEVGAPEQLRQSDGPFAALWRV
FT                   WSNQH"
FT   gene            complement(115426..117192)
FT                   /locus_tag="HMPREF0675_3102"
FT   CDS_pept        complement(115426..117192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3102"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3102"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99165"
FT                   /db_xref="GOA:D4HF41"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF41"
FT                   /protein_id="ADD99165.1"
FT                   /translation="MIRTPRRHWHPKLGWLPHIPRQTPPPIDAPLIDVTHAHDGRAVVR
FT                   RMARDGRRWLLPGSVSSAFVSLVNIGVPMALGRAIDDGVVAADAAALTGWLALVALAYL
FT                   VRAIAQTIRMQTNVGAGLAEHDLRIQALERITAPEGIGGRSRLPGDLLAVVVTDVRAVS
FT                   RAFIALTSIPGNVVTLLGALISMTLINGWLALATVCIVPLLILLSVKGVAPVKRSTRRE
FT                   RRAEAAVAGSAADLTSGLRIIQGLSAQRRATARFRTASRQGLDATLRTRRVKGVYTGTI
FT                   NASVGVFITALTVLAGWLTLAGRISVGELVTVVGLAQTLGPPLRALGVDTATMLATAHA
FT                   SGDRFCELRDSPAAWQVHPDDGARTTPGDGPVELHIPVRDFQLDVAGGTHVGVMAPQSV
FT                   CDALAEAIDHGSETVLNGVPASRLNPAQRRRLVLVAPRSPELFDDTARANIVLDSQTTV
FT                   ARLNAVVDAAALDTVVAVLPRGLETEVGEGGRHVSGGQRQRLALARALLHSPDGLVLID
FT                   PTTSIDAVTTATIARKVRQLRAGRTTIIATTSSALLDQMDEVVLLDADGRQIARAPHRE
FT                   LLARDDYREMLS"
FT   gene            complement(117189..118175)
FT                   /locus_tag="HMPREF0675_3103"
FT   CDS_pept        complement(117189..118175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3103"
FT                   /product="magnesium chelatase, subunit ChlI"
FT                   /note="identified by match to protein family HMM PF01078"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3103"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00863"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF42"
FT                   /protein_id="ADE00863.1"
FT                   /translation="MAQRPVYPFCAIVGQEEMKLALILATISPDLSGVLIRGEKGTAKS
FT                   TAVRGLAALLPQHREIPGPYHLSPDEYPTHAVALNLPEVMPEPRTVQVPVVELPVGATE
FT                   DRVTGTLDMETALREGRRRFEPGLLAAAHRAILYVDEVNLLDDHVVDLLLDSAAMGVNT
FT                   VEREGVSVTHPARFTLVGTMNPEEGELRPQLLDRFGLCVTVSGEDDPDKRTEVIRRRMA
FT                   FEDDPGGFSRTWEQDGHKLSERIQRATELVTQVVISDETLTTAARTCINAHVDGHRADI
FT                   MMVRAARTLAAWNGCTEITTEDLSQAARLVLPHRMRRQPLESVGRAV"
FT   gene            complement(118177..120141)
FT                   /locus_tag="HMPREF0675_3104"
FT   CDS_pept        complement(118177..120141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3104"
FT                   /product="cobaltochelatase subunit"
FT                   /EC_number="6.6.1.2"
FT                   /note="identified by match to protein family HMM PF00092;
FT                   match to protein family HMM PF01078; match to protein
FT                   family HMM PF07728; match to protein family HMM TIGR02442"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3104"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00191"
FT                   /db_xref="GOA:D4HF43"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="InterPro:IPR041702"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF43"
FT                   /protein_id="ADE00191.1"
FT                   /translation="MTYPFTAVVGQDEARLALLLCAVNPRIGGVILSGEKGTAKSTVVR
FT                   GLVELLPGHIMRTLALGTTEDRLVGGLDLEATLVAGRPVLQPGLLSEVDGGVLYIDEVN
FT                   LLDDHLVDLVIDACAGTVRVEREGLTASLPSRFVLVGTMNPEEGALRPQLLDRFGLCID
FT                   VHGESDPAVRAEIIRRRLDHDADPAEFDHRWQSDQNRQAAVIERARHIVAGVRLDEVVT
FT                   ELISCLCRQNHVAGHRADIVMAEATRAHAALVGRGVATEDDVLTISEMVLRHRRRVETP
FT                   SESPPPRNQYPDDQPDQPEQRPREPERPDPDVEKRQAGENLATPPSSSGEQQPEYHDGP
FT                   QNQRDDGQHDPRKQPSGSGEQVVAAGDPFAVRPLEPGQDRFARRACGRRLRTRSNDRRG
FT                   HYVSARPTDRPDDLALDATLRAAAVHQKSRRATERPDLAVHVKPIDWRAKVRAGRAASC
FT                   VIFVVDASGSMGSRGRMTASKGAVLSLLLDAYVKRDRVCLIGFRRDRAEVLVPVTSSVE
FT                   VAQHGLAELPVGGRTPLSAGLIKACEVVRPLLLKDPGLRPLLILVTDGRGNVSLDGRPN
FT                   SQATDEAIRVATKLGVDTRLSWVVIDTEDPRGIQLSRARDIATALGGPCLRIDDLRADD
FT                   LVNVVSRLDPSHQSPRKDR"
FT   gene            complement(120141..124046)
FT                   /locus_tag="HMPREF0675_3105"
FT   CDS_pept        complement(120141..124046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3105"
FT                   /product="putative cobaltochelatase, CobN subunit"
FT                   /note="identified by match to protein family HMM PF02514"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3105"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00112"
FT                   /db_xref="GOA:D4HF44"
FT                   /db_xref="InterPro:IPR003672"
FT                   /db_xref="InterPro:IPR011953"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF44"
FT                   /protein_id="ADE00112.1"
FT                   /translation="MTTLSFFSATGGELTLVSQALSRLRTRGLDITLFGRTKDQITDPE
FT                   LARAFAQAAARSDAIVLSFHGGTTSCPAWPALVEAWKNRRESGLPLPWIHIQPTSGDDD
FT                   GLLAAQDWASGLDDGTWRGLIGLLEMGGPDNVEAALRILVDRVRGGSAPIPDVIPAPTE
FT                   GIWHPRHGLFTNLAEYRHHLDPDLPTVGITFPRSYWLEHNTAHIEALIEAIEGLDANTV
FT                   PFFCLRLPDARRGNPSMAQTLETLLRDDDGNRVIDTLIDVHGMSMTAGVPANADAYPKL
FT                   GVSVLHALTSYAPLAAWKAQGMGAMDVATQAAQPEFDGALITKFLATREVDRVDDLTGA
FT                   VVPHMVPVPGRPEAMAELALSWARLARTSANQRKVAIVFHHHPPRNDRIGCATGLDTFE
FT                   SVRRLLVRMAEDGYDVPEQFDSADDLAQVLLSSLTCDQRWLTPEQMYQRAEVHADLATS
FT                   RSWYRALPASVRESMDRAWGPHPGSLFVHHDEFSFAGHLDGNVLLTIQPPRGNFEAVTD
FT                   SDIHDPLLPPPHHYLAHYRWIRDVFKADAVIHVGTHGSLEWLPGKGLGLSEECYPELAL
FT                   DRMVNIYPYIINNPGEGTQAKRRSAAALIDHLTPPMRQAELYDSTAEIDRILREYAGAQ
FT                   SQSPQRARLVAEQVWDAVTKAGLDTDLGLTSADVDADPVEVLDRVHHHLLDLQDREISD
FT                   GLHVLGQVVAGHDDPIAAKVEYVAQLTRQPNGPVPSLREAVLNAWGTSLDEVSARAGEP
FT                   VPVTADLPDGLTGRQLMSEAHRRCVKLLTPVVVRHRDRHPDDTEAHDLAAQLCHEQLGA
FT                   ERGDVIETLTWVLTDLMPRLDATNNEIDAIMTALDGGFVAPGPSGAPSRGNAHILPSGR
FT                   NFFSLDPQTMPTPTGWREGVELADQLLRGYAEAHPDQPWPRTVGVVVWGTPNMRSGGAD
FT                   IAEILYLMGVRPVWESSGLVSGLQIIEPCELGRPRIDVSPRISGLFRDAFPNLVEMIDR
FT                   AVRMVAALPEPDDDNMLRAHVEADVVEMTARGIDVEQARRKATLRVFGCPPGGYGAGVE
FT                   ELIETKAWQDKADLGRAYIAASSHAYGEGVLGQVETERFTASLKRMDVTVKNEDTREYD
FT                   MLSCTDFYNYYGGLIAAATTVRGEAPMSLVGDSSDPTRIATRTTTEEARLILRSRILNP
FT                   SWIEGLQRHGYKGAGDLSAVLDILIGWDATADVVDDGLWERVARRYALDPAMQEWFRQV
FT                   NPHALHNIVDKLLDAAQRHVWEANPSTVEELENTYADIEGTIEEVSDDPAIAPNTRVGA
FT                   PPQNPAGGLDLSELGLI"
FT   gene            complement(124043..125137)
FT                   /locus_tag="HMPREF0675_3106"
FT   CDS_pept        complement(124043..125137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3106"
FT                   /product="putative bacteriochlorophyll 4-vinyl reductase"
FT                   /note="identified by match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3106"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99419"
FT                   /db_xref="GOA:D4HF45"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF45"
FT                   /protein_id="ADD99419.1"
FT                   /translation="MTVRYLVLWPTAACDLTCPYCYRRDRRGGRMPVEVADTALDLVAE
FT                   GVRTTGQPAHVQLAGGEPTLVPSLIEHVAKRVVEIRWGKVTCGIQTNAARLDGDIIAML
FT                   KRHSVRVGVSVDGPPPVHEKTRGSAAQTFRGLLALAHADIPVRVTTVLSALNVDHLDGL
FT                   AVTLAALPNVTGFGLDPLVAIGSATGRDELVPCDEAVINGITTLHRRLAQINALRATPL
FT                   RWRELETVRTALRRGPVPTTSAVDPAGRTLLPVANHPYCHAAIGESMAVAPDGSVYPCS
FT                   QAVGDMASRAGTVHSIDWESLRRRFSQDRHTLRGPCHRCALAGRCPGDCPSRVEANALA
FT                   DPEQRRTPLTCLIDSTLARLESAS"
FT   gene            complement(125134..126135)
FT                   /locus_tag="HMPREF0675_3107"
FT   CDS_pept        complement(125134..126135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3107"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3107"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01129"
FT                   /db_xref="GOA:D4HF46"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF46"
FT                   /protein_id="ADE01129.1"
FT                   /translation="MTGLTLSNLTVGYRSGRHVTRVLSGVTGSVAAGQMIGLVGPNGAG
FT                   KSTLLRSVAGLQPSLAGEVRINGTPTSRMSRRQVAQALSTVLTDRVSVARLTCRDVVSL
FT                   GRHPHSGIGGRLRPHDHAVIDESLTAVGAADLADAFIGELSDGQRQRVMVARALAQEPS
FT                   ILLLDEPTSFLDPPGRIALLGMLREVCTARNIAVVVCSHDIEPVMRYADTLWVAGHDTD
FT                   VVIGAPEDLARNGALEAAFRTEGITFDLRTLTFWQSDSGRPVARVVGHGVDADLARHVL
FT                   TRSGYRVVEQPGDEVLTIGVTDEGWAVDDCVLPTLSQLHEHLIGRHRERARS"
FT   gene            complement(126132..127160)
FT                   /locus_tag="HMPREF0675_3108"
FT   CDS_pept        complement(126132..127160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3108"
FT                   /product="iron chelate uptake ABC transporter, FeCT family,
FT                   permease protein"
FT                   /note="identified by match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3108"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00464"
FT                   /db_xref="GOA:D4HF47"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF47"
FT                   /protein_id="ADE00464.1"
FT                   /translation="MPVRFTILAAIFVAVTLAGLALGSVNIPLGDVMTVVTGGTNVDPV
FT                   SMTIIHDVREPRTITALLVGAALGMSGLEMQTLFRNPLADPYVLGISSGASLGVALVVL
FT                   STSASAGAATFASGLGIGPDLLIMVAAALGAAVVLLIVMLAGRFIHSSTILLLLGVMIG
FT                   YFVSSGVTVLLSRASPELIAQYTRWQFGSYHGVTWQNLRVMVPIIVAMILASLLLAKPL
FT                   NALLLGERYAQTMGMNLKVVRTLLVASTAILAGAATAFCGPIGFLGIAIPHLTRGVLGT
FT                   ADHRHLLPGCILTGSSLALMADILAQLPGDDVLPVNAVNAVFGAPVVMVILIRWYREAE
FT                   AT"
FT   gene            complement(127354..128517)
FT                   /locus_tag="HMPREF0675_3109"
FT   CDS_pept        complement(127354..128517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3109"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00489"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF48"
FT                   /protein_id="ADE00489.1"
FT                   /translation="MSINRLVAGLAATTMCVATPTGCSHSEQSGSSANTSSSGSSRQGC
FT                   IKDFDPSKDYFGDKATFGDARDITVSYHKSYKIVTLKHPSNTATKPVQYVLVQCGAPDP
FT                   HLDGELAKAQRITIPTTKVALGSTTLPMKFQMLGKLDSVAGMVNVDRVGNPDTRQALKD
FT                   HKVASFAAGDNATEIDKIKEIGIPVVAEPNFLESTPLGRAEWIKYDSLFVNAEKTANQK
FT                   YDEIAEKYHATAKRTAKVKTRPTVLHGSQYKGVWYIKPNENYAIQFLRDAGGEYVFKDL
FT                   HGVASRKLDTEAVIKQAHDADFWIDGPEKSSIPQILKADPRLKSLKALDNGNVWDATLR
FT                   ADPKHGNDYWQTGVVRPDLVLADLTAILHPELDRDHQFHFYRKATAK"
FT   gene            complement(128574..129842)
FT                   /locus_tag="HMPREF0675_3110"
FT   CDS_pept        complement(128574..129842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3110"
FT                   /product="periplasmic binding protein"
FT                   /note="identified by match to protein family HMM PF01497"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3110"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00348"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF49"
FT                   /protein_id="ADE00348.1"
FT                   /translation="MSTPKTMPRRISALITLFVAPALALTGCSGSSDRTTSLNTSTAAP
FT                   SVGTGANMSGCIKSGEFDKDKDYFGDKATFTGARNVHVSYHKSYKVLTLGEQDRPAQTF
FT                   VLLQCGAPKPALTGDLAKAPIIDVPVKRIAASSTTQIPVFHTLGALDSIVGVNQIEQIY
FT                   RGPAREALEARHIPSYGSSRMQIDTEKIISLKPDAVLAASSEVEEFKQVQSAGIPVLQD
FT                   LDYLESTPLARAEWMKAYGILLNKEGAATKSFDSIAERYAEVAKKAKNAADKPSVLVGQ
FT                   ETKGQWYVPGADSYMIKFMTDAGASDVMAQAVKGNGATPTDAEVVFKYGSKADFWLNGN
FT                   YMSMTTWHGKDDALKQNPRYANLSAFKHGNVWNPSKRTAPDTGNDFWQSGIVQPDVVLA
FT                   DLTYIFHPDLMKGYTPYYYTKLS"
FT   gene            complement(130126..130899)
FT                   /locus_tag="HMPREF0675_3111"
FT   CDS_pept        complement(130126..130899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3111"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3111"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00953"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF50"
FT                   /protein_id="ADE00953.1"
FT                   /translation="MTAPNRVPSRCLSITRLRDLLLADIPASRLVIACDTIGGIGPRPD
FT                   DSYPADPVWCAHLGARVPLLEVLCAGARPLVLVDTLCQDSASAQPMIAEFRRCALDAGI
FT                   DPDAVTGSTEDNVATTQTGVGVTIIGVMHHEDSPKSLDGDVLVCVGAPISAPDDDVAPG
FT                   RREIMDVTEVRALMASGKVHDCVPVGSHGVAWEAKQLASTAGLRVAFQPTDVDLTRSGG
FT                   PATCVVMACAKTNLEQLHALVNPERPWAVIGHLRS"
FT   gene            complement(130939..132723)
FT                   /locus_tag="HMPREF0675_3112"
FT   CDS_pept        complement(130939..132723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3112"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06100"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3112"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00974"
FT                   /db_xref="GOA:D4HF51"
FT                   /db_xref="InterPro:IPR010354"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF51"
FT                   /protein_id="ADE00974.1"
FT                   /translation="MTNFQHIYQRSYPVSPDGNPFVQNDLGRYTQNHPVPPDDVAERKA
FT                   YLVGSGIASLLSAAYLIRDAQMPGENITILEEMSEPGGAFDGAGDTEKGFIARGGREMG
FT                   QHFECFWDIMKDIPALEMPEPYSVLDEFRIVNENDPNINPCRIINNRDHKRDASKMGLN
FT                   KKGQLDIVRLLLAKESDTYYKSIEDWFDEDFLQSTFYLLWKTMFAFEQWQSLTELKRYM
FT                   HRFLQYLPGFSNLSCLRFSRYNQHDSFVVPLVKWLTEKGVNFQYDTLVYDVDLEITAHR
FT                   KIARGILWRDKEGGEHRIDMSAKDLVFVTNGSLTECTGYGDMDTPAPYHKDMQAGWELW
FT                   RNLVRRSPAFGRPDVFCGDADKTVWQSISFNFIGRDHPFLKKIKELTGNDPLSGRTVTG
FT                   GIITAEDSSWCISLTMNRQPQFHGQPEDWGVAWAYGLYPFEKGDVVNKTMLECTGEELL
FT                   KEYCYHFGLLDQFEEVKAHTKVRIATMPWITAFFMPRGKGDRPEVIPDGCVNLACLGQF
FT                   VETPDDCVFTTEGSARTAMMAVYGLLDLDRDIPPIWPTQYDIRSLLASAKTLNNGRLPG
FT                   SWLLSKLLKNTYYEDILP"
FT   gene            132840..134549
FT                   /gene="thiD"
FT                   /locus_tag="HMPREF0675_3113"
FT   CDS_pept        132840..134549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="HMPREF0675_3113"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="identified by match to protein family HMM PF01256;
FT                   match to protein family HMM PF03070; match to protein
FT                   family HMM PF08543; match to protein family HMM TIGR00097"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3113"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00486"
FT                   /db_xref="GOA:D4HF52"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF52"
FT                   /protein_id="ADE00486.1"
FT                   /translation="MFGRFSAAERKLWWGDILVFGHGVRLGGAEITPVEPDLVRTGEGM
FT                   SEMTTSDALAERGTIPRVLSIAGTDPSGGAGTAADTKSIVAAGGYAMVVVTSLVAQNTE
FT                   GVRAIHTPPTDFLVQQLAAVSDDVRIDAVKTGMLGTAEIVDAVATFLDEHRPPVVVVDP
FT                   VMVATSGDRLLAPDAEAAMREFCRRATVITPNIPELGVLCQSEPATTPEQAVEQARRWA
FT                   AETGVAVVVKTGHLNSQRVDNMWVTPEGAMHTVPAARVKTTNTHGTGCSLSSALATRLG
FT                   AGDTPGDALAWVTDWLHEAIQYGSALNVGKGHGPVDHSHRARRLAKDASAVAWFAPIDP
FT                   LESPQGLVGSAEPSPDAVVGPAGPWTTALWQASGDIARRIEDSDFVAALVDGTLSKPAF
FT                   EFYLGQDAQYLTYYSRALASLAARAVDPEESVWWAQSSQACLVEEAELHRSWLGDHIDV
FT                   VAGPVTLAYTDFLLARALGDDYVVGTAAVLPCFWLYAHLGAKVPHVPDDHPYASWLQIY
FT                   GDPEFVEGASHTIGLVEKAFQNASAVTRARAAHAYLTACRHELEFFDQALRV"
FT   misc_binding    132895..132989
FT                   /gene="thiD"
FT                   /locus_tag="HMPREF0675_3113"
FT                   /bound_moiety="thiamine/thiamin pyrophosphate"
FT                   /note="TPP riboswitch (THI element); Rfam score 66.95"
FT                   /inference="nucleotide motif:RFAM:RF00059"
FT   gene            134726..134902
FT                   /locus_tag="HMPREF0675_3115"
FT   CDS_pept        134726..134902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3115"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99975"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF53"
FT                   /protein_id="ADD99975.1"
FT                   /translation="MLAPTAIGLVPVRTRMVREFLDAGPDVAGEVAAARAGGPGSFRVQ
FT                   LRDALDEAARTAK"
FT   gene            134911..135564
FT                   /gene="thiE"
FT                   /locus_tag="HMPREF0675_3116"
FT   CDS_pept        134911..135564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="HMPREF0675_3116"
FT                   /product="thiamine-phosphate diphosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="identified by match to protein family HMM PF02581"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3116"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01173"
FT                   /db_xref="GOA:D4HF54"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF54"
FT                   /protein_id="ADE01173.1"
FT                   /translation="MTLDLRCYLVTSGTGRHTVETAAAAAGAGAGMVQVRAKELSTRDL
FT                   FSLVLQVGEAVRRANPATRVVVDDRADVAWAAIRARGNVHGVHVGLTDLPVRDARAMLG
FT                   PDAIVGYTTGTLDLVRSAEPFADALDYVGAGPFRPTPTKESGRSPLGVQGYPALVGASS
FT                   LPVVAIGDVQVADVPALAATGVAGVAMVRAIMASDDPAAVVRQVVQSFDEVRVS"
FT   gene            complement(135855..136820)
FT                   /locus_tag="HMPREF0675_3117"
FT   CDS_pept        complement(135855..136820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3117"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00637"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF55"
FT                   /protein_id="ADE00637.1"
FT                   /translation="MDMRENFELELRSNGGVARIVRDSPLRGQADRSVARGDTVRILPG
FT                   VVAATGAARHVTTMIQALKLWHRDATLVGMAALVLLGLKNPVTQRCWDYTGIQAIEAFS
FT                   PTRRLRRPRIWVHRWHVPHYFTIEDEGIRVAIPEVSVIILAIQGQWDWMCQALRQRLVT
FT                   PASCRAARKALTGRYSKAEVDRALADIDLNPWSIPELELARILRATGITGHKPNHQVWV
FT                   GEGNYRYVLDQAFQAEMLGVEMEGRSVHGTPEGYEAMMVRSAHLEQARWRILHTTPTML
FT                   RRDPKFVLDWIINHLHKRHRPKTTLTNQVLRQIMNGAVPA"
FT   gene            137237..137374
FT                   /locus_tag="HMPREF0675_3118"
FT   CDS_pept        137237..137374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3118"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99585"
FT                   /db_xref="GOA:D4HF56"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF56"
FT                   /protein_id="ADD99585.1"
FT                   /translation="MVPQPAPRKPRVVVKEPVMLDVIWLLGVIALFILLALCVKGVDAL
FT                   "
FT   gene            137347..137460
FT                   /locus_tag="HMPREF0675_3119"
FT   CDS_pept        137347..137460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3119"
FT                   /product="putative K+-transporting ATPase, F subunit"
FT                   /note="identified by match to protein family HMM PF09604"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3119"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99094"
FT                   /db_xref="GOA:D4HF57"
FT                   /db_xref="InterPro:IPR011726"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF57"
FT                   /protein_id="ADD99094.1"
FT                   /translation="MREGGRCAMTILNLVAAILGIAAVVYLVIALIRPERF"
FT   gene            137460..139130
FT                   /gene="kdpA"
FT                   /locus_tag="HMPREF0675_3120"
FT   CDS_pept        137460..139130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpA"
FT                   /locus_tag="HMPREF0675_3120"
FT                   /product="K+-transporting ATPase, A subunit"
FT                   /EC_number="3.6.3.12"
FT                   /note="identified by match to protein family HMM PF03814;
FT                   match to protein family HMM TIGR00680"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3120"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99123"
FT                   /db_xref="GOA:D4HF58"
FT                   /db_xref="InterPro:IPR004623"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF58"
FT                   /protein_id="ADD99123.1"
FT                   /translation="MTWICFLAGLALLAIALGIAQHHLGTYMARVFTSDKDTRVETWCY
FT                   RVMGVNPRAGQTWKSYARAVLAFSFCGVVFLYALQRLQLWLPWSLGKGSVNPAVSFNTA
FT                   ISFVTNTNWQAYSPEATLGHFVQLAGLCVQNFVSAATGIAIAVALIRGFVGHGEHTIGN
FT                   FWVDLTRCTLRILMLIAAVAAFLLIAGGAVQNFTGFLHVTGVAGGNQVIPGGPVASQEA
FT                   IKELGTNGGGFFNGNSSHPFENPQPWTNMLEIFLILLIPFSLPRTFGKMVEDVRQGRAI
FT                   LAAMVVLFTVNLCAMAAAEFSGHGTAARLAGAAMEGKEQRFGLAQSVLFANSTTMTSTG
FT                   AVDSMHDSFTAIGGMFTLLNMMLGEISPGGVGSGLYGMLVIAVIAVFIAGLLVGRTPEY
FT                   LGKKIGPREMKLSALYILVMPTLVLCGVALSLAVPGLRSSVNTSIANPGEHGLSELVYA
FT                   FTSAANNNGSAFAGLDASTNWLCAALGAAMLLGRFVPIILILALSGALVEREPVPVTAG
FT                   TLPTHNALFTTLIVFTAILVTALVFFPVLTLGPLAEGLI"
FT   gene            139133..141247
FT                   /gene="kdpB"
FT                   /locus_tag="HMPREF0675_3121"
FT   CDS_pept        139133..141247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpB"
FT                   /locus_tag="HMPREF0675_3121"
FT                   /product="K+-transporting ATPase, B subunit"
FT                   /EC_number="3.6.3.12"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00702; match to protein
FT                   family HMM TIGR01494; match to protein family HMM
FT                   TIGR01497"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3121"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99268"
FT                   /db_xref="GOA:D4HF59"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006391"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF59"
FT                   /protein_id="ADD99268.1"
FT                   /translation="MTVIPSNSRSRGLTGTQARQALPGALRKLDPRFQWRNPVMFLVWI
FT                   GAVLTTIIAGLELLTGVTDGGVSVGFSMAIAVWLWLTVIFANLAESIAEGRGKAQAESL
FT                   RKTRTATSAIRVDGWDERNDPSAEHTTTTEVVSSELRYGDVVVVAAGQTIPGDGDIVWG
FT                   IASVDESAITGESAPVVRESGGDRSAVTGGTTVLSDRIVVKITSKPGQSFVDRMIALVE
FT                   GSGRQKTPNEIALNILLASLSIVFVLVTLTLNPIASLAARPVSVTVLVALLVCLVPTTI
FT                   GALLSAIGIAGMDRLVQHNVLAMSGRAVEAAGDVTTLLLDKTGTITYGNRRASEFIPMP
FT                   GMSDEEIRDAAARSSLADPTPEGTSIVDLAREQGFVPDACGEQGKVVPFTAQTRMSGID
FT                   LPDGTKIRKGAGSAVRAWLTESHINMDIDTLAHMDRRVDSVSQSGGTPLVVAVRTPDHS
FT                   GKVLGVVHLKDIVKEGLTDRFAELRRMGIRTVMVTGDNPLTAAAIAKEAGVDDFLAEAT
FT                   PEDKLAYIRKEQEGGRMVAMTGDGTNDAPALAQADVGVAMNTGTSAAKEAGNMVDLDSD
FT                   PTKLISIVGIGKQLLITRGALTTFSIANDIAKYFAIIPAIFMATYPGLSALNIMGLHSP
FT                   ASAVLSAIIFNAIIIVILVPLALKGVAYKPAGASKILARNLRIYGLGGVVAPFIGIWLI
FT                   DLIIRLIPGF"
FT   gene            141260..141865
FT                   /gene="kdpC"
FT                   /locus_tag="HMPREF0675_3122"
FT   CDS_pept        141260..141865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpC"
FT                   /locus_tag="HMPREF0675_3122"
FT                   /product="K+-transporting ATPase, C subunit"
FT                   /EC_number="3.6.3.12"
FT                   /note="identified by match to protein family HMM PF02669;
FT                   match to protein family HMM TIGR00681"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3122"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00683"
FT                   /db_xref="GOA:D4HF60"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF60"
FT                   /protein_id="ADE00683.1"
FT                   /translation="MIISSRTRTVLVGLRSMLLFTVIVGVVYTGLMTGLGQLMLHHQAN
FT                   GSQLEVNGKVVGSTLIGQSFTDKGGRPLPKYFQPRPSAAGDDGYDAGSSGGSNMGPENP
FT                   DLAKAIKERRSQVAAFNHVDADRVPADAVTASSSGLDPHISPEYANIQIARVAKARHLD
FT                   KAVVRRIVDDNTTGRQLGFLGETKVNVVTLNAELDRQH"
FT   gene            141906..144398
FT                   /locus_tag="HMPREF0675_3123"
FT   CDS_pept        141906..144398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3123"
FT                   /product="ATPase/histidine kinase/DNA gyrase B/HSP90 domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00582; match to protein
FT                   family HMM PF02518; match to protein family HMM PF02702"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3123"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00577"
FT                   /db_xref="GOA:D4HF61"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF61"
FT                   /protein_id="ADE00577.1"
FT                   /translation="MAVRGRLRVLLGAAPGVGKTYAMLDEGKHLRAGGSDVVIAVVETH
FT                   GRAATAAMTEGMEVIPRHYVECRGIELPEMDLDGVLAQHPDVALVDELAHTNAPGSRNE
FT                   KRWQDVEELLEAGIDVISTVNIQHIESLNDVVEQITGVPQRETVPDTVLRRASQVEVVD
FT                   LAPQALRDRLSSGKVYPAERIDAALSNYFRLGNLTALRELALLWVADEVDHALVDYRSE
FT                   HGIDSRWEARERVVVALTGGREGETLLRRGARIAVRAGGGELLAVHVTTEDGLRSPHPG
FT                   ELARQRGLVDKLGGSFHQLVGDDIPETLIEFAKSVNATQLVIGASRRGKLSRLLTGHDV
FT                   EADIIRASGAIDVHIVSHDAQAKALRLPRMGGSLSTRRRIAGFAVLAVLGPLLTWLLVS
FT                   SRSPEALTTDVLAYELLAVVVALVGGAFSSLIAALASGFALDYFFTKPFYTVTVNEPLH
FT                   LVALLLYLLTAALVSVVVDRAARKTRVARRAAAESGLLQSVAGLVLRGEDAVESLLSRA
FT                   TEAFGLSGARLMTDGKVVANWGTTSDQVTEHRIDDHTVVEFHGPEPDASERRLMSVIAA
FT                   QLGTALEQHQLEETAKAVEPLAATDRVRTALLSAVGHDLRRPLAAATAAVSGLRSEWSK
FT                   LSDQDRADLLETADEALSQLANLVTDLLDVSRLQSGVLGVSVMPVDPAEVIMPALDELS
FT                   LGPADVEIDLGSDVPEMVADPALLQRVVVNLLSNALRYEPAGSRVRLAESSFANQVEIR
FT                   VIDHGPGIPEDRRDDVMVPFQRLGDTDSSVGLGLGLALSKGFVEGMDGTLALEDTPGGG
FT                   LTMVISLPRVGVEEASVQ"
FT   gene            144395..145078
FT                   /locus_tag="HMPREF0675_3124"
FT   CDS_pept        144395..145078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3124"
FT                   /product="response regulator receiver domain protein"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3124"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99635"
FT                   /db_xref="GOA:D4HF62"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF62"
FT                   /protein_id="ADD99635.1"
FT                   /translation="MRILIADDDPQFLRALRITLGARGYEVLLARDGQHALEMAIDHKP
FT                   DIILLDLGMPRLDGVKVIEAVRGWSSAPILVISGRSGSAEKVEALDAGADDYVTKPFSM
FT                   DELLARIRVLTRRIGQDEVDEEPIVAFGSVWVDLAAHTVTRDGANVRLTPTEWRVLELL
FT                   IRNEGRLVTRQTMLSQVWGSEHVTDTGYLRLYISQLRKKLEPEPSRPRYLITDAGMGYR
FT                   LVLDP"
FT   gene            145187..145606
FT                   /locus_tag="HMPREF0675_3125"
FT   CDS_pept        145187..145606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3125"
FT                   /db_xref="EnsemblGenomes-Tr:ADD98952"
FT                   /db_xref="InterPro:IPR027580"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF63"
FT                   /protein_id="ADD98952.1"
FT                   /translation="MSEALREYVKRRKLMRGGAEQVEVDLRTDGIDHRVSFMGRRLVKV
FT                   QRDHEQGCRIDTVYATARKQFAVVSKVRRVLPSWAGGKEDLWSHPETWDKEFWTVGDRT
FT                   LKVFANLDELRAADGELAERVDSALHVAPYEVLDI"
FT   gene            145817..146155
FT                   /locus_tag="HMPREF0675_3126"
FT   CDS_pept        145817..146155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3126"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3126"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00901"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF64"
FT                   /protein_id="ADE00901.1"
FT                   /translation="MLWTLGVSLSAHLRWLNISDRRRSLRTLRNANRRLCNQAFFIKIY
FT                   IDEDDQLRVENNRPFEMLLDPQINANALTWAQNGNKARIETKGFEPCAWGYLDVHFDTR
FT                   IWVGARRG"
FT   gene            146352..148049
FT                   /locus_tag="HMPREF0675_3127"
FT   CDS_pept        146352..148049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3127"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3127"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99616"
FT                   /db_xref="GOA:D4HF65"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF65"
FT                   /protein_id="ADD99616.1"
FT                   /translation="MSAIEVINLSFSFSAQPLLDNVSFSVGDSERAVLVGPNGSGKTTL
FT                   LRLIRGELTPDRGHIAISDAGDAGSCRFPYVRDATGTVQDYLDDVLAGPWELLTRFDHV
FT                   TKQLSAAQSSASLAKEYDHILTSLTLADVWSLEARIDEVLAGLGLGQLTGRGRQRALGS
FT                   LSPGQAVRLELAGIIMVRPVTLVLDEPTNHLDDEAVGFLIQQITDWPGPVLMASHNRAF
FT                   IEETATVIYDLDIAPWQALATAEGEAVSGVYRCTGAYSDYLGAKQHARMEHQKLHATQQ
FT                   SEKRAIRSHRRRSEDIARGGVKLAKAQGMARKFFSDRAEKTALRRTRNDDQRLHDLAEH
FT                   EVRKPRNYQLKLNLPPVGSRGGLAVTARSAFIPGRLLPITFDLATGEHLILTGPNGAGK
FT                   TTLLNWLASGKTTIDPRSEASGTISVSGRLAYVPQRLPRTGDSYFHPEHWKDGIRELGT
FT                   GILHPSMWATPVGQLSDGNQRRAQIALAVAQKPEILVIDEPTNYLDLATLEELEDALRQ
FT                   WNGTLIIASHDRWLINHWQGTQIELCPTDPAPGSPNPLLLVKSRFEPW"
FT   gene            complement(148017..148784)
FT                   /locus_tag="HMPREF0675_3128"
FT   CDS_pept        complement(148017..148784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3128"
FT                   /product="hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3128"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00251"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF66"
FT                   /protein_id="ADE00251.1"
FT                   /translation="MKINEGEVPQYYVTSNHEPIIDPVTWDTVQAELARRAGKGTSNTH
FT                   PFANTITCSDCGGRFGRKVWHSTSKYRRYIWRCNNKYNKDHHCATPHVTEDQIKDAFVA
FT                   ALAKRVTGNDVLDDTMRLLDETVYDTRELETKQATLGERIEETITLMNQLITPQPRPPT
FT                   TLTTTTAVTTSLKIGTTNLRPSINGSATRSTICATAEHKQSKYATTLPPNHHSNTPTKP
FT                   GTPSSITPPSTTTALSNSHSRTALPRLEPALNE"
FT   gene            complement(148781..149614)
FT                   /locus_tag="HMPREF0675_3129"
FT   CDS_pept        complement(148781..149614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3129"
FT                   /product="resolvase, N-terminal domain protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift; identified by match to protein family HMM
FT                   PF00239; match to protein family HMM PF07508"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3129"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99005"
FT                   /db_xref="GOA:D4HF67"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF67"
FT                   /protein_id="ADD99005.1"
FT                   /translation="MTTKQIRNKRVTAIPATKIPGHTTVQGTRRRRRVAAYARVSTEME
FT                   EQASSYEAQIDYYTSHIQSRTEWEFAGMYADEGITGTSTKHREGFKTMIADTLAGKIDL
FT                   ILTKSVSRFARNTVDTLIHVRQLKDKGVEVYFEKENIWTLDSKGELLITIMSSLTQEES
FT                   RSISENVTWDHRKRFADGKIMVSYASLLGYKKGEDGNLAIDETQAPTVRRIYARFLEGA
FT                   TPQTIAKEFTSDGIPTPRGKQIWSPSTVRSILANEKYKGDALLQKSFTTDFLTKP"
FT   gene            complement(149611..150813)
FT                   /locus_tag="HMPREF0675_3130"
FT   CDS_pept        complement(149611..150813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3130"
FT                   /product="resolvase, N-terminal domain protein"
FT                   /note="identified by match to protein family HMM PF00239;
FT                   match to protein family HMM PF07508; overlaps another CDS
FT                   with the same product name"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3130"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99241"
FT                   /db_xref="GOA:D4HF68"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF68"
FT                   /protein_id="ADD99241.1"
FT                   /translation="MTSRSFRVIPPRPATPRRLRVAGYARVSTEHERQLSSIAAQVSYY
FT                   SHLIQSTPGWDYAGVFIDEGITGTSTVRREGFQTMMAAARSGDIDMILTKSISRLTRNT
FT                   VDLLDAVRELKILGVSVRFEREQIDTATADGELLLTLLASFAQEESRSMSKNVKWGIRK
FT                   KYADGLMHSRQPYGYQYVGSDLAIIETEAKIISQLNAEGVKPRRGAKFRGKTIRKWLEN
FT                   EIYTGRVILQKYYRPNVAELNCHTNTGELPRYLVDESHPPIIDQTTFGAVQAELARRRH
FT                   LGRGATPSARTTGLTSRIECSVCSRFYHRRTKTRRHTSYKFWWCETATKGKGNPCQAPQ
FT                   IRETHLTQICTRVLGLDDWDDEYALTRLVKIVVNPDRTLTIHTISGEVPVAVSLDEESA
FT                   I"
FT   gene            complement(150870..151058)
FT                   /locus_tag="HMPREF0675_3131"
FT   CDS_pept        complement(150870..151058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3131"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3131"
FT                   /db_xref="EnsemblGenomes-Tr:ADD98911"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF69"
FT                   /protein_id="ADD98911.1"
FT                   /translation="MTGAMFNAEVDLARQVAFIDRLTETGALTPNESHVILTRIGHEAT
FT                   APVGALLLQVRLDKTQV"
FT   gene            complement(151214..151462)
FT                   /locus_tag="HMPREF0675_3132"
FT   CDS_pept        complement(151214..151462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3132"
FT                   /product="hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   premature stop"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3132"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99070"
FT                   /db_xref="GOA:D4HF70"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF70"
FT                   /protein_id="ADD99070.1"
FT                   /translation="MAREITRERVVELRCRGASYGQIATRLGMSRNTVKSICRRADINI
FT                   DPAVDVEPAKACEHCNGHFEAAVAGQRFCSDVCRLSW"
FT   gene            complement(151631..152230)
FT                   /locus_tag="HMPREF0675_3133"
FT   CDS_pept        complement(151631..152230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3133"
FT                   /product="Cpl-7 lysozyme C-terminal domain protein"
FT                   /note="identified by match to protein family HMM PF01510;
FT                   match to protein family HMM PF08230"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3133"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99701"
FT                   /db_xref="GOA:D4HF71"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR013168"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF71"
FT                   /protein_id="ADD99701.1"
FT                   /translation="MIIHHNAGNLTIKGCWDVWQTRPASAHYQVETSGRIGQLVWDRDT
FT                   AWHAGNWAANTTSIGIEHADASSNPWKISDACLDNGAHLVAAICRYYKLGRPTWGKNVF
FT                   GHKNFSATECPASLAGTQHAAYMARAQYWYDHMTGNTPAPAPAPKPAPTPKPAPNIDAL
FT                   ADAVIRGEYGNGNERRRRLGSNYDAVQRRVNEKLRH"
FT   gene            complement(152260..152335)
FT                   /locus_tag="HMPREF0675_3134"
FT   tRNA            complement(152260..152335)
FT                   /locus_tag="HMPREF0675_3134"
FT                   /product="tRNA-Ala"
FT   gene            complement(152475..153848)
FT                   /locus_tag="HMPREF0675_3135"
FT   CDS_pept        complement(152475..153848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3135"
FT                   /product="peptidase M16 inactive domain protein"
FT                   /EC_number="3.4.24.-"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift; identified by match to protein family HMM
FT                   PF00675; match to protein family HMM PF05193"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3135"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01257"
FT                   /db_xref="GOA:D4HF72"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF72"
FT                   /protein_id="ADE01257.1"
FT                   /translation="MKTCNERPLTSRPTVRPGSPWSFPQCLVETLPTGLTVVRVPMPGQ
FT                   RIVTMEIGLEAPLCAEPAGLEGLAGLVVRTADESTGPHPGAAFAEAMESIGASYDGSAG
FT                   LAGSHVGVDVPVTRFDAAAELFVELLNTTSLVEEDIARQIDAARASLAQTSQRGSSLAE
FT                   MAAARALWPVGSRSSLPTIGTLSSVEKLNAAAAREFWAAHWTISDAVLVVAGEGVEDLD
FT                   LSIFKEWTTSGSPSQVAPLQPRLDGPRVILVDRPDAVQADVRIQQATVGRSHPGWAALK
FT                   VACGALGGTFGSRLNQVLREDKGWSYGVGMSSRPLPDGGVATVAGSFRTEVGADAVAEA
FT                   LRILTSSDDLRADEVDAARDHSVGIAPLQYDTAGTVAHQVAALVGAGLAPNWVDDHLAA
FT                   VASARASAGEWSVNRAWRELLIPDSWRIGICGQAEELAPALAERGLEAVIVSPAEVLS"
FT   gene            complement(153848..155119)
FT                   /locus_tag="HMPREF0675_3136"
FT   CDS_pept        complement(153848..155119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3136"
FT                   /product="peptidase M16 inactive domain protein"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF00675;
FT                   match to protein family HMM PF05193; overlaps another CDS
FT                   with the same product name"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3136"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99240"
FT                   /db_xref="GOA:D4HF73"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF73"
FT                   /protein_id="ADD99240.1"
FT                   /translation="MLGPMSEALQLHRATLDNGMRVVVNPDTTSPGVAVNMWYRVGSAD
FT                   EEPGHFGFAHLFEHLMFSGTTSGIASSEHLATIESVGGSANASTSFDRTNYFETVPAGA
FT                   LELALWLEAERLAHLAVTEANLATQREVVKEEKRQRYDNTPYGDLFDLLLDGRFGGEHP
FT                   YGHPTIGSVPDLDAACLDDVTAFHSTWYRPDNAVLVISGCVQADEGLTLADKYLGAVPA
FT                   ATGDLPERIQGRVRHDNPRVVVTRPLPRTAVTRAWATPPITNPDNLTVAMATDILGSGM
FT                   SSRLIRTLERERHLVDGVGMNDFGLARGASAALVSAHLKPGVSEEELTGAVDEIITELA
FT                   ANGPSQAELERARAQVERSWLESLAVVDERADLLNMHESLLGDAALVNTHLDRIRAITA
FT                   DHIAEAARRWLSPHQASTVVHQEA"
FT   gene            155183..155302
FT                   /locus_tag="HMPREF0675_3137"
FT   CDS_pept        155183..155302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3137"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3137"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00835"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF74"
FT                   /protein_id="ADE00835.1"
FT                   /translation="MSVGVVTLTSPTLIATRGSKHVRRILRERTVEHWCCEVV"
FT   gene            155223..155744
FT                   /locus_tag="HMPREF0675_3138"
FT   CDS_pept        155223..155744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3138"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99186"
FT                   /db_xref="InterPro:IPR035169"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF75"
FT                   /protein_id="ADD99186.1"
FT                   /translation="MPHGARSTCGGFFENAPSNTGAAKSSEQRRTLEGMQTQRNVVSHA
FT                   LQRRHTLEALRSPQVDLSAPTACDADPMLVRAAMHHGEPLNHDCPVCESPRLALLRHAF
FT                   GHQLGQYSGRIRTLDELEEMEHQFGEFHVYEVEVCPDCLWNHILVDYVLGDGRRRRPPR
FT                   HQPTVEDIYG"
FT   gene            155737..158082
FT                   /locus_tag="HMPREF0675_3139"
FT   CDS_pept        155737..158082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3139"
FT                   /product="transglycosylase"
FT                   /note="identified by match to protein family HMM PF00905;
FT                   match to protein family HMM PF00912"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3139"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00418"
FT                   /db_xref="GOA:D4HF76"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF76"
FT                   /protein_id="ADE00418.1"
FT                   /translation="MADHKPARASKRHAPATGGGAGRARRAAGRPSRHPRLGKFLRGLV
FT                   IAILSLVLIAVVGVFVAYERTELPDPNRDFQTNTSFIYYRDGSRLGSFSVQNRQSIPYE
FT                   TMPKTLRDAVVSAENRTFWSDPGISVKGMTRAAWAIARGGEMQGGSTITQQYIKVLYLS
FT                   QERTMGRKFKELLLAVKTGKEVSKKDILAGYLNTIYFGRGAYGVQAAARAFFYTDASKL
FT                   TLSQSAVLAAVLNSPSNFDPSGGVGARERLLQRYRYVLDGMLEAGNITQAQHDEAYRQL
FT                   PKFPKVPDYNRWAGTDGYLMKLVYDELIARGFSDQQIKGGGLKVTTTLDRKDQQAAVAA
FT                   GQKYKKIAGRNAGPEGAKNLHPALASVDVSSGGVLALYGGDDYISNTRDWALTARPAAS
FT                   TFKTYAAIAGMRHGFSLRSRLEGNAFTPDGDSTEVHNENDRNYGTVSLRQAIAKSINTA
FT                   FVDMVSRIKNGPRAVVQAATDAGLSQGTGWDLNNRIALGTAEVGPLAQAGGYATIANDG
FT                   KRVTPHIVDKVVDQSGKVLYQAPTPSKQTIEADISHDVSYALQSVVEEGTGRIVAGFDH
FT                   HVAGKTGTSGVGHGVTSAWFVAYTKQISTAVMFVAGDSGNENLNRYAREGATGFHGGDY
FT                   PARTWLDYMQTAMRGMPNKSFAAPDWVNLSGKHYGSTNRPQVSVEDDSDRDRSNQNDPE
FT                   SLGRPSPTPTRTSASSPEPSSAPSREQSSEPSATRTASAHTHTSKPTQTSQPAHTSRPT
FT                   HTSTHTSRPTSGETTHGGNQLSGRAQNG"
FT   gene            158092..159639
FT                   /locus_tag="HMPREF0675_3140"
FT   CDS_pept        158092..159639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3140"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00248"
FT                   /db_xref="GOA:D4HF77"
FT                   /db_xref="InterPro:IPR016570"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF77"
FT                   /protein_id="ADE00248.1"
FT                   /translation="MTIPDPKDDAMAARRCAVAHPNDGSPGYTARRGLDFPRGSRVSQL
FT                   GLDRRIGGRMGRHAWPRGVFFDPGPWAIMSAIVVWLLTIYRVTPCVQHDVAKAVDPYQR
FT                   QCYSDIPTLYRSSGMGHGGSLFANPDIAQTPLVTVLMAFCRRVVWAFGAEVSPKATDQQ
FT                   VLDAANAYWGVAQIVLFVAFLAVAISVMLLGRGSDTNLPVDDKGRPTQARRRSWDVFWV
FT                   VLCPAVYLAGLIDFSMVPVALATTSMLAWARRRPWLAGILMGLACAGSLQAAVVAFAVL
FT                   VCCLRATRLPELGRYLLAGSLVLVVCHVIAVCLGLHTWWAYLRSTFWSGTGLGTIWYVI
FT                   QDSSGGTIPGIGWITGTLTVGGLLGLAWLSMTVPRRPRIAQVACVALLILFITNKVYSP
FT                   QWMLFLVPLAALARPDLRDWAVLMVGECFYSLAVWAHLGGLSLPGGSDADVVYWASVVL
FT                   RLACEMWFAWGVLDDIRRPWNDVVRVGYADDPTGGVLDHAPDPAPEPVEDSSAEVAR"
FT   gene            159636..160811
FT                   /locus_tag="HMPREF0675_3141"
FT   CDS_pept        159636..160811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3141"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01256"
FT                   /db_xref="GOA:D4HF78"
FT                   /db_xref="InterPro:IPR007315"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF78"
FT                   /protein_id="ADE01256.1"
FT                   /translation="MTRTGRATARRFAPTADGRLVAQTWLGSRAILLVVAVVVMTGYHR
FT                   TFSQVTGNWDVQHYMSIARNGYADPLEMAFFPGLPALLKGGSFLGTPMEVTGVLLGLIG
FT                   SALAAWALFRIGGMLPACLWLIAPATVFTMVGYTEAPFCAAAFWAWERARAGRWWAAAL
FT                   LAGLACTFRVSGLFLIGALAVLAVLGDRDEGRPTSQAARRRRLIDVVNRLSTLLVPTAV
FT                   LVAFVVWLHRLTGSWTAWSQAQTNGWRRGFTTPAETLRHTLPATHADTWRSLYGAGASG
FT                   VAVVFRLELVSVALGVLVFVYCLVRQRWASASWVGIQVVAFSIGYWYMSVNRATLLWFP
FT                   LFVALAEVTRGPSKPPGLVLLWRGIMGIVIAIDLAVMVWWGWRFFTGGWAS"
FT   gene            160808..162145
FT                   /locus_tag="HMPREF0675_3142"
FT   CDS_pept        160808..162145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3142"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99998"
FT                   /db_xref="GOA:D4HF79"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF79"
FT                   /protein_id="ADD99998.1"
FT                   /translation="MRRTAFIGPGRYQQAIGSLTSWGLVALVVVEAFADFRHGLTSPPW
FT                   IVSSYLIVDVLIILACGPALWLRRHDLGRAGRWMLGGALGFMVWAIVSASFCPLPNLGP
FT                   GPVARLLLVMAPVTAVATLLAGLSVAAGLTIRSSGRMVIERLWWPAAAMTCVSYLQWPR
FT                   AMKVHGSTRLATGMGGSAVLHVALLLACGVLVAAAVAGCRRVASGILATGALVAVILTG
FT                   SRAGLACATLFVLGCAIGLVVWRRSRVVRRAGHRRMVWGALVALAVVVIGMVIVVPGLR
FT                   RMLNPSDPMRSRTLRTGIQVWSSDLNHVFFGLGSGRLWPWYLYDCHARQEPWRELMTTQ
FT                   WGPTLSSAHSTVLAVLVELGLLGFVLLLPVLLGPVVELVRRLFDGTGSPAEVVLRWAVV
FT                   ATLPAFLVDTYLVKNFGVSMWWWVVTLSSVAWTDQRPPSTSRQNSG"
FT   gene            complement(162106..163368)
FT                   /locus_tag="HMPREF0675_3143"
FT   CDS_pept        complement(162106..163368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3143"
FT                   /product="glycosyltransferase, group 1 family protein"
FT                   /EC_number="2.4.-.-"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3143"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00304"
FT                   /db_xref="GOA:D4HF80"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF80"
FT                   /protein_id="ADE00304.1"
FT                   /translation="MAHRESTLILLTNTYPLSCGEEFLENEIDHVGRAFDQVVIIPIQA
FT                   GPADVQTRAIPSNAQVMHIARSSPRGLDRALAAVKGLVRLPPSGVDWAATRRQPRLLVS
FT                   DAHFEACAQTALDSILAKLPNLRLTSESHVTIYSFWLHITARTATLLAEQLRAQGVTVD
FT                   RVISRAHRYDLYPSVAPRHHIPERRLLLQSLDGICPVSEQGTRELQTTWPQYAGKIHTR
FT                   YLGTSDPGPTAHCRRDPFTIVSCAHLVPVKRMIRMPAILARVRASGIDARWTHLGDGPQ
FT                   MDTLREEVTVHRVTDAVTLLGHVDNTQVMATQRDLKPSVFVNLSSSEGLPVSMMEVASL
FT                   GIPIIATGVGGVGEIVSSDNGHLLPAEFTDAQASDALVQLARLSEDEYQQVCQASRQVW
FT                   EEKFRASVVYPEFCREVLGGR"
FT   gene            163636..164763
FT                   /locus_tag="HMPREF0675_3144"
FT   CDS_pept        163636..164763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3144"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01045"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF81"
FT                   /protein_id="ADE01045.1"
FT                   /translation="MPQTGADREVRRCIYHVPYPLDPSTTFGGQKRAVAMLKALTQWGE
FT                   VWVVAGDARQRRRQIQVVMNAIRAGTRFEFCYSESSTMPTTLTEPHHLPTHPLEDFAFL
FT                   TRLRRHGIPVGLFYRDVYWKFPLYGEGVPKAKQLVAQAMYRYDLLAYRQCLDVLFLPSL
FT                   RMGEWVDVGDRVKKVALPPGHDIDETPTATPPSPLSMFYVGGLGSLYDLRAFCEAVASV
FT                   PEASLTICTRPKEWEQARKDYEPLMGNNIKVVHANGKKELEPYFAAANVAVLAMAPHEY
FT                   RDFAAPLKLFEYIGNGKPIIATEGTFVGDVVTRDELGWTVQASVNEFAALLEQLTQHPE
FT                   RVDEACDRVMAARDQHTWAARVEELVTALAAVDQR"
FT   gene            164760..166082
FT                   /locus_tag="HMPREF0675_3145"
FT   CDS_pept        164760..166082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3145"
FT                   /product="O-antigen polymerase"
FT                   /note="identified by match to protein family HMM PF04932"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3145"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00485"
FT                   /db_xref="GOA:D4HF82"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF82"
FT                   /protein_id="ADE00485.1"
FT                   /translation="MSVAERTAARPLDRQEMASRATSGVWLGAVAAVLVMRLPMGFLLF
FT                   LIVPWVILAVQTRFASSLRVTPLVAVEVCCMVASGMAVVLFHPGLLTDTGNSAFIMLAV
FT                   IGVTLVVFRSAEPGRTARQVLSGLYWGAILVWLIGMGEIVTGVKLLPLLYPRANTLGAV
FT                   SKNRWVVTATYPNYNDYGVVMAMLFTAVLARLWFNPRRGAIRLGRLFVLATCLVMILIG
FT                   GSRGALFGCICAVMLLFVLNVRRLHTAAIGVRAFVWGGALVIVLGTGLWMSPYVQDHST
FT                   AERGTIMANALSMTLSNPAALLLGYGSLSEYQARASALYGHVLMDPHNLLLEIVLRYGA
FT                   IAMILFVVCWLWILVRGFLPRRPVADWQAAFGLTVVMLFPVLGVVPSSTLRYHVTWLYL
FT                   VAASSITAETVAANSASAGRPTLSPEAVTQTERSAGGPGAA"
FT   gene            complement(166056..166832)
FT                   /locus_tag="HMPREF0675_3146"
FT   CDS_pept        complement(166056..166832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3146"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00954"
FT                   /db_xref="GOA:D4HF83"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF83"
FT                   /protein_id="ADE00954.1"
FT                   /translation="MSSLPSEPTVAQSGSSAIEREGTTDSSTQPPRPRNPGQPIDLLGF
FT                   LKGLGHHWLAGLITFIVAAGLLVGYSLLMAPRNTVGTVAAHAHVMVTLPEPRTEAQATV
FT                   ESATVDQIMSNYVALTTPDPIVNAAVKYLHDGTTADDLKAGASVYWGGGGTVIAVYAMG
FT                   TNQNQAIERANAYARAFAEKANDLVPSSLASLPQPKLTIVQPAFPSDPNPNAPATNKNS
FT                   TKLSSPMVGVAAGLILGLVVMGVLEYRSSRRSRASR"
FT   gene            167006..167623
FT                   /locus_tag="HMPREF0675_3147"
FT   CDS_pept        167006..167623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3147"
FT                   /product="bacterial transferase hexapeptide repeat protein"
FT                   /note="identified by match to protein family HMM PF00132"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3147"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99910"
FT                   /db_xref="GOA:D4HF84"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF84"
FT                   /protein_id="ADD99910.1"
FT                   /translation="MGEPRIIDTADLDDGVTIGDGSSIWHLSQVRSEAVLGQNVVVGRG
FT                   AYIGEGVHVGDNCKIQNYALVYEPAKLEDGVFIGPAVVLTNDHFPRAINPDGSLKSADD
FT                   WEQVGVTCKRGCSVGARSVCIAPVTIGEWATVAAGSVVTKDVPAYALVAGVPARRIKWV
FT                   GRSGFPLDPDGENKWIDSRTGDRFIEDPATDTLTLVSEGEQA"
FT   gene            167707..168819
FT                   /locus_tag="HMPREF0675_3148"
FT   CDS_pept        167707..168819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3148"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01041;
FT                   match to protein family HMM PF01053"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3148"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99434"
FT                   /db_xref="GOA:D4HF85"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF85"
FT                   /protein_id="ADD99434.1"
FT                   /translation="MTAQFIPPAKPILGDDERKAVDEVIASGMVAQGPQVHAFEDEFSS
FT                   QVVDGVHCVAVNSGTSALHIGLLASGIGEGDEVIVPSFTFAATGNSVALSGAKPVFADV
FT                   DPVTFTLDPASIEASITDKTAAIMPVHLYGLPANMAEIVAIATKHGLKIFEDCAQAHAA
FT                   SIDGKHVGTFGTFGAFSFYPTKNMTSGEGGMITTSDPEIARKAAMLRNQGMEKRYANEY
FT                   VGLNNRMTDIHASIGRVQLTKLAGWTKTRQENAAFLSSNITEAITPAVPEGYVHVYHQY
FT                   TIRLEGATGEERDRFVTALKEEHQVGSGVYYPIPNHRLPSLAPYAPGLELPNTEKVAAE
FT                   CVSLPVHPSLSQADRERIVAAVNTCAKAGA"
FT   gene            168819..169811
FT                   /locus_tag="HMPREF0675_3149"
FT   CDS_pept        168819..169811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3149"
FT                   /product="oxidoreductase, NAD-binding domain protein"
FT                   /note="identified by match to protein family HMM PF01408;
FT                   match to protein family HMM PF02894"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3149"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00679"
FT                   /db_xref="GOA:D4HF86"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF86"
FT                   /protein_id="ADE00679.1"
FT                   /translation="MANLRAGMVGIGSMGKNHVRNLRAIDGVDLVAIADASGKDPFGVA
FT                   GDLPVLPDVDAVIETGIDYCVVAAPTKFHEEIGLKLAEAGVHALIEKPLAYDTAAATRL
FT                   AEAFESKGLVGAVGHIERYNPALQSLRKRLENGDLGDLYQVATRRQGPFPARIADVGVV
FT                   KDLASHDIDLTAWVTQRQFELVAARTMFKAGRDYEDMVSATCQLSGGLMSNHLVNWLTP
FT                   TKERRTFVTGEKGMFVADTLTADLTFYSNAKVATVWDDIANFRGVAEGDVTRFAIPKPE
FT                   PLRTEHENFRDAVLGKESDIVTMTQGATVVQVCEAMITSAATGEFVKIS"
FT   gene            169913..171295
FT                   /locus_tag="HMPREF0675_3150"
FT   CDS_pept        169913..171295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3150"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00180"
FT                   /db_xref="GOA:D4HF87"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF87"
FT                   /protein_id="ADE00180.1"
FT                   /translation="MTPIFRLHDSPDGSSAVTLLRSVAPIQWFSGAAEVIVACLFVTCT
FT                   FVTVAQPVFDNGACQLMLPLFAVAALVLEALCIVRDVRGVPSPREWSRSLTIVTCSFVA
FT                   LLVWAAVSIPFHEHLIYDDSMGVTRDLPLYALVMPLAEATVTLLVAIFACRMIAVGNLE
FT                   GALWRLSMLMAIANPIDLVREYVEGNTTGWRVATRLGGAAICHVLLILALAVAVDAVIR
FT                   HRHRILSSVAAVSHLGCLAASGSRAGTISLALFVIGLVFFGRSYRTRSRKQRTVIAMLG
FT                   LLTAGVAIWLVSTVRSGSLVDPARARTWALAGRVVVDSPSHFLVGTGYGTIWPWFAVES
FT                   TFMPESSHGMRQTLYGYSLPHAHSLIAQVVGELGVIGLALILVCLGTVIAVCVKGIRGG
FT                   YPLLSLGVLATMPAFLMDTYLIKNFPVALFWWIFTLALCRLVTTGDADVEGDSGYREEK
FT                   YA"
FT   gene            171499..173076
FT                   /locus_tag="HMPREF0675_3151"
FT   CDS_pept        171499..173076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3151"
FT                   /product="amino acid/peptide transporter"
FT                   /note="identified by match to protein family HMM PF00854;
FT                   match to protein family HMM PF07690; match to protein
FT                   family HMM TIGR00924"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3151"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00192"
FT                   /db_xref="GOA:D4HF88"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR005279"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF88"
FT                   /protein_id="ADE00192.1"
FT                   /translation="MSLEPLDVDAEGVAAATKARGFRPKHLVTGPSRDDKSFLGHPGGL
FT                   PWMLQVEMWERFSWYGMRAILVYFITDTLAHGGLGLPINAGQVVMASYGAAVLLMTIPG
FT                   GIFADRILGPWMSTLCGGLIIMTGHVILAIPQVVTSWIGLICIAIGTGFIKPNLSTVVG
FT                   GLYDDGDPRRDQGFLYFYMSINIGSLFAPIVTGLLKDHYGYHVGFIAAAIGMALGLIAF
FT                   FHGRSKLREFAFDIPNPLAPGEGRRMVLRALGIAVVGAVLAIGFKALLGEWTSAIAYAL
FT                   FAFASVTALSYFLTMFRSPKVSDRERGHLWAFVPLWVGQVLFTMIFEQAAGKMATFAKD
FT                   NTDGHIVGSWSVEPEQYQTINPAAVLILAGLLGMWFRRREGKFPNTPQKFAISVFIIGI
FT                   TALIMGFGFRSWPGGNRLAPWWFLAVVFVIQTVAELFMNPIGLSTATKLAPKKFASQNM
FT                   TLWLLASACGQGLASVTIERTKNLGDVVFYYSLGIVTILVAVVLFVIAPWTQAKMKDVD
FT                   SVAEEGDA"
FT   gene            173125..174504
FT                   /locus_tag="HMPREF0675_3152"
FT   CDS_pept        173125..174504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3152"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3152"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99811"
FT                   /db_xref="GOA:D4HF89"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF89"
FT                   /protein_id="ADD99811.1"
FT                   /translation="MPCQGVYAWCGNPVSGGDGCHPSWQDMPLRADMPYEAWPSAKSSL
FT                   EPSKRQGRQVTLVGVCIVSTMNPILGADMTTYQYLIVGGGMAADSAARGIRDIDKKGSI
FT                   AILSADVDAPYPRPALSKKLWTDPEFTWDQADLATVGDTGAELRLGTEVLSIDRDGKTV
FT                   LTASGQVFGYQKLLLVTGLTPSRIDDDGDAVLYFRSARDYQQLRALAQPGHQFVVVGGG
FT                   YIGAELAAGLVQQGCEVALVTPDPTLGGSQFPAQVASEYQKLFADAGVHLVTGKRVCSV
FT                   RKHEAAEVTLDDGTILQADDVIAGLGASPVTKLAEEAGLTVNDGVIVDEQLRTNDPAIW
FT                   AAGDIANYPDPVLGRTRVEHVDNAIAMGKAAGRIMAGSKDSYTHTPMMYSQIFGVRWEA
FT                   VGTLDSSLATTSVEAGDGQVVYYLSDGKPVGVLLWNLPGRTDKAGTVLADPPEDLSTAI
FT                   S"
FT   gene            174520..175320
FT                   /locus_tag="HMPREF0675_3153"
FT   CDS_pept        174520..175320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3153"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family protein"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3153"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99465"
FT                   /db_xref="GOA:D4HF90"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF90"
FT                   /protein_id="ADD99465.1"
FT                   /translation="MDLGLNGRTALITGADSGIGWHTAKLLLAEGAKVAITDLDSDELT
FT                   QAAQALDVADDRLVALPADVTDADSLAKLHQQVKDALGPIDILVQSAGVTGAQGKFHEI
FT                   DEEGWRSTLDIDLMGPVRVLREFLDDLRTGGWGRVVLLASEDGVQPYDDEIPYCAAKAG
FT                   VLALAKGLSRTYAREGLLVNAVSPAFIHTPMTDAMMNKRSKELGVSFDEAIESFLDQER
FT                   PYMELKRRGEPEEVAAVIAFLCSDKASFVNGSNYRVDSGSVATF"
FT   gene            complement(175384..175641)
FT                   /locus_tag="HMPREF0675_3154"
FT   CDS_pept        complement(175384..175641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3154"
FT                   /product="phosphocarrier, HPr family"
FT                   /note="identified by match to protein family HMM PF00381;
FT                   match to protein family HMM TIGR01003"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3154"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01183"
FT                   /db_xref="GOA:D4HF91"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF91"
FT                   /protein_id="ADE01183.1"
FT                   /translation="MASKTVKVGSSVGLHARPAAVISQEAAKLSSTVTLAAEGGEPIDA
FT                   KSVLLIMTLGASAGDPVTVAGDNEDDVNTIADLVASNLDA"
FT   gene            complement(175677..177689)
FT                   /locus_tag="HMPREF0675_3155"
FT   CDS_pept        complement(175677..177689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3155"
FT                   /product="putative ATP synthase F0, A subunit"
FT                   /note="identified by match to protein family HMM PF00359;
FT                   match to protein family HMM PF02378; match to protein
FT                   family HMM PF02379; match to protein family HMM TIGR00829;
FT                   match to protein family HMM TIGR00848; match to protein
FT                   family HMM TIGR01427"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3155"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99558"
FT                   /db_xref="GOA:D4HF92"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF92"
FT                   /protein_id="ADD99558.1"
FT                   /translation="MSTPLITPELVSLDANLGSTKTEVITSVAGLIAAAGRADADGLAH
FT                   DALDRESKSPTGMPGGFAIPHCRSAAVSQVSLGFARLSPAVDFNGPDGPADLIFMIAAS
FT                   EDGGADHMKLLTKLARALVNPEFVEQLRQAPDAQTVVDLIGGVVEPKEEASTSSATALP
FT                   APGHAAVTNAASDTPRIVAITACPTGIAHTYMAADYLRAAGKKLGVDVKVEPQGSTATE
FT                   PLSTDDIEGADAVIFATDVGVKGRERFAGKPVIESGVKRAVDEPEKMISEAVAASKDPH
FT                   AHRVPAGHGEQQEPEQAGSHIGWGKRIQQALMTGVSYMIPFVAAGGLLIALGFLFGGYE
FT                   IAKDGMDIALHNTFSNLPTPTAHALGGSATMTYIGAVLFAVGQAAFGFLLPALAGYIGF
FT                   GLADRPGIAPGFVAGAVAGVTGAGFIGAIIGGLLGGFVAYWFTRLNPPRWLRGLMPVVI
FT                   IPLVGSLVAGGLMYVVLGRPLAALTNALNNWLGGMSGASAVILGIVLGLMMCSDLGGPI
FT                   NKAAYLFATTNLAVTNVGSLKVMAAVMAAGMVPPLAMALSTTLRPKLYQPAERENGTAA
FT                   WLLGASFISEGAIPFAAADPLRVIPSMMVGGAITGALSMALGAASKAPHGGIFVFFAID
FT                   RVWAFILAIVVGTLVAALLVTALKASARRKAAAAA"
FT   gene            complement(177699..178649)
FT                   /gene="pfkB"
FT                   /locus_tag="HMPREF0675_3156"
FT   CDS_pept        complement(177699..178649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfkB"
FT                   /locus_tag="HMPREF0675_3156"
FT                   /product="1-phosphofructokinase"
FT                   /EC_number="2.7.1.56"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   premature stop; identified by match to protein family HMM
FT                   PF00294; match to protein family HMM TIGR03168; match to
FT                   protein family HMM TIGR03828"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3156"
FT                   /db_xref="EnsemblGenomes-Tr:ADD98975"
FT                   /db_xref="GOA:D4HF93"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR022463"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF93"
FT                   /protein_id="ADD98975.1"
FT                   /translation="MIVTVTLNPSIDRTAPIAGPLRRGQVNRLGSSTEVAAGKGVNISR
FT                   VLRGAGIETCAVVPAGAKGRLTLGLNHDDIPHQVVPVAAAVRTNLTITEPDGTTTKINE
FT                   PGADLSPEELTAVEEAIVEKSSGAQWVVLSGSLPPGVPTHWYATMTDRLHEIGVKVAVD
FT                   TSDQPLQELAARLPDCAPDLVKPNSVELGQLCGIDGDSLESAATRGQFDDVVVAARGLH
FT                   GIAEVIVTLGGTGALLITEHDAWHARPEPVEVKSTVGAGDSSLAGFLLARTRGDQPENC
FT                   LRAAVAWGTAAAALPGSTMPTPSQADAIHVSLTHL"
FT   gene            178803..178988
FT                   /locus_tag="HMPREF0675_3157"
FT   CDS_pept        178803..178988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3157"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00229"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF94"
FT                   /protein_id="ADE00229.1"
FT                   /translation="MWQSGLRRGVLPWAMVADAIITQISTPRGGAYRSGVRGVRCDALQ
FT                   QIRGLCRWLPEADVRR"
FT   gene            complement(178978..179739)
FT                   /locus_tag="HMPREF0675_3158"
FT   CDS_pept        complement(178978..179739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3158"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="identified by match to protein family HMM PF00455;
FT                   match to protein family HMM PF08220"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3158"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00904"
FT                   /db_xref="GOA:D4HF95"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF95"
FT                   /protein_id="ADE00904.1"
FT                   /translation="MYPAERHKWLIDTARETGRVSVAEASTALGVVPETIRRDLDQLCN
FT                   QKMLRRVHGGAIPIEFDLLGDQPLATRDSSAVTQKEQIARAALSHLPSDKGSIILDAGS
FT                   TTGRLASIMPSTRRFTVFTNSSPIASTVATHSNCDVHLLGGRLRPTTQATVGNVDAISR
FT                   LRVDVAFMGTNGISPTHGLSTPDADEVATKAAMVASAHHVVVLADSRKMGAESTMRFAE
FT                   LGDVDVIITDSGVTPHQVDMLHKAGVEIVIA"
FT   gene            179904..181202
FT                   /locus_tag="HMPREF0675_3159"
FT   CDS_pept        179904..181202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3159"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00984;
FT                   match to protein family HMM PF03721; match to protein
FT                   family HMM TIGR03026"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3159"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99858"
FT                   /db_xref="GOA:D4HF96"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF96"
FT                   /protein_id="ADD99858.1"
FT                   /translation="MKIAVVAMGKIGLPLAVQFAEKGHDVIGVDVQQRVVDEINKGNEP
FT                   FPGEAFLDEKLKKLVPAGKLTATTDYSQAIPGADAIVLVVPLFVNDETWEPDFGWMENA
FT                   TKSLAEHLTPGTLISYETTLPVGTTRNRWKPMIEEISGLSEGKDFHLVFSPERVLTGRV
FT                   FADLRRYPKLVGGLNDEGTAKGIDFYQQVLDFDDRDDLPRANGVWDMGTAEAAEMAKLA
FT                   ETTYRDVNIGLANQFGKYAAANGIDVYKVIDACNSQPYSHIHRPGIAVGGHCIPVYPRL
FT                   YLWTDPDATIVRTAREANMTMPQYCVDQAASVLGDLSGKKIVVLGASYRGKVKETAFSG
FT                   VFPTVDILAKAGADVSVHDPMFTDEELGKFGFKAYHIGDPVDGALLQADHPEYAELTPA
FT                   DLPGIKVLVDGRHVVDPAVWGDVEVIVVGDGEA"
FT   gene            181186..182445
FT                   /locus_tag="HMPREF0675_3160"
FT   CDS_pept        181186..182445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3160"
FT                   /product="O-antigen polymerase"
FT                   /note="identified by match to protein family HMM PF04932"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3160"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99216"
FT                   /db_xref="GOA:D4HF97"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF97"
FT                   /protein_id="ADD99216.1"
FT                   /translation="MTGRPEYSGSFLDKIVEGLLVLLPPAALLGPWAGSGRVFGYRILV
FT                   VLLVGCAVTGWIYPIWVRRFSRAACAIVVVAVAWAVTGVVGAMRLGPRRDLSSLMGAGL
FT                   ALAGAWSVARLISDRHIRRERALRDVAIGWAVAVWVGAPLAVWEILTARHLGTYADGAW
FT                   RNHPGLYRQPATWLTNPNLYAVFLAVGSVWVGVVGVRSATRWVRIAAIATAVTGLGLLL
FT                   ATDSRIVYAALLLAVMVRLWAVRRWRWVLPGVVMAVVVVIVVTHLHQAGLVWHRFIGVL
FT                   IHHNDEGPSSFAVRTTLLAWGLALVMEYPLLGAGPGGYRANILAAPKRWFPHGKSDPHN
FT                   GILEIASQYGLVVTALVAVCWCLAIGRCWRSRRWWGAALITAMPVLSLANSTYLVQSVN
FT                   QLGWLVCVLAASSSRQETPQ"
FT   gene            182564..183679
FT                   /locus_tag="HMPREF0675_3161"
FT   CDS_pept        182564..183679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3161"
FT                   /product="glycosyltransferase, group 1 family protein"
FT                   /EC_number="2.4.-.-"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3161"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99074"
FT                   /db_xref="GOA:D4HF98"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF98"
FT                   /protein_id="ADD99074.1"
FT                   /translation="MRILIVGAASSIHTVRWVNGLVKRGHEVHLASVHPVGRHSIDSRV
FT                   RIHLAPHGGKAKYVVNAGWLRSVAAGVQPDIVNVHYATGYGLLARLAHIDAPTLLSVWG
FT                   SDVYDSPRANPLMRHMVRSNLVSATRIASTSHCMARVTRDLVNKPISITPFGVDTEILT
FT                   PPDRRRDANDGDGVVCIGTIKALHSKYGIGELIRAFSRVHDERPNTVLHIWGGGPDENP
FT                   LKVLARRLVPDGSVEFRGAIDHSEVRDALGSLDIFAALSTLDSESFGVAIIEAGACGLP
FT                   AVVSDADGPAEVVEDGVTGLIVPRGDVIASATALMQLVDDVELRRRMGGAGRHHVVETY
FT                   SWERSLDLMELAYRDTIDDAARQHCSGRHGG"
FT   gene            183777..184850
FT                   /locus_tag="HMPREF0675_3162"
FT   CDS_pept        183777..184850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3162"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="identified by match to protein family HMM PF02350;
FT                   match to protein family HMM TIGR00236"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3162"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01202"
FT                   /db_xref="GOA:D4HF99"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:D4HF99"
FT                   /protein_id="ADE01202.1"
FT                   /translation="MRVVSIVGARPQFVKLAPVAKAFAAEGIDHKIIHTGQHYDVNMSD
FT                   SFFVELGIPNPDLHLGVGGGSHGVMTGRMLEQLDPVLEDMDPDWVLVYGDTNSTIAGTL
FT                   SAVKMHLPVAHLEAGLRSFNRRMPEEHNRVLTDHAADLCLAPTEVAMGHLADEGLASRA
FT                   VLVGDVMTDVCLQVRDSVLANPRPVPGVEAGEEYVMATIHRADNTDDPKRLAHILDALG
FT                   SLDRKVILPVHPRLRARAESDGFTVARGNLTTIDPLAYPDMVNAVTNAAGVITDSGGLQ
FT                   KEAFLLGTICTTVRTETEWVETVENGWNVLDPDAEHLSEYATRPHPESDPGHPYGDGKA
FT                   ARNVATVLLKAGERDRS"
FT   gene            184850..185971
FT                   /locus_tag="HMPREF0675_3163"
FT   CDS_pept        184850..185971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3163"
FT                   /product="glycosyltransferase, group 1 family protein"
FT                   /EC_number="2.4.-.-"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3163"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00429"
FT                   /db_xref="GOA:D4HFA0"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D4HFA0"
FT                   /protein_id="ADE00429.1"
FT                   /translation="MANSSRLGRVVSLSTVHHGHDNRVFNKEAKALVAAGHDYHLVISA
FT                   DRDGIDQGVPVVALHREEGRVRRLVVSQREAWRHLQALQPEVLHIHDPELIPLALVWRW
FT                   RHHCKVIYDAHEDLIGQVDTKPYLGAVTRPLAKMAARGLVGLAERSADAVVAATPTVGE
FT                   RFRRASVTVVRNYPWLGNYTVPPKPVPGQLVYVGDLSEERKLSFMIEVTRTVRKQVPQA
FT                   HLVLAGRVLPRCQETVEHAVAEGFVEHLGLVAPTEVPQVLASAQVGLVFLKPLPNYVAS
FT                   LPTKLFEYMASRVPFAASDFPAWREMFDGYGAGIFVDTEDAAATADALSELLADPQRCR
FT                   EMGCAGRRAVESGLNFESQAEALIDLVAGLLEG"
FT   gene            186194..187141
FT                   /locus_tag="HMPREF0675_3164"
FT   CDS_pept        186194..187141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3164"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99931"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D4HFA1"
FT                   /protein_id="ADD99931.1"
FT                   /translation="MRNLGERLDRRGVARIYRHSYVRGQADRAVARGEAVRILPGVVAA
FT                   SAVARDPRIIIRALLLWHRDIVLVGKAALIMLGMKAPGTTRPMDFYGVKDVEAFSTTRC
FT                   LTRPGIRVRRWHIPHWFITEREQIRIATAEVSVLILAIQGEWGWVCEALRQRVVTPESC
FT                   RQARKSLTGRYPKTKVDAALADICLAAWSIPELEMGRVLRATGITGHKPNHKVRVGDRY
FT                   YYLDRAFEAEKVALEIDGRSVHGTIDGFEATMMRSAHLDRHGWKVLHVTPTMFREDPRF
FT                   VLDWLASHLHRRHRPKIMFTEFALRRIMSGAAPA"
FT   gene            complement(187487..187783)
FT                   /locus_tag="HMPREF0675_3165"
FT   CDS_pept        complement(187487..187783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3165"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99584"
FT                   /db_xref="GOA:D4HFA2"
FT                   /db_xref="UniProtKB/TrEMBL:D4HFA2"
FT                   /protein_id="ADD99584.1"
FT                   /translation="MKKMSKPEVNPEEINKGTLVAVAVAAVAVIGIALKAMRKGPKDRK
FT                   TGSQDPSLFENLATRKPSGGRVTQRRDPRADGHATPMGGTGRVSTAPDFYSYK"
FT   gene            complement(187780..189162)
FT                   /locus_tag="HMPREF0675_3166"
FT   CDS_pept        complement(187780..189162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3166"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF01266; match to protein
FT                   family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3166"
FT                   /db_xref="EnsemblGenomes-Tr:ADD98958"
FT                   /db_xref="GOA:D4HFA3"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D4HFA3"
FT                   /protein_id="ADD98958.1"
FT                   /translation="MGINNLLSDIGLPGLGCKPVLTDSKPRVVIVGAGFGGLAAAEKTA
FT                   EAGCDVTLIDRNPYTTFQPLLYQVATGGLNPGDVTYRLRSFAANNGPHTHFRRACVTGI
FT                   DTENRIVEVDNGDPISYDYLVLSQGVGANFFGTPGAAENSYTIYTRASSLRARDAIFTY
FT                   LEDLDTQRDKTFDVIIVGGGPTGVEMAGTLAEMKSIGIPAIFPDVSTDRVHVTLVEMAN
FT                   HLLMPFDPALRHYTRRQLQKRGVDVRTNTAIAEVREDSVLLKDGQTLPADMVIWAAGVG
FT                   AHKSVTNWGFEQGRGGRIATDGTLLVKGQDRIFAVGDGAINTEDPKPQLAQPAIQGGEC
FT                   VARQIVHLELGEPLEKFEYNDKGTMATIGRNSAVVQLSEKLKFTGIGAWLTWVTVHIFT
FT                   LLGGRNRLQAMINLGARYIAFHREAGAIVGDVLSEEGKENMNKNALRDDDEKGAKPIDG
FT                   KE"
FT   gene            189289..189936
FT                   /locus_tag="HMPREF0675_3167"
FT   CDS_pept        189289..189936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3167"
FT                   /product="hydrolase, NUDIX family"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3167"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00254"
FT                   /db_xref="GOA:D4HFA4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:D4HFA4"
FT                   /protein_id="ADE00254.1"
FT                   /translation="MPHLHTQPHGHDVTISAWILRQFPSDGVRRRQWKALVHKHRKMNL
FT                   WIQPGGHVEHTENPWQALAHELHEETGYSIDQLSVLQPWDRLPDGIHDLMHPTPVLLNT
FT                   HSPYPGHFHSDIVMAMVAHGDPAEKPRPGESQELQWVSPDEFAALPGAEPDAVMIMTMI
FT                   VERVTDSWLAIPATRWSLADAPAEAMTDRSVAEATAPDPLDDRETLGWGTAQ"
FT   gene            189918..191942
FT                   /locus_tag="HMPREF0675_3168"
FT   CDS_pept        189918..191942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3168"
FT                   /product="helicase C-terminal domain protein"
FT                   /note="identified by match to protein family HMM PF00271;
FT                   match to protein family HMM PF04408"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3168"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99887"
FT                   /db_xref="GOA:D4HFA5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4HFA5"
FT                   /protein_id="ADD99887.1"
FT                   /translation="MGDRSVTRNCGPDLVRVGAGLPVAAYRDEITTALHGGRAVIVAPP
FT                   GTGKTTFVPPLVASRCSGRVIVTQPRRVAARAAARRLATLTGTRPGEFASHTVHGESTT
FT                   TRDTKVEFVTTGVLLRRLLSDPDLTGVDAVVLDEVHERHLDADLVVAMVCEVAQLRDDL
FT                   TIVAMSATVDSSGWAAFLGGVEPAPVVEVASALHELEVEWAPAAGAAVESRGVSREFLG
FT                   HLGTVTVDALDRHTEGSALVFVPGAREVDHVVADLRSRLAGIDVVGLSGAMSAREQDHA
FT                   LSDPGNVRRVIVSTAVAESSLTVPGVRLVVDSGLSREPRLDRGRGMTGLVTVRESRASA
FT                   VQRAGRAARLGPGVAVRCLRAQDWAGMNADPTPEVDHADLVASLLSLAVWGSPRGEGMA
FT                   LPTPLPQDRVAAAEEELRDLGAVDAEGRITARGRHLATFPLDPRLARALTDGAAIIGSR
FT                   RCAEIAAMLGLEDGQVDLVGQWRQLRSGRHPEAAMWRREADRLARLINDVPPTDITDDD
FT                   AVATVVSLARPGWIARSRGVGSTSYLLACGTGVDLPRNCPPGLLGQPWLAVARTSRITS
FT                   GALIRAAVPLSESAALESGEAMLTNDTPVTWDGGKVRGRRVSRLGAIELSSTPVRPDPV
FT                   AFGRTVSSTESSGELVDPLTGHSEHTGGVVGAVLLLDPQ"
FT   gene            191997..192431
FT                   /locus_tag="HMPREF0675_3169"
FT   CDS_pept        191997..192431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3169"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99294"
FT                   /db_xref="UniProtKB/TrEMBL:D4H8Y4"
FT                   /protein_id="ADD99294.1"
FT                   /translation="MFFFGTFLPHASRFSLAIQANLDCERVLIGSVLIPRGNDPTGLVC
FT                   DLTQLHRLPDSPESRNLEHPDIRLSRDLTMGDHFVGRLTFYCRVHYFHSFGIFTPARSS
FT                   CARTPTDVSWCPAGIDTRPAPPGRPQISWLPLAFRRRAHP"
FT   gene            complement(193090..193230)
FT                   /locus_tag="HMPREF0675_3170"
FT   CDS_pept        complement(193090..193230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3170"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3170"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99245"
FT                   /db_xref="UniProtKB/TrEMBL:D4H8Y5"
FT                   /protein_id="ADD99245.1"
FT                   /translation="MAMQAAGEFLRTVGGLLFRRALMLWKFGCWFPMPEIPWGAWHLGP
FT                   R"
FT   gene            193966..194262
FT                   /locus_tag="HMPREF0675_3171"
FT   CDS_pept        193966..194262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3171"
FT                   /product="hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3171"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99890"
FT                   /db_xref="GOA:D4H8Y6"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="UniProtKB/TrEMBL:D4H8Y6"
FT                   /protein_id="ADD99890.1"
FT                   /translation="MSDRIRQEDGSYVNGPAIAYDVLAGGSQAVNLVEAAKASGNIRIM
FT                   FAGRYRVTEWRGEQGTRIQHEVRADEVSVSLLGQRVTVERPRGDVASKESTSF"
FT   gene            194340..195134
FT                   /locus_tag="HMPREF0675_3172"
FT   CDS_pept        194340..195134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3172"
FT                   /product="CobQ/CobB/MinD/ParA nucleotide binding domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01656"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3172"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00202"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4H8Y7"
FT                   /protein_id="ADE00202.1"
FT                   /translation="MTAQIFALCNQKGGVGKSTSTFHLARAAVLRGQRVLVVDNDPQGN
FT                   LTSVAAAEPVGEDQAGLADVLSARAPETLRDVIVPGIWSGLDVVPTSGITLGWVRDELV
FT                   IAGAGREGRLREALAGVEDDYDVILIDCAPSLDQLTINGLVAAQGVIVVTHSKLWSANG
FT                   LAQLLDTIDSVRSYYNGALRVAGIIVNQHEENTISGKTWLDELHQAAESRKLTVLDPPI
FT                   PKRVVIADTVEAARGLDEWGSAEAAALGQLYAHHLTCIEGAL"
FT   gene            195134..195505
FT                   /locus_tag="HMPREF0675_3173"
FT   CDS_pept        195134..195505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3173"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3173"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00712"
FT                   /db_xref="InterPro:IPR040851"
FT                   /db_xref="UniProtKB/TrEMBL:D4H8Y8"
FT                   /protein_id="ADE00712.1"
FT                   /translation="MTRPAPRKSSLSGSTPVAPPAQTAPAPSAAPTPHKADESQTSSTT
FT                   RKWRHKVSFYQDPADTDRVRGAILYTMTTEGNRNLSQFVNDAVMAKVVELEVKYNDGQP
FT                   FPAVGARGLPQGGAAAAGE"
FT   gene            complement(195899..196447)
FT                   /locus_tag="HMPREF0675_3174"
FT   CDS_pept        complement(195899..196447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3174"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3174"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00967"
FT                   /db_xref="UniProtKB/TrEMBL:D4H8Y9"
FT                   /protein_id="ADE00967.1"
FT                   /translation="MGPVGLSPADGYPAVIATRLLFTLGGIMARNTFLAHTLLRAVCPP
FT                   PPWAEIIGLSWYDPDTGQASPPDFPEAPGGGHNIHLDILDVTTAPVTVHHIGLDDAERA
FT                   ALALTHDGSLDAPLTHDNPHKRRLARAQLIDDQLHRRAEAATLKARLAAEHADLGYQAR
FT                   RRERREILRAALRTGHHRA"
FT   gene            196561..196800
FT                   /locus_tag="HMPREF0675_3175"
FT   CDS_pept        196561..196800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3175"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3175"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99416"
FT                   /db_xref="UniProtKB/TrEMBL:D4H8Z0"
FT                   /protein_id="ADD99416.1"
FT                   /translation="MVADHDYATPDDEWMTPPQVARVIPNTTAQAVRRWAEEGQLPGAF
FT                   RTPSGRWHIPWSAVVGIMGFDPRESASPSDRHQS"
FT   gene            196858..197103
FT                   /locus_tag="HMPREF0675_3176"
FT   CDS_pept        196858..197103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3176"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3176"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99651"
FT                   /db_xref="UniProtKB/TrEMBL:D4H8Z1"
FT                   /protein_id="ADD99651.1"
FT                   /translation="MEMRDDYIQSWSGYTEGQIQQCWHDEVAPAIDSLMEQVRSVAETP
FT                   VPPGSRFYGDEQWAKPFHPSTAICGSMGPPAITCTR"
FT   gene            197226..197690
FT                   /locus_tag="HMPREF0675_3177"
FT   CDS_pept        197226..197690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3177"
FT                   /product="hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3177"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00462"
FT                   /db_xref="UniProtKB/TrEMBL:D4H8Z2"
FT                   /protein_id="ADE00462.1"
FT                   /translation="MLRALRWYAQDCHDSCRFMDDEQYRDHLLRRIEGTVAAGNLDSRA
FT                   ARKRYRATDVVDEADQLVPGTLRAWRAFSGMAHSRMWASRGLLDMEVLSSGQGMVTAKV
FT                   TSGSAQILWAVVAALNVALSAARLWRDSMCSPFAVAQSVDAMPEAFRRPV"
FT   gene            complement(197958..198482)
FT                   /locus_tag="HMPREF0675_3178"
FT   CDS_pept        complement(197958..198482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3178"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3178"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00704"
FT                   /db_xref="GOA:D4H8Z3"
FT                   /db_xref="UniProtKB/TrEMBL:D4H8Z3"
FT                   /protein_id="ADE00704.1"
FT                   /translation="MHLCLGGVVIAFAIGILGKNGVTRDTVNYIIGFAVLALIMAALPS
FT                   VARELLQRLRCRKVLREMRDHWEEWAPDCWPPTQETHECDRYPKLVKINSLNPDQPVLT
FT                   LKVDPYPSVSVTNPYNLWIREGFQKLSEHLTAQQIVADNNIQLKFEKISATKDGHLFIT
FT                   LTLSITKETSN"
FT   gene            complement(198654..199814)
FT                   /locus_tag="HMPREF0675_3179"
FT   CDS_pept        complement(198654..199814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3179"
FT                   /product="hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain
FT                   one or more premature stops and/or frameshifts"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3179"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99632"
FT                   /db_xref="GOA:D4H8Z4"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4H8Z4"
FT                   /protein_id="ADD99632.1"
FT                   /translation="MVRPAWQPRRADPIISGDPQPTEQNTTDDLDALFTIANLTANPHH
FT                   TAAPAQLTDHIITLANLKGGTGKTPLAVILAQALATTAGHDDIVVVEINPRGTLSTRAP
FT                   RHTDNTVIDLARAARHPGFASQPRDLDPYISWQPEGWATITCLPTITDNHNSLITPPTA
FT                   DDLDRIITALRSRFHVIILDTGNNDLDAAWQHAITIADHIIIPVQWDPDTLTLTQNMVR
FT                   DMNHLGATHLKNRCIWVGTHAPIDLPKRSIKKSFTTALTDAGWTVHTLPADRHIASDGT
FT                   ITWTKLAHHHRQGHPMNHDDPSDDDLFGDTPWKNMPRHQARRHRPDKLLPTLVIILTLA
FT                   LITTLTWATHQTRKEPPHPPRATVTVTVTITASPHSKTPGEPPTQR"
FT   gene            200203..200385
FT                   /locus_tag="HMPREF0675_3180"
FT   CDS_pept        200203..200385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3180"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3180"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00479"
FT                   /db_xref="UniProtKB/TrEMBL:D4H8Z5"
FT                   /protein_id="ADE00479.1"
FT                   /translation="MQITVKTIKDHRVRTVQTAMSSALGIGSQVDMLAPGGSTSSSSGS
FT                   CCSCSTCAVVAQPQD"
FT   gene            complement(200434..201183)
FT                   /locus_tag="HMPREF0675_3181"
FT   CDS_pept        complement(200434..201183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3181"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /note="identified by match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3181"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01014"
FT                   /db_xref="GOA:D4H8Z6"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D4H8Z6"
FT                   /protein_id="ADE01014.1"
FT                   /translation="MIIIATALALYVAYYFVSKPLLRKLSSAAARAGLPLFPNATIAER
FT                   QAVFQMSLVVTLHLLLVCSLARMVLPAGWWDHQVTQPAVQGGVAVLAVGLGIGETVASG
FT                   VLAESVHGLLGWIDTQREARGHRSRMATEMVDASSGGWMKTIRLSVEVSLPVGATLLVL
FT                   QLSCEEIIFRFIFPRCMPGGMWTAGVLFVLMQFGGMKRRIGGVFAAVGASVMAIAQGYL
FT                   ATRTDLLLPLVIAHTAMFLSSRTLSSE"
FT   gene            complement(201180..201899)
FT                   /locus_tag="HMPREF0675_3182"
FT   CDS_pept        complement(201180..201899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3182"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3182"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99428"
FT                   /db_xref="GOA:D4H8Z7"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D4H8Z7"
FT                   /protein_id="ADD99428.1"
FT                   /translation="MSVWSCFLLTTIALISWSPATLAKMVGNVTRKSNYATIYVVVLAV
FT                   LALACLACTPARNLSAPHGWGLVLIGLPVTVAGALLASWLDNRILRHITNARTSGPSTK
FT                   RSASPGYLSGDVSAQQPVWVTRARVARSVQNMPLWQLLVIAVGEEVGFRVGVPVISLRA
FT                   TPAWLALTAVGALLFACGHSVFGRGQVLSKIPLAALGTILFIFWGIWACVLGHLIYNSQ
FT                   YWWNRNGYRRVSSVADR"
FT   gene            complement(201909..203081)
FT                   /locus_tag="HMPREF0675_3183"
FT   CDS_pept        complement(201909..203081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3183"
FT                   /product="putative YcaO-like family"
FT                   /note="identified by match to protein family HMM PF02624"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3183"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99586"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="UniProtKB/TrEMBL:D4H8Z8"
FT                   /protein_id="ADD99586.1"
FT                   /translation="MHALLDRPDPKPGSYHIGGVGLNEFEAEIKVYAEAVERYCAGTGI
FT                   LHSPFERRWATRQELLARTEDEVLDLGAFGFAQRVAGGAFDTYRDDLPMTWVKTPRVGT
FT                   SRQEWIPAQFFYLGYNPRRHDGEPWLGTAVTTGTAVHTSRVAATLSAAYELIQVDAAMG
FT                   LWYGASSPVRIRVEGPRLQRIQRLVERAAGRSHELRFYWLPTPGLKHFTVACMMVGSGN
FT                   QLPLVAVGLGADAGLEAAMYKAFLECSGVRMLAVWTSFDAEADASSMSTEDMLDLDSNV
FT                   SYYARNYQAAQSVVAKFDAGTIAQAEDLPPDDTHTGAELVKSVVNSITCVSPLYIEDFT
FT                   TIEIQGLGLHCVRLWAPGLLALSLPSAPMRAHPRYAAYGGFQNPQPHPYP"
FT   gene            complement(203234..204202)
FT                   /locus_tag="HMPREF0675_3184"
FT   CDS_pept        complement(203234..204202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3184"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3184"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01132"
FT                   /db_xref="UniProtKB/TrEMBL:D4H8Z9"
FT                   /protein_id="ADE01132.1"
FT                   /translation="MDRVEFRRGVWNAESTTLEDDDATGTLWPALDLLSQGLQPPEIVS
FT                   RVPGLTRAALDDVMAHLASIGALVENVEDKMDGGRETRPVWVFSDDALLAGDIQQILEG
FT                   EGLQATVLADDTQPSATLFAGLRLEQSADELHMEQEASQMLALLGSAPDLQPLLVVALA
FT                   QNNPAMLRALDLFARRAHLSWLHAAVDGPALYVGPYVVPGATSSYRTFEQRVAMNLRER
FT                   QSYLSWMRVAAADRVRAGAPAVAASVRAILAAHVAHEAVSIARNGLNTTRNKVLSVYIP
FT                   TMEIAYNDVLPMSRFDAPAQVETAPDLYYDIREWLAAGGER"
FT   gene            complement(204265..205302)
FT                   /locus_tag="HMPREF0675_3185"
FT   CDS_pept        complement(204265..205302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3185"
FT                   /product="putative streptolysin associated protein SagB"
FT                   /note="identified by match to protein family HMM TIGR03605"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3185"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00920"
FT                   /db_xref="GOA:D4H900"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR020051"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D4H900"
FT                   /protein_id="ADE00920.1"
FT                   /translation="MIMHISNPEVNGCRDKDARLWRLPPHAAIVASVRETSEGTVMVAT
FT                   PGGLRKASSAITSYRAQSPGTEGVGFRTHEFRCDNTDGPGLSNAAADFLLASRIARGDM
FT                   EFNVSVGDYFVDPMIVTYGQMDRDTFAADVIELPRSSRVRAPLEQVIARRRSGRNYTGE
FT                   SLDLRDVAAFLRGAAGVTGHVDVPRSSGDIVRYNVRAVPSGGGLYPVSIFMSAQRVSGL
FT                   SRGVYRYSPVIDRLVPVTGEEGCRGVRNSMAGEPAVEQSDAAGVHLVFVISPWRAMRKY
FT                   GARGLRFALQEVGAIAQQINLVCTGLGLASVESSSFYEDELNQALNLDGIFQTATHTMT
FT                   VGVQA"
FT   gene            205322..205813
FT                   /locus_tag="HMPREF0675_3186"
FT   CDS_pept        205322..205813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3186"
FT                   /db_xref="EnsemblGenomes-Tr:ADD98962"
FT                   /db_xref="InterPro:IPR027580"
FT                   /db_xref="UniProtKB/TrEMBL:D4H901"
FT                   /protein_id="ADD98962.1"
FT                   /translation="MYVSEDDLDLFAEATEIAGGLSAAVLEALRSYVDRHHRAAGGFDE
FT                   IELELQNDGIDHRVTFMGRRLIHIRRPDPEGTRIDTVYLTAKHQFAVATKIQRRLPDWT
FT                   TGHEHIWSDPETWNREFWIAGDKTMAVYPSLDKLREADPNVAERAEAAVKIPPFEVLDI
FT                   "
FT   gene            205813..206793
FT                   /locus_tag="HMPREF0675_3187"
FT   CDS_pept        205813..206793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3187"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3187"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00439"
FT                   /db_xref="GOA:D4H902"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4H902"
FT                   /protein_id="ADE00439.1"
FT                   /translation="MTESSSSRRQLAMPVLSVTDLAKKYVVHGGYEVPALNGVSFDLHP
FT                   GEMLGLFGPNGAGKTTLVRIIAGLLSADSGDVHWGSDQGRARLGYVSQKGGLQYGLTCR
FT                   EEMVFHAQCFGQSAKQARTSVDEVAAMLHCDYLMEWDVGRLSGGQRRIIEVGLALVNQP
FT                   SVVLLDEPTLGLDPATRLSLWQTVKSARRETGAAFLVTTHYIDEVAEHLSNVSVINHGT
FT                   VVANGSPAHIREMFATGEVTLGVAEDTVDSAVDVLAGTAFEAHPTETVPGIVVRSRHPD
FT                   VDAAKIITILAGHGISVDSISVREATLEEAFLTITGSRDPERQIP"
FT   gene            206790..207533
FT                   /locus_tag="HMPREF0675_3188"
FT   CDS_pept        206790..207533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3188"
FT                   /product="ABC-2 type transporter"
FT                   /note="identified by match to protein family HMM PF01061"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3188"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01191"
FT                   /db_xref="GOA:D4H903"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D4H903"
FT                   /protein_id="ADE01191.1"
FT                   /translation="MNTCFRRYAAMSLRARRDLALTFIQPLVYLALFGPLFVTTMKMSQ
FT                   RATAATGYSLYITGLSIQMAMTIGAFAGLTIILEYRLGILERIWSTPLTGSKMMAGRIA
FT                   RDVVMMMMPILVVFIIGLVLGTRPSPLGLATYFVTVLGTGATFAGVSYAVALRTKSEAA
FT                   LSAIFNLILLPVLLLSGIMLPMSFAPHWIATAAHVNPLWYLVQGARNQFSVLGLVAAAP
FT                   WSWAVAIVMSAAAFGWASHEFNKRR"
FT   gene            complement(207591..207773)
FT                   /locus_tag="HMPREF0675_3189"
FT   CDS_pept        complement(207591..207773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3189"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3189"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00565"
FT                   /db_xref="UniProtKB/TrEMBL:D4H904"
FT                   /protein_id="ADE00565.1"
FT                   /translation="MKLTTTSSLEHRIRTSQPAVTSVFGGADANVDLLAPGGSTCSSAG
FT                   SSSSCSTCAVTATVR"
FT   gene            complement(208067..209014)
FT                   /locus_tag="HMPREF0675_3190"
FT   CDS_pept        complement(208067..209014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3190"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3190"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00408"
FT                   /db_xref="UniProtKB/TrEMBL:D4H905"
FT                   /protein_id="ADE00408.1"
FT                   /translation="MRRVRDAGVPVELLHSHPGREKMLWTADATAWAVSVTCWCRGPGS
FT                   GKTGSAFWLTGSPSWMLLPGAPCRAPCLALAMRTAGGRCFVGLFTTAPGPSTAPDSRRR
FT                   STLVRLVWFRLNVVSRAGRSPRCHGHGLIVVGICEEEHVMNLDRSRTASSRWPELFDGV
FT                   DETTRRGVDEVMASLGLAGWRWAKTDVADLVAHWPDTTRRQQARSAGSGWQSRARRLAD
FT                   LVAEQPRKPLRGSWDHVSRIHRHLDDGHDGRVRLAGGRQTALMHALEACAQRVRHPLRR
FT                   PHSHGQRPSIGTATYIKNRTLPRPNLEEASRVCS"
FT   gene            complement(209281..210072)
FT                   /locus_tag="HMPREF0675_3191"
FT   CDS_pept        complement(209281..210072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3191"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07512"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3191"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00024"
FT                   /db_xref="UniProtKB/TrEMBL:D4H906"
FT                   /protein_id="ADE00024.1"
FT                   /translation="MTAANDAPQVCEEGPGQNNGLGGIPIFRGIDLPEAYRHQSYHAPT
FT                   VSRETLQEWFSPARLSRYRIEPVDAWYVWNTRISKAFLEDISHVEVLLRNFIDVRLSAD
FT                   TGIRRWWESPSYRLGGFPRNVDRAEKRLRRARLDATPDQIVASLSLDNWRFLLTPRLEA
FT                   TVWKALTDLRNGGMPHYPGRSRRDFEENVELIRHVRNRASHQEPLISAHPDQQAEIRRL
FT                   AHYVTAIDTVARNINPDAAEWIATHSRVLDAIAQRPTPQDH"
FT   gene            complement(210677..211741)
FT                   /locus_tag="HMPREF0675_3192"
FT   CDS_pept        complement(210677..211741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3192"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3192"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99133"
FT                   /db_xref="UniProtKB/TrEMBL:D4H907"
FT                   /protein_id="ADD99133.1"
FT                   /translation="MGQKLSWLLADEEAGRLYRRRPGLVAFVDESYRALSEGSAYIMTG
FT                   VIADTSQFNDYRRGLVENLQSNTFHAVAARANNPMGIDDVDVVNTLVQQRSDVLASVMV
FT                   GTQDLEDDDVKSQVRQQVLGALARQLHESWGVNTIVADHLVDGDRQREDEVTMRRVRDA
FT                   GVPVELLHSHPGREKMLWTADATAWAVSVTCWCRGPGSGKTGSAFWLTGSPSWMLLPGA
FT                   PCRAPCLALAMRTAGGRCFVGLFTTAPGPSTAPDSRRRSTLVRLVWFRLNVVSRAGRSP
FT                   RCHGHGLIVVGICEEEHVMNLDRSRTASSRWPELFDGVDETTRRGVDEVMASLGLAGWR
FT                   WAKTDVADLVRGGR"
FT   gene            complement(212198..212695)
FT                   /locus_tag="HMPREF0675_3193"
FT   CDS_pept        complement(212198..212695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3193"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF09352"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3193"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99440"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:D4H908"
FT                   /protein_id="ADD99440.1"
FT                   /translation="MTRPWGHNGCDTRNDALARDLVEAHLKPGSRCVVVSGRLHDPYTG
FT                   STLAWRRGRHTSTTVQIDHVVALGNAWITGAQKLSPLQRTALANDPLNLLAVDGPANEA
FT                   KRDRDAATWLPPNKAYRCDYVARQIAVKTKYQLWVTPAEKTAMARVLHRCPAQTLPVGA
FT                   TR"
FT   gene            212751..213350
FT                   /locus_tag="HMPREF0675_3194"
FT   CDS_pept        212751..213350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3194"
FT                   /product="ATP-dependent helicase C-terminal domain protein"
FT                   /note="identified by match to protein family HMM PF08482"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3194"
FT                   /db_xref="EnsemblGenomes-Tr:ADD98932"
FT                   /db_xref="GOA:D4H909"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="UniProtKB/TrEMBL:D4H909"
FT                   /protein_id="ADD98932.1"
FT                   /translation="MALEAVRSGGLDVASLTKNGESLRRRLALAHRVFGDPWPDVSDEA
FT                   LLACAEEWLDLDALAAGRGSDAASGLRGLLGWQESARLDEVAPETITVPSGSRIRVDYP
FT                   EPGSDTSPVLAVKLQECFGWTDGPTVCDGRVRVVLHLLSPARRPLAVTDDLASFWASVY
FT                   PAVRVENRGRYSKHPWPEDPMTATPTKRTNRALRGN"
FT   misc_binding    213520..213623
FT                   /bound_moiety="thiamine/thiamin pyrophosphate"
FT                   /note="TPP riboswitch (THI element); Rfam score 60.48"
FT                   /inference="nucleotide motif:RFAM:RF00059"
FT   gene            213658..214287
FT                   /locus_tag="HMPREF0675_3196"
FT   CDS_pept        213658..214287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3196"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3196"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00522"
FT                   /db_xref="GOA:D4H910"
FT                   /db_xref="InterPro:IPR017195"
FT                   /db_xref="UniProtKB/TrEMBL:D4H910"
FT                   /protein_id="ADE00522.1"
FT                   /translation="MTNDKLTMRYRTIDIVTPVMIVVAFGVIFLGYGAVYSLLKPATSV
FT                   YLPIEGILSGIWFLPALLAGLIVRKPGAALLSEVLAAAIEAALGGPWGAGTLISGVVQA
FT                   LPMELCLLVVAYRKAGPKLVLVAGALTGFAEAIYERISYYPMFRFGDTIVYFVFMIVSG
FT                   ALLGGLVAWGIVRGLAAAGALSPFAVSRELRGGKSPRSTISSRNLS"
FT   gene            214284..216383
FT                   /locus_tag="HMPREF0675_3197"
FT   CDS_pept        214284..216383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3197"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3197"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99974"
FT                   /db_xref="GOA:D4H911"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4H911"
FT                   /protein_id="ADD99974.1"
FT                   /translation="MTDVLTHADHVDEVSSRRAVPVDVEGMTVGVPDRDEPILGPIDLH
FT                   LGAGSRVLVSGPSGAGKTTLLHAIGGLLEEESYDLTGRVNTWSGDVNVGLLQQEPIHSV
FT                   VAATCGRDIAFGPENHRVPREDIWPIVEDSQRRARFTMPMDHSTTKMSGGQMQRLAIAG
FT                   ILATNPGLLLLDEPISMLDEESATAIRDEIARMAHDRTVLVVDHHPDQWRGVLDQVVEL
FT                   TDHGTLKKIWDFEDFLDSREATSLPSHTSTAGEVVASTSSLDAHRPQSDDVLLRGVTMS
FT                   ARRGHITVVSGPSGVGKSTLLRLLAGLDVPASGELTLPGQTAWVPQNPENYLVARTAAD
FT                   ELFASPMVPEDADLRDLVRTFGLKSILDSHPMTCSGGEKRRLAIAAALAQRPDLLLLDE
FT                   PTVGLDDDRGASVLSAIRAAADSGVAVVVSSHDRQVIAMADEVVDVASYRVPDPTPNER
FT                   PGEKPAFLTTINPLVAFLIAIAGIFGSLFVRSPLVGAVGLIPAAVMAPMCSRHVKPLVV
FT                   RTVPVLIAAVMLVWTTLLLHSGFTDPSAWSEATRQGLRILVFVLPGALASAAIDPTRLG
FT                   DALAQQTHLSQRPVVASMAGVVRMGHLGDQWHIQSDVRNLRGLGPKRSLSSRITYLSSM
FT                   TFAMVLYAMRSSEVLSRAMDSRGFATATRRTYAVESRWRARDLWGVVLAAFVVAVPALA
FT                   AVLFG"
FT   gene            complement(216396..217571)
FT                   /locus_tag="HMPREF0675_3198"
FT   CDS_pept        complement(216396..217571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3198"
FT                   /product="glycosyltransferase, group 1 family protein"
FT                   /EC_number="2.4.-.-"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3198"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99045"
FT                   /db_xref="GOA:D4H912"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D4H912"
FT                   /protein_id="ADD99045.1"
FT                   /translation="MPQRKVSVINHYAFPPGSGGITRNFDMFSRLRGWQPHFYAANINH
FT                   TSGERMTVDDPRYTLVPIPQYKGNGVKRVLGWVAFAAGAGARALARPADVIFASSPQIL
FT                   SPAVGMVVAALRRKPFVVEVRDLWPESLVSGGALKEGSALHKVLQGLEKTIYAHARQIV
FT                   VVTKGWEDHFREIGINVDKITVVPNGADLAEYEVKESREELRKEYGISGFTAVFSGTHA
FT                   NYVGLDLIVDAARRLPDVNFLLVGAGARKQWAIDEVAKLRLTNVTFHDQVPKSELVRIL
FT                   SACDVGLHTVSPQSVFDKGMSPNKLYDYMAAGLAVVSNAKVPIRDVISDDEVGACVDPT
FT                   DLVAGIERVRDADEATMKRWHERARELMANKYSLQASVDKLARVLEKALYR"
FT   gene            complement(217662..218081)
FT                   /locus_tag="HMPREF0675_3199"
FT   CDS_pept        complement(217662..218081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3199"
FT                   /product="DoxX family protein"
FT                   /note="identified by match to protein family HMM PF07681"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3199"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00858"
FT                   /db_xref="GOA:D4H913"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:D4H913"
FT                   /protein_id="ADE00858.1"
FT                   /translation="MSHPSHFTAPSPSKRHPLRTLSRLGVGGLLAYAGVGHLTFVREEF
FT                   QAQVPDWVPVDDDTVVWLSGAAEIILGAALLSGRHKKFWGRSAAAFFAAIFPGNVGQLV
FT                   EHKDGFGLDDDRKRAIRLLFQPILVGLALEGTRED"
FT   gene            218230..218457
FT                   /locus_tag="HMPREF0675_3200"
FT   CDS_pept        218230..218457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3200"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99248"
FT                   /db_xref="UniProtKB/TrEMBL:D4H914"
FT                   /protein_id="ADD99248.1"
FT                   /translation="MWTDSGSGRSWRSDRFPELVAGTFKMTSSRGDHVTASRTSIAAQP
FT                   VGSTPRLCGSALAIGYRYSPESWCGISVGE"
FT   gene            complement(218677..219684)
FT                   /locus_tag="HMPREF0675_3201"
FT   CDS_pept        complement(218677..219684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3201"
FT                   /product="dihydroorotate dehydrogenase 2"
FT                   /EC_number="1.3.98.1"
FT                   /note="identified by match to protein family HMM PF01180"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3201"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01126"
FT                   /db_xref="GOA:D4H915"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4H915"
FT                   /protein_id="ADE01126.1"
FT                   /translation="MSDLHTKYMGLTLRSPLVASAGPIQQKVDGVRALADAGVGAIVMY
FT                   SLFEEQVRHEEARQAEIELEYMDSFAESLSFFPTVASNEGGITERYLAHLEASANAVDI
FT                   PVIASLNGATNGGWVDTAKRMENAGAAGIECNIYMVPGDLEQSAEEVEDRHVEIVQAVK
FT                   DAVSVPVAVKLSPFFSALGNMATRLDAAGADALVMFNRFLQPDINVETMQVEPGVWLSS
FT                   PADARLPLTWIAALSGRIGASLAASSGVESANDVVKYLLAGADVVMTTSALVRHGAGYA
FT                   TELQKGLESYLQRKEVDLDTLRGTLAVPNDASTAEYERNGYVAALEKAKTTYGS"
FT   gene            complement(219708..223322)
FT                   /gene="nifJ"
FT                   /locus_tag="HMPREF0675_3202"
FT   CDS_pept        complement(219708..223322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifJ"
FT                   /locus_tag="HMPREF0675_3202"
FT                   /product="pyruvate synthase"
FT                   /EC_number="1.2.7.1"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF01558; match to protein
FT                   family HMM PF01855; match to protein family HMM TIGR02176"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3202"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00611"
FT                   /db_xref="GOA:D4H916"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011895"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019456"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:D4H916"
FT                   /protein_id="ADE00611.1"
FT                   /translation="MANSSDSRVRTIADGNTAAASVAYRCNELCSIYPITPSSPMAETA
FT                   DEWSAAGRKNIWGDIPTVMEMQSEGGAAGAIHGALQGGALSTTFTASQGLLLMIPNMYK
FT                   IAGELTSTVFHVAARSLAAQGLSIFGDHQDVMACRQTGFAMLCSSTVQECHDLALISQA
FT                   ATMRSRVPFMHFFEGFRTSHELNVLEMLSDDDIRHFITDDLVHAHRERALSPAHPFIRG
FT                   TAQNPDTHFQAREAANKYYEKVPSIVQSLMDEFAQVVGRQYHLVEYHGDPEATEVIVCM
FT                   GSGARTIEHTIDHFNARGHKLGLVELHLFRPFPTAEVVKAIPETARTVAVLDRTKEPGS
FT                   NGEPLFLDVLAALSEAHSRGTRNSMPIVSGGRYGISSKEFTPGMVAGIVAELELESPRP
FT                   RFTIGIDDDVTGISLPWEPLDIEDPTTIRAVFYGMGSDGTVGANKNTIKILGSDPNTYA
FT                   QGYFVYDSKKSGSKTTSHLRFGPKPIEAPYLVSQAGFIGIHAWGILESMDVLTMAREGT
FT                   TVLLNSPYSADEVWDKLPDTMQRQVLDKHLDLWTIDALSVARKVGLRNRTNTILQTCFF
FT                   AISGVLPKDEAIAKIKDSIQKTYGKKSQKIVEMNHAAVDASLEHLHQVKVPDQMTANHS
FT                   LIPAVREDSPKFVKNVTARMIEGFGDLLPVSALPDDGTYPAGTTKYEQRTLSDVIATWE
FT                   PNACIQCGNCAFVCPHGVIRSKYYPQSQLEGAPESFQSAELNAAGLPESCYTLQVVPDQ
FT                   CTGCGLCVEACPAHPVGEPDRKAINLEEHLDKTVQRENVKFFETIPVNDRSRVDFATVR
FT                   GTQFLEPLFEFSGACSGCGETPYVKLITQLFGDRAEVANATGCSSIYGGNLPTTPWGKN
FT                   ASGRGPAWSNSLFEDNAEFGLGMRMAANVQTVLARRRLQEVSSQLDPEFVEDLLHAPQL
FT                   TEHDLQSQQHRVKELQAKLADMEQTPAVRDLMSVADHLLRRSVWIIGGDGWAYDIGSGG
FT                   VDHVLASGRDVNVLVLDTEVYSNTGGQASKSTPLGAVAKFASAGKPTAKKDMALQAIAY
FT                   GSVYVARVALGADPQQTLRAFREAEAYPGPSLIIAYSHCIAHGYDLRNGLDQQYKAVHC
FT                   GHWPLMRYNPVLADEGRNPFLLDSPKPDETWREYTKLELRYRMLQKAHPEEAERMLDLG
FT                   QRQVERRYAEYAEMASRTAEDFAVDARMSEFAASSNRA"
FT   gene            complement(223338..225125)
FT                   /locus_tag="HMPREF0675_3203"
FT   CDS_pept        complement(223338..225125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3203"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF00070; match to protein
FT                   family HMM PF01134; match to protein family HMM PF03486;
FT                   match to protein family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3203"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99552"
FT                   /db_xref="GOA:D4H917"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D4H917"
FT                   /protein_id="ADD99552.1"
FT                   /translation="MSAETMTSDTTDPNGYVIRENQDITARPDLARTTGRVTPTRTRRP
FT                   VYLDMLPPCNAGCPAGENIQEWLRLIKAHEEEKAWRQLTADNPFPAIHGRVCYHPCEVA
FT                   CNRADLDGAVSIHSVERYLGDLAIEKGWTFTRPTEPSGHRVLVIGAGPAGLSAAYHLAM
FT                   LGHDVEIHDAGDKVGGMMRYGIPEYRLPREILDAEVARLTDLGIKIVLNHPVNDLMEEK
FT                   AKGRFDAVFVAIGAHLSKRVDIPTVDASRMVDAVSFLHNVAAGEKPLIGRRVAVYGGGN
FT                   TAMDAARVAKRLGAEESIVVYRRTAEQMPAHAEEREEAEREGVQMNWLRTITDVGDDLT
FT                   VEVMELDEDGKPHGTGRYEKLEADTVILAVGQDADTSFLHKMPGMRFRNDVVDVNPSTL
FT                   MTDVPGIFAGGDTVPSERTVTIGVGHGKRAARQIDLWLNRESGYPTAKNTTVGFNDLNL
FT                   WYFGDHLRRHQPELDPTQRVGFDEVVGGLTDDQAHFEAGRCLSCGNCFECDGCYGSCPE
FT                   DAIIKLGKGHRYEFNYDKCTGCATCFDQCPVHAIEMIPEGTDPATVQGSGNPTPGWAVR
FT                   PEPNPQRSASLKFTVDSEN"
FT   gene            225404..225721
FT                   /locus_tag="HMPREF0675_3204"
FT   CDS_pept        225404..225721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3204"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01910"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3204"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99550"
FT                   /db_xref="InterPro:IPR002767"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/TrEMBL:D4H918"
FT                   /protein_id="ADD99550.1"
FT                   /translation="MIVAFSLVPSGGRASREDGGVADAVAAAVRVVRDSGLPNHTSSMF
FT                   TEIEGSWDEVMDIVKRATEAVAQYGTRVSLVLKADIRPGRTGEMTAKLERLQGELDKQH
FT                   N"
FT   gene            complement(225743..226405)
FT                   /locus_tag="HMPREF0675_3205"
FT   CDS_pept        complement(225743..226405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3205"
FT                   /product="FCD domain protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift; identified by match to protein family HMM
FT                   PF00392; match to protein family HMM PF07729"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3205"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99068"
FT                   /db_xref="GOA:D4H919"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4H919"
FT                   /protein_id="ADD99068.1"
FT                   /translation="MRHIDDEILAGRWVNGSRLPPERELAASLSVSRGAVREAIRALEA
FT                   QGILSSGTGRSNGTRVDARPSDAMGRILRLQLALDVVSFADLTETRIALEKAPCAAAAK
FT                   VRAPVPLTRATDLLVQMHDAMQPDSFNALDTAFHVALAEAGDNRLMRDLTVAIREAVHL
FT                   PILEAEHSLIGWEQWRDDLVCDHQEMLAAIENGDSERAAKVTEAHIRNTYDTLLIDR"
FT   gene            226900..228588
FT                   /locus_tag="HMPREF0675_3206"
FT   CDS_pept        226900..228588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3206"
FT                   /product="transporter, lactate permease (LctP) family"
FT                   /note="identified by match to protein family HMM PF02652;
FT                   match to protein family HMM TIGR00795"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3206"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00894"
FT                   /db_xref="GOA:D4H920"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:D4H920"
FT                   /protein_id="ADE00894.1"
FT                   /translation="MVLLQTFTPSANPLGSQWLSALLAVLPVLAMLITLGALRWKAHLA
FT                   GLFSWGVALIVAITAFRMPIGMAFSSSVQGFLYGLFPISWILLGAIWMYQVTVISGRFD
FT                   DLRRTFFLISDDPRVLGILIAFCFGGLLEALAGFGAPVAIAAAMLIAIGFGKLRGAITA
FT                   LVANTVPVAFGAVGLPVLMAAKTGGLDVAMVAPVTARVCAVLCLVVPFLMLAIMDGRKG
FT                   VRECWPFGLFVGVVFGVTKVIVGGTPVYNLTEIFAAVVTVTLSLLFLKVWKPKGGREAA
FT                   ERIGIPIDPTVEIESVEAQEVDTSDLTGSRIFMALVPYILVIVVFGIAAIPAVKDSFKA
FT                   ADVKMAWPGLSGLMTAGGEAAAHQTYTWQWLSQPGFLLAIVAILVGFIYRVPLADVTKE
FT                   LWINAKKMKFSMLTIGLVVALAYVMGDSGQTLALGMFIAGAGAVYPFLAPILGWIGTYV
FT                   TGSDTSANILFSGLQSSVGQQVGAGSYLGMESMRHLLVGAGASGGVVGKMISPQSLTIA
FT                   ATAIGLAGGESVILRKVFKFSIILLVLMCIIVGLMSTPVLGWMVP"
FT   gene            228643..229437
FT                   /locus_tag="HMPREF0675_3207"
FT   CDS_pept        228643..229437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3207"
FT                   /product="cysteine-rich domain protein"
FT                   /note="identified by match to protein family HMM PF02754"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3207"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99784"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:D4H921"
FT                   /protein_id="ADD99784.1"
FT                   /translation="MTTTTSPGARATLPGLPGAGMTVGLFITCINDVMFPQTGVAVTTL
FT                   LERLGCKVEFPREQTCCAQMTTNTGYFDEGIPTVRQYVRAFGDYDYIVAPSGSCVAAVR
FT                   DQHPMLAEYAGDSGLAKEVEHTSQCTYDLPEFLVDILGVTDVGAYFPHRVTYHPSCHGK
FT                   RLLNLGDRPYELLRHVKGMTLVDLPMAEQCCGFGGTFCIKNPDMSAAMANDKARHVRET
FT                   EAEYVVAGDNSCLMNIGGVLSRQNSGVKPIHIAEILANTEED"
FT   gene            229441..230976
FT                   /locus_tag="HMPREF0675_3208"
FT   CDS_pept        229441..230976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3208"
FT                   /product="iron-sulfur cluster-binding protein"
FT                   /note="identified by match to protein family HMM PF02589;
FT                   match to protein family HMM TIGR00273"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3208"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99288"
FT                   /db_xref="GOA:D4H922"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D4H922"
FT                   /protein_id="ADD99288.1"
FT                   /translation="MSTELRRVTYGNHGVARLTPAPDKPGTYMGMPKFSKAVKGELNLS
FT                   VQRKNMRNATMTIRNKRAMRVSESPDWQDLRDAAESIKNRVGRHLDHYLVEAEKNLTAN
FT                   GVHVHWARDGEEANRIVAQIAKDKGVDEVVKIKSITSQETDLNEYLEEQGIAAWETDLA
FT                   ELIVQLGHDRPSHIVVPAIHRNRAEVREIFLHEMKNYGRPAPEDISENPPELTNAARLH
FT                   LREKFLRAEMAVSGGNFVLADTGSLVIVESEGNGRMCLTLPDTLVSIVGIEKVLPSFDD
FT                   LEVFLKLLPRSATGERMNPYNSVWSGVTDGDGPQEQHVIFLDNGRTDVLADTLGREVLR
FT                   CIRCASCINICPVYERAGGHAYGSVYPGPIGAVLNPQLRGVEHPVDRGLPYACSLCGAC
FT                   NEVCPVKIPFTDILLKLRNKVVKSEKADRIPQDYEVAGEMGLMKTASWAFSDHKHFEAI
FT                   QVGSRGVGRVLRGKKMGPVPVPVAERWLKYRDVDAPPADTFRTWWKKNREAQR"
FT   gene            230973..231653
FT                   /locus_tag="HMPREF0675_3209"
FT   CDS_pept        230973..231653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3209"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02589"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3209"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99788"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D4H923"
FT                   /protein_id="ADD99788.1"
FT                   /translation="MTTISTDPVARTEILARIRPASTDITNSDPVADVPIEWEYGTGID
FT                   MDDVVGTFVEKVIDYKATVVRVKGADVPQAVVEGLRSTGAEHSAVVPVGLDKSWVGAIK
FT                   TAGFDARLDDPQLSKKELNDTDAVVTGAACGIADTGSIVLTHVEDQGRRAITLVPDRHV
FT                   CVVKASQVVSDVPEAIQIVKPAVHEGHPLTFISGGSATSDIELSRVDGVHGPRRLYVIV
FT                   VDDR"
FT   gene            231749..232507
FT                   /locus_tag="HMPREF0675_3210"
FT   CDS_pept        231749..232507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3210"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3210"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01046"
FT                   /db_xref="GOA:D4H924"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4H924"
FT                   /protein_id="ADE01046.1"
FT                   /translation="MAAFVTVPVRSATMIIDDVTFSYRRHHEVLHGVTVELAPGRTVLL
FT                   GPNGAGKSTLFSLCSGSRAPTSGRIGLAGMAEASSRTLRRRVGLMRQNVLPIPGFTVRE
FT                   QIIYCGWLMGMSTREATVRADDVIAAVNLTEKADDRTSRLSGGQLRRVGLAQVLVGEPE
FT                   VLLLDEPMAGLDPAQRVRFRAVLEHVPDDRVIVVSTHQVDDLTDSYDRVIVLSCGRVVF
FT                   DGTPKEFVDLAPECSQRRAEMAYLGLVADK"
FT   gene            232558..233733
FT                   /locus_tag="HMPREF0675_3211"
FT   CDS_pept        232558..233733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3211"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99480"
FT                   /db_xref="GOA:D4H925"
FT                   /db_xref="UniProtKB/TrEMBL:D4H925"
FT                   /protein_id="ADD99480.1"
FT                   /translation="MVVAFIMVVNDTAGEPYWLAQVAGDAGRTMVVNALCALAGALEGH
FT                   RLRTVALRSNRVRSWWRVLLGPIVTSAAMTTVLSVVFMARHGFAPHTLGWSILGVTVLS
FT                   TWAWTVAGIALGLWLHVAVAAPIALATPLVWVTFPPGMSIYWLRHLTGSWIGCCTITQT
FT                   LNPLVITGTLRVELGLLVAAVVVVSARAAQHGRRLLLSLGGCVLVIGFIAGAVQVRHLD
FT                   AFPTIDRELSVTCRTVEGADVQLCLLPEHEAERSLMASSFKRVFPIWKRAGIGLPSIYS
FT                   EQALPGHKDAVEISVSPDMPDAAFAIARLATATGHCFCPPASTSPTEVIQYEGRIDAWL
FT                   REVARASGMEVVGAGVDAEDVTWAERLRTKDPTTQAVVVTRMQKYLRDCYR"
FT   gene            233742..234323
FT                   /locus_tag="HMPREF0675_3212"
FT   CDS_pept        233742..234323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3212"
FT                   /db_xref="EnsemblGenomes-Tr:ADD98965"
FT                   /db_xref="GOA:D4H926"
FT                   /db_xref="UniProtKB/TrEMBL:D4H926"
FT                   /protein_id="ADD98965.1"
FT                   /translation="MRSRLAWLQLALACVFAAVCARTDPDEVAVPAIFGSFGAVVVFSN
FT                   LFGLVLTILYAVGLSRADLSVEDRSPRQTGILDAALGLALSGIMVLGLFGGPANAQVIR
FT                   DVPILLAMTMIAARWMPRNVSALPAIAYFFVGLLAGRQRNEREGWWNWPVADAAGPVSV
FT                   GWIIATTVCGVLALSLPVRTVRRRCEADLG"
FT   gene            complement(234348..235952)
FT                   /gene="cydC"
FT                   /locus_tag="HMPREF0675_3213"
FT   CDS_pept        complement(234348..235952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydC"
FT                   /locus_tag="HMPREF0675_3213"
FT                   /product="thiol reductant ABC exporter, CydC subunit"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift; identified by match to protein family HMM
FT                   PF00005; match to protein family HMM TIGR02868"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3213"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99614"
FT                   /db_xref="GOA:D4H927"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014223"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:D4H927"
FT                   /protein_id="ADD99614.1"
FT                   /translation="MNARTTQLLKTLLRDVPRGRWLLVLSTLLAACASGASVALMGVSA
FT                   WLLSRAAEMPPVLYLEAAAVGVRFFGISRGVFRYAERLVGHDLALRMQGALRMRVYDRL
FT                   SRTTLLGRRRGDLLVRVTADVDAVLDMVVRVIVPACASSLVIIGTTVLLARFSLTSAAV
FT                   LLLSALLAAVVMPAITQRLSRAADSSLVPLRGQLADRTRELAHCAPDLVAYGAQDAILA
FT                   DVLEVDSRLRTAEQRAAWGRGLGTAGQILAAGLAVVSALWIGGNAVADGRIGGRILAVL
FT                   VLTPLALHEVFGAFTGAAQTHTRAKAALQRVVEVLDAPQVGVGDSPTAAASEEKPSLVI
FT                   EGLTVGWPGNQPVLSNVNLHVVAGESVAIVGRSGIGKTTLAATIMGLIPPLTGTVTTTG
FT                   RVRYLAQNAHVFATSISENVRIGCKEATEDEVLTALSRAGLAIPPRRVVTEDGSSLSGG
FT                   EAQRLALARVLVNHGTPADPATHDLLILDEPSEHLDVETSEALMSDLWATTSGTAKVVI
FT                   THDPLVMARCDRVWHVG"
FT   gene            complement(235949..237589)
FT                   /gene="cydD"
FT                   /locus_tag="HMPREF0675_3214"
FT   CDS_pept        complement(235949..237589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydD"
FT                   /locus_tag="HMPREF0675_3214"
FT                   /product="thiol reductant ABC exporter, CydD subunit"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664; match to protein
FT                   family HMM TIGR02857"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3214"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00674"
FT                   /db_xref="GOA:D4H928"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014216"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D4H928"
FT                   /protein_id="ADE00674.1"
FT                   /translation="MAAPLDPRLVRRARATLPFLAGLCVVGVATALLILAQAWLLSRGV
FT                   SSVFAAHHLDGVAMWCGLLAAVFCGRACLAWLQESLAHRASASVKSQLRRDILQARLSR
FT                   PTDATMPSGTLISLMTTGLDALDGYYSKYLPQLVLAVIVPAVLATAIGLNDLTSLVIVV
FT                   VTIPLIPVFMALIGWRTEAAVAKRFKVATRLANHFADLVAGLPTLQVFGRARAQLEGLR
FT                   RTEAANRSETMRTLRISFLSSFILELLATLSVALVAVTVGFRVAAGGMDLRTSLFILIL
FT                   APEVFLPVRQVGVLFHDAADGMAAAEVSFGLIESGRPTAPKSDVEIASPREVPVVISGL
FT                   THTYEGTDRAAPDGLSLRIEPGSVVALVGHSGGGKTTALSCLLGFIDPDSGSILVGDRE
FT                   LIGADESVWQSWRRQLAYVPQVPAMMAGTVAENIRLGCSDAPEAMLRDALDRCGAAAIP
FT                   LNKRIDDDAEGLSAGERRRVALARALVRVEQAEAGLLVLDEPTAGLDADTEATVLEAVR
FT                   ASGASVLVVSHRRNIIAAADVVVDLEVLA"
FT   gene            complement(237593..238666)
FT                   /gene="cydB"
FT                   /locus_tag="HMPREF0675_3215"
FT   CDS_pept        complement(237593..238666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydB"
FT                   /locus_tag="HMPREF0675_3215"
FT                   /product="cytochrome d ubiquinol oxidase, subunit II"
FT                   /EC_number="1.10.3.-"
FT                   /note="identified by match to protein family HMM PF02322;
FT                   match to protein family HMM TIGR00203"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3215"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99106"
FT                   /db_xref="GOA:D4H929"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:D4H929"
FT                   /protein_id="ADD99106.1"
FT                   /translation="MLPVLETTAHSPLTIVWFVLITVLWVGFFFLEGFDFGVAMLLPFL
FT                   GRDDKDRRLMVNTIGPTWDGNEVWLLTAGGATFAAFPGWYATMFSGLYLPLLLVLLGLI
FT                   VRGVAFEYRSKNPSSSWRNAFDWMATIGSFLPTLVLGVGFANFVRGLAVGPHSTPDGGT
FT                   APLVTTSFWGLFTPFALIGGILFVVLFCAHGANFVALKTMGDMHDRARKTSAKLGWIAT
FT                   VVALVWALMFNIMYVTRDGRQVLTWIICLLVVVLLAAGSAVVAKGREGLAFLCTALGIA
FT                   LMIVACMFAMYGNLGYRPSGIAFDMWIASATGRTLKIMTISACVFVPIVLAYQVWSYWV
FT                   FRKRLTREAIPDTAVAA"
FT   gene            complement(238679..240199)
FT                   /locus_tag="HMPREF0675_3216"
FT   CDS_pept        complement(238679..240199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3216"
FT                   /product="bacterial cytochrome ubiquinol oxidase"
FT                   /note="identified by match to protein family HMM PF01654"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3216"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99740"
FT                   /db_xref="GOA:D4H930"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:D4H930"
FT                   /protein_id="ADD99740.1"
FT                   /translation="MDAQLIARWQFGITTVYHFFFVPITIALSMLVAVMQTVWLKTRND
FT                   RYLRLTKFYGKLFLINFALGVVTGIVQEFQFGMNWSEYSRFVGDIFGAPLALEALVAFF
FT                   MESTFVGLWVFGWEKLPKGVHLACIYLTAIGTMISAVFILAANSWMQNPVGASYNPVTH
FT                   RAELTDFGAVLSNPVFKATFVHQISSSYTVAGALIAAIAFWHLAKVARGRTTSQISDAE
FT                   EVESVRTWRWASKFGAWVLIVACVGVVLSGDYQGKVMTDAQPMKMAAAEAAYQNTSDFS
FT                   VLTIGNKDGSEEVWALKIPGMLGFLGNGKWGSQVKGINELKSYQVHEYTYHRKDGSQTP
FT                   LQASYQNVLRQKIDANGIKLEPNVPLSYWTFRIMITLGMIGGLIGLVMLIAMRGGRNPK
FT                   PHGWLTLFMIALPLLPLFAISFGWIFTEMGRQPWIVAGVLPTTAAVSPNVSAGSVLFST
FT                   IAYTVVYGILAVVEVGLFWKALKEGLPELSTRDQPVTEGEDTPLSFAY"
FT   gene            complement(240334..241887)
FT                   /locus_tag="HMPREF0675_3217"
FT   CDS_pept        complement(240334..241887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3217"
FT                   /product="Tat pathway signal sequence domain protein"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3217"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00403"
FT                   /db_xref="GOA:D4H931"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D4H931"
FT                   /protein_id="ADE00403.1"
FT                   /translation="MAEVKNSQLTAHNDTDMAKDQTKVLQRTLNRFDIVFLIVSAVVGL
FT                   EMLGSVSAEGPETFTWLVFLIIVFLIPYSLIFAETGSAFVGEGGVYLWTRRAFGRPAAA
FT                   VTSVFTWITQPVWVGGSMAFLNAEAARNHLVHFSAGSAGDYLFKLAFIWLTVFAAILSL
FT                   AKAKWIPTAGAFFKISFLCLFLVTAAVYATQHGVQPLSLGSFSPTLRGFITLTPLLLFA
FT                   FLGFEGGSSASGEMRNAQHDVSVSVLRSATMAGIFYLLPVATILLVLPPSDIDGVSGLL
FT                   KAVNTVFSVYGPAAEPMMVLALVMFTLANIGQGAAWMIMSDRMQAMAAADGSFFGGFFG
FT                   KFHPRLGTPVHVNLLSGIVSTLFMLAAMELTGSSADLFNVVLGVAVTTYLFSYLLIIPA
FT                   AAKLRLSEPDVERPFRAGPNWFFILMCVVTTTFVALGSWVSIFPGTLEALVGMPHDFSK
FT                   AQGVSYASFEALTLGTLAFIIVMALIGYWRGAPLRRSGISTESLNQTSTEVHRRERTCD
FT                   "
FT   gene            complement(241998..243998)
FT                   /locus_tag="HMPREF0675_3218"
FT   CDS_pept        complement(241998..243998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3218"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3218"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99340"
FT                   /db_xref="GOA:D4H932"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D4H932"
FT                   /protein_id="ADD99340.1"
FT                   /translation="MTGKDAQQAPTRNEQAEIARASSQQGHRGSQVTEKPISFGPSLKR
FT                   LLGQLKPHRITLTIVVIMATISVAFNVIGPKILGRATDVIFGGIVGKQIGKHIPAARGM
FT                   TAETFINTLGQASHGGDRGKIITLLQQYPHVVIGSGIDFHRLGVIIGWALGLYACAALL
FT                   MFLQGFLLNTAIQRSMYDLRRQVSAKLDKLPLSYFDGQPHGELMSRMTNDIDNVSQTLL
FT                   QTLQQLLNALLTIIGVLIMMFWISPLLAVISLVVIPIAGVIAGLIGKRAQGQFAQMWKA
FT                   TGELNSRVEEAYSGHALVKTFGRSRAVAQEFHERNEELRQATAKAQFVSGLIQPVMFLL
FT                   GNANYAIIVLIGCLRVAKGQMPLGNVQAFIQYSRMFTQPITQIASMANLLQSGVASAER
FT                   VFQVLDADELSTDAHGSLPATKGRVVFDHVRFSYNPDKPLITDLSLVAEPGQTIAVVGP
FT                   TGAGKTTLVNLLMRFYEIDDGTITLDGVDISAVPRAELRSRLGMVLQDTWLFSGTIHDN
FT                   IAYGCPEASEEDILNAARAAHVDHFVHTLPDGYDTIIDDDGSNVSVGQKQLITIARAFL
FT                   AAPDLLILDEATSSVDTRTEMLVQEAMANLRKERTSFVIAHRLSTIRDADLILVMEHGD
FT                   IVEQGGHSELLEHQGHYYELYQAQFAAASHE"
FT   gene            complement(243995..245731)
FT                   /locus_tag="HMPREF0675_3219"
FT   CDS_pept        complement(243995..245731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3219"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3219"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99809"
FT                   /db_xref="GOA:D4H933"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D4H933"
FT                   /protein_id="ADD99809.1"
FT                   /translation="MLAKLVTRHLRAYRLHVAVIIVMQVCAQIAALSLPTINADIINKG
FT                   VVTADTGYVTTHSLFMLAIALGQTICQVIAVYLAAQVAMGTGRDIRDAVFTRTLGFSAR
FT                   EINKFGAPSLITRTTNDVQQVQMLVFMTLAMLIGAPIMMMVGIIMAVRADVSLSWIIMV
FT                   AVILLAIGAGLIVSRMGPLFKRQQKRIDDLNRVVREQITGIRVVRAFARERHEAARFDA
FT                   TSSSLRDIQVNVGRTMAAMFPLVMLIMNLSQIAVFWFAATRIDDGQTEVGILASFTTYL
FT                   MLILISVMMAVMLIVMWPRASVCANRIEEVLHTSSSLTIDPEPVMALPDAPTLLEFRDV
FT                   TFSYPGASEPVLHDISFTLARGTTTAIIGSTGSGKSTLVNLIPRLVDVTHGQVLVNGTD
FT                   VRRYDPETLWSCIGLVPQRPYLFGGTVASNLRDGRCDATDEELWNALHVAQSDDFVSHM
FT                   DGKLEATITQGGTNVSGGQRQRLSIARALVKDPDIYIFDDASSALDVATDSRLRAALEA
FT                   NHGDAAMLIVAQRVSTIRNADQILVLDAGHIVGRGTHDELIKSCPTYLEIVDSQLSVEE
FT                   AA"
FT   gene            246003..247112
FT                   /locus_tag="HMPREF0675_3220"
FT   CDS_pept        246003..247112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3220"
FT                   /product="DNA-binding helix-turn-helix protein"
FT                   /note="identified by match to protein family HMM PF01381;
FT                   match to protein family HMM PF06114"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3220"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00282"
FT                   /db_xref="GOA:D4H934"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D4H934"
FT                   /protein_id="ADE00282.1"
FT                   /translation="MSEDMREIGERIKSRMPEGMTQQSLAEAMEMTPDALSRMLNGKRG
FT                   ITMTELGKAAEVLGASAHWLVTGHKDPYAMRFAARHTYDFDTHRHINEGREKDREVLDH
FT                   IAEVYRAAHGSLRASSVVLPKTAKQMREALGDGFVNDFAARVKEVLDVDVMKRSGLSTD
FT                   YSLCIVGRRVVVLNKQFWARTTWSLAHELGHLVQGHLDRDGDIAGEADEKQANAFAAEL
FT                   LLPEKWMRNFNWPALTRADVARMVWEAKVSAAAMRVRIETLRLKASDEVREALELTTPK
FT                   LLTLARTSAAERYRDVFVPDWSPTVIAALLEETEKGNADPMLTSRVLGVPVDDIDFPEP
FT                   PSEEEMVERYERTMLDRRRRDDGAGESAL"
FT   gene            247540..247662
FT                   /locus_tag="HMPREF0675_3221"
FT   CDS_pept        247540..247662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3221"
FT                   /product="hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3221"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00467"
FT                   /db_xref="UniProtKB/TrEMBL:D4H935"
FT                   /protein_id="ADE00467.1"
FT                   /translation="MYGRIDANNEPSVHLVDDMGFELEQMESVHLQTWSTMLGV"
FT   gene            247960..249492
FT                   /gene="lysS"
FT                   /locus_tag="HMPREF0675_3222"
FT   CDS_pept        247960..249492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="HMPREF0675_3222"
FT                   /product="lysine--tRNA ligase"
FT                   /EC_number="6.1.1.6"
FT                   /note="identified by match to protein family HMM PF00152;
FT                   match to protein family HMM PF01336; match to protein
FT                   family HMM TIGR00499"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3222"
FT                   /db_xref="EnsemblGenomes-Tr:ADD98966"
FT                   /db_xref="GOA:D4H936"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:D4H936"
FT                   /protein_id="ADD98966.1"
FT                   /translation="MSSDTASSQSPDVSEQMQVRLDKRARIIADGGQAYPVDLLRDHTL
FT                   VQVRQKYTDDTGELTLAPGEETTDEVTVGGRVVFVRNTGKLCFASLQDGFTETSNGERL
FT                   QIMLSKAEVGDESLAAWKSDVDLGDHVWVRGRVVVSRRGELSIMAAEWRMASKALRPLP
FT                   TLHKELSEESRVRRRYADLVVREESRQMVRTRAVITRAVRRALDERGFLEIETPILQLV
FT                   HGGAAARPFNTHLNAFDIDMSLRIALELYLKRTMVGGTDRVYEMGRVFRNEGIDSSHSA
FT                   EFSMLEAYMSWGNQFTIAEVIKDIIMAVADALDVHQIETPKGTIDLDGQWRWVSVYPGL
FT                   SEKLGREVTLDTPLEELQSIAAEHEIEIDQSWEAGKVVMELFGELVEPGLINPTFVCDY
FT                   PAIAQPLARPHRDDPRMVEAWDLIIGGMERGTGFSELVDPVIQREVLTKQSLAAAAGDP
FT                   EAMQLDEDFLEALEFGCPPMGGLGLGVDRLVMLFTNAGIRETILFPLLKPEH"
FT   gene            complement(249531..249812)
FT                   /locus_tag="HMPREF0675_3223"
FT   CDS_pept        complement(249531..249812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3223"
FT                   /product="putative septation inhibitor protein"
FT                   /note="identified by match to protein family HMM PF06781"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3223"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99757"
FT                   /db_xref="GOA:D4H937"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:D4H937"
FT                   /protein_id="ADD99757.1"
FT                   /translation="MPESKVRPQAKKKAQAKNRATMDERRAEKKAAPVDRSWVPKVFVP
FT                   LFLLGVLWLIVYYIAGNQIPGISNLGDWNILIGMGLMAAGFGVATLWK"
FT   gene            249934..250764
FT                   /locus_tag="HMPREF0675_3224"
FT   CDS_pept        249934..250764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3224"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05949"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3224"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99561"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:D4H938"
FT                   /protein_id="ADD99561.1"
FT                   /translation="MSDDNDPDDVRPDDASVDIDEDRSQATTDPSIQDVRSDSRHPRLA
FT                   RSASVIVMALAGLMMTTAATNSRGHDLRPERDTDMATLVRSQASHNAALQKEAAGLRAQ
FT                   VEDLSKANQTPGVTSSVISSASALAPSVGLEAVSGKALRVTLDDAPLSENPDGVDANML
FT                   VVHQQDIQMVVNTLWSGGAEAMTIQGQRVISTTAVKCVGNTVVLHGVAYAPPYVIEAIG
FT                   DLNAMQKALDTSEAVRIYKEYVSAYQLGWSVERAGQVTMPAYTGAVAVSHATPR"
FT   gene            complement(250855..252753)
FT                   /locus_tag="HMPREF0675_3225"
FT   CDS_pept        complement(250855..252753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3225"
FT                   /product="kinase domain protein"
FT                   /note="identified by match to protein family HMM PF00069;
FT                   match to protein family HMM PF03793"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3225"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00096"
FT                   /db_xref="GOA:D4H939"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D4H939"
FT                   /protein_id="ADE00096.1"
FT                   /translation="MSAESWLSGRYELQNLIGRGGMADVWKARDHRLGRDVAVKKLRTD
FT                   LASDDTFQARFQREAQSAARLNHPNIAAVYDTGETKDPATGLPVPFIVMELIDGHTLRD
FT                   VLRDGRKILPRRALEFTQGVLDALSYSHAAGIVHRDIKPANVMLTREGYVKVMDFGIAR
FT                   AVADTSATMTQTAAVIGTAQYLSPEQARGETVDNRADIYATGCLLYELLVGRPPFIGDS
FT                   PVSVAYQHVREVPAPPSSLDAEITHQMDAITLKALAKDPADRYQTAKQMRDDIDRLLSG
FT                   REPFAMQNYADSEADTEEQTHLIPAAATDPIPATAAQQDESSPASAESPQEPEEPHRKR
FT                   WPVIVVTIVVVVLLALLGFGLHKILSSSSQPSPAPTPSRTVKMVKVPAVTGLSQQGATS
FT                   TLENAGLKVQVDHVQRDQATANQVVSQSPAANEKVPAGSDVKITVNDGPKQLTIPRNIV
FT                   GLPKNDALKALKDAGFSDSQIKVTNDDPKTEPNSAKAGAVDAVSPGAGTTLTPDQQVTL
FT                   TIATGKSVVPNLKGMSVEEANSAAGSSGFSISVERQVTSSAAPGTVFGQDPDYGAIANR
FT                   STAIKVLVAVAPPAPEPTREPPTNSAPSEEPSSSSIAPVPPAPTTAVPTTSSSSGR"
FT   gene            complement(252800..254227)
FT                   /locus_tag="HMPREF0675_3226"
FT   CDS_pept        complement(252800..254227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3226"
FT                   /product="penicillin-binding protein, transpeptidase domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00905"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3226"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01189"
FT                   /db_xref="GOA:D4H940"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D4H940"
FT                   /protein_id="ADE01189.1"
FT                   /translation="MNRQIRAVSLLAGLMFLALMVNLTGSAMFRQASLNNDPHNVRVRD
FT                   AEFSQNRGNILVGSRPIATTTSSNGKFAYQRVYLSGPKYAPITGYYSYYYGRSMLEQTQ
FT                   NAQLTGTSDAQWLSRITGTLSGHKPEGGSITTTINAKAQDAAWDGLKGKKGAVVALDYT
FT                   TGAVLAMASSPSYDPNELASHHLNDTTRAWKNLVADPSSPLTNRATREIYPPGSTFKLV
FT                   TAAAALQNGYHPNSMVDSPENWILPGTRTPLTNETNCGGSRITLAHALDISCNTAFGKV
FT                   GVSLGQDKIRDQAERFGFGKVVNSDVSSAASRFPQNLTDAQLAQSSIGQYDVAASPLQM
FT                   AMVTAGIANGGKLMTPYLTAQVRASNLQVVSEHHPKQMSQPMTKESAEQLKAMMASVVN
FT                   NGTGKRARINGTTVGGKTGTAQTVKGKAPYAWFVGWSDNPHVAVAVFIQSSDTAINEVS
FT                   GGRLAAPIARDVIEAMR"
FT   gene            complement(254224..255615)
FT                   /locus_tag="HMPREF0675_3227"
FT   CDS_pept        complement(254224..255615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3227"
FT                   /product="cell cycle protein, FtsW/RodA/SpoVE family"
FT                   /note="identified by match to protein family HMM PF01098"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3227"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99361"
FT                   /db_xref="GOA:D4H941"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:D4H941"
FT                   /protein_id="ADD99361.1"
FT                   /translation="MSIGQEFDDGTVVIQAKRRWTELFMLLIAWAIGFGGWVLTELNIN
FT                   HVLPDTWTTVGGVWLAVAIVAHIFVRIVIPYADPVILPIVFTLNGLGLAMIHRIDYIPD
FT                   PHYHRMDAQALWTALGIVLFVATLLILRDHRNLQRYPYVLFIVGLVFLMLPLVPGLGMA
FT                   TLGSRVWIHVGSYTFQPAEVSKVVLAIAFAGYLVDNRDVLSRAGHKILGITLPRARDLG
FT                   PIAVMWVATMLVIVYQNDLGTGMLFYGMFVVMLYITTERVGWAILGAVSFLGGAVLAYT
FT                   CFGHVRVRFDSWLHPFSNYTQNYQITQAQFGLAWGGLAGRGWGLGRPGMVPLAWSDFIA
FT                   TSIGEELGVTGLMAVIVLFFILTARGMRTSLGCRDDFGKLMVAGLSFTLALQVFAIIGG
FT                   VTRLLPLTGLTTPFMSQGGSSLIANWVIVAIIMIVSHRNRKPADDFTATVPAPDPQQAI
FT                   TGGTR"
FT   gene            complement(255612..257099)
FT                   /locus_tag="HMPREF0675_3228"
FT   CDS_pept        complement(255612..257099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3228"
FT                   /product="protein phosphatase 2C"
FT                   /note="identified by match to protein family HMM PF00481"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3228"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01107"
FT                   /db_xref="GOA:D4H942"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D4H942"
FT                   /protein_id="ADE01107.1"
FT                   /translation="MAFSLDIRCHSEIGLVRRNNQDSGYVSPRMLVVADGMGGAAAGDL
FT                   ASTVAVRHVAKADRRFSGEGSPARPQGEEMLTVLSGAVADANDELADLVAWDSSLEGMG
FT                   TTFCGAMFSGTQLGIVHIGDSRGYLLRQGRMKRMTHDHSWVQSLIDDGRITPEEAAVHP
FT                   HRSLLLKVLNGQPQHIPDTQIVDLRLGDRILFCSDGLCGLVNDDTIGEHLNTTNLDDVV
FT                   DLLTTDAHAGGGTDNITIVVAEVVEADPNLDASEPHIIGAATTRKVPEHEVTAPLPLDQ
FT                   PASATNNDGKSTVLFDSEAEESMRYAPVDSMTRHRRHWLWPVVILAFVAVVVGGIFGAR
FT                   AYLNTQYYVGTDDDTVAIYQGSPDNLAWIQLSHVTEKTNIKTADLPRYYRDRVLGNIRV
FT                   SSMDSAHATVAELRTGAQQCKVIREAATAPPPTKPATPPSTPPQPSASGPTANAHHTPQ
FT                   PSAVPTPAMPTPTSAMPSPSAAGHEVDLPAVTSGDCQ"
FT   gene            complement(257103..257591)
FT                   /locus_tag="HMPREF0675_3229"
FT   CDS_pept        complement(257103..257591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3229"
FT                   /product="FHA domain protein"
FT                   /note="identified by match to protein family HMM PF00498"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3229"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99113"
FT                   /db_xref="GOA:D4H943"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:D4H943"
FT                   /protein_id="ADD99113.1"
FT                   /translation="MSEFLVTLLRIAYLAILWIFILFVTNVIRTDIYGHRVPRNAGEAA
FT                   VETGRRSKGRRTRRREPAPIPTGLQVISGSRAGTFVPLANGVTVGRGNDCTLPIDDDYA
FT                   STHHAEFSPGIDGAWFVEDLASTNGTHVNGERIENPTRLSVGDEVRIGRTTMTVTGRR"
FT   gene            complement(257594..258283)
FT                   /locus_tag="HMPREF0675_3230"
FT   CDS_pept        complement(257594..258283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3230"
FT                   /product="FHA domain protein"
FT                   /note="identified by match to protein family HMM PF00498"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3230"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00017"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:D4H944"
FT                   /protein_id="ADE00017.1"
FT                   /translation="MGFLNKVEKSIEGAVSGVFARAFRGEVEPVEIAGRLQRELDSEAQ
FT                   ILSRDKSLVPNDFVVRLSSRDYERLVPYTKTLNAEIIPTLRDHASERHYVFNGPIHIRY
FT                   DLDDALPVGKFTVLTGENHAKAVSDRRAPLVLEVDGVRHPLTPPGLTIGRGSDADIRIN
FT                   DPGISRLHARINVWPQGNDIGLSIEDLDSTNGVTVNGVKVTSTELGDGSRIEIGSTRML
FT                   VHSPTRI"
FT   gene            complement(258455..259498)
FT                   /locus_tag="HMPREF0675_3231"
FT   CDS_pept        complement(258455..259498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3231"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00371"
FT                   /db_xref="UniProtKB/TrEMBL:D4H945"
FT                   /protein_id="ADE00371.1"
FT                   /translation="MHLNLGLAKTINRATHVTRGFRRIVMVTAAGEGRPGRLVADLTNE
FT                   FSRRGIDVSQLPIEGSEDTASSMPAPAHKVLAKWSRHRQGTARHELVESLDHQCALIVT
FT                   DPRRLDEIVGLQAQSDRPVVVLLATDPDDAPDKLAEIVDVVVTPNPQTEPWEHLGVPVH
FT                   SIGVPATGGGPAPGDRPNRIALLGPCTDEQLADALLAFDHACQVVPGWSLEICLDDESR
FT                   ARSAVAARRDVGIHPAGSENTVMNQSELALVMTRKEDLASRILDAAGAGLPAAAYADTP
FT                   AAADILSRCGYPAAGELSSALAQGMADAPLRRIQREYVAEVLADHAGAKIGEAWLDLMF
FT                   NVGRSHH"
FT   gene            complement(259571..260533)
FT                   /locus_tag="HMPREF0675_3232"
FT   CDS_pept        complement(259571..260533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3232"
FT                   /product="phosphotransferase enzyme family"
FT                   /note="identified by match to protein family HMM PF01636"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3232"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00148"
FT                   /db_xref="GOA:D4H946"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D4H946"
FT                   /protein_id="ADE00148.1"
FT                   /translation="MKPSRVRWDQLPDSVHHRVAEILGSPVSVDHVQTHGTTPGVASRV
FT                   VTADGSHAFVKIGHPAINEAIPSLNRREATLLSLLPDTAPAPRLLGRIDVDGWVGMVTS
FT                   DIEGPHPDLPWSDEDIDTTLASLSRLTEVTADFHQQWEPFSARLQNTPSVWEQFMADTP
FT                   TDLDPWLIERLPDLAGRVERLARHAYGDTVIHNAVRSDNVLLRTSGTVLVDWSHAVIGP
FT                   AWVDAAGLIVDIIHTDPIDAPRWNRADDLVKRVAAEFSPSTHGGPAVEPIVDFLVAILG
FT                   LSERECRNPDPAGMPQFREFQRERASRLRAWLWASEHLA"
FT   gene            complement(261126..261626)
FT                   /locus_tag="HMPREF0675_3233"
FT   CDS_pept        complement(261126..261626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3233"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00812"
FT                   /db_xref="GOA:D4H947"
FT                   /db_xref="UniProtKB/TrEMBL:D4H947"
FT                   /protein_id="ADE00812.1"
FT                   /translation="MLSIFLSNSDGIRDSIGGWFCFIFFLGTPVWILSDVTLRRYGVDY
FT                   DKIWTRFGPFFYHQIRFTDITRFDIGGHRYKIWAGKTKINIDYHRYDYALVHLRLAEEL
FT                   HHRHIQLPQANITDPNWDEQAHIWRNILAADAYREHRDFYNTNPEQLAHLNALTPPPHH
FT                   YDN"
FT   gene            complement(261837..262940)
FT                   /locus_tag="HMPREF0675_3234"
FT   CDS_pept        complement(261837..262940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3234"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99491"
FT                   /db_xref="GOA:D4H948"
FT                   /db_xref="UniProtKB/TrEMBL:D4H948"
FT                   /protein_id="ADD99491.1"
FT                   /translation="MSPDPLTPPAGALWANNPYDYANNNPLTLTDPLGTHPVTDDQLAL
FT                   LTHPIGTLAHYVANSVSTLVHHITDPISHWWATHKDRILSRDFLIGAGLVIGGIAVAAT
FT                   GVGGPLLAAAISGGLISGGFSASSQKYATGDVNWGTVSKEALIGFVVGGVGAGTTNLVG
FT                   TQVLKHSDTAAAAITKFSVRDEVRFAQTGLKGILNANTAANNALKLAAKSGDLDALETM
FT                   YIHHFAGSAASNFAASNTQYIMDTAMSHDKHFSASGLAQANGNAIFGVVLSARGNAMAR
FT                   PNISFNNGCFKRGPALLTDTMGVKQQFSTFGHELVRGAIADATTQEISTAMNGQDPHDF
FT                   ADGFSKKTAHTLGNAAHTSFPGLHTSK"
FT   gene            complement(262922..264397)
FT                   /locus_tag="HMPREF0675_3235"
FT   CDS_pept        complement(262922..264397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3235"
FT                   /product="YD repeat protein (3 repeats)"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift; identified by match to protein family HMM
FT                   PF05593; match to protein family HMM TIGR01643"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3235"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00402"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:D4H949"
FT                   /protein_id="ADE00402.1"
FT                   /translation="MCGRPTRTWDPVTGTRHFRYNTAGRLITAVDAAGQVHRYTWDKRG
FT                   RLVTTTNAAALTTYRYNQLDQIVESTDPAGGTHHYTWNPAGRLTSHTGPDGITTSYDTR
FT                   GGTETVTIDGQVSTRKWWDLEARQLHIDDHTDPAAPLHHTISVDARGLVCDHTTTDGDG
FT                   KVIGRHHWDWDSEGRLTRADDTRATVSYTYRGDGLPTRITHSALGAASLAWDSAGRLTD
FT                   VTTPDHHDHWDHDGGLVCGYVHDGRVTRVARDVQGRVTGIEGPSGRWSYGYNEAGSLIS
FT                   ATGPCTQHTWTHDAYGRLTSHATSGTDTTFTWDQEGHLTQTCTRANGYATATQYRYDAA
FT                   GRRVSATSPDGQEERYSWDGRGWLSGITTDSTTLSTHVDALGRASRITTGDQQVRVDWD
FT                   LVTGAPTSIDGHPVLPLPGGRILGATPIGDTNLWREVMPTDPDNPYQPATATIEGVPET
FT                   IRMAGNTLVVDGHPWWGRASTTQLPPPSCLLTR"
FT   gene            complement(264464..266992)
FT                   /locus_tag="HMPREF0675_3236"
FT   CDS_pept        complement(264464..266992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3236"
FT                   /product="YD repeat protein (3 repeats)"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift; identified by match to protein family HMM
FT                   PF05593; match to protein family HMM TIGR01643"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3236"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01150"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:D4H950"
FT                   /protein_id="ADE01150.1"
FT                   /translation="MGDYQNPVKFDFAVPANLTGGARLIHGANRGLMPASALEALYEHF
FT                   CASCQYGSLTVGGLFGQYQRWMGLNDADVAWLEAVGRAFAAAGGSGSVILADVALEAGL
FT                   RAAGVSVTRADIQVSSPTLSGIDPATGYIEDPVNSATGNFVLPETDVVFGGPSQGLAIS
FT                   RMYNSTLAAAYDEPEACGVLGPGWSTILDQRLIVTDEQARWVRDDGREIVFPLTGRNGV
FT                   SGSPTAEGCHTVEGPWRAAQDNVWISRGDAADLAGVQGATVAGPVWIVADNTGSRLIFT
FT                   AEGAWVGSTSGAGDGIWIERRDGMAISMHSEWGRSVDLFYAQGRLAKAVASDGRSVSYA
FT                   YDSHGRLVEVTRPDGVHRYQWDGWLLSQVIDASGVAQCVNTFDEAGRIRTQRDATGHLT
FT                   RFTYLPGGVTVADDGQGHHCNTWISDARGRTVGIIDADGQRTSMLYDRYGNLVSATDRA
FT                   GKVIRHTYDGRGHCARTTLPTGGVIDYGWDEADRLTTISSGGTLRVRLDYQGTERTPVR
FT                   LADAHATTLTMSWNRGLLRQLVDATGASISVDYDEYGQVMAITNGVGATWRFNHDEAGQ
FT                   ISQILTPLGYRTELAYDEAGRLVERTDPDGACWSYDYDDAGRLEASTAPDGGCTRYAWG
FT                   PDGQITTVTDPTGATTTLSYDEVGDLAGIGLPDGASWGFLRDAMARLCAVKDPDGAHWH
FT                   ASYNIIGELTSLTDPTGVSLHATTTAHQAQVTNAAGRVIAADQFDDYGRIVSSTDVFGA
FT                   MSRIDYNTAGLPAVLTDPSGALTRFDYDRVGHLSAITSPSGLQERYSYDAAGRLASTTD
FT                   PTGAVTRYLYDADSRLTGIIDPTGVTAKYS"
FT   gene            267093..267275
FT                   /locus_tag="HMPREF0675_3237"
FT   CDS_pept        267093..267275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3237"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3237"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00852"
FT                   /db_xref="UniProtKB/TrEMBL:D4H951"
FT                   /protein_id="ADE00852.1"
FT                   /translation="MLPGVMSPEQLVDVVETQSAAPEPCIVLIDDAHLVADDSQVLARV
FT                   LALPDSPLLFNRGWA"
FT   gene            267262..268107
FT                   /locus_tag="HMPREF0675_3238"
FT   CDS_pept        267262..268107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3238"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00117"
FT                   /db_xref="UniProtKB/TrEMBL:D4H952"
FT                   /protein_id="ADE00117.1"
FT                   /translation="MAGRNNDLRTLYSHWTGQIRKSRLGVLLVPDADYDGDLLDVRLPR
FT                   HPAATVNKGTLKYSLTYRTIKQPLSGDVLEVVTSARSCPDATWDGTAKVVPHSPALTSI
FT                   DAKCGWTITLKTLPQEEPVTVTAKFPATEAAISNQANLQTWLQNQQQATDKALNNDAVT
FT                   STAYSLQRLQTMRIKIPPRVKEGSAIPVTILGTWPGGENEMTPIYTTPFSSNPTSILTD
FT                   ITGGKLENVRLTDRCSGAVSITPDGHDVSALHPASCSIGAEIGNYQVQESPITIVAGGS
FT                   "
FT   gene            268481..269380
FT                   /locus_tag="HMPREF0675_3239"
FT   CDS_pept        268481..269380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3239"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99368"
FT                   /db_xref="GOA:D4H953"
FT                   /db_xref="UniProtKB/TrEMBL:D4H953"
FT                   /protein_id="ADD99368.1"
FT                   /translation="MFNLPRPVRCCLVVLLAPVVMGAAKFNYGMEIRDEDHVRSTFVYG
FT                   VSRADLEEAGKKPSDFSDCDKTFDVSASEKQHGVKAEFVEDKEYVGCKFTMTTTADDAR
FT                   GAGLGLTFDADKVSLSIGRKFFEDARLDKIKVGAFKVSVTFPGKVISHSGSSSVDGNTV
FT                   TWTDIKDSTSGLKAVGERPTGAATAGPSFWKGFGRHGIRGGIIGLIAGIASYFGNKRRA
FT                   KKKRAKSGGATVTAQYPGYGQPQPQEWQAPGQNGHQYGESMNSGGNQPYMQDGRYIGDP
FT                   WNANSTNTSGFNEKPNPR"
FT   gene            complement(270049..270165)
FT                   /locus_tag="HMPREF0675_3240"
FT   CDS_pept        complement(270049..270165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3240"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01078"
FT                   /db_xref="UniProtKB/TrEMBL:D4H954"
FT                   /protein_id="ADE01078.1"
FT                   /translation="MQPVKAIEDSDTLGQLPGGGNQILITDEQVKNQWKTKK"
FT   gene            complement(271322..274234)
FT                   /locus_tag="HMPREF0675_3241"
FT   CDS_pept        complement(271322..274234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3241"
FT                   /product="RHS repeat-associated core domain protein"
FT                   /note="identified by match to protein family HMM PF05593;
FT                   match to protein family HMM TIGR01643; match to protein
FT                   family HMM TIGR03696"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3241"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00427"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9I9"
FT                   /protein_id="ADE00427.1"
FT                   /translation="MCGRPVEFQDESGAVTHVERDLAGRIVALVSPTGLRTSYSYDACG
FT                   RMVDVTDPAGRVTRYSYTSDFQVATVTYPTGETARYEYDAMGRVVLSHVPGAGVSQYRY
FT                   DPCGRLVFSCDLVYGQRHFSYDLAGQLVAATNPAGGVSRYGYDRCGRLVTRTDPGGGLT
FT                   TYQYNECGQMIAATDPLGRVTEYTWDKSGTLAAITRPDGTVVSRRLGPKGVEEYIDDQL
FT                   VSRILITPTTRTVTIDDYTDPAFPWRHLLGYDPRGLLLTHSVAPVPGDESIVDEGPLTS
FT                   SEQWWYDAEGRRVRHLTLTGDSIDYAYTNTGVLGSIRHSRLGEVSLEWDAVGRLAKLGS
FT                   PLDQQQWGYTDGFVTSHTSSRGSTTISRDEMGRVLRVSAPYGDFRYGYDDSGSLTSADG
FT                   LDGSSRRWVYDTAGRLVTATCQDAGTSQTCHYDYDLAGELVSTVTQLGPGDSTVETHYR
FT                   YDPCGRRIEAASSDGMREEFRWDSRGWLAGVMTFRAGRSHEFATHVDAFGCLTDVSGPA
FT                   GRTPIAWDLATGEPQLVQVGGIPALPLPDGSVLTPVSADSDQDEPWRRPATDPLDPYTL
FT                   IQEHLTAGISMTGGHLGVAGLAWMGARVYDSTTASFLTIDPLAAPPGSLWEAASYGYAA
FT                   TNPLALADPLGLRPVTDAQMRQFASTIDTRNLWDRHIRNVFSWETLGGVALATAGGLLM
FT                   CFGAEVPGAMLIGAGGDMVFQQVVRGHVDYGEVALSGALAPTGGSGLSEIAGLGTRTLL
FT                   TRGIEAGTTQGYVMGNYHWGTSPGPHNAETYLEQVGGETLSGAAFGGITATIGGKTYDA
FT                   LPDSIPTGHFGPHNTILRVGKQPETFIRKYQRNGKLDFGQATSFRGATFKSKIAIKPIT
FT                   TYRSWSDPDYEVGGYVSRTRPAGPLQTQLDLALAPQWGNKANHISEYEIPQFAPFYEGA
FT                   AGVQPVKAIEDSDTLGQLPGGGNQILITDKQVLDRWKSKK"
FT   gene            complement(274189..276981)
FT                   /locus_tag="HMPREF0675_3242"
FT   CDS_pept        complement(274189..276981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3242"
FT                   /product="YD repeat protein (3 repeats)"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift; identified by match to protein family HMM
FT                   PF05593; match to protein family HMM TIGR01643"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3242"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00247"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9J0"
FT                   /protein_id="ADE00247.1"
FT                   /translation="MVDFSVFGDYQNPVEFNFSTAEGFSSQLRWTSQRINIFDARTSLV
FT                   ESIASRGFRGFFATVFTQNIHICSADAMALSEALTTAADMVDYLAEQARLENKRRQQVR
FT                   DFAAQHDDFGDHVRDFFTGVDVPPNLTPAEPPSPQLLHPPVTGDRQQDRSIRGSSGGIS
FT                   AADPKDLISAAQVLGEAAAQVPSGSVLAGWFDDFTSQCKYGTVEVGDLFVQLDRWRGLN
FT                   DGDVEWLHAVAKAFQAAGSGVITLPNSALRAALRAAGTPLWRTDLDITSPGLSGIDPRT
FT                   GYLEDPINSATGNFIEPETDLAFAAASSPLALSRMYNSIQAVRGQGGVFGPGWVSILDQ
FT                   CLLVKPGCVEWVREDGRHIAFAVEAAPTAVLPTTNQLPNPAEEDEKPVEQWRAQGENLW
FT                   LSRVSASQLPEFLRDPATSKWVWVISDNRGGRWVFTEGGAWVCSGSSQRDVVHTVREGD
FT                   RVTAMETSWGHKITVSYGGARVVSAISSDGRCVRYSYDDENRLVQVDGPDGSRRYEWDD
FT                   TLITTVVDACGNAECINSYDGRGRITSQQAANGRTVHFRYLPGGVTAASDADGTNANTW
FT                   ICDAHGRTTGVVDAHGGQVSMTYDSFGNMVRCVDRAGNVTSHRYDQRGRLTHTDLPTGG
FT                   TIDCSWDDLDRLVSTTLANGAQTTFEYDGTERDPVRVTDPCGGVTVAEWKDGLLLRATN
FT                   PVGVSLRFSYDHHAELVRVEDAHGEASRLIRDEAGRIVETISPGGATTRFSYDDAGRLA
FT                   AVVTPDGATWEHRYDVAGHLIELVAPDSGVTKWEYHPDGQISRVIDPLGRVIEHSYDHL
FT                   GNLAGMQLPDGSAWSFIHDALSRLTQVVAPDEARWTYAYDVDGNLSGVTDPAGFARPGS
FT                   LLTVSLPAPPRIVTGTNSTASMPIPTVLLLPSPMSLAPSRSSRVICVADRLSFRTSLAR
FT                   "
FT   gene            complement(277101..277823)
FT                   /locus_tag="HMPREF0675_3243"
FT   CDS_pept        complement(277101..277823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3243"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3243"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99560"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9J1"
FT                   /protein_id="ADD99560.1"
FT                   /translation="MTKKLTKTCLLGMVGIMAISLAACGDKTNSSSDTPANPSPSTKAV
FT                   KRISKDDFTKAFSHKKIDGHTFVIQDNSQLRPVVDNLDKTLSQAKISPAGCDAALRQSS
FT                   LGLTSHEISDTLVAVSDKPSTRIIVTTAMSDRQKKAYKSQEEQTSKCGHTTLSTQGVNH
FT                   GLEINIKASPIKGYENISKQAALFDVSIKRSTGTSDHGYQAYIWLNNDQAIRIFGRDAG
FT                   IVKSTLQSATKALGIAKK"
FT   gene            complement(278029..278113)
FT                   /locus_tag="HMPREF0675_3244"
FT   tRNA            complement(278029..278113)
FT                   /locus_tag="HMPREF0675_3244"
FT                   /product="tRNA-Ser"
FT   gene            complement(278193..278558)
FT                   /locus_tag="HMPREF0675_3245"
FT   CDS_pept        complement(278193..278558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3245"
FT                   /product="S4 domain protein"
FT                   /note="identified by match to protein family HMM PF01479"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3245"
FT                   /db_xref="EnsemblGenomes-Tr:ADD98918"
FT                   /db_xref="GOA:D4H9J2"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9J2"
FT                   /protein_id="ADD98918.1"
FT                   /translation="MTRIDVWLWSVRVYKSRSLATAAVKGGHIRLNGDPVKPSHDVKPG
FT                   DTVTIHTPGWDRVLKVVNPITKRVGAKLAVEAYEDLSAPRPAYLSAPLARRDRGTGRPT
FT                   KKDRREIDRLRGRDSRY"
FT   gene            278683..278786
FT                   /gene="srpB"
FT                   /locus_tag="HMPREF0675_3246"
FT   ncRNA           278683..278786
FT                   /gene="srpB"
FT                   /locus_tag="HMPREF0675_3246"
FT                   /product="bacterial signal recognition particle RNA"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            278841..279197
FT                   /locus_tag="HMPREF0675_3247"
FT   CDS_pept        278841..279197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3247"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3247"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01250"
FT                   /db_xref="GOA:D4H9J3"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9J3"
FT                   /protein_id="ADE01250.1"
FT                   /translation="MDDQRRIITTDRAGSIWAGITWCSLLLFIVAGIIGMMAQTMLPAN
FT                   LGYPQLHDSGVPTWLTWTVVGLDVVAFFIPPLVTTSCGRKAKRLGHPVRSAVQISWATF
FT                   TVVTVISFLLVFFG"
FT   gene            279265..282138
FT                   /gene="dnaX"
FT                   /locus_tag="HMPREF0675_3248"
FT   CDS_pept        279265..282138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="HMPREF0675_3248"
FT                   /product="DNA polymerase III, subunit gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM TIGR02397"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3248"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00355"
FT                   /db_xref="GOA:D4H9J4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9J4"
FT                   /protein_id="ADE00355.1"
FT                   /translation="MDERAPEPGMENEAVEPEVFEQDGPDLFGDEESPRPVMPPDEATP
FT                   DDDLPSDPCDPGLLDGPETPEEPDGLETDEDEEDGADVIERVQELIGEAPDSNPDDDLP
FT                   ELPLALYRRYRPETFDEVIGEDHVIEPLKRAILNNRVNHAYLFSGPRGCGKTTTARILA
FT                   RALNCEQGPTPTPCGTCQSCRDLACGGPGSIDVIEIDAASHGGVDDARDLRERAFFAPV
FT                   HSRYKIYIIDEAHMVTPQGFNALLKLVEEPPPHVKFIFATTEPEKVIGTIRSRTHHYPF
FT                   RLVPPKVLVEYLAELCGKEGIDVDHAVLPLVVRAGGGSVRDSLSVLDQLLGGAADGHVS
FT                   YEQAAALLGYTPEALLDEIVDAFAAGDAHQVFATIDKVIEVGQDPRRFAEDLLRRMRDL
FT                   VIVSAVPDACRSGLIDVSPEQATRLAHQVSGFGAGELTRAAEVLATGLTNMRGTTAPRL
FT                   HLELMCSRILLPGADTDGRGIHARLERLERRIGVSGPVEEVERAERPVTAQPPTRYADT
FT                   PQQASPPQHWPAENLQNPERRSAPEHHDAPSPGQRPSGRPRPSRKDYRPGNQLAEQPPS
FT                   NQHGDDGQMSQGPRQQGGPSTSQRQQPRPQDHQPSQRDRQDTPPAQPQQPSAEQGGRAD
FT                   DAINITTLRREWPQVLEAVKDGGRVAWMVLNQYAQVLEVHGNQATLGFSNIGARENFAA
FT                   GNYPKVLHDAVVKVLGVDLAFTAVVGEPPAAVRPESHPAEFQSGPAAQEPPDDDPWEQG
FT                   PHHQDSTRGGEPSDPTHPGRDPQGRPGDRQAISDDASKDAPPPPVTSSHPSEAGDDDPA
FT                   PDATTEDQSADVRDEVVESGPVAGAPDPDSGGAAEPKPDLVPGQDHVEAAGRAESARQI
FT                   DPGGASSQGRPSAAAVSTAHRWSERAKGSVRPLEVTSRSAQVEEPPDDGGEWDDTVVEE
FT                   SNESPIDLIMRELGGVVIDTDGDSTAR"
FT   gene            282248..282571
FT                   /locus_tag="HMPREF0675_3249"
FT   CDS_pept        282248..282571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3249"
FT                   /product="DNA-binding protein, YbaB/EbfC family"
FT                   /note="identified by match to protein family HMM PF02575;
FT                   match to protein family HMM TIGR00103"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3249"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99493"
FT                   /db_xref="GOA:D4H9J5"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9J5"
FT                   /protein_id="ADD99493.1"
FT                   /translation="MTTGGFDLGGLDIGALLAQAQSVQNQLEAAQNQLAESNFEGTAGG
FT                   GLVRATVTGTGELDALTIAPEALEDTDAETLADLVVAAVKDATGQARAMQQSLMPQMPS
FT                   LGL"
FT   gene            282602..283207
FT                   /gene="recR"
FT                   /locus_tag="HMPREF0675_3250"
FT   CDS_pept        282602..283207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="HMPREF0675_3250"
FT                   /product="recombination protein RecR"
FT                   /note="identified by match to protein family HMM PF01751;
FT                   match to protein family HMM PF02132; match to protein
FT                   family HMM TIGR00615"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3250"
FT                   /db_xref="EnsemblGenomes-Tr:ADD98989"
FT                   /db_xref="GOA:D4H9J6"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9J6"
FT                   /protein_id="ADD98989.1"
FT                   /translation="MYDGPLQELIDALSRLPGIGPKGAQRIAFHILDAPAEEANELADA
FT                   LREVKEKAKFCKICFNVSSDEVCQYCRDPRRDQSMICVVEESKDVIAVERTRQFRGLYH
FT                   VLGGAISPLDGKGPADLHIRELCQRLADETVTEVILATNPNLEGEATATYLSRLIAPMG
FT                   VTVSRLASGLPVGGDLEYADEVTLGRAFEGRLHVGVGA"
FT   gene            283315..283890
FT                   /locus_tag="HMPREF0675_3251"
FT   CDS_pept        283315..283890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3251"
FT                   /product="transcriptional regulator, PadR family"
FT                   /note="identified by match to protein family HMM PF03551"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3251"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00872"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR018309"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9J7"
FT                   /protein_id="ADE00872.1"
FT                   /translation="MSIKFAILALLAEKPRHGYEIKNEFDRRTNHTWPLNIGQVYTTLD
FT                   RLERDGLCYRGEETPDGRVIATISPKGREEVRRWFTTPIAPANPPRNELAIKIALAATS
FT                   KDVDVATLIQDQRHATMHQLQECRQARRSVAEDDLAGQLLVDGMIFAAEAEIRWLDHCE
FT                   SKAVQASHARPHQPAEPVTDGSKAVQEA"
FT   gene            283896..284678
FT                   /locus_tag="HMPREF0675_3252"
FT   CDS_pept        283896..284678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3252"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3252"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01105"
FT                   /db_xref="GOA:D4H9J8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9J8"
FT                   /protein_id="ADE01105.1"
FT                   /translation="MTSTPLHAADQITPTMQRTVLSLDHVSRSFGEGEQRVDAIVDVSL
FT                   GVNPGTFAAVMGPSGSGKSTLLGLAGGLDQPTSGTVSVCGEPLGGMSRDDLARVRRRQL
FT                   GFVFQDYNLVPTLTAVENVSVPLELDGVSATRARKAAEIALERVGVPELVDRHIEKMSG
FT                   GQRQRVAIARGIVGDRRVLLADEPTGALDSVTGDEIMALIRTLADEGVAVVLVTHEARH
FT                   AAWADRVIFLRDGRLVDESQVVSDPMELLNDNPKRGRW"
FT   gene            284675..287317
FT                   /locus_tag="HMPREF0675_3253"
FT   CDS_pept        284675..287317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3253"
FT                   /product="efflux ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3253"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99524"
FT                   /db_xref="GOA:D4H9J9"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9J9"
FT                   /protein_id="ADD99524.1"
FT                   /translation="MMSARTTPEMPTSAVRLSGDAIARGRPHRRLINRLAVRDIGRHKL
FT                   RSLLIVMLIALPVAIMSGLGVLLRSDGSVSGSQALNNYGDADMVISPISNWDGHCSQQG
FT                   PTNTYCDDGAEPDAHQRAQQQTALANLRLPGHKLHPLRTTEASVSWRLATLSATVKAMD
FT                   LTTMRPYRMEFPRGPMPTGNNIWVTTGAAKDYGWSVGSRVTVNGHRYTITGVVREEWPG
FT                   NGPTFWVAPRSPLARGGELTYYVNGASLTRQQVEKLNASGVGVADRRAEESASQGDTFE
FT                   RDMFALILAAGVLSAIVVATIAAAAFAIGARQQRRMLALLGITGAARRDLMGVMIHQGL
FT                   LLGLTGALLGVGLGVGMGDGAVAIIRIVYPDYITYGVDWGYAAVGSVVGLLAALTACWF
FT                   PARDVARQDALMGVKHAESAARPARRPTLAIVIAAIGLLAGVGGVIYGRRGTTGDVMVR
FT                   LNIGIIVTIVVLYLAAVSAMPWLVDKVSGRKSSRLPIRFALRDLNRNRGRAVPGVAASM
FT                   AITVLACAAVTFCDSLAIQDKAEYVPEFGDHIGVLAGEHDDGVRTSDDRVAGEIKRVTA
FT                   VFGPHVKYLRPEEPVTCGQDGKYCTSSLEVTPKVPNGAMSSTVAIDDGTLYELLTGEKA
FT                   DGRVMKALDDGVVLFSPDATRISQAIISDHDERHGAGTTVLPAIHAPHHALGYGVPNLI
FT                   SRRTAAKVLGVSPDNMKTQSTTVWLRLPHTPTAREGDRLQHSLMDVTGSPSEFIWEKGY
FT                   SDISGTVMRWSAVVGTLLAVCVGAVVLALTLSDSRGSRTAIASVGASKATLRRMVAAQA
FT                   LVTTGLGQILGFLVGFVPVAVMTCVGPRWPMPMPLPWLALIVFAPPVLLALVTMVAVPV
FT                   PRPRMQRLD"
FT   gene            complement(287321..289156)
FT                   /locus_tag="HMPREF0675_3254"
FT   CDS_pept        complement(287321..289156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3254"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06738"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3254"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99142"
FT                   /db_xref="GOA:D4H9K0"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9K0"
FT                   /protein_id="ADD99142.1"
FT                   /translation="MAEKRPGARSGSASRNHPRSWHGDDPIPRTADGIDARIFRPGQAS
FT                   AQPATPPQSSATPPEPPVNEENPTRMAPVGNLSRSWPLTRSRTVSPHNGQAKLRHSRPP
FT                   RAHRTRRVPLEKLFRAKTPVEPTLALNLGDAEMAIMQARRVVDLVTRVAVMAISVGGSA
FT                   SEAVAIALRITATYGVTVHIDITNTSVIVTQHRGLDEDPITVLRVVRSRSNDYQRLGEL
FT                   QLLVDDICDKTVGLEEAADRLAAITRSPRLYRQWFVTMNIGLMGAGLSTLFGGTVMDGV
FT                   LSFFSTCIVDATVQAMARKRITNFFAQAAGGAIATAFALIVMVYMAASNHPLPLSPSLI
FT                   VAAGIVSLLAGGSFVAASQDALDGYVVTSSGRFLEGFVQTGGVILGVITAMWIGLRLGV
FT                   PGYISPALGFSTNPVLQMVAAAVIAVTFGISSHAGYRTLAICAALGAAAWAGYLLGMQL
FT                   TGSVSAASGLAAMVAGFIAGLGAKRWKVPQLGLVTIAIVPLMPGVMMYRALYMIVNAQN
FT                   ETGGTSNAGWTLFLEALLVGVALAVGGSFGALLARPFTLPKDLRSRLATLASWGAGQAV
FT                   PRERRRRRSQPPADPHHPALNNTETDPTVTGTWAR"
FT   gene            289267..290067
FT                   /locus_tag="HMPREF0675_3255"
FT   CDS_pept        289267..290067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3255"
FT                   /product="HAD hydrolase, family IIB"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM PF08282; match to protein
FT                   family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3255"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99441"
FT                   /db_xref="GOA:D4H9K1"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9K1"
FT                   /protein_id="ADD99441.1"
FT                   /translation="MLIATDLDGTFLTPDATVSPRNRAAVKAAEAAGIHVIPVTGRAIG
FT                   GLRVIGPVFHRYALVSNGAVGTDMSTGETLFTETMSARTVKSYVDQLTAECPGVVFCAE
FT                   VGDSSVFLVEEGYDEIVPAFESENDPAEHVLVSRKELCSSEAVKLMIVHPTVPASDIYQ
FT                   LSRRLRVPGVHATWAGFTVAEAGPADVTKASGLERICQLLGEDRANVVALGDGANDVEM
FT                   LQWAGVSYAMSGAKPEAIAAADRRAPSCEEDGFAVVVEELLASR"
FT   gene            290077..290886
FT                   /locus_tag="HMPREF0675_3256"
FT   CDS_pept        290077..290886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3256"
FT                   /product="Cof-like hydrolase"
FT                   /note="identified by match to protein family HMM PF08282;
FT                   match to protein family HMM TIGR00099; match to protein
FT                   family HMM TIGR01484"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3256"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00788"
FT                   /db_xref="GOA:D4H9K2"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9K2"
FT                   /protein_id="ADE00788.1"
FT                   /translation="MLIATDLDGTLLTPDGTISPRTRDAIRVAEKAGVPVVPVTARQIY
FT                   GIEKWRDDLGRWALCSNGAICWDLQARTVLFRQLMPGAVANEFAHRLLDAAPGTRFLTI
FT                   KDDGLTFASQRGYAELTTFADHSREPSDMPALDLDEVLDGDCLKMVARHPNLSVEELAA
FT                   RAASVGMADEVHVTTSGKPMLEISAKGVAKDSGLSMLCDHLGIDRADTVAFGDGANDVE
FT                   MLAWVGDSYAMAHAVPLAVAAARHRAPSNAEDGVAQVIEKLLSMRER"
FT   gene            complement(291533..291736)
FT                   /locus_tag="HMPREF0675_3257"
FT   CDS_pept        complement(291533..291736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3257"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3257"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00465"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9K3"
FT                   /protein_id="ADE00465.1"
FT                   /translation="MSGHHKTTSSAELREQIPKYVLLRWVKASSWLIEQNNRLFSYQSL
FT                   SQTNSTQLSSGQLIGLVLQTVF"
FT   gene            291758..291904
FT                   /locus_tag="HMPREF0675_3258"
FT   CDS_pept        291758..291904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3258"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99126"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9K4"
FT                   /protein_id="ADD99126.1"
FT                   /translation="MYNRVVILHEGHIAYDGSTDEFLMHGAGSSHAAEAAFLDVVGVSE
FT                   QAR"
FT   gene            291901..293106
FT                   /locus_tag="HMPREF0675_3259"
FT   CDS_pept        291901..293106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3259"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01051"
FT                   /db_xref="GOA:D4H9K5"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9K5"
FT                   /protein_id="ADE01051.1"
FT                   /translation="MTWHLLLRRSYGVRFVPVMLLMWWYGAFGNPPARSAIERASSILY
FT                   AFMMVAGPVALSTCLELRRFTEGQILKRLSKRSRLRIVAPWWEIAVLPSTIAVGVFVLL
FT                   SGSGDQIVKMSLIGVVWMLAWGVFGAVIGMSWPLALSAPTALLIPFILVLYGPAVSVLE
FT                   MRYLVGYYMDCCNAGEMLDPQVLAAGMTMACGVLVVSMVAFIASRGRHHSSVIVTVILI
FT                   IGLVSTVLIGFREVEGVGAFPAVPRTGTQTCLKDPTVCTWDAHDLQLLGPIVQKADAAW
FT                   RANGVHVPRAYRQGIGQSTQTIVWWSASAEDVSESALPALSAVAEGLAVAPCQVRQDEV
FT                   ETWVEDVQERVVAWLVEHSGIEVRDTALSPETREWLKSIDRLPIEKQVSIIEHDRARLR
FT                   TC"
FT   gene            293421..293708
FT                   /locus_tag="HMPREF0675_3260"
FT   CDS_pept        293421..293708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3260"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00387"
FT                   /db_xref="GOA:D4H9K6"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9K6"
FT                   /protein_id="ADE00387.1"
FT                   /translation="MGNLPVGMVATRNTVGLSGVTLLANALGVTRLSSLPATIWVLMSL
FT                   LAGSTASFEAPWSWPVKDRTDVLSAVLSVALCLLGISASLVKPRPWRNRG"
FT   gene            294353..297721
FT                   /gene="ileS"
FT                   /locus_tag="HMPREF0675_3261"
FT   CDS_pept        294353..297721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="HMPREF0675_3261"
FT                   /product="isoleucine--tRNA ligase"
FT                   /EC_number="6.1.1.5"
FT                   /note="identified by match to protein family HMM PF00133;
FT                   match to protein family HMM PF08264; match to protein
FT                   family HMM PF09334; match to protein family HMM TIGR00392"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3261"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99963"
FT                   /db_xref="GOA:D4H9K7"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023586"
FT                   /db_xref="InterPro:IPR033709"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9K7"
FT                   /protein_id="ADD99963.1"
FT                   /translation="MTDVNPVRSDNCRQYNNVPPQIDLPAMDHEIIDLWARQHTFDKSL
FT                   EATKDGQPWTFFEGPPTANGQPGTHHVEARVFKDIFPRFKTMQGFRVDRKAGWDCHGLP
FT                   VELAVEKELGFSGKPDIEEYGVEPFNAKCRESVTRHVDAFSELTERMGHWVNMDEAYWT
FT                   MSPSYVESVWWGLKRIWDKGLLGEDHRVAPYCPRCGTTLSDHELAQGYQDDRDPSIYVR
FT                   FPVTSGPLAGRAKLLVWTTTPWTLVSNTAVAVHPEVRYVVAHRDPVPEGSDAVATASAE
FT                   DPASQDLIIAEPLFEKVLGEGWSLTGESFLGSQMELWTYERPYNFLEWPKTERVTVDGR
FT                   PTPADANFVVLADYVTVEDGTGLVHQAPAFGADDLQTCRRYGLPLVNPIRPDGTFEESV
FT                   PLVGGQFFKTADKPLCEDLDRRGVLFRLEMHWHSYPHCWRCDTHLIYYAQPSWYIRTTK
FT                   VKEQLLAQNEVTTWYPETIKHGRFGDWLENNIDWAVSRSRYWGTPLPLWRNDDDRSDVI
FT                   CVESLAELSQYVGRDLTGMDPHRPFIDEVTFTRDGHTYHRVPEVADAWLDSGSMPFAQW
FT                   GYPHVPGSKEKFESHYPGDFICEAIDQTRGWFYTMMAVGTLVFDESSYRNVLCLGHILA
FT                   EDGRKMSKHLGNILLPIPLMDSHGADALRWFMAADGSPWSARRVGDETIQETVRKVLLT
FT                   YWNTVSFQVLYARANGWSPAQGTQHDADPARGFGGVVPPAVDAVVPPAVGSRGFGGVVP
FT                   PAVTERHVLDRWLVSATNVLVRDVTEALNNFDTQRVGNLIAQFVDELSNWYVRRSRRRF
FT                   WDGDEGALWTLHETLETLTKLMAPMVPFITERVWQDLFVTTNPHGPESVHLASWPVADD
FT                   SLIDESLSESMDLARRIVELGRGARAEAKAKIRQPLSRALISGAALAKLDEDLQAEIRS
FT                   ELNVMALDSFTAAGDLVDHCAKGNFRALGKKYAKATPKVAAAIAAADPEWLASELAIKG
FT                   SVEMDVPEVEGGKAVVTADDVIVSERPREGWSVVNEQGETVALDLEITPELARAGQARE
FT                   VIRFVQDSRKKAGLDVSDRITLAWSASADLATAIEEHAEQISQEVLAVQMSREPRADDW
FT                   AVEPDLGLAVKVVKV"
FT   gene            complement(297836..299173)
FT                   /locus_tag="HMPREF0675_3262"
FT   CDS_pept        complement(297836..299173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3262"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06354"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3262"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99445"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR021144"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9K8"
FT                   /protein_id="ADD99445.1"
FT                   /translation="MQKTRCQTPLSPSEINNLIEALHQGVTPATGCTEPIALAYAAARA
FT                   KRALGSDAKQLDSLHIDARVSPNIMKNGMAVMVPGTGRPGLEIAAAVGALAGNPDAGLA
FT                   VLADVSEDAAEKARHLVDSGAVELTVADVDDDLYAETVLHLDGHHARACIAGDHTNVFL
FT                   VSRDDEVLESKERPAAGHVPPTAALLQGLSLAKIYDFATTVDIERIEFITEAERLNSAL
FT                   VDAGRDGSYGIGEGAAILGSIDRGMASDDLCTRMTAYTAAASDARMGGAPLPAMTNSGS
FT                   GNQGIVATVPVTVAADYAGVDHERRVRALALSHAVALYAHAGLPVLSAFCAATTAAMGA
FT                   AAGICLVLDGSYSAVERAVASMTGDVVGMVCDGAGCSCALKVSASANAAGRAALLSLAG
FT                   RRVPGTNGLVHDDVDAAIRGIGRLGTEGMKQTDPEILSLMMAKQTV"
FT   gene            complement(299237..300532)
FT                   /gene="stp"
FT                   /locus_tag="HMPREF0675_3263"
FT   CDS_pept        complement(299237..300532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stp"
FT                   /locus_tag="HMPREF0675_3263"
FT                   /product="serine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3263"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99175"
FT                   /db_xref="GOA:D4H9K9"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9K9"
FT                   /protein_id="ADD99175.1"
FT                   /translation="MNTLVTVDRPASMTEQEWRKAIKFDSTDWGWIIMSIGMAIGAGIV
FT                   FLPVKVGLVGLWVFLVSSVIAYPAMYLFQRLFINTLAESPECKDYPSVISGYLGKNWGF
FT                   FIGILYFIMLVIWVFIYSTALTNDSASFLHSFGVTKTVWSHNPFYGLVVICIMVAIASR
FT                   AEKILFRISTVMVLTKLSVVTFLGLAIIGSWNLANVGAFPSLGYLVKQTIIMLPFTLTS
FT                   ILFIQSLSPMVISYRAHYRSIEVARHKALCSMNIAFSVLFITVFFYAISFNLTMGHDVA
FT                   VKAYNQNISTLAMVAQGMGGTTVKIFSLILNIFAVMTAYFGVFLGFREACQGIAMNVLR
FT                   RLIPEERINKKIVSWSILVFAILVSWGAILLNAPVLSFTSICSPIFGMIGCLIPAYLVF
FT                   KVPSLHKFRRPSLILIIATGILLVVSPFLAFS"
FT   gene            complement(300510..300662)
FT                   /locus_tag="HMPREF0675_3264"
FT   CDS_pept        complement(300510..300662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3264"
FT                   /product="hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3264"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00670"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9L0"
FT                   /protein_id="ADE00670.1"
FT                   /translation="MTDVPLPLRPCWIIMDTSTTTCSMQGKEYANIIKNPNLDEVDSHE
FT                   YIGHC"
FT   gene            complement(300759..301784)
FT                   /locus_tag="HMPREF0675_3265"
FT   CDS_pept        complement(300759..301784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3265"
FT                   /product="oxidoreductase, NAD-binding domain protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift; identified by match to protein family HMM
FT                   PF01408; match to protein family HMM PF02894; match to
FT                   protein family HMM PF03447"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3265"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00448"
FT                   /db_xref="GOA:D4H9L1"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9L1"
FT                   /protein_id="ADE00448.1"
FT                   /translation="MDTTTTIGWGIAGTGRIARTILKDFAHVPGARICAIASRSAARAD
FT                   AFADLVTQNLSCPRPDTHDSYVDMITNPTVDVVYVATPHPQHRPIALAAIDAGKAVLVE
FT                   KSFAATAHAAAEIAEAARAKRVFAMEGMWTRFLPVVTEMIDAVNNGAIGEPTGIQGDLF
FT                   ALRDYDPDDRLFSPALGGGITLDLGVYALDFAIRLFGEPTEVIARGNHFPNGVDSDASM
FT                   LLTFPKNKFATLAISFTSDGPGRMTIQGTDGWIEVEPRFHHPSRILIHRRGVIPEIHNT
FT                   PALGRGYAHELMEVCQCLRAGRTESLTMPLDDTLAVARTMSRVLDQLGVENYDDTELSH
FT                   A"
FT   gene            302074..302190
FT                   /locus_tag="HMPREF0675_3266"
FT   CDS_pept        302074..302190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3266"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99704"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9L2"
FT                   /protein_id="ADD99704.1"
FT                   /translation="MTERERRRLLRERPDVTSWRDVLLADRGTLTKTARVKS"
FT   gene            302187..302360
FT                   /locus_tag="HMPREF0675_3267"
FT   CDS_pept        302187..302360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3267"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99459"
FT                   /db_xref="InterPro:IPR025234"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9L3"
FT                   /protein_id="ADD99459.1"
FT                   /translation="MTRWEYFTAPILVHASQQILNNFGADGWELVQIVAGPNPDSLVGY
FT                   FKRPLPDQEEPR"
FT   gene            302357..302812
FT                   /locus_tag="HMPREF0675_3268"
FT   CDS_pept        302357..302812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3268"
FT                   /product="endoribonuclease L-PSP"
FT                   /note="identified by match to protein family HMM PF01042"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3268"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01144"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9L4"
FT                   /protein_id="ADE01144.1"
FT                   /translation="MSATTRCAELGITLPPVAAPVADYVPAIQTGSQILTSGQLPFVDG
FT                   ELTAVGKVGDAVSAEQAAEAARAAALNAIAAAADVAGGLDAIKRIVRVVVFVNSAPDFT
FT                   GQAGVANGASQLLGQVFGEHGRHARSAVGVATLPLGSAVEVELTVEV"
FT   gene            complement(302895..303626)
FT                   /locus_tag="HMPREF0675_3269"
FT   CDS_pept        complement(302895..303626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3269"
FT                   /product="cyclic nucleotide-binding domain protein"
FT                   /note="identified by match to protein family HMM PF00027;
FT                   match to protein family HMM PF00325"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3269"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00857"
FT                   /db_xref="GOA:D4H9L5"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9L5"
FT                   /protein_id="ADE00857.1"
FT                   /translation="MHVLMRGDVRMANVVATAATQPFFATLGAASAARIMAMCEASVCP
FT                   RNTVIFEAGDSADNLYLVVEGKVKLTRSTTADDLTPRDSLLWLMGPSDMFGELSLVDGG
FT                   TRSTTATTVTRCSLLKTPGAQMRELVKGRHDVALAMLGRLSERLRRADDNTAHFVSGDV
FT                   PSRLAYTLLDLARRFGTANPSTGHIVVRHDLTQHELAQAVGSSRETVNKALTDFAARGW
FT                   IAARPKVVTIMEPEKLASRAN"
FT   gene            303787..304440
FT                   /gene="nth"
FT                   /locus_tag="HMPREF0675_3270"
FT   CDS_pept        303787..304440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nth"
FT                   /locus_tag="HMPREF0675_3270"
FT                   /product="endonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /note="identified by match to protein family HMM PF00633;
FT                   match to protein family HMM PF00730; match to protein
FT                   family HMM TIGR01083"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3270"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99787"
FT                   /db_xref="GOA:D4H9L6"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9L6"
FT                   /protein_id="ADD99787.1"
FT                   /translation="MRALLAKAYPDAHCELNYAGPYQLLVATVLSAQTTDRRVNTVTPT
FT                   LFNRWPGPLALADADIGEVETVVAPLGCGPTRAARLVSMGAKLVDNFDGAIPDDLDSLV
FT                   TLPGVGRKTANVVLGNAFGIPGITPDTHVMRVSRRLGWTDATTPAKVETDLAELFDPSE
FT                   WVMLCHRLIWHGRRRCHSRRPACGVCPVAEWCPSFGEGPTDPEEAATLVREPRR"
FT   gene            304773..305024
FT                   /locus_tag="HMPREF0675_3271"
FT   CDS_pept        304773..305024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3271"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00352"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9L7"
FT                   /protein_id="ADE00352.1"
FT                   /translation="MHFLGIDYAESDASEAISFAGDAGLTFPHLQDPDSTIQGAWQISG
FT                   VPVTFIVRDGTIVTRHSGQWRSQRELDSAIDKVIKRTP"
FT   gene            305021..305677
FT                   /locus_tag="HMPREF0675_3272"
FT   CDS_pept        305021..305677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3272"
FT                   /product="hydrolase, NUDIX family"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3272"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99808"
FT                   /db_xref="GOA:D4H9L8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9L8"
FT                   /protein_id="ADD99808.1"
FT                   /translation="MSHLSALIASLGRDDPDFSVGRRPGGGRSSAVLALISEEGNDIVL
FT                   TRRPLSLRHHAGQVALPGGRAENTDETIVDTALREAHEEVGLDRRLVTVRGVLPTAHVA
FT                   ASGSDVTTVIATWSGAGTVGVVDPAEVAMVQRVRLADLANPAARATTRHPSGYRGPAFV
FT                   LPDIFVWGFTAHVLDALLDRGGWSRPWDRERMVEIPEGYLGARRLPEEMTPNDIP"
FT   gene            complement(305758..306294)
FT                   /locus_tag="HMPREF0675_3273"
FT   CDS_pept        complement(305758..306294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3273"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07332"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3273"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99342"
FT                   /db_xref="GOA:D4H9L9"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9L9"
FT                   /protein_id="ADD99342.1"
FT                   /translation="MADKLPVGDTIDNLKTDGQKLVQDSKALVTAEIKPAAKHAGIGVG
FT                   MFGGAGYFGIVGALLLWLCGAFAFSLMWQHIGNWDILLSLVVGFATMAVVLFILAGILA
FT                   LAGKGQISQVKAPTGIVDEAKSTLTAVKSAVARGKYNATARSSIDASEIPSPAAPVAAD
FT                   GTSAPRRASGATERD"
FT   gene            complement(306391..307653)
FT                   /gene="nhaA"
FT                   /locus_tag="HMPREF0675_3274"
FT   CDS_pept        complement(306391..307653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaA"
FT                   /locus_tag="HMPREF0675_3274"
FT                   /product="Na+/H+ antiporter NhaA"
FT                   /note="identified by match to protein family HMM PF06965;
FT                   match to protein family HMM TIGR00773"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3274"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01184"
FT                   /db_xref="GOA:D4H9M0"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9M0"
FT                   /protein_id="ADE01184.1"
FT                   /translation="MTDSRKNKRPRKSILRPVTGPNALHLSDIFRNETTGGMLMLAATV
FT                   AALLWANLGHHSYHFFRELALGPLTIEQWAADGLLTVFFFIAGLELKREFVEGSLSRPA
FT                   DALVPIVAAVCGMVFPAGIYTLFNVLASDGHPAGWAIPMATDIAFALAVLAIVGAGLPQ
FT                   AVRAFLLTLAIADDLGSIIVIAVFFSTGLDIWWLAGAIACIGLWGVMQHFHVDNGWWYV
FT                   PIFIVGWWCMLRSGVHATIAGVAFGLLTRTEEDVLDDPVDRWQHKVEPWSAGVVVPFFA
FT                   LMSAGVHVSGKTFLALWTHPISLGIVCGLILGKVIGITLGSCLTARFTSAELGRGVVWR
FT                   DIIAVAVLAGIGFTVSMLMTDLSFPKNHEFADEAKASVLMASFLAAILGGAMLHHRGKS
FT                   HAMRQTKHSHEVPVAAGTCND"
FT   gene            complement(307821..308966)
FT                   /locus_tag="HMPREF0675_3276"
FT   CDS_pept        complement(307821..308966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3276"
FT                   /product="methyltransferase domain protein"
FT                   /note="identified by match to protein family HMM PF08241"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3276"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00667"
FT                   /db_xref="GOA:D4H9M1"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9M1"
FT                   /protein_id="ADE00667.1"
FT                   /translation="METAPTPSPTQPCPLLPAMDHSSTKPVTRLRGPLRLPHQPHRWLP
FT                   LTRRPPPIDYPGSPRRPLSPPGQHYAQADAPQRPVLVQESSYLQLSSETAEFVTQCQIC
FT                   GKPCQLADEPLWTTLATTIPSTIGAMAVSSAPHLPSGSFEWLTAGRVDPGSRVVVLCPT
FT                   VAHCRAVASHGADVLAVHRDPDTAEKLNRIPGVMAVCGSPESLPLNSSSFDAVLVHQGF
FT                   HELAPGLALPEIARVLRPGSVLGVSWLVRDDTVPWVKRLAALLRTVDENAMSGDYGTES
FT                   VHELISSKYFPEDEHTTKRLWVPVNRDSLVAMAAARPAVRALDSDARSNVLTKVAALAD
FT                   DSAGTSGLRLPYQLECWRAWVDHDELTTPIRPHDDGLTITL"
FT   gene            308930..309766
FT                   /locus_tag="HMPREF0675_3275"
FT   CDS_pept        308930..309766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3275"
FT                   /product="CpaE-like protein"
FT                   /note="identified by match to protein family HMM TIGR03815"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3275"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00130"
FT                   /db_xref="InterPro:IPR022521"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9M2"
FT                   /protein_id="ADE00130.1"
FT                   /translation="MAGSVMAWGLSPRSGTYVVGFDAEEAARWSAGLSASVIVVPRANQ
FT                   VLTEILHDELATTSRATVVQVNSSGGGTGVSTLASGLAWAAARSGIKVGLVELNPSAGG
FT                   IDLLLGIERKDGWRWPELASARGVTTDLGSHVPSLDGVEVVSAGRVGVHVPPAARRAVV
FT                   DSLAGDHDLVVVDPGGLDTPEVTVNVKVGVVAADLRSVMTARGQNLPDLLVARRGPGRS
FT                   MPDEDIESVLGVRPDMTIKDDRRLARGQGDGEAPWVVASRRWRSGCAELVDQVMGS"
FT   gene            309763..310929
FT                   /locus_tag="HMPREF0675_3277"
FT   CDS_pept        309763..310929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3277"
FT                   /product="helicase/secretion neighborhood ATPase"
FT                   /note="identified by match to protein family HMM PF00437;
FT                   match to protein family HMM TIGR03819"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3277"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99956"
FT                   /db_xref="GOA:D4H9M3"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR022399"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9M3"
FT                   /protein_id="ADD99956.1"
FT                   /translation="MSGEEPDLKLVEQVRRRLAGLARDWTPMDVAHAILDCGRVASDKT
FT                   VLAVVEELRRTSTGAGRLDPLLAMDGVTDVLVNGPNQVFIDRGQGLELTDVTFSGPEEV
FT                   RALAVRLAAAVGRRLDDGNPWVDARLPDGIRVHAVLDVLARPGTCLSLRVPSRRCLSLD
FT                   DWVTGGSMALGCRRMIDTILSRKLAFLVTGGTGTGKTTLLSAMLTSLPSDQRLVIVEDS
FT                   REIWIDHPHWVSMEARAANSEGKGSVTLTDLVRQCLRMRPDRIVLGEVRGAELRDLLMA
FT                   LNTGHEGGCGTVHANGVAEVPARLEALAALGGLSREAASAQITAALHTVIHVERGERGR
FT                   RVAEIGVFVDVEGRAVVLPAVRWDADGVMTLGDGAGRLSQLLGMEVAR"
FT   gene            310926..311696
FT                   /locus_tag="HMPREF0675_3278"
FT   CDS_pept        310926..311696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3278"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00612"
FT                   /db_xref="GOA:D4H9M4"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9M4"
FT                   /protein_id="ADE00612.1"
FT                   /translation="MTVIGASLLMGLAVWIAMPSATRKQEGRHLPAWSGIPVGFVVAWL
FT                   LFGASGVVWAVMTVIVGETVLVVVRRQRRRAQILKGGREVARATRALAGRVSVGEIPSV
FT                   ALEHVADDVEVLAQARRAQAVGGSVSDALIATSRQPGMAGLVPLAHAWHLAATTGAPLA
FT                   PAAKSVAEGTARRARLEATLDSELAAARASGRIMGLLPLVGLLMGHVVGAHPTVFLTTT
FT                   WLGRACLLGSTLLACVGVLWSESLADRVAKEALP"
FT   gene            311693..312442
FT                   /locus_tag="HMPREF0675_3279"
FT   CDS_pept        311693..312442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3279"
FT                   /product="bacterial type II secretion system domain protein
FT                   F"
FT                   /note="identified by match to protein family HMM PF00482"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3279"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01085"
FT                   /db_xref="GOA:D4H9M5"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9M5"
FT                   /protein_id="ADE01085.1"
FT                   /translation="MSDIDVTGTLLPAMIMAAIAAWLVVPATARTRTQARKPPPAWLAP
FT                   RPGAPASHIRVLAGLVAACAVLIGVPWPFPAAAGLSVLVGTVMWWGSGRLESSGHRRME
FT                   QHRAAQLPEALLMLSSAMEAGLPLRSAVTTVAESLEGPCAEDLRRLASSLAAGVPDSRA
FT                   WNDLASVEVWRDPAQDVSRAVDSGEGISELLSAHAAQLQVAAAEKTEKKARKAGVDAIG
FT                   PLVCCHLPAFLLVGVVPIIAGMVLGAL"
FT   gene            312651..312938
FT                   /locus_tag="HMPREF0675_3280"
FT   CDS_pept        312651..312938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3280"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00423"
FT                   /db_xref="GOA:D4H9M6"
FT                   /db_xref="InterPro:IPR025338"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9M6"
FT                   /protein_id="ADE00423.1"
FT                   /translation="MSENTDPTTEPVISARSLDLVGATDVVEPRHRGRYRAARNKIIDR
FT                   GMATAEYAVGMLAAVALALVLLKVVTHQEVFTKLLKLVVSIIGKAGGMLP"
FT   gene            312935..313345
FT                   /locus_tag="HMPREF0675_3281"
FT   CDS_pept        312935..313345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3281"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01095"
FT                   /db_xref="GOA:D4H9M7"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9M7"
FT                   /protein_id="ADE01095.1"
FT                   /translation="MTGLARRGGRSRVSATPGRSPQRSRQRIARGMVTVEMAVSLIAAT
FT                   LVVATSCWVVGLVVVEDACRTTAAQVARQVARGDTASARQAESNAPTGAKVSTTTSGGW
FT                   VNVTVQVDRSLGRIGPVHLRGQARSPMEPGQT"
FT   gene            313342..313749
FT                   /locus_tag="HMPREF0675_3282"
FT   CDS_pept        313342..313749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3282"
FT                   /product="TadE-like protein"
FT                   /note="identified by match to protein family HMM TIGR03816"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3282"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99628"
FT                   /db_xref="GOA:D4H9M8"
FT                   /db_xref="InterPro:IPR021202"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9M8"
FT                   /protein_id="ADD99628.1"
FT                   /translation="MMNLALSRIRTRGTKAGGERGSGTLLLAAVGVGFIAAVWMSLLIT
FT                   GWWSATHRAEETSDMAALAAGGAQVIGEPGCPVAERTVKANGAELVSCVVHNTENGSSV
FT                   AVEVGVQLHRGWELPGMPTRVVKSSRAGPME"
FT   gene            313844..314101
FT                   /locus_tag="HMPREF0675_3283"
FT   CDS_pept        313844..314101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3283"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00137"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9M9"
FT                   /protein_id="ADE00137.1"
FT                   /translation="MLCRDLDMELGRITVIPDAHRTGKLYLYRELRMVPGMAPSEVISA
FT                   QAAEDDLGQLSVTSLSVNRCESPTWGAELPRVVLGMLQGR"
FT   gene            complement(314162..316462)
FT                   /locus_tag="HMPREF0675_3285"
FT   CDS_pept        complement(314162..316462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3285"
FT                   /product="putative DEAH-box helicase"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF09369; match to protein family HMM TIGR03817"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3285"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00813"
FT                   /db_xref="GOA:D4H9N0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR022307"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9N0"
FT                   /protein_id="ADE00813.1"
FT                   /translation="MIVPSVSSTRDAVSRLLTSPQVVYLDHREAAAGHTCEWPSWFPED
FT                   CRQAVEAAGIHRPWQHQARFAELARAGRHAAICTATASGKTLAYLLPIMAATASATPVV
FT                   PESPTPGLPASLRDSLHRNSALYLAPTKALAHDQERVCREVGPRDWLVSTLDGDSDEAE
FT                   RRFAREQARYVLTNPDMLHHTVLPSHARWAGLLGSLRYVVIDEAHRYRGVFGAHVAQVI
FT                   RRLRRLCRMHGADPVFLLSSATSTNAAEAGTRLLGVEKVEVVDEDCSPHPGRDVVLWQP
FT                   AESISTDATGLVADLADAGLQTICFVASRSLAEVISAHAQDRVTSGARVTAYRAGYLPE
FT                   DRRRIEARLQDGSVRAVVATNALELGVDISGMDAVVIAGYPGRLSALWQQAGRAGRSGR
FT                   DALVVLMARENPLDQYLFEHPELLFSSSVESTVLHPDNPYVLGPHVAAAAQEAYLSPAD
FT                   EEFYGSAFAGICKTLTGQNVLRRRGNRLFWTRPERAVDAIDLRSAAGKGIDIIDVSTGR
FT                   VIGGVDEAAADRTVHPGAVYLHQGDQWLVDEYNPVEHHALVHQDLPGYWTQPQSASTVR
FT                   ILREERRRACGPGYVACGQVELTEQVVGYLRRDEITNDVWDSVALEMPTHTMITQACWW
FT                   VIPDKVVDDLKFDAVHLAGAAHGAEHTAIGLLPMYSPCDRWDVGGVSTVMLPDTGACTI
FT                   VIHDGQAGGAGFAEAGFEKAEEWWHATIMRLAQCGCESGCPACVVSPKCGNANQMLDKA
FT                   AAAALTAAMDPLA"
FT   gene            316450..317967
FT                   /locus_tag="HMPREF0675_3284"
FT   CDS_pept        316450..317967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3284"
FT                   /product="methyltransferase, HemK family"
FT                   /note="identified by match to protein family HMM PF05175"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3284"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99381"
FT                   /db_xref="GOA:D4H9N1"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9N1"
FT                   /protein_id="ADD99381.1"
FT                   /translation="MERSRAKIATMGRHLTVDEIEQLRHIFTDIGYVTDPVMAAIGDSG
FT                   QLGLTRNSTTPALRALAGRTDALAGAIRLWLLQQPVPVEQLAPLPLQALTEAGIVSTAG
FT                   STARALVDVRPYGSPDDGASGWTVSDLTPGLDKAITKIRPDYVLGVSPASVSLTQMAVP
FT                   THVGSALDMGCGCGVQSLHLSRHADHVVATDVNPRALEMAQLTCRLSHADVDIRDGSLY
FT                   DPCGHDTFDLIVTNPPYVMAPPSRDGQRLIYREGGFCGDGLVEAVVRGAPARLNDGGML
FT                   QVLANWAHIGDQPWSERLATWVEETGCDLWVVEREHLDVCEYIETWLTDAGLDGSAQWR
FT                   SRYDEWLSYFDNLDVTGVSLGWITLTKAGRDDPDLCFEEWPWQVAQPIGGTMARRAQAV
FT                   IWAHLSDEDLLARRWRIAPNVDSETTGRPGATDPEHVVLRQRRGLCRAVEMTTASGGVL
FT                   GACDGELTLAQITDAVSAILEVDHDALLIEVLPLVRECLRYGILETA"
FT   gene            318060..318347
FT                   /locus_tag="HMPREF0675_3286"
FT   CDS_pept        318060..318347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3286"
FT                   /product="hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   premature stop"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3286"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00062"
FT                   /db_xref="InterPro:IPR018720"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9N2"
FT                   /protein_id="ADE00062.1"
FT                   /translation="MTDHQEIPLTETHHCSCGESDTELPELDVRTIPHAIRHGAVIGAF
FT                   AQLQPGASMVLIAPHNPLPLLSQLEQIGSVGVEYLVEGPDEWHLKLTKQA"
FT   gene            318570..321359
FT                   /gene="topA"
FT                   /locus_tag="HMPREF0675_3287"
FT   CDS_pept        318570..321359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topA"
FT                   /locus_tag="HMPREF0675_3287"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /note="identified by match to protein family HMM PF01131;
FT                   match to protein family HMM PF01751; match to protein
FT                   family HMM TIGR01051"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3287"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00804"
FT                   /db_xref="GOA:D4H9N3"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9N3"
FT                   /protein_id="ADE00804.1"
FT                   /translation="MSPTKSLVIVESPHKATMIAGYLGPKYTVRASQGHVRDLPTSASE
FT                   VPAKYKGEPWARTGVNVDNEFTPVYVVSPEKRSTIRELKSLLKDSDELLLATDGDREGE
FT                   AIAWHLLDELKPKVPVRRMVFNEITDKAINEAVAHTRKLDTDLVDAQETRRILDRLYGY
FT                   EVSPVLWKKVLPRLSAGRVQSVATRLVVDRERERMAFTSANYWDMEATLTADLDEFQAR
FT                   LVSLDDTKIATGRDFDSHGNLISSVRRLDEVAATAIAKALEKAPFTVTKVESKPYTRRP
FT                   YAPFRTTTLQQEAGRKLGFTSQRTMSVAQNLYEGGYITYMRTDSVALSQEAIHAARNQA
FT                   AELYGSDHIPDKPRIYASKVKNAQEAHEAIRPAGEHFRTPAETGLTGDEFRLYELVWMR
FT                   TLASQMADAKGETLSVTIDATPVSPVNLPDGDVTTATFTASGRTITFHGFLRAYVESVD
FT                   EGASDDAQKRLPQLSKGQDLDPREVTAKGHDTRPPARYTEPSLVAKLEELEIGRPSTYA
FT                   SIIRTITSRDYVFKKGSALVPTWLAFAVTRLLEEHFSNLVDYQFTADMEETLDQIARGN
FT                   ADRVAVLSAFYFGQTKTGDGDVPTPTEGHEGLHQLVTELGDIDARTICTFPLDDSDVVV
FT                   RVGRYGTYVEDPEGNRANVDDALPPDELTVEAAKELLVSPNGQDRELGLDPHSHRPIVA
FT                   RNGRFGPYVTEVLDDDEATEIVETTTKDGKKRRTKRKVKPRTASFFRSMSLETVTLDEA
FT                   LKLLSLPRVVGTAADGTEITAQNGRYGPYLKKGTDSRSLGSEDEIFSITLEQAEAIYAQ
FT                   PKQRGRAAAKPPLRELGEDPASGRPIVVKDGRFGPYVTDGQTNATLRKDDSVEDITPER
FT                   AQELLAEKRAKGPAKKSPTKKKTTRKTTTRTTTTKKTTKATSKSVKVTKANAKTSSGS"
FT   gene            321361..322848
FT                   /locus_tag="HMPREF0675_3288"
FT   CDS_pept        321361..322848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3288"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3288"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00998"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9N4"
FT                   /protein_id="ADE00998.1"
FT                   /translation="MTTGCRSGSTEPLYFELAWTAARPVPADLRTTVAAGGARRTIECK
FT                   VTLLDSPDHRLLRSGIVVAHRVVDGLGEWYMDAPEWSPWLPVARSVALDAAGELPQDFT
FT                   CLVRPFLRGATLCPVAALSWERNETILEALDCTKLALIRDDRIAVVQSGVTTSRVRELT
FT                   ITPQRGLAEGQREWLTNRILALDGVPVSRHPSVLRRLGPGAGALTDYPRPHLHHGAGLQ
FT                   TWVSAQLAGQLRDVIEADLAVRCQGMDLGPTETTRTEPRVLPESPDRTDLVGMGYDPVT
FT                   MSTPSIHDGNHGSIRPLQKAIRALSETLDAMSGLLDQAWVERAQNLCLRVMGLDPGHIS
FT                   IHNLSREYYQLLEEITAAARSPRLTVDPDQPARPTMKRVLRKSVADAVAKCDDVEDVQG
FT                   WSTAEVAVRHAAAVAGILDTGRAGKVAKRLRPVVKEIAQTKRSVTEAVDVSKMSPQEAF
FT                   EAGREVERASASLFAARQSFRDDWQQHRRKILKAIHD"
FT   gene            322841..323485
FT                   /gene="tmk"
FT                   /locus_tag="HMPREF0675_3289"
FT   CDS_pept        322841..323485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="HMPREF0675_3289"
FT                   /product="dTMP kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="identified by match to protein family HMM PF02223;
FT                   match to protein family HMM TIGR00041"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3289"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99737"
FT                   /db_xref="GOA:D4H9N5"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9N5"
FT                   /protein_id="ADD99737.1"
FT                   /translation="MTDQTVTGRDLGGVFVVFEGGDGAGKTTQARLLDQWLTTEGIPHL
FT                   MTREPGDSWLGQRIRELVLSPGSGPISSRAEALLYNADKAQHVDEVVIPALREGKVVVC
FT                   DRYVDSTIAYQGAGRALDPGEVGQLACWATTGLVPDVTVLLDVDPCEGAGKIAAKDRLE
FT                   AAGDEFHLRVRQHFLDLAAAHPQRYLVLNARKSRKEISEAIRQRVTGLLNR"
FT   gene            323532..324740
FT                   /gene="holB"
FT                   /locus_tag="HMPREF0675_3290"
FT   CDS_pept        323532..324740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="HMPREF0675_3290"
FT                   /product="DNA polymerase III, delta' subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM TIGR00678"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3290"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00759"
FT                   /db_xref="GOA:D4H9N6"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9N6"
FT                   /protein_id="ADE00759.1"
FT                   /translation="MSDVLTGVWADLVGQEKAVGVLRRAAESQPGRSSHAMSHAWLITG
FT                   PPGSGRSNAAKAFAAALQCVDHGCGQCNACRTTLSGAHPDVTLVRTEALSIGVDEVREL
FT                   VRRAAMNPVHGCHQVVVVEDADRITERGADALLKAIEEPAPKTVWLLCAPTPEDVIVTI
FT                   RSRCRRLHLATPRDEAVADLLTRRDGIAPEVAAEAARAGQGHIGRARRLAWDEEARARR
FT                   NAIGELPTRLRSLGDCLQAAEDLVNQASEEAAAATAEVNAAERAELNKALGFGSSGARP
FT                   RNAQAALRDLEKQQSARLKRLQRDALDRVLTELTAYHRDVLAIQTGAVRPEEENALRGA
FT                   RLVNAGWSASLHRIADSQSPEHTVATIDAILAARKSLEHGVTPLLVMETLLIAMTGVDR
FT                   ARW"
FT   gene            324872..325678
FT                   /locus_tag="HMPREF0675_3291"
FT   CDS_pept        324872..325678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3291"
FT                   /product="DoxX family protein"
FT                   /note="identified by match to protein family HMM PF07681"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3291"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99107"
FT                   /db_xref="GOA:D4H9N7"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9N7"
FT                   /protein_id="ADD99107.1"
FT                   /translation="MSKAIKRTAADSTDAETTRVIRTGASRVDADVNPTEVIKPSDSAD
FT                   SERTSVIDDNVFRPASETTRVVDDREFEEERRRRELAEQRARERADRQAIEAERQRRAA
FT                   HAEPEPEQVAEPAPKRTTDKVMASLGLFLFRLIVGGILGVHGFQHLAQRDLTLRAVQAL
FT                   PLPSGYAQSGVWVLGICECIAAVCIILGLFTRVAGAGIIAIMVLSLTFIFWGSFAIFKT
FT                   MGFKGELELLLAACGVLLLFLGAGGWSIDAAYRRSRAAAKAEEVGD"
FT   gene            325843..326415
FT                   /locus_tag="HMPREF0675_3292"
FT   CDS_pept        325843..326415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3292"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00011"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9N8"
FT                   /protein_id="ADE00011.1"
FT                   /translation="MPTCPGKAGDAAVAAAARDRRTRAEILQTVRRTIEDVGVDMEVLA
FT                   IDLVESGDDRAIAVYFRAPHRVEFATIVGPLARRLRARIDLRQLRGRDTARVVGGVGVC
FT                   GRSLCCSTFLPEPSSVPNRLVSEQGMASNPLAVTGACGKLMCCLRYESPYYADFEAALG
FT                   EVRVPDAPRCPLMSTCSRRRDQERKDA"
FT   gene            326432..328114
FT                   /locus_tag="HMPREF0675_3293"
FT   CDS_pept        326432..328114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3293"
FT                   /product="TAP-like protein"
FT                   /note="identified by match to protein family HMM PF00561;
FT                   match to protein family HMM PF08386"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3293"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00087"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9N9"
FT                   /protein_id="ADE00087.1"
FT                   /translation="MTPRVSRRRMFVSALMASSLFAVTACTSAGSRPPQSASVSRQSAS
FT                   HKPSASPSVTASVVPAQDKVDTNPPVASFDPKAHALMEGPQSPDRQAMHPARDNKPFSK
FT                   APAGKGTNRYLSRKISWHDCGTFQCADIPVPLDWDNPDGPAITLALKRKPAEGAAKATL
FT                   FINPGGPGGSGQDMVSSFQSSAFPDHDVIGWDPRGTGASTHVNCGPAKTMDGLFSLDAS
FT                   PDDEAEWNELIRGTRDFARSCRAYSGQLLDHVSTIDTARDLDYLRYLVGNKKLDYLGVS
FT                   YGTFLGATYAELYPGRVGHMVLDSTVNITNHDTVSQAVGFDRAFGDFAQWCANRGNRCA
FT                   LGTSEAEVRKATLNFLDRLDAHPMKVAGRELTQSLAATGIALFLYSGKQAYSYLIAALV
FT                   GAMKDGNGGYLLTASDYLNGRGKDGQWETIASAFPAISCLDQADFGLKHARQEWPQEVA
FT                   KAPTLGKALGVAPICEVWTARPAPQLYLTARGAAPILVLGATGDPATPYEQATWMAGQL
FT                   KSGVLLTWRGSGHSAWELGNQCVKKAVEGYVNDGKMPKDNTVC"
FT   gene            328203..328535
FT                   /locus_tag="HMPREF0675_3294"
FT   CDS_pept        328203..328535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3294"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00538"
FT                   /db_xref="GOA:D4H9P0"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9P0"
FT                   /protein_id="ADE00538.1"
FT                   /translation="MTLGQRHVTGIVVRAVGLALLAGILLALEWAWRTHAWNDLKAVDG
FT                   RCVLVGARVDDGRVPTVGCHENGARYVKDVVKPSSQCPEGLTRVSVRHELSHDTGYVGA
FT                   LCVRNP"
FT   gene            complement(328569..330239)
FT                   /locus_tag="HMPREF0675_3295"
FT   CDS_pept        complement(328569..330239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3295"
FT                   /product="hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift; identified by match to protein family HMM
FT                   PF05960"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3295"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00701"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9P1"
FT                   /protein_id="ADE00701.1"
FT                   /translation="MHTPPTRWDQRSTRLPTTIGLPSSSPALRSPRRSVWILTRTNTTT
FT                   CPPAGLDAQYRLAMDTLDRLDQAMPADDTDRITAAAMRSSLGLEAESHDRGYDLLSLNG
FT                   IASGVHEIREVYDAMPTETPDQVSTVARRLHATGPALDGWLATQRASIDAGIPPAIRQV
FT                   GLLVEQITAWTSDGGFFDDYLKRTASRDLPDAVTTALAEGIDAAKRNFRRTAEALSSEI
FT                   APLATETDAVGIDRYRLASRQFVGTTVDLTETYEWGKQELARIEQMQRETAERIRPGAS
FT                   IKEAMAVLDADPAYQITGTAALKVWIQERADEAISSLDGTHFEVPEQARHIEGMIASTH
FT                   DGGVYYTPPSDDSSRPGRMWWSVPDGVNTFTTWRELTTVYHEGAPGHHLQTSSAIAARE
FT                   ELNSWRRNYWTSGYGEGWALYAEWLMADLGYMDDPGHFMGLLDGQSMRAARVVLDIGLH
FT                   CQFEAPEEMGGGEWNWDKAWAFFNNHVSMDEGSARYEVNRYFGWPGQAPSYKLGERTWL
FT                   ELREAAKAKDPNFDLKEFHTTALRMGALPLDVLRRAMLS"
FT   gene            330377..330452
FT                   /locus_tag="HMPREF0675_3296"
FT   tRNA            330377..330452
FT                   /locus_tag="HMPREF0675_3296"
FT                   /product="tRNA-Thr"
FT   gene            330657..332006
FT                   /locus_tag="HMPREF0675_3297"
FT   CDS_pept        330657..332006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3297"
FT                   /product="amine oxidase (flavin-containing)"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF01593"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3297"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99781"
FT                   /db_xref="GOA:D4H9P2"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9P2"
FT                   /protein_id="ADD99781.1"
FT                   /translation="MYDSIIIGAGLAGLTAAEELASAGHSVVVLEARARVGGRLENAEL
FT                   SNGQVVELGGQWVGEGHEELRSLLSSQGLELVDSTDGDVVVKARGRVSHVTSLSEPSAH
FT                   SLSPFELADLGQGLLRFRRLADRVANNKGWAAANATWLNQSLSQWTASNVRTEAGRGYI
FT                   TNLFRQAFGVSANDTPLFNGLAKANAGVDLESLVAVNGGLKQQRVKGGVAQVTRNLAEP
FT                   LGDDLKLSSPVRSVHSDDDGVTVTTTDGTQYQGRSVIVTVPPRLLKDMTFEPALPAERL
FT                   EMADKVPAGNVIKAYLVYDSPWWRTSGASGQMGADEGAVRVIFDTSDDETGKGILMGFF
FT                   EGAEASGYGKLSIGLRQRAFEEVVESAFGKAPSSPIEYLDRDWLAEPYTGGCHGAHFAP
FT                   SLWTTTGPILAEPLGRVLFAGAEYASSFNGYMEGALRAAARAAQEVLDLL"
FT   gene            complement(332256..332402)
FT                   /locus_tag="HMPREF0675_3298"
FT   CDS_pept        complement(332256..332402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3298"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3298"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99146"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9P3"
FT                   /protein_id="ADD99146.1"
FT                   /translation="MRTAPGKRKFSPHCGQTASCAPTWVPHRAQNILISIHEWLLKNMA
FT                   SSH"
FT   gene            332485..333336
FT                   /locus_tag="HMPREF0675_3299"
FT   CDS_pept        332485..333336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3299"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3299"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99242"
FT                   /db_xref="GOA:D4H9P4"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9P4"
FT                   /protein_id="ADD99242.1"
FT                   /translation="MQTPSEPVEWQDSMPTQQWQVQDSTPTQQWTTNSQSGPQQPSQGQ
FT                   YRDLGASQMPDDWFRDPEAERTRVMAAVPENPVFTPPPPPSTPAMAYPPPPSGDSSRHR
FT                   KVLIGLVVGLLVLVVLGAVLLFAGGLKGRSGSEPAVVATPSASSQPKQSASEDPQATSI
FT                   DTTPSFLMSSPASPSPVPSSPALSTPTPLSPQSPTLSARQVADKLPDGDTLCSSSVGAV
FT                   GTTSCPFALEVANAIPAGAQGDYEVQAYSPVTGKTYTMKCETQESYTTCTGGIAAKVHI
FT                   LR"
FT   gene            complement(333354..333839)
FT                   /locus_tag="HMPREF0675_3300"
FT   CDS_pept        complement(333354..333839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3300"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /note="identified by match to protein family HMM PF00300"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3300"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00512"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9P5"
FT                   /protein_id="ADE00512.1"
FT                   /translation="MHTLFLMRHAQPASHAPGEDRERPLTDVGRRQAREVGTRLGLRNV
FT                   GHALVSDALRTRQTWDCLQLDCPVEFMRALYYCGTDTVRQRIGEIDDDVDNLLIIAHAP
FT                   TIPGLAAQLAAMSGAENEVGCWYPPATLTEVEVDGTWADLKDEYFDKVRLVGVQRPM"
FT   gene            333887..334876
FT                   /locus_tag="HMPREF0675_3301"
FT   CDS_pept        333887..334876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3301"
FT                   /product="acetyl xylan esterase (AXE1)"
FT                   /note="identified by match to protein family HMM PF05448"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3301"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99097"
FT                   /db_xref="GOA:D4H9P6"
FT                   /db_xref="InterPro:IPR008391"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR039069"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9P6"
FT                   /protein_id="ADD99097.1"
FT                   /translation="MPLTDLGIDEARTYRPNVPEPDGFDSFWAETLDEYSGVPQDLTAV
FT                   PFDNRQALIDTWDLSWAGYHNSRVSGWLHAPAAVNGPLPLVIEYLGYSSSRGVPIGSVF
FT                   AAAGYAHIVVDPRGQGWGHPTLTENCPDVHDGSGAPGFMTQSLSDPHGHYYRRLFTDAF
FT                   RCLQAAREMELVDPTRIAVLGHSQGGGQAIAVCALAAMRGIKLAGAFVDVPFLCHIRRS
FT                   CDIATDGPYLEVVRYLAAHPSLCGRAFQTLGYFDGLHFARRARTSTWFSVAMMDQAVPP
FT                   SSVWAAYNAWGDGMVADKHIAVYPFAGHAAGEDVQRWNQLGVLAQLFS"
FT   gene            complement(334892..335905)
FT                   /locus_tag="HMPREF0675_3302"
FT   CDS_pept        complement(334892..335905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3302"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99733"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4H9P7"
FT                   /protein_id="ADD99733.1"
FT                   /translation="MSESLVLLAPAANHVYAGQAGRLCAAELSLTCPNATSVAPVTVAG
FT                   VEYLSIHSEDPLPPADLAAVARSSAALACFEYRGDLLAPLELPQVDVVDEDLVTIPKYR
FT                   GKTNEQFTRLLLNLTLASLEGRCATRRDEGQRLAILDPLAGRGTTLECAWRAGHNGFGV
FT                   EQDAKAVEALAAHVTTWLRRKHLKHSCGTHPVRRDGRSLGKRFDAEVRLPKTEPLAMGV
FT                   FTGDAADSAVLWGRKTFDAVVTDAPYGVVHGSHSGASRRRSPTDLLREAIPVWAGQLRH
FT                   GGALGMSWNTLGLSREHLVTILSAAGLTPLDDDLWHQFSHRVDSSIHRDLIVAVKP"
FT   gene            complement(336016..336570)
FT                   /gene="ppa"
FT                   /locus_tag="HMPREF0675_3303"
FT   CDS_pept        complement(336016..336570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppa"
FT                   /locus_tag="HMPREF0675_3303"
FT                   /product="inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="identified by match to protein family HMM PF00719"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3303"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00136"
FT                   /db_xref="GOA:D4HA30"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:D4HA30"
FT                   /protein_id="ADE00136.1"
FT                   /translation="MTDDFTNPFQGEQPESLHFDVTIEIPRGNKNKYEMDHETGRIRLD
FT                   RTLFTSTQYPYDYGYIEGTLGEDGDPLDALVLLTEPTFPGCLIECRALAMFQMQDEMGG
FT                   DDKVLCVPADDPRRAGLIDLDDVGSMTLMEIEHFFTVYKDLEPGKSVEGATWTDRDEAE
FT                   AEIKASFERAKGTSYENLHTA"
FT   gene            336697..338070
FT                   /gene="dacB"
FT                   /locus_tag="HMPREF0675_3304"
FT   CDS_pept        336697..338070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacB"
FT                   /locus_tag="HMPREF0675_3304"
FT                   /product="D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="identified by match to protein family HMM PF02113;
FT                   match to protein family HMM TIGR00666"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3304"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00173"
FT                   /db_xref="GOA:D4HA31"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D4HA31"
FT                   /protein_id="ADE00173.1"
FT                   /translation="MPGWVPVTVGIAVVVIVVVAVIVSSLRSGSPARWTGGGILPHRHD
FT                   NTAQAVQPGRGVVAAVAPTTPSAKPVAATIANRVKSAGAAPGVLGADIMDAATGETLYQ
FT                   SGQNSLLTPASNLKVLTAIALLDCTDAGHRYTTKVVANGSALTLVGGGDPYLRSKSSAQ
FT                   HPEYPSMEELAKRTAAALKKAGTTKVTVNFDDTLFTGPDWNGAWPVDNYSDEVTPITSL
FT                   WVDEGMINNSPWNRSKTPAVLATNAFIGSLRSAGITVNGSVSRHKADRSAREIAAVQSV
FT                   PVEDLVTRTLEESDNSAAEVLSRQMALASGKPGSFAGGTQALEEHLKYIGAWQDGAVIQ
FT                   DGSGLSQGNRITASMLSRAWRKVLTTPKLQPVANAVPVGRVSGTLHKRFSDPSTAAGRG
FT                   VVHAKTGSLQGVISMSGWLRDADGRILVASFIINQTDGSARSWLDVVYGNLAGCGCTR"
FT   gene            338052..339005
FT                   /gene="tilS"
FT                   /locus_tag="HMPREF0675_3305"
FT   CDS_pept        338052..339005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tilS"
FT                   /locus_tag="HMPREF0675_3305"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /EC_number="6.3.4.-"
FT                   /note="identified by match to protein family HMM PF01171;
FT                   match to protein family HMM TIGR02432"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3305"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00811"
FT                   /db_xref="GOA:D4HA32"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D4HA32"
FT                   /protein_id="ADE00811.1"
FT                   /translation="MRLHPLMARRELGPAALAVAQAVERMVRGVDRFVVGCSGGPDSLA
FT                   LALASKWASRRCESGVRVVIVDHQLQQGSDEVAERTRDLLVRRGMDACVRRVDVDADDP
FT                   DGPEAAARTARRAALLDVAGDEPVLLGHTRDDQAEQVLLSLARGSGATSLAGIRPRSGQ
FT                   FWHPLLEVRRAQTVQACREWEVEPWQDPHNGDPRFLRSRVRTELMPVMEEVLGPEVAAS
FT                   LARSATLLAGEDEVVARVARMWADEHGVKANELPGLRGVEVGLARRVVKEWLPQARMVH
FT                   VDAVLGLLDGPGGAGVDVPGGRVEMRQGTLYLARRL"
FT   gene            339033..339587
FT                   /gene="hpt"
FT                   /locus_tag="HMPREF0675_3306"
FT   CDS_pept        339033..339587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="HMPREF0675_3306"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01203"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3306"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99395"
FT                   /db_xref="GOA:D4HA33"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D4HA33"
FT                   /protein_id="ADD99395.1"
FT                   /translation="MRASDIPGDFDHVLYTEEQVASRIREVAAQIDADYAGREILMVGV
FT                   LNGAVMTMADLCRAMTSHMSMDWMAVSSYGAGTKSSGVVRILKDLTKDIDGRDILIVED
FT                   IIDTGLTLSYLVQNLRSRNPNSIEIMAMFRKPEVVTCPLDVKYVGFDIPNEFVVGYGLD
FT                   YADKYRNLTDVATLAPHVYKS"
FT   gene            339729..341882
FT                   /gene="hflB"
FT                   /locus_tag="HMPREF0675_3307"
FT   CDS_pept        339729..341882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflB"
FT                   /locus_tag="HMPREF0675_3307"
FT                   /product="ATP-dependent metallopeptidase HflB"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF01434; match to protein
FT                   family HMM PF06480; match to protein family HMM PF07728;
FT                   match to protein family HMM TIGR01241"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3307"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99933"
FT                   /db_xref="GOA:D4HA34"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/Swiss-Prot:D4HA34"
FT                   /protein_id="ADD99933.1"
FT                   /translation="MKNASRIFKGPLIWILLCIGLIIVFLQFAGSGNGYKDIPTSEAVS
FT                   IINSSKKLDSVTLTDGDQVIKITENENKKYRSYWVGNQSDQLVDRLNDRVKAKTLKSWQ
FT                   GENPGQSIWKALLINFLPFVIILLFFLWAMNAAQGMGGRGGVMGFGKSKAKVGSKDTPK
FT                   STFADVAGCQEAIDELQEIREFLAEPAKFQRVGAKIPKGVLLYGPPGTGKTLLARAVAG
FT                   EAGVPFFSISGSDFVEMFVGVGASRVRDLFEQAKEAAPAIIFIDEIDAVGRHRGAGMGG
FT                   GHDEREQTLNQLLVEMDGFDVHGGVILIAATNRPDVLDPALLRPGRFDRQIAVEAPDLD
FT                   GRLKILKVHAHGKPMADDVDLASIARRTPGMTGADLANVLNEAALLTARANLPVIGNSE
FT                   LDEAIDRVIAGPQKKTRLMNQHERLVTAYHEGGHALVAAAMPGTDPVQKITILPRGRAL
FT                   GYTMVMPDSDKYSQTRSELLDSMAYMMGGRAAEELIFHDPSTGASNDIEKATKVARALV
FT                   TQYGLSARVGTVQLGSGDTEPFLGMTAGQQRDYSDETAKIIDDEVRELLENAHQEAFDC
FT                   LDANREVLDELVRQLFARETLSKAEVADIFKPLKRWPERGAFTGSDKRVPSSIPPVKPP
FT                   QIAGVDEDAPEVGAPRRGVIAPPTPEPGGDLPGDNPGEWEPPSDWQPPSVGGGKSPEPP
FT                   SPTHPGEGPQPPSNGNPWGPPRS"
FT   gene            341947..342522
FT                   /gene="folE"
FT                   /locus_tag="HMPREF0675_3308"
FT   CDS_pept        341947..342522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /locus_tag="HMPREF0675_3308"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="identified by match to protein family HMM PF01227;
FT                   match to protein family HMM TIGR00063"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3308"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99222"
FT                   /db_xref="GOA:D4HA35"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:D4HA35"
FT                   /protein_id="ADD99222.1"
FT                   /translation="MKLSVDRERAAAAIREFLLAVGEDPDREGLRDTPMRVAQAAEELF
FT                   GGLSQDPGELLATTFDISHDEMVLVRDIELQSMCEHHLLPFIGVAHVGYIPARDGRVTG
FT                   LSKIARLVEVYARRPQVQERLTTQVADALVEHLDARGVIVVVEAEHMCMTTRGVRKPGA
FT                   RTVTSAVRGILRNPATRAEAMGLITAGR"
FT   gene            342640..342888
FT                   /locus_tag="HMPREF0675_3309"
FT   CDS_pept        342640..342888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3309"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3309"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01061"
FT                   /db_xref="GOA:D4HA36"
FT                   /db_xref="UniProtKB/TrEMBL:D4HA36"
FT                   /protein_id="ADE01061.1"
FT                   /translation="MTGLAEGTLILAFVTPRRYRRGDEADLPVRSRWWVPVWTVFGRSP
FT                   GAGFLVFVVFFALALISGGGGIGMGDVKRAVFIGLMG"
FT   gene            342900..343019
FT                   /locus_tag="HMPREF0675_3310"
FT   CDS_pept        342900..343019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3310"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3310"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00681"
FT                   /db_xref="UniProtKB/TrEMBL:D4HA37"
FT                   /protein_id="ADE00681.1"
FT                   /translation="MSGPVVSTTSTPGDAGDPAPVPIEPTSGHMRCGDVFVFR"
FT   gene            343130..344236
FT                   /locus_tag="HMPREF0675_3311"
FT   CDS_pept        343130..344236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3311"
FT                   /product="OmpA family protein"
FT                   /note="identified by match to protein family HMM PF00691"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3311"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00605"
FT                   /db_xref="GOA:D4HA38"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:D4HA38"
FT                   /protein_id="ADE00605.1"
FT                   /translation="MWNWKMRAAGFIGGLAVVFGFVALPAHSDESVTVPVPLVDAVAVS
FT                   HYESAKRQKEKPGSVILALHAVRRLPYATVVYYSVSVDASVSGPLEDYGYLVGRGGAQA
FT                   HYSGTLSADGAVIDVGNHKLYRTIGDFQGCKMCASEWWNGAPIWEMAPGHSRLGWFSTP
FT                   PLPADVSRVDVTVANRIFHDVPVGDGLLGPTIDKEAATGRWNKGMPLGVAWPALDPKDL
FT                   AGVDVSKFVNALVTTTGDASDASRERVTKESMKIDLDASVLFDLDSDVVKPAGRQIIDR
FT                   TAKQLVARKVSGKIEVTGYTDSSGSASHNLDLSRRRAASVAKVLGSQLSKGITLVTAGK
FT                   GEADPVTSNDSEAGRRLNRRVTITVKEG"
FT   gene            344236..344874
FT                   /locus_tag="HMPREF0675_3312"
FT   CDS_pept        344236..344874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3312"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99922"
FT                   /db_xref="UniProtKB/TrEMBL:D4HA39"
FT                   /protein_id="ADD99922.1"
FT                   /translation="MKGRPVFVGCVAVLVLTACGGAGVSAGSHPHTAVASSSVSVVGMS
FT                   APPSASVSVMGSEQAAAVESAAGKAIRDKVKEDGGPIPKEVANVSFHPNLDDNVDVTAH
FT                   VVSIKAGPTGTVLTFWLTSNTIDHAMGPVFPEDFPSLVDTVGGVKYGVNYFSKAGDTSK
FT                   FVVGSEEPEIDAKSVYVMQASYPPLPKSVTKVKIAIGSAKTSPDIPVTR"
FT   gene            345123..345602
FT                   /locus_tag="HMPREF0675_3313"
FT   CDS_pept        345123..345602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3313"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3313"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99271"
FT                   /db_xref="UniProtKB/TrEMBL:D4HA40"
FT                   /protein_id="ADD99271.1"
FT                   /translation="MGGLMLGVGLVGCSDSEEGWESVTVDRITVSHPTEWVEKPPENEN
FT                   FTKNFTDGPHGMQIAGHYSDDTEPTLAWSVLEFMIRGTFQGYDPKGYQEITVKGAARAI
FT                   KCPFDFTYKGKSARGYWLVASGVLPTEGSAIVLLRLPRDDTNLVDKIIASMSFKA"
FT   gene            345725..346084
FT                   /locus_tag="HMPREF0675_3314"
FT   CDS_pept        345725..346084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3314"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00435"
FT                   /db_xref="GOA:D4HA41"
FT                   /db_xref="UniProtKB/TrEMBL:D4HA41"
FT                   /protein_id="ADE00435.1"
FT                   /translation="MLLTIVAAGIADVVVVWSCALVYDTRLGAALLGCLGALVLSHVWA
FT                   SRRALATVWWSCGLVLLCVVGMAVYAWVRAGLSPVDPVVVETLAPILPVAACTAVGTGY
FT                   VWRLCARLVADHRSL"
FT   gene            346274..347248
FT                   /locus_tag="HMPREF0675_3315"
FT   CDS_pept        346274..347248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3315"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00302"
FT                   /db_xref="GOA:D4HA42"
FT                   /db_xref="UniProtKB/TrEMBL:D4HA42"
FT                   /protein_id="ADE00302.1"
FT                   /translation="MRTRDDRGAAAPEYIAILLIAAMFTSAVAVGVKPEWVQQKVCQAL
FT                   AVIFGKGSCAPASQAKPPAQQLPKRCLIHSDENATSIYAEGKITWVTIGGEGGYGYHLV
FT                   EYSDGKADVELFYNVGASAGAAAPGWSKGPASLDASITGSAKYTKGETVHYDSVAAARA
FT                   DRDSLNKYARERALAVMHLGSAPDVPNSRLSSTSRTVEVDVKGKATLKVKAKVGGHGSA
FT                   DAGASGSVNGIVQYITKRDSKTGAVTHTVEALGSANGDAHANAGATMGNHGVKTPTVGG
FT                   HAGLDDDTSVSVTKDNSGKITELVITKSGAEGADFGVDGDFKI"
FT   gene            347418..347834
FT                   /locus_tag="HMPREF0675_3316"
FT   CDS_pept        347418..347834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3316"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99627"
FT                   /db_xref="UniProtKB/TrEMBL:D4HA43"
FT                   /protein_id="ADD99627.1"
FT                   /translation="MSKKPGREEESDGDHKSRETTTIRVAVNDQNRSQVEKWLGDNDVG
FT                   PSNAVPLLVKARFMNPLDADATNDFAKFLYQSEDTQIDTQTSSETSDLKDDSYDILVAK
FT                   VGEKDARESSSSTGQMGYLLENGKRVPKISEGCK"
FT   gene            347890..348735
FT                   /gene="folP"
FT                   /locus_tag="HMPREF0675_3317"
FT   CDS_pept        347890..348735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folP"
FT                   /locus_tag="HMPREF0675_3317"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="identified by match to protein family HMM PF00809;
FT                   match to protein family HMM TIGR01496"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3317"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01253"
FT                   /db_xref="GOA:D4HA44"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:D4HA44"
FT                   /protein_id="ADE01253.1"
FT                   /translation="MINVGSATNSHPARTLVMGVVNVTPNSFSDGGMWADPEVAIRHAR
FT                   DLVVEGADIIDVGGESTRPGTERTPEHEELRRVLPVVKALVADGVAVSVDTMRASVAKA
FT                   VVEAGATIVNDVSGGKAEPEILDVVADAGVDYVLMHWRGQSATMQNLVDYDDVVADVIS
FT                   ETSQQVDAAIAAGIDRRRIIVDPGIGFSKTSEHNWQLMNAVDAFQEGFADLRVLWGVSR
FT                   KRFLGELLAQNGEDRPALERDASTMALSTYFALHHAWCVRTHEVRANRDAVETVARLLA
FT                   "
FT   gene            348796..349158
FT                   /gene="folB"
FT                   /locus_tag="HMPREF0675_3318"
FT   CDS_pept        348796..349158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="HMPREF0675_3318"
FT                   /product="dihydroneopterin aldolase"
FT                   /EC_number="4.1.2.25"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift; identified by match to protein family HMM
FT                   PF02152; match to protein family HMM TIGR00525; match to
FT                   protein family HMM TIGR00526"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3318"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99387"
FT                   /db_xref="GOA:D4HA45"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:D4HA45"
FT                   /protein_id="ADD99387.1"
FT                   /translation="MTYGQITLTGIRAHANHGVLASERELGQPFSVDVSLDVDMDTVSD
FT                   DLTQAVNYATVAQRVLNILTREPVSLIETLAGKIADTVLAISPRVHSVQVTVHKPHAPV
FT                   GVALDDVAVTYRKDAE"
FT   gene            349155..349712
FT                   /gene="folK"
FT                   /locus_tag="HMPREF0675_3319"
FT   CDS_pept        349155..349712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="HMPREF0675_3319"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   diphosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift; identified by match to protein family HMM
FT                   PF01288; match to protein family HMM TIGR01498"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3319"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00055"
FT                   /db_xref="GOA:D4HA46"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:D4HA46"
FT                   /protein_id="ADE00055.1"
FT                   /translation="MKTVFSLGSNMGDPFAHLRDAVRLIAETPGIHDVVVSPVYVTAPI
FT                   GGVEQDDFLNLIVVATSDLPPSVLLERAHVIEAAHGRDHTIPNGPRTLDVDLIRVGDET
FT                   VTTDELTLPHPRAHKRAFVLVPWRDADPEAELPGYGRIADLVASFDADELADAVKPYSR
FT                   QIDVAGVTVAGEWDERHDEEDV"
FT   gene            349709..350245
FT                   /locus_tag="HMPREF0675_3320"
FT   CDS_pept        349709..350245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3320"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00906"
FT                   /db_xref="GOA:D4HA47"
FT                   /db_xref="InterPro:IPR021517"
FT                   /db_xref="UniProtKB/TrEMBL:D4HA47"
FT                   /protein_id="ADE00906.1"
FT                   /translation="MTRSLPPEWDDDRRPGGGNPQGNIAPTDWKVIIVAALCGAALGWF
FT                   ALSIYKINDVTVPILPWSLPVVILVAAIATWGYARAFRTKVVDPQREVEANQGLVSLAL
FT                   GKAIALSGAALVGACIVYVLTFVWHLNIPYPRQRAIVGGVTAITCAAMAWAGWFLENAC
FT                   KVPKGPDDSEKHPKG"
FT   gene            350340..351005
FT                   /locus_tag="HMPREF0675_3321"
FT   CDS_pept        350340..351005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3321"
FT                   /product="putative cell division topological specificity
FT                   factor MinE"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3321"
FT                   /db_xref="EnsemblGenomes-Tr:ADD98913"
FT                   /db_xref="GOA:D4HA48"
FT                   /db_xref="UniProtKB/TrEMBL:D4HA48"
FT                   /protein_id="ADD98913.1"
FT                   /translation="MSGEHDPKRVEKDTGERRGVLALLIVATIVAAVCGVVPSIWAVRA
FT                   GVLVALVGAWISVFMAWRQVDAIRRMHFDTLKELRHAASEQEKRHHAESMEMIDTFSRR
FT                   VGSISKTLADTRAKLDRAESELSTLRGDKAALQYKVTAGNKKVASLEMRITELETELDA
FT                   LLADGRSGRLTTLRTVTDAGVPTAEEIWERGNDATIADLSRVAFPRLSEGTRETRRQA"
FT   gene            complement(351082..352242)
FT                   /locus_tag="HMPREF0675_3322"
FT   CDS_pept        complement(351082..352242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3322"
FT                   /product="respiratory-chain NADH dehydrogenase, 49 Kd
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF00346"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3322"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00399"
FT                   /db_xref="GOA:D4HA49"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:D4HA49"
FT                   /protein_id="ADE00399.1"
FT                   /translation="MRKIMFVIGSMPLTHPSQSADGDPGKKYEVTRLDLGHLHPTRSGL
FT                   VTIATTVDDDVIISSQVNVGTLHRGDEKLFEVRDYRQIPMLASRHDWTAPFIGETGAAH
FT                   AIEDAMGITIPTRVAWIRTLLAEFSRITSHFTFLSWVGHHCDDAGLENAIATAIENARR
FT                   IWQRCSGNRIHPMITRIGGLRIHPESEWQPALGEWLDDANALVTRLRTALDATVGVRGV
FT                   AVIPTNMIDRYGLSGPVSRASGVDLDTRRRTAVYDELKWPEVVIEPRGDAYSRLATLCN
FT                   DAAVSSSLCRQILDRLPSLDGPLETRLPTAIKAPRGRTWTTIEAPWGRAGYLLESRGST
FT                   TPWRMALRTPTFANVQVLEAVLPGTRVDDVEATIASLGWTLGDLDK"
FT   gene            352411..352728
FT                   /locus_tag="HMPREF0675_3323"
FT   CDS_pept        352411..352728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3323"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01080"
FT                   /db_xref="InterPro:IPR024412"
FT                   /db_xref="InterPro:IPR042254"
FT                   /db_xref="InterPro:IPR042261"
FT                   /db_xref="UniProtKB/TrEMBL:D4HA50"
FT                   /protein_id="ADE01080.1"
FT                   /translation="MAQRVRVDLVDDVDGSPAEESVNFALDGVNYVIDLSAENASKLRD
FT                   ALSLWVDHARRTGGRRTRGRRPTGGPTANEVRQWAKSQGYEVSERGRVSNEIREAYQRT
FT                   H"
FT   gene            352990..355524
FT                   /locus_tag="HMPREF0675_3324"
FT   CDS_pept        352990..355524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3324"
FT                   /product="ATPase family associated with various cellular
FT                   activities (AAA)"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF02151; match to protein
FT                   family HMM PF02861; match to protein family HMM PF07724;
FT                   match to protein family HMM PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3324"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01193"
FT                   /db_xref="GOA:D4HA51"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:D4HA51"
FT                   /protein_id="ADE01193.1"
FT                   /translation="MFERFTDRARRVVVLAQDEAKALNHNYIGTEHLLLGLISEGEGVA
FT                   AKALESLDISLEAVRAQVEEIIGHGTSTPTGHIPFTPRAKKVLELSLREALQMNHSYIG
FT                   TEHILLGLIREGEGVAAQVLIRLGADLNTVRNSVLQLLQGYQGDERQAATSGAPEAGPQ
FT                   QSSATILDQFGRNLTEAARDGELDPVIGREREIERVMVVLSRRTKNNPVLIGEPGVGKS
FT                   ACVEGLAQAIVRGDVPETLRDKKIYSLDLGSMVAGSRYRGDFEERMKKVLKEIKNRGDI
FT                   ILFIDEIHTLVGAGAAEGAIDAASMLKPMLARGELQTIGATTLDEYRKYIEKDAALERR
FT                   FQPIQVDEPSIPLAIEILKGLRDRYEAHHKITITDEAITSAANLASRYIQDRFLPDKAI
FT                   DLIDEAGARMNIRRMTAPPDLREFDERIARVRVEKEAAIDAQDFERAAGLRDDEKKLLA
FT                   EREAKEEEWKQGDESVPAVVGPDEIAEVLSGATGIPVFKLTEEESQRLLHMEDEIGKRY
FT                   VGQEDAVKALCRSIRRTRAGLKDPKRPAGSFIFAGPSGVGKTELTKALTEFLFGDEDAL
FT                   ITLDMSEYSEKHTASRMFGSPPGFVGYEEGGQLTEKVRRKPFSVILFDEIEKAHPDIFN
FT                   SLLQILDEGRLTDAQGRVVDFKNTVIVLTTNLGTRDISKSVNLGFSKADDVESSYEKMK
FT                   AKVTEELKGHFRPEFLNRLDEIIVFHQLTQPDILRIVDLMVGQLEDRLADKDMGIEVTP
FT                   AAKELLSTRGFDPLLGARPLRRTIQRDIEDVLAEKILFGEVKPGQIVVVDAAPEGSEEP
FT                   FVFTGTERSELPDEVPPELTSSAGENNRGQQG"
FT   gene            complement(355577..356584)
FT                   /locus_tag="HMPREF0675_3325"
FT   CDS_pept        complement(355577..356584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3325"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99194"
FT                   /db_xref="InterPro:IPR021365"
FT                   /db_xref="UniProtKB/TrEMBL:D4HA52"
FT                   /protein_id="ADD99194.1"
FT                   /translation="MTLDDDAPIWAKTIIDGLNRPFPWGSAHQSSGPDDVDVTPWRLHP
FT                   AFHGCLDWHSSVHMQWSAVTLLRCANQVIDHTTIDALNGVLNDRLTDENARVEAEYLRI
FT                   HRGYERPYGWGWATLLAAQCAPLTGTTWASATRIISLQVFENLLAWLPTLTFPVRTGTH
FT                   DNTAFGIGLCLDAARSLQRPEVIEAIVEHSHRLFDADVDYPSSWEPSGNDFLSAALSEA
FT                   HLMARVYDVEGRTNEFGTWLHTFLPRLGQSDDNLLNVPRVTDGTDGKLAHLYGLSLSRA
FT                   WQLRALATWLAEGSRHRIEKATARQINEVSHQITHGDFMATHWLVSFALQAVLV"
FT   gene            complement(356581..357567)
FT                   /locus_tag="HMPREF0675_3326"
FT   CDS_pept        complement(356581..357567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3326"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06166"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3326"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99597"
FT                   /db_xref="GOA:D4HAI6"
FT                   /db_xref="InterPro:IPR009323"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAI6"
FT                   /protein_id="ADD99597.1"
FT                   /translation="MIKVEWFYWLCGFLFLVTAVVRLRDREDNKRFGSAAFWAILAFSF
FT                   GYGSFVINKTAPTLVEGIAVLLLVVLAACRFPGRGSTETTTEAEREKSAKKFGNKLFML
FT                   ALIIPFVAAIFAVAGMRNVSFDGSPLLETGMATIIGLGAASVIALVTAMIMFKVRSPVV
FT                   AFKEGDRLLGHIGWAAILPQFLATLGTLFNNAGVGDAVGRITSWILPSESLFAAVCVYC
FT                   LGMALFTLIMGNAFAAFPVMTAAVGWPLLIQHFHGNMAAVFAMGMLAGFCGTLCTPMAA
FT                   NFNLVPAALLELDDSYGPIKAQIPTAVPLLVCTILIMYLCCFPGGLL"
FT   gene            complement(357564..358328)
FT                   /locus_tag="HMPREF0675_3327"
FT   CDS_pept        complement(357564..358328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3327"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06149"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3327"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00552"
FT                   /db_xref="GOA:D4HAI7"
FT                   /db_xref="InterPro:IPR010374"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAI7"
FT                   /protein_id="ADE00552.1"
FT                   /translation="MWVLLAVAIVVIGFALRLNAMLVVAVAGIAAGLIAGMSPVKLIET
FT                   FGTGFASSRSVTVFIVVLPVIGLLERHGLMQQAGRLMSKMKSMTAGKLLAVYLAVRQIA
FT                   AAVGLSSIGGPAQAVRPLVVPMAEAAARRTHPRYTRKMREKLRSYASSADTIGLFFGED
FT                   VFIAIGSILLITGFVDATYNLKLEALQIALWAIPTAICAFLIHAPRLWLLDRKLAKMAA
FT                   EGGDNVDTDEVPEPGHTVSLPSGGNPEQGVHE"
FT   gene            358451..359221
FT                   /locus_tag="HMPREF0675_3328"
FT   CDS_pept        358451..359221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3328"
FT                   /product="LamB/YcsF family protein"
FT                   /note="identified by match to protein family HMM PF03746"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3328"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00861"
FT                   /db_xref="GOA:D4HAI8"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAI8"
FT                   /protein_id="ADE00861.1"
FT                   /translation="MATVDLNADMGESFGSWKTGDDESLLGIVTSANVACGFHAGDAVV
FT                   MGQTCKAAAEHGVCIGAHVSYRDLAGFGRNFIDVDPGRLRDEVIYQLSALRGIAAVHGA
FT                   SVRYVKPHGALYNTIVHHQAQAKAVVEAIDAVNSATGADMAILGLPGALVLDLAEQQGV
FT                   RTLSEAFADRAYNPDGTLVSRRQEGSVLHDPGEVAERVVTLVTQGSVTAIDGTKVPIKV
FT                   DSVCVHGDTPGAVAMATAVRDRLASTGIELRAAA"
FT   gene            359218..359838
FT                   /locus_tag="HMPREF0675_3329"
FT   CDS_pept        359218..359838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3329"
FT                   /product="conserved hypothetical protein TIGR00370"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift; identified by match to protein family HMM
FT                   PF02682"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3329"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99217"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAI9"
FT                   /protein_id="ADD99217.1"
FT                   /translation="MRLLPAGRTAVLVELDDAGQRRRLHRTLSEHPAVGTVDLVPAQTT
FT                   VLIDVESPDQLPAAVAHVQEFIAAGLDCVEQGAREIVEVPVRYDGLDLSDVAELLSMTT
FT                   DELVKRHSDQQWTVEFAGFMPGFGYMSGADWPYRIPRRDSPRTRIPPGSIALADGFTGV
FT                   YPQASPGGWQIIGTTDAILWDEKADPPALLLPGAVIRFEVVDS"
FT   gene            359835..360704
FT                   /locus_tag="HMPREF0675_3330"
FT   CDS_pept        359835..360704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3330"
FT                   /product="allophanate hydrolase subunit 2"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift; identified by match to protein family HMM
FT                   PF02626"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3330"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01198"
FT                   /db_xref="GOA:D4HAJ0"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAJ0"
FT                   /protein_id="ADE01198.1"
FT                   /translation="MTHFVVETAGPRTLIEDAGRRGWADLGISGCGAWDRRAYLDGARL
FT                   VGNGAGLGCLEILLGPVRLRCVGGPVLVAVTGADAQIDLDGAPRPSGWGFLVTDGQTVS
FT                   IAMPATGLRSYFSVTGGINASPTFASVSADPTRGMGPAPLKAGDRVSVGDGPAGLISTT
FT                   PVDIQQAPTELVLHGVWGPRDDWFTDAGRRSLEQTPWRVAQASDRVGTRLEGPSLERAV
FT                   TGELTSEPVMRGAIQVPTSGVPLVFGPDHPTTGGYPVIGVVDPEDADRLAQARAGVVVR
FT                   FAMTAHDW"
FT   gene            360868..362355
FT                   /locus_tag="HMPREF0675_3331"
FT   CDS_pept        360868..362355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3331"
FT                   /product="drug resistance MFS transporter, drug:H+
FT                   antiporter-2 family"
FT                   /note="identified by match to protein family HMM PF07690;
FT                   match to protein family HMM TIGR00711"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3331"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00732"
FT                   /db_xref="GOA:D4HAJ1"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAJ1"
FT                   /protein_id="ADE00732.1"
FT                   /translation="MSPEQSSVAHVEHLAQDRDGHVVTEEQAWSALWALLIGFFMILVD
FT                   TSIVTTALPATIRALNANLNQGVWITSAYLLTYAVPLLITGRMGDRWGPHRMYIIGMLV
FT                   FGVSSLACGLSPTIGVLIAARAVQGIGAALMTPQSLSMITRLFPPEKRGAAMGLWGATA
FT                   GVASFVGPVLGGILVDTLGWEWIFFVNVPVTVIGLWLAIRNVPALETHGHAFDWCGVVL
FT                   SGIGMTLLVFGIQEGEQYNWGTITGIISVPLLIVLGVVFMVLFVVSQTQWAQSRLHARS
FT                   TNFEPLVPLRLFTKRNFTLANIAIFLVGMLVTSYFLPTAIYLQNVRGKSPTVAALLLIP
FT                   TAVVSGVLSPVVGRVLQHRRSGRMAAIGVSLYVISSIGWWLFTVPSTGLWVFPLLSVIT
FT                   GVGAALTWSPISLVGTDDLGQADAGAGSGVYNATRQVGSALGSAFIAMMMDARIMARHD
FT                   LGRGLGESMFITITAGTICVIVCAFFANFQRSRQRNS"
FT   gene            362423..363322
FT                   /locus_tag="HMPREF0675_3332"
FT   CDS_pept        362423..363322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3332"
FT                   /product="TIGR01777 family protein"
FT                   /note="identified by match to protein family HMM PF01073;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF08338; match to protein family HMM TIGR01777"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3332"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99876"
FT                   /db_xref="GOA:D4HAJ2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAJ2"
FT                   /protein_id="ADD99876.1"
FT                   /translation="MRIAIGGFAGLIGTALVQRLRKEGHDVVTLTRHEPIQPSDRRWDL
FT                   DTLSIAPPFLDDVDAVVNLAGAPIADGRWTDERKTRILASRIDSTRVVVRALASSPRCR
FT                   IFLNGSAVGYYGPHGDEWLDENDPAGAGFLAEVCQRWETAANSAPDGVRVATLRTGHVV
FT                   SSFGGMLGKERPFFQFGLGGKIRDGSQYMSWISLHDHVSAMMKVLTDDAMSGPVNLVSP
FT                   NPCTNAEFTTALAQAMHRPSVIPFPVPAAKMIFGSQLVDEALCSGQRVKPAKLLEHEFE
FT                   FRDTSITESITSALAGRR"
FT   gene            363319..364227
FT                   /locus_tag="HMPREF0675_3333"
FT   CDS_pept        363319..364227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3333"
FT                   /product="peptidase, S54 family"
FT                   /EC_number="3.4.21.-"
FT                   /note="identified by match to protein family HMM PF01694"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3333"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00536"
FT                   /db_xref="GOA:D4HAJ3"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAJ3"
FT                   /protein_id="ADE00536.1"
FT                   /translation="MSQNNQRPDGFSRPDESGSWQDEPQQNHGDASGAASHARPAQRDE
FT                   STASQPEPYRSVDVDPSWAPPSASYQQATPRPVARVKRHSDVPVVTWTLIGICFLVWVG
FT                   EWLSPQVGEAVVLAPRVGFTEPWRFVTSMFGHALSIFHIGFNMYALWALGRSLEPFLGR
FT                   ARFLAAYLMSGLGGGALFCLMATADGGRAILPNVDDGVVGASGAIFGLFGVLLIVQRRL
FT                   GASTRELWVVLAINAALLLFISGIAWQAHLGGFLVGMMCGVIFFEDPKRIQAGKSAQTW
FT                   PRMALLLFAMVAALVVKYLVI"
FT   gene            complement(364245..364763)
FT                   /locus_tag="HMPREF0675_3334"
FT   CDS_pept        complement(364245..364763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3334"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00305"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAJ4"
FT                   /protein_id="ADE00305.1"
FT                   /translation="MLIDANRFDLLEELILAEPLRHGQPVVLIDGRSGAGKTTLANTLI
FT                   CHHADWQLVHADDLYPGWSGLSAVWDLRDLVARRRYRRWDWYQNRFDDEVILNANRPLV
FT                   IEGCGVLTPTNAPLASLRVWCEVSAPLRRHRALARDPEFRDQWAMWAVQEGLHIARHRP
FT                   ADLADLTIS"
FT   gene            complement(364873..365529)
FT                   /locus_tag="HMPREF0675_3335"
FT   CDS_pept        complement(364873..365529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3335"
FT                   /product="response regulator receiver domain protein"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00196; match to protein
FT                   family HMM PF04967; match to protein family HMM PF08281"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3335"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00883"
FT                   /db_xref="GOA:D4HAJ5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAJ5"
FT                   /protein_id="ADE00883.1"
FT                   /translation="MLPVRVLLVDDDTLVRRAVRQILEAADDLEVVGEASDGDGAVRQA
FT                   PQADVVLMDLRMPGMSGVEATSRITHSPSSPKVVVLTTVTADAAITDAVHAGASGFLLK
FT                   ASSPDDIVNAVRAVHAGDAFMSPTSTRQLLEQLRGDAGRRVRGAARKTLSALTDREREV
FT                   AIAVAEGLTNDAIAARLNVSASTVKAHLSTIQTKLDVDSRVRIAVLVERAGYLAA"
FT   gene            complement(365609..366841)
FT                   /locus_tag="HMPREF0675_3336"
FT   CDS_pept        complement(365609..366841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3336"
FT                   /product="histidine kinase"
FT                   /note="identified by match to protein family HMM PF07730"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3336"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99304"
FT                   /db_xref="GOA:D4HAJ6"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAJ6"
FT                   /protein_id="ADD99304.1"
FT                   /translation="MIEYEVVGDDRRPAVWLSIVLIAIGILGCFTSTAFCPLALRMTAQ
FT                   NPSGLTVLHGVAALVADMVLPVGLLWRHRQPFTITLVTAAISLVLPIGNTVPLIALACL
FT                   LGRRRGAASWWATAAVTITTTIVGIVDAARSPKAASTIKTLLSPANTPDAADLTVSWFT
FT                   VAAFIAAGLIISIGSGLWRRTQRATTSLTRERDVAQATNAKLGDELSRREERERIAQEI
FT                   HDQLGHRLSLLSLQSGALETQLRDNPDVVKAAHEVQAGAAAAVNDLHSLLSVLTESRVT
FT                   PDLPLSKLAEVIDESFGAGQPLNSSVFIEDADRVDPAVSRAVYRIVQELLTNAAKHAPG
FT                   QTTTLRIRGNPRDGISIDATNGYIGGWAGGPSAHSRGLKGITERVELLGGSLHYGLDDN
FT                   LFHVHVDIPWQ"
FT   gene            366992..367588
FT                   /locus_tag="HMPREF0675_3337"
FT   CDS_pept        366992..367588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3337"
FT                   /product="hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   premature stop"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3337"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00956"
FT                   /db_xref="GOA:D4HAJ7"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAJ7"
FT                   /protein_id="ADE00956.1"
FT                   /translation="MSNDQQPPHYPQPQYPGEGPQSQSNPQYALNSGGMPPSKPKKPIY
FT                   KRVWFWIVIAVVILGIFAALGGGSKGGDEQKSGSDKAASAPATSQAKEADKSAGKPAEK
FT                   PAAKTTDEDQVKGDLALLKGWKLKKDEFSAHVTGYVRNNSDESINNYIQIEFNAYDASG
FT                   SNTDTCLANTNTIDAHGKWKFDAICSQNPSEIKTV"
FT   gene            complement(367794..368705)
FT                   /locus_tag="HMPREF0675_3338"
FT   CDS_pept        complement(367794..368705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3338"
FT                   /product="PRD domain protein"
FT                   /note="identified by match to protein family HMM PF00874;
FT                   match to protein family HMM PF03123"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3338"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00617"
FT                   /db_xref="GOA:D4HAJ8"
FT                   /db_xref="InterPro:IPR004341"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="InterPro:IPR036650"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAJ8"
FT                   /protein_id="ADE00617.1"
FT                   /translation="MQRPDRSRYATTKQGSLRPGHVIVKKIYNNNVLLGVNGSGTEMVV
FT                   NARGIAYGRHRGEIVDASSAQRYVAEGAYRTTAIASLLTNATHTEVRVAQAIVELAREE
FT                   LGTPHARRMMLPILDHLVAAVHRAKQGAVIDFPLEWEVRQLYPDEAELGRRAVEIVDGA
FT                   LGIHLQPEEWVAFSLHFINQRWDSKDVSRTMSMTQTICDVFTELEDLWHVEIDRSSMSA
FT                   SRFVTHLRYLFARASDNKQLSHVDLDIVGLMSDRYAEATLAASQVAEHMSKVIGNDLTK
FT                   AEINYIALHTTRLYNEVMGMDG"
FT   gene            complement(368710..369183)
FT                   /gene="ptbA"
FT                   /locus_tag="HMPREF0675_3339"
FT   CDS_pept        complement(368710..369183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptbA"
FT                   /locus_tag="HMPREF0675_3339"
FT                   /product="PTS system, glucose subfamily, IIA component"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift; identified by match to protein family HMM
FT                   PF00358; match to protein family HMM TIGR00830"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3339"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99505"
FT                   /db_xref="GOA:D4HAJ9"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAJ9"
FT                   /protein_id="ADD99505.1"
FT                   /translation="MSIFRKRRKATPLTIAAPVSGEIIDIADVPDPVFAGKHMGPGFAV
FT                   APVSGDFTSPIDGLVMLVAPTLHAVSLRADNGAEVLVHVGVDTVELKGEGFTAHVNEGD
FT                   RVRTGDPLLSVDLDSIRPRVPSLISPVVVTNAAGFTISERSNDPASVLSVTAG"
FT   gene            complement(369195..370721)
FT                   /locus_tag="HMPREF0675_3340"
FT   CDS_pept        complement(369195..370721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3340"
FT                   /product="PTS system, glucose-like IIB component"
FT                   /EC_number="2.7.1.69"
FT                   /note="identified by match to protein family HMM PF00367;
FT                   match to protein family HMM PF02378; match to protein
FT                   family HMM TIGR00826"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3340"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00573"
FT                   /db_xref="GOA:D4HAK0"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAK0"
FT                   /protein_id="ADE00573.1"
FT                   /translation="MFKTLQKIGKAFMLPIAILPAAGLLLGIGGALSNPTTVKSYPVLD
FT                   NPILQDIFQVMSAAGNVIFENLALLLSIGLCIGLAKRDKGTAALAGITGFLVMTATTKA
FT                   LVVLSRHPDRTIDTGVVGSLVIGAVAVWLHNRYHNIELPAFLGFFGGSRFVPIVTAFAG
FT                   IIIGAFFFVVWPPIQAGMVSAGTAIADWGVIGTFFYGFLMRLAGAVGLHHMIYPMFWYT
FT                   PLGGTEAVAGKTVVGAQKIFFAQLADPNHVGLFTHSTKYFAGRFATMMFGLPGACLAMW
FT                   RCVPKGRRAKYTGLFASVAFTSFLTGITEPIEYMFLFVAPLLYVFHSVLDGVSFLVADL
FT                   INIRIGNTFSGGAIDYLLFGVLQGEAKTHWLYVLPVGALWFVIYYFSFTFFIKKFRIAT
FT                   PGHLEDTMTAATPTDRRSQEKSERRNDGIDETAAEIITALGGAENIEDVDACITRLRVS
FT                   VKAPDQVSKASLKNLGATEVFEVGGGVQAVYGAKAILYKNAINAQLGIDD"
FT   gene            complement(370723..371016)
FT                   /locus_tag="HMPREF0675_3341"
FT   CDS_pept        complement(370723..371016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3341"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99566"
FT                   /db_xref="GOA:D4HAK1"
FT                   /db_xref="InterPro:IPR007260"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAK1"
FT                   /protein_id="ADD99566.1"
FT                   /translation="MNSVVQSLAKGLIVPCQTLPDEPIYSKSGGVTPLFTTAAAQSGAV
FT                   DIRANSVRDIKTILSTGADIVAVGGTITRPAQICTQFIDAIRARIPHTSLEN"
FT   gene            complement(371556..371738)
FT                   /locus_tag="HMPREF0675_3342"
FT   CDS_pept        complement(371556..371738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3342"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00855"
FT                   /db_xref="GOA:D4HAK2"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAK2"
FT                   /protein_id="ADE00855.1"
FT                   /translation="MWQLIAIYLCFMGGFYGYTLWLPPRGQGTHVPLAISAVALVVGAA
FT                   LAWVVIKPKITRTAP"
FT   gene            complement(371893..372768)
FT                   /locus_tag="HMPREF0675_3343"
FT   CDS_pept        complement(371893..372768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3343"
FT                   /product="putative A/G-specific adenine glycosylase"
FT                   /note="identified by match to protein family HMM PF00633;
FT                   match to protein family HMM PF00730"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3343"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00331"
FT                   /db_xref="GOA:D4HAK3"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAK3"
FT                   /protein_id="ADE00331.1"
FT                   /translation="MPDTGLTSQVIEAICAWFDANGRDLPWRRPGTSAWGVLVSEVMSQ
FT                   QTPMSRVIGPWHEWMNRWPTPDDLAEEDSGEAVAAWGRLGYPRRALRLHSCAVAIATEH
FT                   DGVVPNSYDELVALPGIGDYTASAVVSFAFGGRATVLDTNVRRLIARAESGIANCPTSV
FT                   TRAERVVADALVPDEDVRAAKWAVASMELGALVCTARSPQCEVCPIRDSCRWVIDGKPD
FT                   NAPARRGQPWKGTDRQCRGVIMDVVRNSPRGVKVQMALSAWPEPDQASRCLESLLDDGL
FT                   VHRRGSLISL"
FT   gene            complement(372761..374071)
FT                   /gene="hemL"
FT                   /locus_tag="HMPREF0675_3344"
FT   CDS_pept        complement(372761..374071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="HMPREF0675_3344"
FT                   /product="glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /EC_number="5.4.3.8"
FT                   /note="identified by match to protein family HMM PF00202;
FT                   match to protein family HMM TIGR00713"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3344"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99526"
FT                   /db_xref="GOA:D4HAK4"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAK4"
FT                   /protein_id="ADD99526.1"
FT                   /translation="MTSNAELFSAAQAVIPGGVDSPVRAYGSVGGVPRFIEKAQGPWIW
FT                   DAEGTRYVDLVCTWGPALLGHARPEVVSAVQVAASKGLSFGAPTRTETELADAIIERMA
FT                   PVEKVRFVSTGTEATMTAVRLARGTTGRDVIVKFAGNYHGHSDVLLAAAGSGVATAGLP
FT                   GSAGVPAASTADTIVVDYNDVAALDAMFSERGDQIAAVIVESCPANMGVVPPEPGFNAA
FT                   IRRLTTEHGALMITDEVLTGFRCSPSGFWGLQQQAGEDFAPDIFTFGKVIGGGMPLAAL
FT                   GGRAEVMDLLAPTGPVYQAGTLSGNPLATVAGVKTLQLADAGVYQRLDARSEKWRSELV
FT                   SALDAAGVTYRLQNAGNLFSVFLGVDSPVRNYDNAKSQNAEAYTAFFHAMLDAGVNLPP
FT                   SCFEAWFLSDAHDDEAFEVFRAALPKAAQAASQVISA"
FT   gene            complement(374119..375165)
FT                   /gene="hemB"
FT                   /locus_tag="HMPREF0675_3345"
FT   CDS_pept        complement(374119..375165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="HMPREF0675_3345"
FT                   /product="porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="identified by match to protein family HMM PF00490"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3345"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99000"
FT                   /db_xref="GOA:D4HAK5"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAK5"
FT                   /protein_id="ADD99000.1"
FT                   /translation="MNPYLPDASDPRMAGVKPLPEGLRPVSRPRRLRTTPAMRRMVAET
FT                   RVAPAQLMLPAFVKEGIDSPVEITSLPGQFQHSTESIKELATQAAEAGIGGIDLFGIPE
FT                   HKDEIGSQAWDLKGILNAGISAVREAVGDDLVICADTCLDEFTDHGHCGALTPDGRVDN
FT                   DSTVPLYAAMAVSQARAGAHMVSPSGMMDGQIAVIRDALDREGFTDVSIMAYSAKYASA
FT                   FFGPFRDAVNCSLKGDRKTYQQDPPNRREGLRETLLDLAEGADLVMVKPASHYLDVLSD
FT                   VAEVSQVPVAAYQVSGEYAMLEAAAANGWIDRRRCIGESLTSIVRAGADLVLTYWAIEA
FT                   AQMFREDL"
FT   gene            complement(375195..375920)
FT                   /gene="hemD"
FT                   /locus_tag="HMPREF0675_3346"
FT   CDS_pept        complement(375195..375920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemD"
FT                   /locus_tag="HMPREF0675_3346"
FT                   /product="uroporphyrinogen-III synthase"
FT                   /EC_number="4.2.1.75"
FT                   /note="identified by match to protein family HMM PF02602"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3346"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00165"
FT                   /db_xref="GOA:D4HAK6"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAK6"
FT                   /protein_id="ADE00165.1"
FT                   /translation="MTTNPADLVKPPVVVPRDDSHDKFVTTLKQAGYGVIHTALTRTVT
FT                   LPDAERLTAPDLWQADWLVVTSKTTVGLLPTPLPNPNIKVAAVGAATSAALRTRGIDVD
FT                   FVPENHSGAGLVAEWPGGVASILLPASQLTADTVPLGLTKVGCTVNRLEIYTTAAVEKL
FT                   PEVIAQSWPSVGVVVVTASSVGRALVELVEPLGWRRQKLVALGKPTARTLEVLGHPAHA
FT                   VASSPTPEAVLEAVESLVA"
FT   gene            complement(375917..377017)
FT                   /gene="hemC"
FT                   /locus_tag="HMPREF0675_3347"
FT   CDS_pept        complement(375917..377017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="HMPREF0675_3347"
FT                   /product="hydroxymethylbilane synthase"
FT                   /EC_number="2.5.1.61"
FT                   /note="identified by match to protein family HMM PF01379;
FT                   match to protein family HMM PF03900; match to protein
FT                   family HMM TIGR00212"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3347"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00660"
FT                   /db_xref="GOA:D4HAK7"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAK7"
FT                   /protein_id="ADE00660.1"
FT                   /translation="MPLWCRRPAELSVNLSDCRLESASVLSATIGNMSAIRLGTRASTL
FT                   ATTQSEMVAGLLRSEGLDVNLTTITTHGDTSTASLAAMGGIGVFASAIRAALLEGEADI
FT                   AVHSFKDLPTGRPLGLAIGAVPARADPRDALVARDGLTLHDLPQEASVGTGSPRRAAQL
FT                   LAVRPDLTIVDIRGNVDTRLGRVKGLGRYAKNGGKEDLDAVVLAASGLARLGHSGAVTE
FT                   FLDPSVVLPAPAQGALAVECRTADSRHGKLAKALARIDDRRTRLAATAERAVLSHLEAG
FT                   CAAPIGALAQLKPVSGKSLQVLTLDVVVAAVDGSRTVREQVSVELPAEVEPALAAAHTL
FT                   GVTAAEELLDDGAADVADLKASGSTR"
FT   gene            complement(376968..378416)
FT                   /gene="hemG"
FT                   /locus_tag="HMPREF0675_3348"
FT   CDS_pept        complement(376968..378416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemG"
FT                   /locus_tag="HMPREF0675_3348"
FT                   /product="protoporphyrinogen oxidase"
FT                   /EC_number="1.3.3.4"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM TIGR00562"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3348"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99138"
FT                   /db_xref="GOA:D4HAK8"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAK8"
FT                   /protein_id="ADD99138.1"
FT                   /translation="MSRVATMNISDPQHVDAVVIGGGMAGLVAAWQFTQEGLHPVLVES
FT                   RGYTGGLIARSTLAGISYDIGAEGWAVRLPDTAELATELGLTVEKPTIAPSWVYFDDAC
FT                   FAMPDNAILGIPANLSDPVVIIALGAEEAARAAELDRAPMPEDLPRDLGTLVASRMGSE
FT                   VLRRLVTPIAGGIHAADPHLLSVDVVSPGLRAATQATGSLAAGVALCRSRMPAGPAVAS
FT                   VAGGMFIMPAELRRQAEQAGATTMTRVGARGLTRHGDQWLVETAGTSRNPDPSLPPVTD
FT                   GEIRSFLTPRVVVACSAGPATKLLSNVIDTVGPELAPGAPIGHVNLALQAPALDSSPRG
FT                   NGMLVAPGTTTVTAKALTHMSAKWPSLRESCPEGLHLLRVSYGRSGEANVALSVDQALT
FT                   DASVLLGVDLSAEQVVDSQIIHWTGSLAPTTPQARAWRDGLHRQLEVLNQSGQGRIGLV
FT                   GSWASGSGIAALVPQARRTVRQLV"
FT   gene            complement(378413..379477)
FT                   /gene="hemE"
FT                   /locus_tag="HMPREF0675_3349"
FT   CDS_pept        complement(378413..379477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemE"
FT                   /locus_tag="HMPREF0675_3349"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   premature stop; identified by match to protein family HMM
FT                   PF01208; match to protein family HMM TIGR01464"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3349"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99676"
FT                   /db_xref="GOA:D4HAK9"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAK9"
FT                   /protein_id="ADD99676.1"
FT                   /translation="MMTETTTFMADSPLLQAMTGHRPTVTPVWFMRQAGRSLPEYREAR
FT                   EGTTMLESCLNPELAAEITCQPVRRHHVDGAVLYSDIMVPLALAGAEVRIEPGVGPVLD
FT                   EPVRTASDVDRITRRHVEDPSVIEEAARLAITELGDATPLIGFAGAPFTIAAYLVEGGP
FT                   SRDHLSARAMMHSDPQTWARLMEWVADLDAAFLAAQLRGGARAFQLFDSWAGSLSASDY
FT                   RASVAPFSQRALATVDPNIPVVHFGINATHLLSEFAQVAATASRYPVLGVDHRTSLDEA
FT                   CATLMVSGMEMPVQGNIDPALLFAGWEPLESATRDIVAAGRQAPGHVVNLGHGVPSNTD
FT                   PNVLTRLVELVHSL"
FT   gene            379589..380944
FT                   /locus_tag="HMPREF0675_3350"
FT   CDS_pept        379589..380944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3350"
FT                   /product="glutamyl-tRNAGlu reductase domain protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift; identified by match to protein family HMM
FT                   PF01488; match to protein family HMM PF05201"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3350"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99433"
FT                   /db_xref="GOA:D4HAL0"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAL0"
FT                   /protein_id="ADD99433.1"
FT                   /translation="MGLCVLTVDHAEQGLGVVSEAAAQVDGLGLALTDHPQIRGALVLS
FT                   TCNRVCLIVETSPEAVAQGFDEAALRRCIADHGANVLAESAQLVCENDAVWRLFRVAAG
FT                   MESMVFGEREVAGQMKRALSEARREQTVSYTIGHVVEEALKTSRHVATETALAAEGRTV
FT                   VAVGLDLVAQRMDLDGARVLVMGTGSYAGASCAQLSSRGVAEIQVHSASGRAAGFARRH
FT                   RVSEALDIDAALAQADLVVTCRGSGVPALSAEAARRAVDARRGRDLMVLDLAISGDVEE
FT                   PVPAGVEVIDLETIRQAVPASAEAERAAAEHIIATGVRHFAVDLERRRMAPAVVALRDV
FT                   ISDLVTAELERLPEEGSVPVYEVAASLRRLAASMAHIPSARARMASEQGLGDRWLNSLS
FT                   DVLGIDVDIAAPVIDMSSFANADCMTCPVTGLRVEDLATDAAPEVRRGHRDR"
FT   gene            380934..382985
FT                   /locus_tag="HMPREF0675_3351"
FT   CDS_pept        380934..382985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3351"
FT                   /product="ferrochelatase"
FT                   /EC_number="4.99.1.1"
FT                   /note="identified by match to protein family HMM PF00762;
FT                   match to protein family HMM PF06778"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3351"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99943"
FT                   /db_xref="GOA:D4HAL1"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR010644"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAL1"
FT                   /protein_id="ADD99943.1"
FT                   /translation="MTANPYAAPTDPLAPYSAVLVVSFGGPRSPEEVMPFLRRVSHGRI
FT                   PEERLADVARHYDRFGGVSPINDATDVFVNAIGNELRRHGVRVPVLLGNRNGTPFLEEA
FT                   LTDMHAHGVRRVLAVVTSAYASYSGCRQYREEIATALAHAGITDMQVDKVPPFNEAPGF
FT                   IRANAEALMQAFMRIPPTPLEATRVVFVTHSIPDSMQDASGAGQPGTDYISQHKAVCER
FT                   VAGQVRQVFGNMPQWDLAYCSRSGRPSDPWLEPDIIDHLRSLPEQGVQSVVVAPIGFVA
FT                   DHMEVVNDLDYEAAEAAKESGLAFTRAATAGTHPAFIADLAGLILSQAAAARGEGGNLT
FT                   SWPAPCVAGCCRRYPDAQDIPAVSGGDVESVAAGADVVDAEPGGVDFVPSGSASAVDRP
FT                   GPEAVELETPPSPYNPLTKEAPMSDHSSADSVIEGPRDDEVPAGSYTAPTDPRDTPVIP
FT                   EEVNASSKWAMYSVFRVATALPAEDDERRRLVEGSDEWAGQSGVDTRGWYDLSGLRANA
FT                   DLLVWWVSDDPAVLQDAYHRFRASGLGRHLEPVWSNVGVHRPAEFNKSHLPSCFAGIAP
FT                   RRWAAFYPFIRSKEWYLLPAADRSRMLREHGIVGAASSDVKASTLAAFALGDYEWILAL
FT                   EGDDLARIVDVMKDLRYVEARRYVDVDTPFFTGERVSPVVWADRQMRA"
FT   gene            382985..383689
FT                   /locus_tag="HMPREF0675_3352"
FT   CDS_pept        382985..383689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3352"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3352"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00203"
FT                   /db_xref="GOA:D4HAL2"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAL2"
FT                   /protein_id="ADE00203.1"
FT                   /translation="MTSLRGLTDPVGPESPQTYWVRRLMLLVVVVVVVALVIAGIAKLA
FT                   GGSKESAAPAASSFTPDPSWTDTAWASATPSASSSAVSPSKSAPRTESPSPSALASTPS
FT                   ASSTMCEGSQLSVKVTGDTKKPHVGDTETFTVEVSSSTSCHWDTQKVKQTLTVTSGSDR
FT                   IWSTDDCGSWGPKGVHEIKSKNPWTYKISWPTKRSTGKCKLSQESLGAGYYVATVNLGG
FT                   GPSGRFVMRMGT"
FT   gene            complement(383725..384825)
FT                   /locus_tag="HMPREF0675_3353"
FT   CDS_pept        complement(383725..384825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3353"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02457"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3353"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00715"
FT                   /db_xref="GOA:D4HAL3"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAL3"
FT                   /protein_id="ADE00715.1"
FT                   /translation="MNDVQPDPETSREMQAEQVRHLMALLAPGTPIREGLDRIVNGRTG
FT                   GLIVLGDGPEINGVCSGGFPLDVRLTPQALRELSKMDGGLVVSSDHERIKAAAVHFVPD
FT                   GSLPTLETGTRHRTADRLSQQTGVPVVVVSASMSVMSLFLNGRRYLIERPEQLLARANQ
FT                   ALATLASYRGRLVDEAENLTTLEIRDQVQVRDVAAVAQRVEMWRRIDAEVRGYVSALGV
FT                   EGRLVQLQRNELSLGVEDLGRLLTDDYRPNSVAPGGFSLSGLQKLSWEDLLNVTMVAET
FT                   INLGPAEHPLDSPIRARGHRQLTLMTDLSSRTIQRIIDHFSDLQSLVSASTSELGDIKG
FT                   VGLRRAREIRQGLESIFEGDQRTHHH"
FT   gene            complement(384878..386275)
FT                   /gene="radA"
FT                   /locus_tag="HMPREF0675_3354"
FT   CDS_pept        complement(384878..386275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="HMPREF0675_3354"
FT                   /product="DNA repair protein RadA"
FT                   /note="identified by match to protein family HMM TIGR00416"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3354"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99549"
FT                   /db_xref="GOA:D4HAL4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAL4"
FT                   /protein_id="ADD99549.1"
FT                   /translation="MARKTQTPTWVCTECGWTTTKWVGRCGECQTWGSVVEKGAPKLTE
FT                   VTSSTPTSKAVPIGQVSEQAANRHLTGISELDRVLGGGLVPGVVVLLAGEPGVGKSTLL
FT                   LDVAAKWAKAGRRTLYVTGEESAAQVRLRAGRTKSLADELYLASETDLGTVLGHIEQTE
FT                   PSLMVLDSVQTVGTSQADGSPGGVSQVREVTGALVRVAKRRGMAVIIVGHVTKEGSIAG
FT                   PRTMEHLVDVVLNFEGDRHSGFRMVRATKNRYGPADEVGCFEMTDAGIMEVPDPSGLFT
FT                   SDNADPQPGTCVTVTIEGRRPLLSEVQALVAPSASEKYPRRITHGVKGGRVAMILAVLE
FT                   RKAGLPLSNRDVYVSTVGGARVSDPSADLAIAVSVASAVLDTNFPTRVVALGEVGLAGD
FT                   LRRVPGLERRVGEAARLGFDLAVVPRNSREAHTKIPTMHGLHVIEVGSVAEALSVLNLR
FT                   RQRKVNQ"
FT   gene            complement(386341..387987)
FT                   /locus_tag="HMPREF0675_3355"
FT   CDS_pept        complement(386341..387987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3355"
FT                   /product="malic enzyme, NAD binding domain protein"
FT                   /note="identified by match to protein family HMM PF00390;
FT                   match to protein family HMM PF03949"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3355"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01188"
FT                   /db_xref="GOA:D4HAL5"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAL5"
FT                   /protein_id="ADE01188.1"
FT                   /translation="MSRKPEPMTNPITNRGTAFTRAERLEHGMIGRLPAAVETLEQQAQ
FT                   RCYRQLQGLGCNIDRYVFLEELQNRNETLYYKLLVDHLVELLPVIYDPTVGEAIKKWSH
FT                   AYRRSRAVYLSVDHIEDVRPSFETLELGPDDVDLLVVSDSEQILGIGDWGVNGTDISIG
FT                   KLAVYTAAAGIRPERTIAVNLDVGTDNAYLLNDPSYLGNRHARVRGERYDELIHEYLEV
FT                   ASELYPHALLHFEDFGASNARRILVQNAANHRIFNDDMQGTAAIVLAAVISGLKVTRQS
FT                   FADQRLIVYGAGTAGTGIADQIRAAMISDGLSQQEAVDRIWLVDRNGLVTDDMKGLPDY
FT                   QEPYAKPVEKTRHWAHTNRHIGLTETIRRIHPTILIGTSTDHDAFTQQVVEEMCREVER
FT                   PIIMPLSNPTEKIEAMPADVIAWSKGKALVSVGIPVAPFHYEGTRYEIGQGNNALLYPG
FT                   LGLGVIVSGAERVSARMIRAAAEAVASQVDPRPAGSSLLPAVENLRASSATVAVAVVQA
FT                   AMEEGLATKKPSNVVQAVQDTMWWPHYPPVG"
FT   gene            complement(388051..388689)
FT                   /locus_tag="HMPREF0675_3356"
FT   CDS_pept        complement(388051..388689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3356"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99206"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAL6"
FT                   /protein_id="ADD99206.1"
FT                   /translation="MHVDHLMFAAGPAGLDEDAARLGEILGTSFINGGVHPSFGTRNRI
FT                   LPLSGPRYIEIVEVLDHPAAEKAVFGQAVRARQEQGGGWMGWAVSVDDLAPYEKRLERQ
FT                   SVPGKRTFPDGRHLEWRQIGIKGLMADPQLPFFIKWTSPTELLPSSLSGNVTLTSVEMS
FT                   GSRQRVEDWLGETIPDEVDGITFNFASPNGHPGIDAVTFDTPSRGCVRI"
FT   gene            388841..389728
FT                   /locus_tag="HMPREF0675_3357"
FT   CDS_pept        388841..389728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3357"
FT                   /product="AP endonuclease, family 2"
FT                   /note="identified by match to protein family HMM PF01261"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3357"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99871"
FT                   /db_xref="GOA:D4HAL7"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAL7"
FT                   /protein_id="ADD99871.1"
FT                   /translation="MPDCFGLSETTTTSASVAPRVTLSTTSVYPESTADAFARAKAIGY
FT                   DGVELMVGIDPVAADVDRIVDLSAEYGVTVSSIHAPCLLVTPNVWGSDPWGKLDNAAEA
FT                   AGRLGSKLIVVHPPFRWQRDYAGRFEEGIAKFNEKYFPLVFAVENMYPWRTPAGRFAAY
FT                   SPGFDPTNLSYDHLVLDLSHAATAQMNSRTLVDLWGSRLRHIHLTDGSGTFKDEHLLPG
FT                   QGNQHAWEVIERAVTGGFDGDIVLEVNTRKFSGEGAGQGARFEALSETLTQTRLAIDRG
FT                   IFARRSGQAWEGAR"
FT   gene            389791..390687
FT                   /locus_tag="HMPREF0675_3358"
FT   CDS_pept        389791..390687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3358"
FT                   /product="proline dehydrogenase"
FT                   /EC_number="1.5.99.8"
FT                   /note="identified by match to protein family HMM PF01619"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3358"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99577"
FT                   /db_xref="GOA:D4HAL8"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR008219"
FT                   /db_xref="InterPro:IPR015659"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAL8"
FT                   /protein_id="ADD99577.1"
FT                   /translation="MRLAMDPTIAHKVSRSRIAREIAVTYVAGEDVASAVDKAADQVSK
FT                   GLDVSLHPLDPDPADLAQARRAMVRLCGVIERLGADPSFNGHAEVSISLAALGLKVSDD
FT                   LARDHARQVCQVARDNHVAVTVDDEGPDIHDRSHRIVMDLLSEYENTGIVIQAARHDSL
FT                   MQVRELAAPGRRIRLCKGSYTGPRSVTLIRPHDVDLRMAACLRALMTGPSTVMLASHDP
FT                   VFVALGEQLMASLDRQLEFQMLQGIRPLEQRRLVDIGHRMRVYLPYGHDWYRYCTRRIV
FT                   ERPGNIWLFGRSLVERR"
FT   gene            390753..391523
FT                   /locus_tag="HMPREF0675_3359"
FT   CDS_pept        390753..391523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3359"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /note="identified by match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3359"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00115"
FT                   /db_xref="GOA:D4HAL9"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAL9"
FT                   /protein_id="ADE00115.1"
FT                   /translation="MMRDRAADRRLLWETMFVLAVSLGQSAWYSILRMIERLTRGVPMN
FT                   QQTSTLNSSVTPGRPWLDLLYQLSDIAFGVVPALLAVLLLAQVKPPRQGVRRALGLEAP
FT                   GWGRDVGAGAMLAAIIDIPGLGFYWAAHALGFNTTVRAADLQHVWWTAPVLIGLAGMNA
FT                   VLEETVMIGYLFTRWGQIGWSTTMVIVTSAIIRGTYHLYQGWGDFIGNIVMGLFLGWVF
FT                   SRRCRLLPLIVAHAFLDIVSFLGYAYLAGRVSWL"
FT   gene            391568..392611
FT                   /gene="asd"
FT                   /locus_tag="HMPREF0675_3360"
FT   CDS_pept        391568..392611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asd"
FT                   /locus_tag="HMPREF0675_3360"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="identified by match to protein family HMM PF01118;
FT                   match to protein family HMM PF02774; match to protein
FT                   family HMM TIGR01296"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3360"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00862"
FT                   /db_xref="GOA:D4HAM0"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAM0"
FT                   /protein_id="ADE00862.1"
FT                   /translation="MGIMKLGVFGATGQVGRVMRTLLAERHFPADEVRFFASARSAGQK
FT                   LSWNNGSGDSEVVVEDTATADFAGLDIAIFSAGGGTSREFAPRVAAAGAVVIDNSSAWR
FT                   RDPDVPLVVSEVNPEDVAKRPKGIIANPNCTTMAAMPVLKPLHDAAGLTRLVVATYQAV
FT                   SGSGVAGVRALTDQTTAIDDPAGLALDGRGVPVADLGPYVAPIAFNALPVAGNFVDDGS
FT                   GETDEEQKLRNESRKILHIPDLLVAGTCVRIPVYSGHGLVVHAEFRESLSPEKATELLT
FT                   QAPGVRVVDVPDPRSAAGIDPSLVGRIRADQSAPAGKGLVFFCAADNLRKGAALNAVQL
FT                   AELVAAE"
FT   gene            392608..393399
FT                   /gene="proC"
FT                   /locus_tag="HMPREF0675_3361"
FT   CDS_pept        392608..393399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="HMPREF0675_3361"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="identified by match to protein family HMM PF01210;
FT                   match to protein family HMM PF02558; match to protein
FT                   family HMM PF03807; match to protein family HMM TIGR00112"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3361"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99335"
FT                   /db_xref="GOA:D4HAM1"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAM1"
FT                   /protein_id="ADD99335.1"
FT                   /translation="MSGKIAVLGCGTMAGALVGGLIDAGQMKAEDVVATARSASHRDEI
FT                   ANTLGVTTSGDNTTAVRDADLVILGVKPYAAVDVLEEVSGALKADAVVVSIAAGVTTEK
FT                   LLMAWQGKIVRVMPNTPVRVGKGAFIVSSAPGSEDAAKKVGDLLESVGVVVTVPEELHN
FT                   AATAVSGSGPAYVFLVAEAMIDAAVALGVPRDQASQLTVATLAGSAELLAGGEHPAVLR
FT                   SKVTSPGGTTAAAVAALEAGGVRSVFADAMTACRDRAAGLS"
FT   gene            393469..393636
FT                   /locus_tag="HMPREF0675_3362"
FT   CDS_pept        393469..393636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3362"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08213"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3362"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00515"
FT                   /db_xref="InterPro:IPR013177"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAM2"
FT                   /protein_id="ADE00515.1"
FT                   /translation="MGQELRTYLGAPSFQFQRKRLTVGSVIKKRRKRMAKKKHRKLLKK
FT                   TRIQRRRAGK"
FT   gene            393656..393997
FT                   /locus_tag="HMPREF0675_3363"
FT   CDS_pept        393656..393997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3363"
FT                   /product="glutaredoxin-like protein"
FT                   /note="identified by match to protein family HMM PF05768"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3363"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01010"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAM3"
FT                   /protein_id="ADE01010.1"
FT                   /translation="MWRHQHGMAALRSGELRPLDPLVEGRVIIVTRQGCRLCDEVIGLV
FT                   ARLRQEHRDLVPEPMIVDVDANEDFRSRWGDHVPVIFVDGTLISYWTLDADTFLSALRD
FT                   GPSLPAVLP"
FT   gene            394121..395836
FT                   /gene="hemD"
FT                   /locus_tag="HMPREF0675_3364"
FT   CDS_pept        394121..395836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemD"
FT                   /locus_tag="HMPREF0675_3364"
FT                   /product="uroporphyrinogen-III synthase"
FT                   /EC_number="4.2.1.75"
FT                   /note="identified by match to protein family HMM PF00590;
FT                   match to protein family HMM PF02602"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3364"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99485"
FT                   /db_xref="GOA:D4HAM4"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAM4"
FT                   /protein_id="ADD99485.1"
FT                   /translation="MTDEAHQPTPQPAGDLGTASSQARVQFVGTGPGDPNLLTLGAVDA
FT                   INRAQVIVISCAEHRMLLGSDFLGLRPDVRIVLAGGVDEEAAVLPSQPGTGAPTPVDVD
FT                   EHCADVTATVIDAASQGLEVVRLVSGDPFLDGDIGAEAAAVARADYDVDVVPGVTGMTA
FT                   VPEYAGLTLHGHDVQLIGDAACQRDIAGHGSNWSDQGLVVVNTEAGKLKEVVKHAIESG
FT                   RGEDEPAALICHGATTQQTTHTVTLGELPQTAKTARLGDAEPVHVAIGKVVEAPEREQL
FT                   DWYESKPLFGWNILIPRTRDHSATLPSRLQSYGAHSLDVPTISMEPPRTPQQMDKAIRG
FT                   LVEGRYEWVVFTSANAVRAVSEKLEQIGLDARAYSGLRIAAIFDSTINALAEWGVRPDF
FT                   VPSGEQSTRALAAVFPAFDEALDPINRVFVPRADIATESLSADLSELGWEVEDVVGYRT
FT                   VRAAPPPAETREAIKTGKFDAVVFTSSTTVRNLVGIAGKPHKHTVVAAVGMRTAETCRE
FT                   HGLTVDVIAPEPTALSLADALADFAAKRRDDMVAKGLPVVRPSQRKRRGRHPSR"
FT   gene            395859..396575
FT                   /locus_tag="HMPREF0675_3365"
FT   CDS_pept        395859..396575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3365"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /note="identified by match to protein family HMM PF00300"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3365"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99372"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAM5"
FT                   /protein_id="ADD99372.1"
FT                   /translation="MGRAGFAAREVSERETMGATTTVHLLRHGEVDNPTGVLYGCMPGY
FT                   HLSPLGRRMAARAAEHFAGAELSALVSSPLERARETMAPIAALHPGLEVRIDSDVIEAA
FT                   NVFEGQVFGKGNKALRSPRNWRYLSNPLTPSWGEPYVEIAERMTRAIMRAAEEVPAGGQ
FT                   ALIVSHQLPIWIARCAAEGRRLPHDPRFRKCTLASVTSFGVLHGRIVRVDYCEPARDLI
FT                   PAKDRRANISAGGAQG"
FT   gene            396572..397141
FT                   /locus_tag="HMPREF0675_3366"
FT   CDS_pept        396572..397141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3366"
FT                   /product="redoxin family protein"
FT                   /note="identified by match to protein family HMM PF00085;
FT                   match to protein family HMM PF00578; match to protein
FT                   family HMM PF08534"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3366"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00705"
FT                   /db_xref="GOA:D4HAM6"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAM6"
FT                   /protein_id="ADE00705.1"
FT                   /translation="MKTRLIATLAAATLVVTGVSACSSTSASDDKGFAAGDGSWSKLPA
FT                   DKREPAAVLTGTDLNGKKISTADAKGKVIVVNVWGSWCAPCRHEAPALVKAADSTKNVA
FT                   AFYGINTRDLDPGPPQAFSRTFHISYPSFYDPDGALLLKFTELPPKAIPSTLVIDRKGR
FT                   SAARFVGEVSTATLVQAINDVAKESQ"
FT   gene            397138..397899
FT                   /locus_tag="HMPREF0675_3367"
FT   CDS_pept        397138..397899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3367"
FT                   /product="cytochrome C biogenesis protein transmembrane
FT                   region"
FT                   /note="identified by match to protein family HMM PF02683"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3367"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00188"
FT                   /db_xref="GOA:D4HAM7"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAM7"
FT                   /protein_id="ADE00188.1"
FT                   /translation="MTPLDLGSWAAGALTGSMAGAIPVAVFAGLLSFFSPCVLPLIPGY
FT                   LSYVTGLGAADVIEGQRRARTVVGTVLFVVGFTVVFVATGTIIGTLGKVLVGHRRAIEI
FT                   IVGALTVVLGAMFAGLVPLGRRELRIHRLPRAGLAAAPILGIVFGLGWTPCIGPALSVV
FT                   YGLSLTQGSAVRGAVLAICYSLGLGIPFIAAAAAVVWMGRTIDAMRTHQHGVQRFGGIL
FT                   LMTVGVLLVTGWWESIMAMLRAWAAKFGAVI"
FT   gene            397899..399488
FT                   /locus_tag="HMPREF0675_3368"
FT   CDS_pept        397899..399488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3368"
FT                   /product="ResB-like protein"
FT                   /note="identified by match to protein family HMM PF05140"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3368"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99754"
FT                   /db_xref="GOA:D4HAM8"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAM8"
FT                   /protein_id="ADD99754.1"
FT                   /translation="MGDSVTDSKVTTASPSGNSGLGFRPFMRWVWGQLTSMRTALILLF
FT                   LLALAAIPGSVVPQSAQSAMKVSDFAANHPTLDRICRPLGMYHVYTSVWFSAIYLLLLI
FT                   SLIGCIVPRIVSHAKALRRQPPRVPARLDRLAAHASMITSASAAEVSQRAQQWLTSHRY
FT                   RFVVDDDGSLRAEAGRHRETGNLVFHIFLVFVLVGVGWNTLWGFKGTSVVVEGQGFSNS
FT                   ITQYDEFKAGAMVDTDNLTPFSMKLRKFVVSFETGTVQRGAARSFDATVDLTMGGKTQT
FT                   RDLQVNHPLRIGSTKVHLLGHGYAADVVVRDGDGKVAYSGPVVFLPQDANFKSVGVIKV
FT                   PDARPDRLAFQGFFLPTGAITAGGPTSLFPDALNPQLYLTAWYGKPTVETGVPSNIYTL
FT                   DTTGLTQVTNGKDKARFVLSPGQRYKLPDGKGSIQFNGWQRWAKIQVSQNPGLPLTFLS
FT                   VVLSVAGLCVSLFSRSRRVWVRTIPGDDGLRVEIGGLDRSDSRSGAVDDVNSLLAALHG
FT                   DSMSGDVGEEHS"
FT   gene            399491..400378
FT                   /gene="ccsB"
FT                   /locus_tag="HMPREF0675_3369"
FT   CDS_pept        399491..400378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccsB"
FT                   /locus_tag="HMPREF0675_3369"
FT                   /product="cytochrome c-type biogenesis protein CcsB"
FT                   /note="identified by match to protein family HMM PF01578;
FT                   match to protein family HMM TIGR03144"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3369"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99287"
FT                   /db_xref="GOA:D4HAM9"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR017562"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAM9"
FT                   /protein_id="ADD99287.1"
FT                   /translation="MENLSAVGIVTAAVLYMLAFLAHAVEWASVRGTEHPSHEERLRSE
FT                   TWGRMGLNLTVLGAACAAIGVVCRGIAAHRLPWGNMYEFVTSALFFVVIAYLVLVAIHH
FT                   VRWMGIAVTLLLAVGNGLAATVFYVAVAPLVPALHSVWFVIHIVAACIAAAALNVGAIA
FT                   SIMYLIATNAQAKAQRTGVPVKGLVAKLPPLESMDALAYRAHAIGFPIWTFTIAAGSVW
FT                   ADYAWGRFWGWDPKETWSLVTWVVYAAYLHARSTAGWRGRRAALIAIVGAACFWFNFVG
FT                   VNLIFNGLHSYAGI"
FT   gene            400380..401828
FT                   /locus_tag="HMPREF0675_3370"
FT   CDS_pept        400380..401828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3370"
FT                   /product="RNA polymerase sigma factor, sigma-70 family"
FT                   /note="identified by match to protein family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3370"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00582"
FT                   /db_xref="GOA:D4HAN0"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR019606"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAN0"
FT                   /protein_id="ADE00582.1"
FT                   /translation="MTGSFSESRDDWLPQLYQERWDAFVRLATLLLADQQVAEDAVIAA
FT                   FATSYLRDPKLHSYEHAVSYVRTAVVNKARSRQPAERDATPPETPEDLAYWCLRGLLAR
FT                   QREVLVLKLATPDLSDDDIAETLGMSVSAVRNNETKGLIAIGERLRPGSQTNPGHADPR
FT                   VEAVVHSALETFAESIHPMSRYDAIISQIACRPHRGRPTTWVIVLACGLAFLVGVLLPL
FT                   LGSGNGSTMGDPEALPSIRTPESSSQSLSTLQTGLDVFYLGRDDGLIHRELRDLPTSGD
FT                   RLGTAVGAVLNVAPLDPNYTSGWAAGQVNRATVKGNRITLDLSASAFSQFKNGEQVQRA
FT                   IQQLVATATAAVGDRTGDKSVRILVDGSPNLPIIGKPATDFVDEGFARCARVWVDSPQA
FT                   GADMSAGTITISGVAQPTVSVMSYEVRPPQSSRIITSGQINLSANDGDKWRPWHATFTM
FT                   PKGEYDLIIREGTHIADEKVITAK"
FT   gene            complement(401840..402634)
FT                   /locus_tag="HMPREF0675_3371"
FT   CDS_pept        complement(401840..402634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3371"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family protein"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3371"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00034"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAN1"
FT                   /protein_id="ADE00034.1"
FT                   /translation="MNDMEATRDERPWALVSGASGGLGQAFSRHLASCGVNLVVTGRRH
FT                   DVLDDLADQLTTRYGIQTIVHPCDISSASERLALVNEIAGRGIIIDTLVNNAGFGAAGR
FT                   IAETDPERQTSQVEVNCEAVVHLCGLLLPGMITAKRGSIINVASTAAFQPIPQFATYAA
FT                   SKSFVLSFTRALWAETNGTGVRATAICPGPTETGFFDVAGVPRMAAGARRDPDDVVRTA
FT                   FDALARHRPYAVDGFVNRTVARLAPHLPARLVMTQAEKYLQV"
FT   gene            402924..403079
FT                   /locus_tag="HMPREF0675_3372"
FT   CDS_pept        402924..403079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3372"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3372"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00675"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAN2"
FT                   /protein_id="ADE00675.1"
FT                   /translation="MSNCVWLYYLLRLRHSQRLKLILQVADMILLRDDFIGLIMSDKPH
FT                   NKNGNK"
FT   gene            complement(404137..404841)
FT                   /locus_tag="HMPREF0675_3373"
FT   CDS_pept        complement(404137..404841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3373"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00134"
FT                   /db_xref="GOA:D4HAN3"
FT                   /db_xref="InterPro:IPR033458"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAN3"
FT                   /protein_id="ADE00134.1"
FT                   /translation="MFTLTSTPVTFIGLLILFAWSLVWSVRDAIKAPTVVTRISTWVHV
FT                   VMAVTMILMVPKSWWKPIVPAIGGPITPVIIFAICTAWMVFMAAWRSSWSSWGHAAMFA
FT                   AMVWHLAAMRKMSSLMTAPRDSGMGQMNHTHSGMHGPGMQTAMNAAMHDYAVVGVPLMV
FT                   ALLAMAVAGLWRAISGRAENPGKAPTCHVVATEPLAIRLSGLADFAMAFGMAWMSTGLL
FT                   SPVMPFTAHLHP"
FT   gene            404965..406365
FT                   /locus_tag="HMPREF0675_3374"
FT   CDS_pept        404965..406365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3374"
FT                   /product="putative mycothione reductase"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF02852; match to protein
FT                   family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3374"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00279"
FT                   /db_xref="GOA:D4HAN4"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAN4"
FT                   /protein_id="ADE00279.1"
FT                   /translation="MEHYDIVVIGSGSGNTILDEDFADRRAAIIDSGAFGGTCLNVGCI
FT                   PTKMFVLPADFASSPSEAVRVGVDLQFRGASFASIRDRIFGRIDSISKAGLSYRQGLDN
FT                   IDVYTGEAAFIDAHTLEVGGRCITADQIVLAAGSRPRVPDVPGLDDPSMAGLIHTSDTI
FT                   MRLAELPQRLVILGGGLIAAEFAHIFSGLGSQVTVINRSGRMLRHEDREISQRFTEQMG
FT                   RRVRLRMAEGLVGVDRDPGGHLVVLTVDGDGVDYDYPADVVLNATGRVSNGDRLNLPAA
FT                   GVDVDDDGFVVVDKHQRTNVEHIWALGDVCSPWELKHVANHEARVVRHNLLHPDDLASS
FT                   NHCFVPHAVFSNPQVASVGATEQGLLQSDTPYAAYLQEYADVAYGWAMEDEGHCVKLLG
FT                   DPQTRTLLGAHIIGPQASTLIQTCIQGMSVGQTVDEMARGQYWIHPALSEVVESALLGL
FT                   GKEMDTTR"
FT   gene            complement(406448..407464)
FT                   /locus_tag="HMPREF0675_3375"
FT   CDS_pept        complement(406448..407464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3375"
FT                   /product="periplasmic binding protein"
FT                   /note="identified by match to protein family HMM PF01497"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3375"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99270"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAN5"
FT                   /protein_id="ADD99270.1"
FT                   /translation="MSTPHTRRRATRVTAAVLTGLCAISMSACAGSSTEKSSSSSSGPA
FT                   RTVMSCNEKLTFTSVPKRVIMLGDTDASTMNALGVLDHVVARAGRIKEGAYDAKTLAKL
FT                   KAIPTIASQELNTGGVKVSTETILDQHADLVIGYDTGVDRDALRKSGVKMYSTDAMCTD
FT                   KKPPAPATFSQVKDEVTKVGQIFDVPDKAKQVNKELDAKISTIQKQTASGAKANAVALY
FT                   ITPGSTEFYTYGSSSMIEPMFAANGLRNMYHSNTTRVFDADMEDLLHKSPEWIVLLAGD
FT                   GAMSKVEPTFLSFKGAKELKAVKKGHVVTMSFALTDPPTPLTITGTEKLHDLIKDKK"
FT   gene            complement(407476..408234)
FT                   /locus_tag="HMPREF0675_3376"
FT   CDS_pept        complement(407476..408234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3376"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3376"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99148"
FT                   /db_xref="GOA:D4HAN6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAN6"
FT                   /protein_id="ADD99148.1"
FT                   /translation="MINASQLVVRRGQRIVLENIDFSAGQGVTVGVVGPNGAGKSTLLS
FT                   ALYRNVSIASGQVTVSDHDLASMSRREIAREVAVVSQTPDPSLPLTVRDTVALGRLPHR
FT                   SLMGYGDAADRNIVEEALTRTDLTDLADRLVTQLSGGERQRVLVARAIAQQAGHLLLDE
FT                   PTNHLDIGHQFALLDLVRTIKATTVIVLHDLNLAARVCDQLVLLAEKHLVATGSCEDVL
FT                   QPDLLSKVYEVNVERITHNGHIHLLFNPPR"
FT   gene            complement(408231..409256)
FT                   /locus_tag="HMPREF0675_3377"
FT   CDS_pept        complement(408231..409256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3377"
FT                   /product="iron chelate uptake ABC transporter, FeCT family,
FT                   permease protein"
FT                   /note="identified by match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3377"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00519"
FT                   /db_xref="GOA:D4HAN7"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAN7"
FT                   /protein_id="ADE00519.1"
FT                   /translation="MVRSLHRRTPVRFILLVALLVLTPVLSIAFGAAPVPIGQVLGVLA
FT                   DHCGLPVHLSWDSITDAIVWQNRMPRIVTGLGVGAILGAAGVTLQAVVRNPLAEPYVLG
FT                   VSAGASSGAATAIILVGISSTFGVAGMAFLGALASTAIVLFMGGGRNSSTLRLILAGLA
FT                   VGFVFQALTNFIIFSSDSPETARAVMFWTLGDLSRASWAQGWTSIVVAVVLSILLWICA
FT                   PWLDALASGDSTATAVGIDPAMIRVLLLVPVSAGVAIAVAISGGIGFVGLVIPHLMRSF
FT                   IGHGHRRLVVSSAIAAAIFLVWADTFSRTVFSPAELPIGVITGLLGAPFLLVLVKRETL
FT                   A"
FT   misc_binding    complement(409292..409477)
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="cobalamin riboswitch; Rfam score 71.80"
FT                   /inference="nucleotide motif:RFAM:RF00174"
FT   gene            complement(409494..410381)
FT                   /locus_tag="HMPREF0675_3379"
FT   CDS_pept        complement(409494..410381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3379"
FT                   /product="Siderophore-interacting FAD-binding domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF04954;
FT                   match to protein family HMM PF08021"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3379"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99028"
FT                   /db_xref="InterPro:IPR007037"
FT                   /db_xref="InterPro:IPR013113"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR039374"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAN8"
FT                   /protein_id="ADD99028.1"
FT                   /translation="MAEYRPYLMRLSSRSLVEPNFIRLILTGDEVRFPQPCLDRRIKLL
FT                   FIGEHPNPALTDPKVGDGWYQLWLDDPARPEMRTYTVRRVIENGIVIDVACHDGDGPGH
FT                   RFATSAPLGSQVLVIGLDATAPGAEQTGIDFHPGDAKRLLILGDDAAAPAVCSILEQLP
FT                   THAAEVEAVVEVPQLARKIEAGPDGHWTDSRGNRINIRWQERLSERGDRLAEAIEDHLH
FT                   RFPLPRCQQDSPEEGPDDLLWDTPASPPQEFYSWIAGESTMVRRLRRILVNDHGVDRRH
FT                   IAFMGYWRHGSAGM"
FT   gene            complement(410608..411384)
FT                   /gene="pstB"
FT                   /locus_tag="HMPREF0675_3380"
FT   CDS_pept        complement(410608..411384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB"
FT                   /locus_tag="HMPREF0675_3380"
FT                   /product="phosphate ABC transporter, ATP-binding protein"
FT                   /EC_number="3.6.3.27"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR00972"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3380"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99535"
FT                   /db_xref="GOA:D4HAN9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAN9"
FT                   /protein_id="ADD99535.1"
FT                   /translation="MAKRIETKDLDIYYGSFHAVESVNLIVEPRTVTAFIGPSGCGKST
FT                   VLRTLNRMHEVIPGAYCTGKVELDGVDLYGKGVDPVAVRRNVGMVFQRANPFPAMSIRD
FT                   NVVAGLKLNGVRDNKLLDEACEKSLRGANLWDEVKDRLERSGASLSGGQQQRLCIARAI
FT                   AVEPEVLLMDEPCSALDPISTLAIEDLVSELKERFTVVIVTHNMQQAARVSDQTAFFNL
FT                   KAQGEPGRLVEIDTTERIFSNPKEKATEDYISGRFG"
FT   gene            complement(411403..412329)
FT                   /gene="pstA"
FT                   /locus_tag="HMPREF0675_3381"
FT   CDS_pept        complement(411403..412329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstA"
FT                   /locus_tag="HMPREF0675_3381"
FT                   /product="phosphate ABC transporter, permease protein PstA"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR00974"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3381"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00312"
FT                   /db_xref="GOA:D4HAP0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAP0"
FT                   /protein_id="ADE00312.1"
FT                   /translation="MSATTPDHITHHGDNTPGQLDLSRPSGKRTIKSGCASAFMIVATV
FT                   LAVIPLAWLLFAAVRRGIGSLFHASWWTHSMDPSFDLAEQGAIHAIVGTLEIGLITSII
FT                   SVPIALMTAIFLVEYARGTKIAKGISFAVDVLTGVPSIVAALFVFAVVVTTFGGTQSAW
FT                   ASSLALMILMVPTVLRSTEEMLKLVPDSLREASFALGVSQWKTIMKVVLPTSMTGILTG
FT                   IVLGLARVMGETAPLIVLLQFNTELTFNPSTPNFATLPTVITNAYTQGGVDTPVVWGAA
FT                   ITLIILVMGLNLIARRISRRYMRRMGK"
FT   gene            complement(412326..413330)
FT                   /gene="pstC"
FT                   /locus_tag="HMPREF0675_3382"
FT   CDS_pept        complement(412326..413330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstC"
FT                   /locus_tag="HMPREF0675_3382"
FT                   /product="phosphate ABC transporter, permease protein PstC"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR02138"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3382"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00939"
FT                   /db_xref="GOA:D4HAP1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAP1"
FT                   /protein_id="ADE00939.1"
FT                   /translation="MAETTSPAQRKLTAASRMKPVSRVGDTIFAGASSVIAIALAIIVI
FT                   LMFVFLMKTAAPTLLANTDNFFTSRAWTTDQNPPAFGIQALLWTTVISSLLALLIAVPL
FT                   SVGIALFITQLAPRKLASPVAFVVDLLAAVPSIVFGLWGGIVFGSSGIINGLRGAIIKA
FT                   LGWIPIFSEDPSWSSATGTVYLASLVLAIMILPIITAVSRDVMAQTPHDQVEAALALGS
FT                   TRWEVIKLAVLPHSRSGIISGSMLGLGRALGETLAVTLILQTMSPMALKQNLNLSIFVG
FT                   GETFASKIAGNFSEAISDPTSLGALVASALALFVITFVVNATARLIAAKGVKR"
FT   gene            complement(413439..414590)
FT                   /gene="pstS"
FT                   /locus_tag="HMPREF0675_3383"
FT   CDS_pept        complement(413439..414590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstS"
FT                   /locus_tag="HMPREF0675_3383"
FT                   /product="phosphate ABC transporter, phosphate-binding
FT                   protein PstS"
FT                   /note="identified by match to protein family HMM PF01547;
FT                   match to protein family HMM TIGR00975"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3383"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99326"
FT                   /db_xref="GOA:D4HAP2"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAP2"
FT                   /protein_id="ADD99326.1"
FT                   /translation="MNRFAKITALAAISAISLTACGANGDKGSSSASSSKTTSTASSAA
FT                   QPSDSSADAVSFKPACPGGSISGAGSSAQLNAINQVISDYKAACSSATVNYSPTGSGAG
FT                   VKSFIGRQTDWAGSDSVLNADKGEPDKAKQRCNADPWHLPMAAGPIAVVYNVDGVKDLT
FT                   LSTATLAKIFSGAITNWNDDAIKKENPKAALPSAQIEVFYRKDESGTTDNFTKFLNKAA
FT                   GDIWTEKHSKTWKGAGKGADKSAGIAQAVKSTKNSISYDEWSYATKNSLDMAAIDNGNG
FT                   PVKLTGESAGKAVSAAKVVGQGHDLQLELQYKNTPAGVYPAVLVTYEIACSKGQDSGKA
FT                   ALLKDFLSFYASEREQKKIQDLGYAPLPSDVASKVLGSAQALS"
FT   gene            complement(414763..415704)
FT                   /locus_tag="HMPREF0675_3384"
FT   CDS_pept        complement(414763..415704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3384"
FT                   /product="hydrolase, NUDIX family"
FT                   /note="identified by match to protein family HMM PF00293;
FT                   match to protein family HMM PF00300"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3384"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99826"
FT                   /db_xref="GOA:D4HAP3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAP3"
FT                   /protein_id="ADD99826.1"
FT                   /translation="MGGHKGPIQAAGAVVLRDIDDGAREVLVVHRPSYDDLSLPKGKLE
FT                   PGEDLPTTAVREVAEETGINIRLTMPLQPIEYTVKYSTRDGKPKSRAKVVSWWLGVAIG
FT                   GSIENATASPEEIDGAFWMPTDQALERLTYPTDVQVLEEALDLPSTSTIILVRHGKAVS
FT                   RKEWNSRKRHGKDATRPLERRGRRQAKALADLLSAFGVARLASSSSTRCMQTLQPYADT
FT                   IGAQITGLDALSEETHEADPHKATSAMRKIIGRALADPNQPIAICGHRPVLPTMRDALG
FT                   GANRPMSTAECLIVHLDETGRTIRQEWHSSRY"
FT   gene            complement(415712..417817)
FT                   /gene="ppk1"
FT                   /locus_tag="HMPREF0675_3385"
FT   CDS_pept        complement(415712..417817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppk1"
FT                   /locus_tag="HMPREF0675_3385"
FT                   /product="polyphosphate kinase 1"
FT                   /EC_number="2.7.4.1"
FT                   /note="identified by match to protein family HMM PF02503;
FT                   match to protein family HMM TIGR03705"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3385"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00641"
FT                   /db_xref="GOA:D4HAP4"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAP4"
FT                   /protein_id="ADE00641.1"
FT                   /translation="MAKKPTPGTSPSSPDELPEGRYSDRELSWLAFNERVLDLARDTER
FT                   IPLLERAKFLAIFSSNLDEFFMVRVAGLKRRIDAGVAVPSVAGMLPRELHDAILARTHD
FT                   LVSEQSRVFAEEVRPGLVDEGIEILRWAELSDDEKGRMRTLFSERIFPILTPLAVDPSH
FT                   PFPYIRGLSINLAVMLANPITGAEQFARVKVPSVLPRLVNLGEGRFLPLEEIISRHLDQ
FT                   LFTGMHVLQHTTFRVTRNEDLEVEEDDAENLLFALEKELLRRKVGRPPVRLEVQDDISA
FT                   EMLELLTRELDIRDKEVFRLPAPLDLTGLFSLADVDRDDLSYPNFLPITHPHLAEVETA
FT                   RPADMFAAIRRRDVLVHHPYDSFATSVQRFIEQAAQDPQVLAIKQTLYRTSGDSPIIDA
FT                   LVDAAEAGKQVLAVVEIKARFDEQANITWARLLERAGVHVVYGMVGLKTHCKLAMVIRD
FT                   EGEGLRRYAHIGTGNYNPKTARQYEDLGLLTSNPIITEDVARLFNHLSGMTAEKRYRRL
FT                   LVAPESIRSGIIDAIEREIDNKKAGLPAGVRIKVNSIVDERVIDALYRASRAGVPVDLW
FT                   VRGICSIRPGVPGLSENIRVISILGRFLEHSRIFWFANGGRPMVAIGSADLMHRNLDRR
FT                   VEALVGLSNKQHVAEVEEMFDMAFDPGTVSWHLQDRTWTEVSRGPDDIPLTDLQEELIR
FT                   RTRDRRR"
FT   gene            complement(417939..418652)
FT                   /locus_tag="HMPREF0675_3386"
FT   CDS_pept        complement(417939..418652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3386"
FT                   /product="transcriptional regulatory protein, C-terminal
FT                   domain protein"
FT                   /note="identified by match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3386"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00059"
FT                   /db_xref="GOA:D4HAP5"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAP5"
FT                   /protein_id="ADE00059.1"
FT                   /translation="MMGCDIVDDMISNNAISAWEGIRMARLSLLGPLDAPLPQALELLP
FT                   HSISRYDDLKECMSHLEGVDVVLVDCHDEPAKAREACLRLSCHERRVPVLLLVGSDTLS
FT                   VISPDWGMDDFLCDSATPSEAETRLRCLFTIQVTNQLVAGPFTVDEDGYTASVGDKDLD
FT                   LTYTEFELLKYLVGHPGRVLTRDLLLSDVWGYDYYGGTRTVDVHIRRLRAKVGPEYEGH
FT                   IQTVRSVGYRFQAER"
FT   gene            418702..419595
FT                   /locus_tag="HMPREF0675_3387"
FT   CDS_pept        418702..419595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3387"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3387"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99507"
FT                   /db_xref="GOA:D4HAP6"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAP6"
FT                   /protein_id="ADD99507.1"
FT                   /translation="MTRMPDEWFRPDEEESGPGEPCPAESVEGPQENENPPSRHADSEE
FT                   TPISSTTSGTIRVLTDDTGPSVVVGHARATGASASSHHRHFPIWILGVAAALVVGLVLG
FT                   TFITQSRDSTGAAQIAPRALVPASTSTADMPYQGKVKAIGGVKATASCVSDPAVGSRHE
FT                   LVRYDAKYVVDDKPETAWRCNGSGEGQQITLTLPHPSRIVGVGMINGYAKVFGNVDLYP
FT                   QYRRVRTVRWTMPDGTWFNQDFTDDDQDLQKVMIAPRTVKGDITLTIIASTQPGSLGEP
FT                   TRDSVLISSVQLYEES"
FT   gene            complement(419610..420047)
FT                   /gene="dtd"
FT                   /locus_tag="HMPREF0675_3388"
FT   CDS_pept        complement(419610..420047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dtd"
FT                   /locus_tag="HMPREF0675_3388"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by match to protein family HMM PF02580;
FT                   match to protein family HMM TIGR00256"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3388"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01177"
FT                   /db_xref="GOA:D4HAP7"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAP7"
FT                   /protein_id="ADE01177.1"
FT                   /translation="MRVVIQRATSAEVVVEGRTVGSLTTPGLVVLVGVTGTDTATTAEK
FT                   LAEKVWGLRILSEEKSASDLNAPLLVVSQFTLYASTRKGRRPSWSAAAPGPVSEPLVDH
FT                   FVTHLRSLGAHVETGIFGADMKVGLVNDGPMTILIDTDDWH"
FT   gene            420243..420743
FT                   /locus_tag="HMPREF0675_3389"
FT   CDS_pept        420243..420743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3389"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08768"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3389"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00824"
FT                   /db_xref="GOA:D4HAP8"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR014878"
FT                   /db_xref="InterPro:IPR022939"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAP8"
FT                   /protein_id="ADE00824.1"
FT                   /translation="MPFQIPDDLNRDLMPLAWMIGHWEGEGHGNTPDDGEFSFGCQVDF
FT                   TDNGGDYLHYICQTFTMNPDGTPAAPLRMETGFWRPNVDTRKVDVLMAAPEGWAEVWTG
FT                   NIDGAKIELVTDAVARTEEALVPYTGGQRLYGQVEGDLLWTFDRATVDAPLQPYMWARL
FT                   KRS"
FT   gene            420745..421686
FT                   /locus_tag="HMPREF0675_3390"
FT   CDS_pept        420745..421686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3390"
FT                   /product="glycine cleavage T-protein C-terminal barrel
FT                   domain protein"
FT                   /note="identified by match to protein family HMM PF01571;
FT                   match to protein family HMM PF08669; match to protein
FT                   family HMM TIGR03317"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3390"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00291"
FT                   /db_xref="GOA:D4HAP9"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAP9"
FT                   /protein_id="ADE00291.1"
FT                   /translation="MSDPVLLTDGPDTGLVSHMRNPIAEQRLMVDGGGSVELSNREVLA
FT                   ISGVDRLGWLHSLTSQFLDGMEPGRTTTSLVLSPTGHVEHVLHGVDDGQTFWAWTEPGR
FT                   GADLAAWLDSMRFMMRVEVALRPDMTVRWFGHDVAVSDGVVLDSEVAGGHEVILPVDAE
FT                   IPGDADPVGVLAWEALRIAAGIPRIGLDTDDRTIPNEIGLYGTHMDKGCYRGQETVARV
FT                   YNLGRPPRRLTLLQLDGSRAELPEVGADIHAGGRRVGAMGSSANHGVDGPIGLALVRRG
FT                   VDVGLELEVDGIAAGQQPLVDPEVGLHVCPVV"
FT   gene            421727..423112
FT                   /locus_tag="HMPREF0675_3391"
FT   CDS_pept        421727..423112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3391"
FT                   /product="exopolysaccharide biosynthesis polyprenyl
FT                   glycosylphosphotransferase"
FT                   /note="identified by match to protein family HMM PF02397;
FT                   match to protein family HMM TIGR03025"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3391"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00827"
FT                   /db_xref="GOA:D4HAQ0"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAQ0"
FT                   /protein_id="ADE00827.1"
FT                   /translation="MKKDYFNRTQKLVTVLIDAIVFVVGIFLSFWMRFGMVIPQRNLDD
FT                   GKAALMTSVIAFLIINVLSGVYVLYNKTLLDIGIITVVDQVMVTIVIMALTFFGRWFAF
FT                   PRSVLLINLVVGIVLLLVWRSVEVVAYRHLRGAKRVMLLGPPEMLNRAVMNYMANKATR
FT                   HRLTHVVRGHYLEQIRSHINEFDTAHVSDDIPSSERVAIYDLLLSEDKEIFMSTSFEHM
FT                   MLINPTIMSIEDETIIAASPFKIPAEMDIVKRFFDILLSLIALVVASPIMFVTAILVKA
FT                   SSPGPVFYRQTRITKDGREFKILKFRSMGVMAEKESGPMLATTNDPRVTTVGKYLRSLR
FT                   IDEIPQLINVLIGDMSIVGPRPERPFFVDQFQEQNAHYTLRHNVRAGITGYAQVYGKYA
FT                   SDFAAKLNFDLIYIKQYSLVLDVKIMIQTIKILFDKVSSRGVDETAEPDENIHLPAEVQ
FT                   QLN"
FT   gene            complement(423135..423872)
FT                   /locus_tag="HMPREF0675_3392"
FT   CDS_pept        complement(423135..423872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3392"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family protein"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3392"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00320"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAQ1"
FT                   /protein_id="ADE00320.1"
FT                   /translation="MTKTAVVTGASSGIGAATARALAGDSWHVICAARRVERIEPLSAE
FT                   IGGQAVVCDVTSDESVTNLVKTVGGKVDLLVNNAGGAVGQEPVTEADLNAWTTMYQTNV
FT                   LGMGQVTKALLPALEIAEGTIITITSTAAEWGYEGGAGYCAAKSGERAVVEALRLELCG
FT                   HPVRVCEVSPGMVHTEEFSLVRFHGDQAKADKVYQGVDSPLVAADIAECVRWISGLPSH
FT                   VNIDRMIVRPRAQAAQYKVARES"
FT   gene            complement(423948..425621)
FT                   /gene="ptsP"
FT                   /locus_tag="HMPREF0675_3393"
FT   CDS_pept        complement(423948..425621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsP"
FT                   /locus_tag="HMPREF0675_3393"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /EC_number="2.7.3.9"
FT                   /note="identified by match to protein family HMM PF00391;
FT                   match to protein family HMM PF02896; match to protein
FT                   family HMM PF05524; match to protein family HMM TIGR01417"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3393"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99771"
FT                   /db_xref="GOA:D4HAQ2"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAQ2"
FT                   /protein_id="ADD99771.1"
FT                   /translation="MRTLSGLGVSAGVGQAHALVVSPAPGLPASDPSRGAEADLAKVEA
FT                   ALGKVADRLDERSLHADPSALAVLQATAMMARDPGLLTSVKSHLSDGHGPAHALWAAFD
FT                   DFCAQLSAAGGYLAERVTDLRNVRDRAVAVMQGLPEPGVPSFDSPVILVAEDLAPADTA
FT                   TLNPELVRGLITAAGGPTSHTAILASQIGIPAVVRCSEARDIEDGTPLALDGVTGTVLV
FT                   EPDEASVSELTERANRRAEVLASAPDGDATLTDGERILVLANIGNPSDAPTAKKKGAEG
FT                   VGLFRTEFLFLDRQDAPTIDEQTEAYATVLKTFDEGAKVVFRTLDAGADKPLAFANLGA
FT                   EENPALGRRGLRLSQVRTDLIDAQLEALAKAAEQTGRDPYVMAPMVATKAEAEWFSSRA
FT                   RAAGIKTVGIMVEVPSTALRSSQVLEPVDFASIGTNDLTQYAMAADRLQGELAELLTPW
FT                   QPAVIQLVKATCDGAGERLIGVCGEAAGDPLLALVLVGVGIRSLSMAAGKITAVKAALS
FT                   RHNLEQCRRIADAALAACSPEEARTAALKLADPSVEVLVS"
FT   gene            complement(425626..425892)
FT                   /locus_tag="HMPREF0675_3394"
FT   CDS_pept        complement(425626..425892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3394"
FT                   /product="phosphocarrier, HPr family"
FT                   /note="identified by match to protein family HMM PF00381;
FT                   match to protein family HMM TIGR01003"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3394"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99308"
FT                   /db_xref="GOA:D4HAQ3"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAQ3"
FT                   /protein_id="ADD99308.1"
FT                   /translation="MPSRTTTIAAESGLHARPAAMFVQAASKSGLAVKIGRPGEEPVDA
FT                   RSILSVMGLGAKHGETVELTAEGDNADEVLDALVANLQTDPEA"
FT   gene            425988..426791
FT                   /gene="ispD"
FT                   /locus_tag="HMPREF0675_3395"
FT   CDS_pept        425988..426791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="HMPREF0675_3395"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.60"
FT                   /note="identified by match to protein family HMM PF01128;
FT                   match to protein family HMM TIGR00453"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3395"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99041"
FT                   /db_xref="GOA:D4HAQ4"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAQ4"
FT                   /protein_id="ADD99041.1"
FT                   /translation="MVDEHTPPVVAVVVAAGMGTRFGGSVPKQVTSLTGKAVVAVAVES
FT                   LAAGGCDEAVVVVKEGMHNHLQLALAASPIPVHFVTGGNTRQESVRNGLRFIAQHHRLS
FT                   DATTVLIHDAVRPLVPAYVVENVIAAVENGAVAVTPVVDVVDTIRQVDGDTSSVVDRST
FT                   LRAVQTPQGFKRAIITECHEQLSIEGGSVTDDISCCERYGHHATLVEGSRMSLKITEPV
FT                   DLDIAEVFAKAAAGAGHHSGRRIGRMLRAAKPSTVVRKLGHGSRR"
FT   gene            complement(427241..427645)
FT                   /locus_tag="HMPREF0675_3396"
FT   CDS_pept        complement(427241..427645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3396"
FT                   /product="PTS system glucitol/sorbitol-specific IIA
FT                   component"
FT                   /note="identified by match to protein family HMM PF03829"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3396"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01171"
FT                   /db_xref="GOA:D4HAQ5"
FT                   /db_xref="InterPro:IPR004716"
FT                   /db_xref="InterPro:IPR036665"
FT                   /db_xref="UniProtKB/TrEMBL:D4HAQ5"
FT                   /protein_id="ADE01171.1"
FT                   /translation="MATTSSTLWNAVVLRIGKGAQDMLDTGVIVLFGEPVPDALSDICV
FT                   VHNRGGRSPLTPQRELLPGDVLNFAGTRYTIDEVGEAATSNLSDLGHVALYFNSPDQSL
FT                   LAGAIKVSGPPPQLPDQGVILTFEPSSDKG"
FT   gene            427831..428124
FT                   /locus_tag="HMPREF0675_3397"
FT   CDS_pept        427831..428124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3397"
FT                   /product="PTS system, Lactose/Cellobiose specific IIB
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF02302"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3397"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99205"
FT                   /db_xref="GOA:D4HB37"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB37"
FT                   /protein_id="ADD99205.1"
FT                   /translation="MIEKKILVCCGTGTATSVQVANKLQRLLRERGINARMEHCRVAEV
FT                   PRVAERFSPDVIVSTTAVKQSTENVKMFRGVAFLTGVDEGQLADEIANALKS"
FT   gene            complement(428208..428693)
FT                   /locus_tag="HMPREF0675_3398"
FT   CDS_pept        complement(428208..428693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3398"
FT                   /product="CarD-like protein"
FT                   /note="identified by match to protein family HMM PF02559"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3398"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99827"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB38"
FT                   /protein_id="ADD99827.1"
FT                   /translation="MTFNVGETVVYPNHGAAVIEDIETRTIKGEEKLYLVLRILGQNDL
FT                   VVRVPASNLDLVGVRDVVDDEGLENVFEVLRKTNVEEPSNWSRRYKANLEKLHSGNVLK
FT                   VAEVVRDLWRRERDRGLSAGEKRMLSKARQILVSELALAKKVADDRAEEMLDEVLAS"
FT   gene            428878..429438
FT                   /locus_tag="HMPREF0675_3399"
FT   CDS_pept        428878..429438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3399"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00806"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB39"
FT                   /protein_id="ADE00806.1"
FT                   /translation="MDADSAKLNDDMRPGRGDSTMIDRRRTTAVLAAVGVLGVVACGAD
FT                   PKVFTSYTPAAGVNGKSDTVKVQNLVLINGGGQARVSAAVVSRKDDKIVGITGEPLTSN
FT                   NSLSGRSFTMRTVNVKLPAQTSVNLTQSKLQVPVEGLSNGLLAKVTIKFANSAPVTLDA
FT                   PVVSSTHPDFAEYAPSGIPSARS"
FT   gene            complement(429491..430171)
FT                   /locus_tag="HMPREF0675_3400"
FT   CDS_pept        complement(429491..430171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3400"
FT                   /product="response regulator receiver domain protein"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3400"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99377"
FT                   /db_xref="GOA:D4HB40"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB40"
FT                   /protein_id="ADD99377.1"
FT                   /translation="MTRVLIIEDEESYREATAFMLRKEGFEVNTAANGADGLEIYSHNG
FT                   ADIVLLDLMMPGLPGTEVCRQLRQRGNVGIIMVTARDSEIDKVVGLELGADDYVTKPFS
FT                   HRELVARIRAVTRRGGPEIEVSPDVLEESGVRMDVERHEVSVGGTAVRLALKEFDLLEV
FT                   LLRNAGRVMTRASLIDRVWGADYVGDTKTLDVHIKRLRAKIEDDPSRPVRIITVRGLGY
FT                   KFQA"
FT   gene            complement(430168..431340)
FT                   /locus_tag="HMPREF0675_3401"
FT   CDS_pept        complement(430168..431340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3401"
FT                   /product="ATPase/histidine kinase/DNA gyrase B/HSP90 domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3401"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99989"
FT                   /db_xref="GOA:D4HB41"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB41"
FT                   /protein_id="ADD99989.1"
FT                   /translation="MGMILSAIIGAVVGAGLTVLVSRVVESSRHPVDTLATDIEAIEVD
FT                   SALARTLDLTTEAAVIVGPHDEVLHTTLGARSMELVRGSRIADEALLKLVRTARREGRD
FT                   IVDTMEMKRASTGADLILTVRVGPLDDHGNAVISASDSSRHVRLAETRRDFVANVSHEL
FT                   KTPIGAVSILAEAIEGAADDPEAVRHFSQRLTAESSRLSALVTQIIDLSRLQADEPLLR
FT                   AEPVAVADAIDEAVSRHREQAANREVSLVVRCDDDLWVLGDQSQLTEAVANLVHNAIVY
FT                   SEPKARVVVSARRVRDVDTDVIAIAVADNGIGISEADQKRIFERFYRVDYSRSRENGGT
FT                   GLGLSLVKHTCQAHGGSVDVWSKLGQGSTFTLRLPTLDVDHHNESNQEES"
FT   gene            431510..432178
FT                   /gene="phoU"
FT                   /locus_tag="HMPREF0675_3402"
FT   CDS_pept        431510..432178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoU"
FT                   /locus_tag="HMPREF0675_3402"
FT                   /product="phosphate transport system regulatory protein
FT                   PhoU"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   premature stop; identified by match to protein family HMM
FT                   PF01895; match to protein family HMM TIGR02135"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3402"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00509"
FT                   /db_xref="GOA:D4HB42"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB42"
FT                   /protein_id="ADE00509.1"
FT                   /translation="MRESYHDELNATSGRILTMAELVRVAVKDATAALIGADLTTAERV
FT                   ISDDSKVDSLNEEIERRCFDLLARQAPVAGELRTIVAMLRMCYELARMGDLAAHVAKIA
FT                   RLRFPEVAVPPQVADQFVEMSKIADSMIGKAEKTLADRDAEAAESLASEDSKMDDLRRD
FT                   QFRLLLGDDWTYGVESAVDTALLGRYYERIADHAVAVGSRVIYIVTGEGPAGEDWPSAY
FT                   "
FT   gene            complement(432320..432514)
FT                   /locus_tag="HMPREF0675_3403"
FT   CDS_pept        complement(432320..432514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3403"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3403"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01050"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB43"
FT                   /protein_id="ADE01050.1"
FT                   /translation="MLGFAMGLFDGDGCEDDWAELTPDFDEELADSGSLLAHPAMAIET
FT                   VVTTTTAPAIVLLRKAKAI"
FT   gene            432558..433394
FT                   /locus_tag="HMPREF0675_3404"
FT   CDS_pept        432558..433394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3404"
FT                   /product="polysaccharide deacetylase"
FT                   /note="identified by match to protein family HMM PF01522"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3404"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99944"
FT                   /db_xref="GOA:D4HB44"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB44"
FT                   /protein_id="ADD99944.1"
FT                   /translation="MPAGVFGVGAAVTKPACAEPPSNYSPLKVPGTVVKDIDGLEAGTN
FT                   HGRAADKYVYSASVVNQWLEKPSTQPKNKKIVFVTFDDGPTTKFTGEQLDNLEKAGARA
FT                   TFFMIPPQMRDVGKNMLSRSLKMGNALAIHSYSHDYKYLYHGSAANKAKHISCDWDWAM
FT                   AQSRAILGSNYFSSAFRYPGGHMSWTNLSQADATLAKRGVGWIDWNAMSGDADAQRPTT
FT                   VPGYLQMVKKSIKESNNPNVVVILNHDTYGKQMTAKAMPSILAWLKSQGYEFGVIA"
FT   gene            complement(433486..434235)
FT                   /locus_tag="HMPREF0675_3405"
FT   CDS_pept        complement(433486..434235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3405"
FT                   /product="phosphoglycerate mutase 1 family"
FT                   /note="identified by match to protein family HMM PF00300;
FT                   match to protein family HMM TIGR01258"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3405"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00167"
FT                   /db_xref="GOA:D4HB45"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB45"
FT                   /protein_id="ADE00167.1"
FT                   /translation="MTAKLILLRHGESEWNSKNLFTGWVDVDLNEKGEGEARHAADLLK
FT                   QENLLPDIVHTSLLRRAIHTAYLALDGCDRHWIPVHRSWRLNERHYGALQGLNKAETKE
FT                   KYGNDQFMAWRRSYDVRPPDLDRDSEFSQFHDPRYADIPASERPVAECLKDVVARMVPY
FT                   FTSDIAADLKDGKTVLVAAHGNSLRALVKHLDEISDEDIAGLNIPTGIPLFYELDDNLK
FT                   PVTRGGRYLDPEAAAAGAKAVANQGNK"
FT   gene            complement(434360..434818)
FT                   /locus_tag="HMPREF0675_3406"
FT   CDS_pept        complement(434360..434818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3406"
FT                   /product="phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system, EIIA 2"
FT                   /note="identified by match to protein family HMM PF00359"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3406"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00491"
FT                   /db_xref="GOA:D4HB46"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB46"
FT                   /protein_id="ADE00491.1"
FT                   /translation="MPTPRLIVADVTATSQNDLYAQVNDRLTADNMVKSTFLNAVSARE
FT                   KKFPTGLDFGYVSIAIPHIDPEHVISPGLLVCRNSASTTFHAMDDPERNLDVQLSIWPL
FT                   VTDPGNQIDMLEAVITLIQDESSYRILLHGSHAEVANTLPDVLATVED"
FT   gene            complement(435063..435356)
FT                   /locus_tag="HMPREF0675_3407"
FT   CDS_pept        complement(435063..435356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3407"
FT                   /product="PTS system, Lactose/Cellobiose specific IIB
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF02302"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3407"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99660"
FT                   /db_xref="GOA:D4HB47"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB47"
FT                   /protein_id="ADD99660.1"
FT                   /translation="MVNKKVLVCCGTGIATSVQVANKLQRMLRDRGITATMKECKTANV
FT                   PAQMTTFQPDAIVVTTAITPPDEEIKVYRGTPLLTGVDAEELADQIASDLKA"
FT   gene            complement(435563..436558)
FT                   /locus_tag="HMPREF0675_3408"
FT   CDS_pept        complement(435563..436558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3408"
FT                   /product="L-asparaginase, type I"
FT                   /EC_number="3.5.1.1"
FT                   /note="identified by match to protein family HMM PF00710"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3408"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99189"
FT                   /db_xref="GOA:D4HB48"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="InterPro:IPR041725"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB48"
FT                   /protein_id="ADD99189.1"
FT                   /translation="MMQTHVLYTGGTLGMVSTPNGFAPGADLTGWLNQLLSGTELAGTF
FT                   ETLSFEHLIDSANATPDDWRRIVDDLWEHRDDADSFVVLHGTDTLAYTSAALSYALTEF
FT                   GKPVVVTGAQYSLGVVGTDAAPNVTGALRAATSGRLNGVAVFFGHKLLRGNRVTKLSSW
FT                   AYNGFDSPAVPQLARTGAPWQWVENESTGCGWLNPGPYQRHDVLVVDLSPGISARRLRA
FT                   VLDPLPEAVILRAFGVGNIPSDEPGVVDAILDVISAGTPVVVASQCMQADVQLGQYQSS
FT                   HALTEGGAVSAHDMTLEALYAKLVFLLSQGLHGKELKRWIETDIAGEISV"
FT   gene            complement(436559..438007)
FT                   /locus_tag="HMPREF0675_3409"
FT   CDS_pept        complement(436559..438007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3409"
FT                   /product="amino acid permease"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3409"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99422"
FT                   /db_xref="GOA:D4HB49"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB49"
FT                   /protein_id="ADD99422.1"
FT                   /translation="MQEGDSVTPHTSTTVDKGDAGYDKALKNRHLQMIAIGGSIGTGLF
FT                   LGTGGRLAQGGPGLAISYAVCGIFAFLMVRALGEMAIRRPSSGAFVSYAREFMGEKGAY
FT                   ATGWFFFLDWSVTVMADITAVALYLHYWTPLRAIPQWVLALIALGVVFTLNMLSVKMFG
FT                   EAEFWFAAIKVAAIILFMIAAIWAIVTGARVGNYTAGLHNIAQHGGFFPAGLAPVFALT
FT                   LGVIFAFGGTEMVGVAAGETKDASKILPKAINSMILRIFVFYVGSIILMALVLPYTAYS
FT                   SNESPFVTFFTGIGIPYAGDIIQVIVLTAALSSLNAGLYSTGRTLRSLAVAGEAPKAAA
FT                   KLNRHHVPSGGIAMTAALGLLGVALNAFLPDSAFEIVMNLAGIGIAGTWAMVLLAHTRF
FT                   VSAVRRGKDNRPEYRMPGAPVTNYISLAFLLIVVLSNVTSESGRWTLALFALVAIAMVA
FT                   GWYAVRNSIKPDLLDNVVPSDEGM"
FT   gene            complement(438383..439858)
FT                   /gene="glyA"
FT                   /locus_tag="HMPREF0675_3410"
FT   CDS_pept        complement(438383..439858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyA"
FT                   /locus_tag="HMPREF0675_3410"
FT                   /product="glycine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="identified by match to protein family HMM PF00464"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3410"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00072"
FT                   /db_xref="GOA:D4HB50"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB50"
FT                   /protein_id="ADE00072.1"
FT                   /translation="MSDPRAVDPTARDIAEKLAPAYRTMLDAIAQVEPRIAEATRAELT
FT                   DQRHSLKLIASENYASLPVLATMGTWFSDKYAEGTAGHRFYAGCQNVDTVETIAAEHAC
FT                   ALFGAEHAYVQPHSGIDANLTAYWTILAHHIETPALSEFGARTVNDLTQVDWDTLRHRF
FT                   NDQRAIGMSLDAGGHLTHGFRPNISGKMFDQRSYGTDPQTGLLDYDKVAELAREFKPLV
FT                   IVAGYSAYPRRVNFAKMREIADEVGAVLMVDMAHFAGLVAGKVFTGDENPIPHAQVVTT
FT                   TTHKSLRGPRGGMVLTTKDYADDVDRGCPMVLGGPLSHVMAAKAVALAEARTQTFRDYA
FT                   QRVANNAKALAEGLMKRGVKLVTDGTDNHINLLDVTTSFGLTGRQAEAALLDAGVVTNR
FT                   NSIPTDPNGAWYTSGIRIGTPALTSRGFGPDEFDQVAELIVTTLEATTPMTASTGKPGK
FT                   AKYQIADGVAQKVHDAADELLGNFPLYPGLDLA"
FT   gene            complement(439972..441078)
FT                   /locus_tag="HMPREF0675_3411"
FT   CDS_pept        complement(439972..441078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3411"
FT                   /product="kinase, PfkB family"
FT                   /note="identified by match to protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3411"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00383"
FT                   /db_xref="GOA:D4HB51"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB51"
FT                   /protein_id="ADE00383.1"
FT                   /translation="MTNPVTLRPADQCCYDIVSLGEVMLRLDPGERRIRTARSFDAWEG
FT                   GGEYNVSRGLSRVFGKHAAVITSLVDDPVGHLVGDLITAGGVDDQFITWVPSDGVGRTV
FT                   RTGLNFTERGFGVRGAVGVSDRGHSAASQLRAEDIDVDRLFGQLGVRWLHTGGIYAALS
FT                   QSSAQTAKAVMAAAHANGTVISYDLNYRPSLWKSIGGQEEARRVNRELARLVDVMIGNE
FT                   EDFTACLGFEVEGNDENLSHLDVNSYATMIDKVIEKFPNISVVATTLRQVRTASRNDWS
FT                   AIAWSKDTGLVRSVERPNLEILDRVGGGDSFAAGLVAGLMETGDLQKAVELGAAHGALA
FT                   MTTPGDTSMVTRCEVESLAAGGSARVKR"
FT   gene            complement(441075..441722)
FT                   /gene="eda"
FT                   /locus_tag="HMPREF0675_3412"
FT   CDS_pept        complement(441075..441722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eda"
FT                   /locus_tag="HMPREF0675_3412"
FT                   /product="KHG/KDPG aldolase"
FT                   /EC_number="4.1.2.14"
FT                   /EC_number="4.1.3.16"
FT                   /note="identified by match to protein family HMM PF01081;
FT                   match to protein family HMM TIGR01182"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3412"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00026"
FT                   /db_xref="GOA:D4HB52"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031337"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB52"
FT                   /protein_id="ADE00026.1"
FT                   /translation="MSNEALNTVLSHLVIPVVVIHDAATTPAVTDGLVVGGLPVAEVTF
FT                   RTDAAPAAIESMAGDGRITVGAGTVINARQVDEAVSAGASFVVSPGLSREVVDRCRHHA
FT                   IPVLPGAITPTEIMAGIDMGLDTFKFFPAGTFGGAATIASLEGPFPHLRFVPTGGVKPH
FT                   NLADFLSRANIPAVGGTWLTPADAVAARDCHTIANLVREAVDSAHHIVKEQS"
FT   gene            442596..442769
FT                   /locus_tag="HMPREF0675_3413"
FT   CDS_pept        442596..442769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3413"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3413"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00177"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB53"
FT                   /protein_id="ADE00177.1"
FT                   /translation="MVRRSTHWVSRISRWVIDMLAPLHDDIKVSSHHLNKAQARNSASL
FT                   PQTSRTSCVPAT"
FT   gene            442808..442939
FT                   /locus_tag="HMPREF0675_3414"
FT   CDS_pept        442808..442939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3414"
FT                   /product="hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3414"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99870"
FT                   /db_xref="GOA:D4HB54"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB54"
FT                   /protein_id="ADD99870.1"
FT                   /translation="MLGAEDFATVEDGAAFINTARGAICGQDALIAELQRDRINAIM"
FT   gene            complement(443167..445647)
FT                   /locus_tag="HMPREF0675_3415"
FT   CDS_pept        complement(443167..445647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3415"
FT                   /product="hyaluronate lyase"
FT                   /EC_number="4.2.2.1"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift; identified by match to protein family HMM
FT                   PF02278; match to protein family HMM PF08124; match to
FT                   protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3415"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99051"
FT                   /db_xref="GOA:D4HB55"
FT                   /db_xref="InterPro:IPR003159"
FT                   /db_xref="InterPro:IPR004103"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011071"
FT                   /db_xref="InterPro:IPR012970"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR038970"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB55"
FT                   /protein_id="ADD99051.1"
FT                   /translation="MFDIPYQVPSRRTFLSLSALSAIAIAASPEMPDAFASPDPDIWSA
FT                   LCEKWTDIITGRNAAKTADPRARAIIAKTDKRVATILTDLASSSSRTTVLLSANLQKEE
FT                   SSFITTTARAISSIACAWATPGSAYHAEPHVLSACIDALKDFCRLRYHPSQDEYGNWWD
FT                   WEDGASRAIGDVMCILHDALPTDVMAAAAAGIDHFVPDPWYQQPESVKPTAHPTQPVIS
FT                   TGANRMDLTRAVICRSIATGDESKLRHAVQGLPDSWRTVAEGDGFRADGGFIQHSHVPY
FT                   TGSYGDVLLSGLAMLLPLVAGTRFDITDSAQANLLSQVERGIVPVMYGGQILDCVRGRS
FT                   ISRIDEPAAMHGMSIARSMLLMANAIPAHRAELWRGTVHGWMTRNTFDHLSEPASLRDI
FT                   DLFDTAANVRPIPESSTPTYFASIDRLVHRTPNWLIAVSNCSNRISWYEYGNSENEWAS
FT                   RTSQGMRYLMLPEDMGQYEDGFWATVDYSAPTGTTVDSTPLKRAVGTAWAERTPDNEWS
FT                   GGLASGEWSAAASQITSQDSTLKARRLWVGLKDALLELTTDVSTDASKATTVVEHRKVG
FT                   KTPPELLVDGITITSKTSFDNPHWAHLRGVGGYVFATDVDLTAQLEKRKGSWIDVNPAR
FT                   TVKGFNEAIERNYASLHVTHHNRPVAWAVLPTASRSQTMALAQRPVDNLFIVLSNDRMV
FT                   QAVRSTGCLLTKDPTVVTTYAFWKPATCAGMTADAPAIIQTQAQGSRVEVIMSEPTQKR
FT                   PSLTVAIEGVWTVENSSDRISVSRSDKTTTLRINTADLGGQSIRVTLSPALPKPTKPSL
FT                   RASSYPLGLPHTSS"
FT   gene            complement(446229..446423)
FT                   /locus_tag="HMPREF0675_3417"
FT   CDS_pept        complement(446229..446423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3417"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3417"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00721"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB56"
FT                   /protein_id="ADE00721.1"
FT                   /translation="MRATSPSPIRHSDRSIVSVRRLSIRRGDTTVHDGRGAVELDPHPT
FT                   PRRKVSTIIWNQIQLLSGI"
FT   gene            446377..447579
FT                   /locus_tag="HMPREF0675_3416"
FT   CDS_pept        446377..447579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3416"
FT                   /product="hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3416"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00912"
FT                   /db_xref="InterPro:IPR016624"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB57"
FT                   /protein_id="ADE00912.1"
FT                   /translation="MLRSLCRMGDGDVARTVDPPGPGLGRGQEICGHPWAPAGTLSRGR
FT                   PLPRRGRRGRQSGSCPAYPRRSLIYRWCTCAPLWAGVFMKVSPLSPGLTRRICSGTVRH
FT                   FLDHGVTSTDILTMVWFHEFRPMAQSYSGVGSPYWAAKGMLGLALPPDHPVWTEPEEPI
FT                   PVEASDIYRIIAVPGWMVSETCQDGIVRVLNIGTDGQDEGELVGEAPLYTSLGFSTATA
FT                   PPQAGEWKLRSVANVVGLRDGQGQVSARSDQRVERCEYIGEVVVGQSSWLAHWVHDDVD
FT                   EGAGYGARGIVEIGPKIVCAHACHRGVEVRCVWVEGALCSGVVLMAGWPTDPCDGPESY
FT                   LEPVTSWSHRERLAGHRVTGLSKLTTVETLKTSLAGGGALYRIGRVRPMRASPTGECKR
FT                   R"
FT   gene            complement(448095..449051)
FT                   /locus_tag="HMPREF0675_3418"
FT   CDS_pept        complement(448095..449051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3418"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="identified by match to protein family HMM PF00588;
FT                   match to protein family HMM PF08032; match to protein
FT                   family HMM TIGR00186"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3418"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00071"
FT                   /db_xref="GOA:D4HB58"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB58"
FT                   /protein_id="ADE00071.1"
FT                   /translation="MAGNSQRRGGGHKSKSSAVGSGGRGRKALKGRGPTPKAEDRVYHK
FT                   AYKAKQEKLARAAARKPANRQSTGAGPEWVIGRNPVLEALHAGLPVRTAYVAEGAEHDS
FT                   RLRAILTFCADHGIALMQATRGELDRMTGGSNHQGVALRLPEYEYATVGDLIAAGTQTY
FT                   RGGLVVALDKVTDPRNLGAIIRSAAAFGAQGVLIPSRRSASMTAAAWKTSAGAAARIPV
FT                   AMATNLNQALGKFAAAGWMIVGLAGEADSDFASAPGFDGPLVIVVGSEGDGLARLTRQS
FT                   CDVLASIPISSDVESLNASVAASIALYEAARMRGAKL"
FT   gene            complement(449065..450564)
FT                   /gene="cysS"
FT                   /locus_tag="HMPREF0675_3419"
FT   CDS_pept        complement(449065..450564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="HMPREF0675_3419"
FT                   /product="cysteine--tRNA ligase"
FT                   /EC_number="6.1.1.16"
FT                   /note="identified by match to protein family HMM PF01406;
FT                   match to protein family HMM PF09190; match to protein
FT                   family HMM PF09334; match to protein family HMM TIGR00435"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3419"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99305"
FT                   /db_xref="GOA:D4HB59"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB59"
FT                   /protein_id="ADD99305.1"
FT                   /translation="MLANLGHTLMVSDVSGYTGNLSHVTFKLYNTATHGIETFKPLREG
FT                   QVSIYHCGMTVQSSPHLGHIRKEVVFDVLRRWLECSGYRVTVVANVTDIDDKILAKSAA
FT                   AGTPWWAHAYHYENELHAAYKALGCRPPTYEPRATGHIPEMIELVKTLIEKGHAYPAPD
FT                   GSGDVYFDVRSWPRYGELSGMRVDEMSPAEDSDPRGKRDPRDFALWKGHKEDEPETASW
FT                   VSPWGRGRPGWHLECSAMSGKYLGEAFDIHGGGIDLRFPHHENELAQSAAAGRPFAHYW
FT                   MHNAWVTMSGEKMSKSLGNTAQVSEVTKTYSPRAVRYFLLAPHYRSMIEFSPSDEGTKG
FT                   SLDEATKAIERIDSFLDRASNLVGEQVTASHELSEAFVIAMDDDLGTPQAVAALFSQIT
FT                   EGNKSVSIGDAEATRHHLSQVKAMLAVFGLDPQAPEWADTATGDARLEPVVDGLVQAML
FT                   DQRAEARARKDWTTADAIRDTLTNLGLTIEDTPTGAHWSLS"
FT   gene            450607..450762
FT                   /locus_tag="HMPREF0675_3420"
FT   CDS_pept        450607..450762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3420"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99135"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB60"
FT                   /protein_id="ADD99135.1"
FT                   /translation="MGESIKPVVPGSRPDKGVEEPETKLESSPSVAASPAQWGSFTVAM
FT                   PPKSSD"
FT   gene            complement(450773..452191)
FT                   /locus_tag="HMPREF0675_3421"
FT   CDS_pept        complement(450773..452191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3421"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01136"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR025111"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB61"
FT                   /protein_id="ADE01136.1"
FT                   /translation="MGGKLFLVTRFLSAKPDSRLLPLPWSTPLAQWPQERLVALPRGIS
FT                   RHVVRFITVDDDVYAAKEVVEHLAIHEYRLLHDLMRLDTPSVEPIGVITDRVASNGEPL
FT                   EPIILTRHLRFSLPYRSLFHSGVRQGTVMRLLDALVVLLVRLHLVGFLWGDISLSNVLF
FT                   RRDAEAFAAYLVDAETGELHDHLTTGQREHDLQIARTNLYGEFLDLEEGDMLDDALDPL
FT                   GLVTTIEDRYHDLWNELTAAEEFDGGDYSQVESRVRRLNALGFDVAELDIQTSPDGQRL
FT                   RIQPKVVDAGHHQRRLLRLTGLDTEEFQARRLLNDLDTFRARNGLQGVDEAVAAHRWLT
FT                   ECFEPVVQQIPPELSRKRELAQFYHEVLDYRWYESQRQQREVPHVEAAQGYVRDILAKL
FT                   PDEAISTESVVPVDGSPAHSGHELVNVYDPSLGYVEDEEEDAPYDPWEAHAEAIDVESA
FT                   SRLDIDALRARMKR"
FT   gene            452443..452961
FT                   /locus_tag="HMPREF0675_3422"
FT   CDS_pept        452443..452961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3422"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03780"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3422"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99866"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB62"
FT                   /protein_id="ADD99866.1"
FT                   /translation="MTDNKTASAKSDATKTENLPETTTKETLPPSPLHTDHGSTLIAEQ
FT                   VVQKIAGIACREVPGVHAMGSTGRRMLSSITDRIPGSTTNVSNGVQVEKGERQCAIDLS
FT                   VVIEYGYSVVEVANKLRETIIDAVEYGTGLEVVEVNVQVTDVYIQGEDDHDDDQSDQVA
FT                   GQRKNTELS"
FT   gene            452973..453158
FT                   /locus_tag="HMPREF0675_3423"
FT   CDS_pept        452973..453158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3423"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3423"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99418"
FT                   /db_xref="GOA:D4HB63"
FT                   /db_xref="InterPro:IPR018730"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB63"
FT                   /protein_id="ADD99418.1"
FT                   /translation="MNASRIGALVGLLLGVIAVCVGVWQAIVVLVLGLLGLIIGRIIDG
FT                   QLDVHDIFGKPSQRNR"
FT   gene            453158..453571
FT                   /locus_tag="HMPREF0675_3424"
FT   CDS_pept        453158..453571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3424"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99462"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB64"
FT                   /protein_id="ADD99462.1"
FT                   /translation="MSAGTTRVRSVPSLAVHNREKASRGTLTVTTAVVEKVAARVAAQS
FT                   EGFGAPTSSFFGSGSRADFDRGPKVSAVLTGRTADLEVEVAIGYPAPVQAQCDDLRARL
FT                   TEQVPKMSGVDIRTIDILVSRVVSKAPTMKELT"
FT   gene            453573..454127
FT                   /locus_tag="HMPREF0675_3425"
FT   CDS_pept        453573..454127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3425"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00706"
FT                   /db_xref="GOA:D4HB65"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB65"
FT                   /protein_id="ADE00706.1"
FT                   /translation="MSKQYVSPPLIRRPSRTLPVTILAVVLLAAGVVAIIAAIQRLQHG
FT                   SLPQWVAWGRGHMTTASWLNDTALTVAIVIGVVALLFLIWAFKPGRTSGVFLQPSEGAP
FT                   DNREIVMDNSDLTGWLSRWLDEEDGVASSVVKRRGKTLKVHAETDVKDPEVMREQLTTR
FT                   IAARVDSLGLEQPLKVEVRLR"
FT   gene            454124..454840
FT                   /locus_tag="HMPREF0675_3426"
FT   CDS_pept        454124..454840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3426"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3426"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00186"
FT                   /db_xref="GOA:D4HB66"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB66"
FT                   /protein_id="ADE00186.1"
FT                   /translation="MKGRANRTRLAVVGIIGLVVVAWFMLVRFNVVSSWGWRQPKPDAP
FT                   IVDVPKAWRTDYASWALLIVGILVAVIGLVWLLRQFSSSNRAHTYGMSHEADHGSTVLS
FT                   TDALGRAVEEQIEEFPGVSSASVRFFGARVAPEMMVQIDIDDRADVRKLVDRLESEVAR
FT                   DVEATLDAKLVRFGTKLRTGAHVTGMGVSHVGVTEVPNIDDSGDSLPANPMPKSTFLQE
FT                   KSDRAKPRTREGKVLA"
FT   gene            454897..455472
FT                   /locus_tag="HMPREF0675_3427"
FT   CDS_pept        454897..455472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3427"
FT                   /product="Sigma-70 region 2"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM PF04545; match to protein
FT                   family HMM PF08281; match to protein family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3427"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99654"
FT                   /db_xref="GOA:D4HB67"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB67"
FT                   /protein_id="ADD99654.1"
FT                   /translation="MVSRVDGHGGDEVILADIRAAQDGDAGAYARIVKSWGGRLLRFCR
FT                   NNLPATIDAEDVVQDVLLTAWQKLPGLDDRSRFRAWMYTIARNRCREVIRTAGRRATDP
FT                   VSPEEVAVKIDSRQDPARAHARDAAMMALRKSVAGLPDTQRSIWVMAQIDGLGYAEIAD
FT                   IEGLPLSTVRGRLARARATIAKEMESWR"
FT   gene            455565..455987
FT                   /locus_tag="HMPREF0675_3428"
FT   CDS_pept        455565..455987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3428"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3428"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99252"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB68"
FT                   /protein_id="ADD99252.1"
FT                   /translation="MRIEALRADQLRDDTVAEDAQTKVVVDPLKLSSVWRSYAADLSPR
FT                   HCVFDDDGGQVEVRETVLAAIVRNSLADCEDGRLNRIRFSVPHTPLRLRIDLSVARGVR
FT                   IPDCAERVRHRISTAMTRELGGRPEAIDIIVEDIHV"
FT   gene            455980..456333
FT                   /locus_tag="HMPREF0675_3429"
FT   CDS_pept        455980..456333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3429"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3429"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99055"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB69"
FT                   /protein_id="ADD99055.1"
FT                   /translation="MSELKNDDVVSGTLLTGEHIIDDLAGIIVTTVRNTPGVTRLVKPW
FT                   WRRIGNDDRSAIRISEEDGLSEVKVEVTVDLTVPIVQLTQDLRHRVSTAITQSGRTPGK
FT                   VDIVVSKVEPNNE"
FT   gene            complement(456399..457499)
FT                   /locus_tag="HMPREF0675_3430"
FT   CDS_pept        complement(456399..457499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3430"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08402"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3430"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00590"
FT                   /db_xref="GOA:D4HB70"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB70"
FT                   /protein_id="ADE00590.1"
FT                   /translation="MATVQYKEATRVYPGTDRAAVSKLDLDIGDGEFMVLVGPSGCGKS
FT                   TSLRMLAGLEEVNAGSIWIGDRDVTDLPPKDRDIAMVFQNYALYPHMTVADNMGFALKM
FT                   QNVPKAERQQRVLEAAKLLGLEDFLNRKPKALSGGQRQRVAMGRAIVRNPQVFLMDEPL
FT                   SNLDAKLRVQTRTQIAALQQRLGVTTVYVTHDQVEAMTMGDRVAVMRDGVLQQVDSPLA
FT                   LYDTPKNLFVAGFIGSPAMNLMEGDVVDGGVELGDYVVPVSRDVLAKVPNETKLTLGIR
FT                   PEAFTLASEGIGLDVAVVEELGADAYLYGSLVGSGKQASIEDGEAHQVVARISSRRPPQ
FT                   RGEQVRLGVDPASVHVFSQETTERIS"
FT   gene            complement(458160..459650)
FT                   /locus_tag="HMPREF0675_3431"
FT   CDS_pept        complement(458160..459650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3431"
FT                   /product="L-serine ammonia-lyase"
FT                   /EC_number="4.3.1.17"
FT                   /note="identified by match to protein family HMM PF03313;
FT                   match to protein family HMM PF03315; match to protein
FT                   family HMM TIGR00720"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3431"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00058"
FT                   /db_xref="GOA:D4HB71"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB71"
FT                   /protein_id="ADE00058.1"
FT                   /translation="MNRHNLFGQHSSPGFGRIMSVAVSVFDIFKVGIGPSSSHTVGPMR
FT                   AARIFVTDLAQSPVWPEVTRVRAELFGSLGATGHGHGSEAAVLLGLEGEDPATVDTDQT
FT                   PARAASIANDGRITLDAVHGGREISFDVTTDLVLHRNRSLPFHPNGMTFTAWSGQEVVV
FT                   ERTFYSIGGGFVVEHGEDEHPAIVRDSAPVPYPFKTGKELLEQCSDYRMSIPEVAMANE
FT                   MTLRAEEEIRGQLLDIWAVMHACVERGCSRAGVLPGGLHVRRRAMKMHHDLVTRERITP
FT                   GKPEPFGSVDWLTVWALAVNEENAAGGRIVTAPTNGAAGIIPSCLHFAVKFLSPGSDID
FT                   SGTPGVDTGDDDLIVNYLLAAGAVGEIYQQSASISGAEVGCQGEVGVACSMAAAGLAQV
FT                   MGGTPTQVCNAAEIGLEHHLGLTCDPVGGLVQIPCIERNALGAIKAVTAARLAMAGDGS
FT                   QIVSLDQVMKTMMETGRDMKVKYKETARGGLAVNIVEC"
FT   gene            459938..462247
FT                   /locus_tag="HMPREF0675_3432"
FT   CDS_pept        459938..462247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3432"
FT                   /product="oxidoreductase, NAD-binding domain protein"
FT                   /note="identified by match to protein family HMM PF00480;
FT                   match to protein family HMM PF01408; match to protein
FT                   family HMM PF02894; match to protein family HMM PF08279"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3432"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00844"
FT                   /db_xref="GOA:D4HB72"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB72"
FT                   /protein_id="ADE00844.1"
FT                   /translation="MTSQERPAGRGQRKDDVLRELRADGALTAAELVERTSLSRPTIIS
FT                   LLRELEEDGWVSSEVGGHGAPGRPATAWAPGSRAGIVIGADVLVDSMLTVVSTFHGRVL
FT                   EVRTDQLVDRCREARLDVVAGVIGEARDRWSEGFGLLRQVAVSTTGVVDGHGTVLRSDL
FT                   VPQWERLDLAAALVQRLGVSVSVENDINMAAWGEFCCRRGQSLSSDGDMLLVQMTKGLH
FT                   TGLVLSGRIHRGRQWNAGEISDVLDLRLEDGQHPDDEWIDRAALTIGSVAGVVDPDLIV
FT                   VAGPTSRSLDVIRQVIARLHQRRVPGSVPVPAEVAALGRAASVVGAVDVALGHASAAFL
FT                   GVERPHPVALQGVERIHQEVEKGHHSVMATTRDKRTIEVLRVGVVGVGARSRLALNAEL
FT                   EGNGGAIVAVCEPHHLARRRVADRLGKDPDSIVITSDVAGLIRAGIDVAFVTSPDDTHV
FT                   EVTCALLEAGVPVYLEKPLAITLESATKVLVTAHRTGTKLYVGHNMRHMNVVRSMRDLI
FT                   RTGRIGEVKAIWCRHFVGAGGDFYFKDWHATREHGTGLLLQKAAHDIDVMHWFAGSHTT
FT                   DVVGMGGLTLYDQITDRCDHSDELMGDWYSLDNWPPLSQKGLNPVIDVEDLSMVLMRME
FT                   SGVYASYQQCHYTPDYWRNYTVIGTEGRIENFGDGEGGVIRLWNTRTHYNAEGDETFPI
FT                   IGDANGHGDADVLTVTEFLNFVRNGTRTDTSSLGAWYAVAAGIEATESLRSGSTPRMVP
FT                   SLDAELVEYFNNNQVK"
FT   gene            462270..463562
FT                   /locus_tag="HMPREF0675_3433"
FT   CDS_pept        462270..463562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3433"
FT                   /product="Tat pathway signal sequence domain protein"
FT                   /note="identified by match to protein family HMM PF01547;
FT                   match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3433"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00339"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB73"
FT                   /protein_id="ADE00339.1"
FT                   /translation="MDRRGFIAGAALATLAVAGCSSSKKEAGSGTASIAPDTSAELVLA
FT                   YWDKNQTRTIKENIKSFNKKYPNVKVTTNLAGYEDYWKKLRTQAQGNELPDVFWMNGPN
FT                   IQLYAGNGMLAPIDKVTDAGVKWSDYPEALVKLYTYDGKHYGVPKDFDTIGVFYNKKIF
FT                   KDAGVELPTADWTWDDFHDKAKKISDWGKSKGIYGCATTINGDGQGTYYNTIFQAGGFV
FT                   IKDDKSGFDDPKSIEGLQCWADWVKDGSVASPKVITDTKPSQMFKSGKSAMYWSGDWTA
FT                   SELAEEFKGHENDYDVIVLPKKDRKATVIHGLGWVVSARSANQAAALALVAHMGSKQAQ
FT                   ETEARNGTAIPAFHGTQDPWVKAFPQWNCKMFVDAATTYAVTYPVSRNTSVWADKEADY
FT                   VNPAFSGEMPVPETARKLATFMNDALAKEKG"
FT   gene            463559..464515
FT                   /locus_tag="HMPREF0675_3434"
FT   CDS_pept        463559..464515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3434"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3434"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99898"
FT                   /db_xref="GOA:D4HB74"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB74"
FT                   /protein_id="ADD99898.1"
FT                   /translation="MIHPGTRGDTAVAPLSSRSGHRKKKDPTSVGAWPALFIGPLMLGI
FT                   AVFYYWPIFENVVASLKQTNAFGGNPQFVGFENYRELFASPDLRSAIGNTLLYTVIVLL
FT                   GIPLSVAVAAMIELPGLRFKGLYRILYFMPYLAMPMAVAQVRKIVYNGQFGLLNQILRS
FT                   VGVSDPPYWLVSPGWALFAVALFGLWASIGFNVIILSAGLKSIPRELYEAASIDGASAW
FT                   RQFRMVTVPLLSPSIFFVTIMTTIGGFQLFDALYAMIGTGNPAEPRTRSLVSLFYRQAF
FT                   VNHDQGLGAAVAIVIFALVAIVTLAQFLGQKRWVNYV"
FT   gene            464508..465398
FT                   /locus_tag="HMPREF0675_3435"
FT   CDS_pept        464508..465398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3435"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3435"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99338"
FT                   /db_xref="GOA:D4HB75"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB75"
FT                   /protein_id="ADD99338.1"
FT                   /translation="MSEVSTGSELSAVEVAALAKRGDTVSQRRFVGVHILLLLGGVLMV
FT                   FPFVYQILMSLSTNMEIQSVPPKLIPDRWQFHNYTEVFTRLPFLKQFGVSVTITVLRSV
FT                   VQLILCSMGGYAFARMKFGGKSVLFGFVLAILMVPGQSYLIGQYEIIRELGLLETPWGI
FT                   VLPGFFSAFGVFLMRQSFMSLPAELEEAARLDGCNPWQTFWRVMVPVVKPGLFAVMITT
FT                   VLWSWNDLLWPLIVTAREESMPLSVGIATLAGQHSSEFALMMAASVMAMAPIFLLFFSM
FT                   QRKVIEGLASSGLKG"
FT   gene            465752..466789
FT                   /gene="tdh"
FT                   /locus_tag="HMPREF0675_3436"
FT   CDS_pept        465752..466789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdh"
FT                   /locus_tag="HMPREF0675_3436"
FT                   /product="L-threonine 3-dehydrogenase"
FT                   /EC_number="1.1.1.103"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM PF08240"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3436"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01152"
FT                   /db_xref="GOA:D4HB76"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR004627"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB76"
FT                   /protein_id="ADE01152.1"
FT                   /translation="MKALVKTRPEPGLELVEVPDPVAGPNDVIVKVMRTGICGTDVHID
FT                   KWDGWAAKTVHTPLVLGHEFCGEIVELGSEVNDLEVGQFVSGEGHYVCGRCRACLAGKR
FT                   HLCRNTQGIGYAVNGAYCQYFVMPAGNVWVHHIPDLDPDVAAIFDPFGNAVHTALQFPC
FT                   LAEDVLVSGAGPIGIMAALVAQFQGARNVVVTDLSDERLELAQQLGLKNAVNVSREGLE
FT                   TVWDRFDMKEGFDIGLEMSGSGTALTSMIDNMTHGGRIALLGTPSTDITLDFSKIIFNM
FT                   ITIQGVTGRQIFETWYTMASLIRSGLDISGIITDRYPITEFREAFDVAGSGHGGKVVMN
FT                   WECLD"
FT   gene            466815..468011
FT                   /gene="kbl"
FT                   /locus_tag="HMPREF0675_3437"
FT   CDS_pept        466815..468011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kbl"
FT                   /locus_tag="HMPREF0675_3437"
FT                   /product="glycine C-acetyltransferase"
FT                   /EC_number="2.3.1.29"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM PF00202; match to protein
FT                   family HMM PF00266; match to protein family HMM TIGR01822"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3437"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00649"
FT                   /db_xref="GOA:D4HB77"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011282"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB77"
FT                   /protein_id="ADE00649.1"
FT                   /translation="MYGPMKDELSAKIAALKEEGLYKAEAPLTSPQSGKITVDDGREVI
FT                   NLCANNYLGLADSPVLIEAAKKALDEWGFGMASVRFICGTQTLHQKLERAITEFLHPDD
FT                   PDNWDTILYSSCFDANGGLFEVLLGPDDAIISDELNHASIIDGVRLCKAQRFRYRNQDM
FT                   ADLEAQLQAAKDCRHIMIATDGVFSMDGFVAPLPQICDLAEKYGAMVMVDDSHAVGFVG
FT                   EHGAGTPEQWGVRDRVDVLTGTLGKALGGASGGYTCSHREVVEMLRQNSRPYLFSNSLA
FT                   PSIAGASLATLDLLKSSGDLLTKLRENTEYFRSEMTRRGFEIPESDHPIVPVMVGDAVK
FT                   AAKMADAMLAKGIYVRAFSYPVVPKGKARIRTQMSAGLTREQLDKAIKAFEEARAEIG"
FT   gene            complement(468028..468951)
FT                   /locus_tag="HMPREF0675_3438"
FT   CDS_pept        complement(468028..468951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3438"
FT                   /product="ABC transporter, substrate-binding protein, QAT
FT                   family"
FT                   /note="identified by match to protein family HMM PF04069"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3438"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99532"
FT                   /db_xref="GOA:D4HB78"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB78"
FT                   /protein_id="ADD99532.1"
FT                   /translation="MITTPMTRRTLLGTALLTGLAACSSNDPLNSDGSGSGSADLIVGS
FT                   ANFTESEIIAEVYAQSLETVGITIKRRMQIGARDVYVKALQDGSVNLVPEYSGNLLQFF
FT                   QGASSASDEKSVMASLRKAVPAGMSVGEPSAAQDADSWCVTTEFSHTHKVTSLTDLATL
FT                   DSLKVGGNPELKERPYGPKGLTKAYGVPSSIVKFTALSDSSGPLTVKALTLGTVDLVDL
FT                   YTTTPAIKEQHLVVLSDPRHLIVPQNVVPLLSKKVDDKARAQLARVSKALTTDDLIGMN
FT                   QRFQGDEKASAATIAKDWLAQRGLAS"
FT   gene            complement(468973..469668)
FT                   /locus_tag="HMPREF0675_3439"
FT   CDS_pept        complement(468973..469668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3439"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3439"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99952"
FT                   /db_xref="GOA:D4HB79"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB79"
FT                   /protein_id="ADD99952.1"
FT                   /translation="MNHIAAALTWLTTSSHWAGSGSIGVRIGEHLWYTLLALTIAAITA
FT                   IPAGLAIGHTGRGKTIAVACSGALRALPSLGLLTLLAISTTIGIENPVVPSTIVLAILA
FT                   IPPLLAGSYSGVDAIDDEVADGARACGMTEMQVLGRVELPLATPLLLGGLRSAALQVIA
FT                   TTTICSYLGMGGLGRFILDGLAVSDYPQMLAGSIVIIVLALVVDGLLCLVTRLLTGPGV
FT                   RHALALTPQ"
FT   gene            complement(469665..470312)
FT                   /locus_tag="HMPREF0675_3440"
FT   CDS_pept        complement(469665..470312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3440"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3440"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00864"
FT                   /db_xref="GOA:D4HB80"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB80"
FT                   /protein_id="ADE00864.1"
FT                   /translation="MNTRWISENWDQIWQLTSHHAVLSVTPVLLSLLLSVPLGWWAHRA
FT                   RTARRILVPGASVLYALPSLPLFVLLPLILGTKILDPINVVVALTLYGIALLVRTATDA
FT                   FDSVGRSVRRDAVAIGHSDSQVFWRVALPLAVPALVAGMRVVSASTLSLVSVGALVGVP
FT                   SLGYFFTDGYQRSFPTEIWVGIIGTLVLAIIFDLVIVCVGRLLTPWRRAATI"
FT   gene            complement(470309..471145)
FT                   /locus_tag="HMPREF0675_3441"
FT   CDS_pept        complement(470309..471145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3441"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3441"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00107"
FT                   /db_xref="GOA:D4HB81"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB81"
FT                   /protein_id="ADE00107.1"
FT                   /translation="MIRFDHVSKRFDDGTVAVDNFELTVESHHLVVLLGSSGCGKTTLL
FT                   RMVNRMVDPSEGRILIDDTDVATVNPVKLRRQIGYVMQSGGLLPHRTVVDNIAAVPLLS
FT                   GVSRTAARTRAMDLLERVGLDSSLARRYPTQLSGGQRQRVGVARALAANPDILLMDEPF
FT                   GAVDPVVRTELQQGLLQIQADLAKTIVFVTHDVDEAFLLGDEVLVLRREAQVAQRGRPD
FT                   DVLLHPIDDFVSSFIGGDRRNLHMERHDDHPTIVDAGGRLVGRFANQPSTTVRENS"
FT   gene            471295..472095
FT                   /locus_tag="HMPREF0675_3442"
FT   CDS_pept        471295..472095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3442"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99695"
FT                   /db_xref="GOA:D4HB82"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB82"
FT                   /protein_id="ADD99695.1"
FT                   /translation="MQNEMSTAAAGEKDSFAVAATSLAVAEDELARSSTGTESSAEEEW
FT                   WKAEGMPWNHKPGRSDYWCMGWIGFLGIFSLAMLPLRGWLLGLDPPILMGLTGSRTGAA
FT                   ATGALASVGQAPYWLWWLLLGSIMSIKLDWVYWWAGKLWGRGMIEVWAGRSERAHRRYD
FT                   QAEKWARKLGWLGVLVTYVPIPLPIMPVVFVLTGASGMKVRWFIALDFVAATIWNLGYL
FT                   GLGWGVGDPIVDALKYYAKIANWVAIALIIVILAPIFVKKKQKA"
FT   gene            472111..472482
FT                   /locus_tag="HMPREF0675_3443"
FT   CDS_pept        472111..472482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3443"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04343"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3443"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00470"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB83"
FT                   /protein_id="ADE00470.1"
FT                   /translation="MEDMTIFRAVNIRDDLKKGPAEGYRVLVDRMWPRGVKKDDARLDE
FT                   RRTDLAPSSQLRTWWNHDPERFDEFAGRYEVELDESGAAKTFLEECAGRDEVILLYGAG
FT                   DREVNHAVVLERILTELAN"
FT   gene            complement(472513..473028)
FT                   /locus_tag="HMPREF0675_3444"
FT   CDS_pept        complement(472513..473028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3444"
FT                   /product="macro domain protein"
FT                   /note="identified by match to protein family HMM PF01661"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3444"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99768"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB84"
FT                   /protein_id="ADD99768.1"
FT                   /translation="MADITILRADITTLDVDAVVNAANRQLAGGGGVDGAIHRAAGPEL
FT                   SQACRKLRETTLTDGLPTGQSVATTAGKMPAKWVIHTVGPVWAKTIDKSDQLASCYRTS
FT                   LHVADEIGARTIAFPTISAGVYGYPMDEATRIAVETCRQTVTKVDTIYLVAFNAEAEAG
FT                   YRAALGEE"
FT   gene            473146..474162
FT                   /locus_tag="HMPREF0675_3445"
FT   CDS_pept        473146..474162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3445"
FT                   /product="oxidoreductase, zinc-binding dehydrogenase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00107"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3445"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99393"
FT                   /db_xref="GOA:D4HB85"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041694"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB85"
FT                   /protein_id="ADD99393.1"
FT                   /translation="MSTTRPTTTRAVHLASRPHGAPTEDNFRIEEISLPELSDGQILVA
FT                   NDVMSVDPYMRGRMNDVKSYVPPFHIDRPLDGGAVGTVIESRSEDIPEGSHVSHQLGWR
FT                   EHAVLNAGDAHIIDTDIAPASAYLSVLGMTGLTAYAGLTRAAEMKAGDAVFVSGAAGAV
FT                   GSMVGQLARLLGASRVIGSAGTDAKVARLRELGFDAAFNYHDGPSTELLGQAAPDGIDV
FT                   YYDNVGGDHLEAAIDHLNIDGRVAMCGAISQYNSVEPPCAPRNLALAIGKRLTLRGFVI
FT                   AKYAEEVRPEFQQRMAEWLPADEIHWDETFRDGLDAAPQAFIDMLDGANTGKMLVRL"
FT   gene            474228..475241
FT                   /locus_tag="HMPREF0675_3446"
FT   CDS_pept        474228..475241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3446"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3446"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00784"
FT                   /db_xref="GOA:D4HB86"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB86"
FT                   /protein_id="ADE00784.1"
FT                   /translation="MSWPSCDIEGWWLQSCRFETGAMDKPAIEIRDLVKSFPQTGSRER
FT                   LIAVDHLSMTINRGEVVAFLGPNGAGKSTTVDMLLGMTRPDSGKVSVLGSDPRTAARTG
FT                   CISAVFQTGGLLPDFTVAETMKAIAAAHGQRSRVKPLIERWELAPFAGTKVGKCSGGQR
FT                   QRLRFALAMLPKPDVLILDEPTTGLDVEARRHFWQVMGEEADAGRTVIFATHYIEEADS
FT                   FARRVVLVSGGQLVADGPINEVRASVSGSIVRATLTDPSGLAEGLHTFPGINDVTVRGQ
FT                   QLIVHTSQPDDLARYLLAHTDAHGLLISTTTLEDAFVRLTGSNDSRDDADDWEAAA"
FT   gene            475238..475987
FT                   /locus_tag="HMPREF0675_3447"
FT   CDS_pept        475238..475987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3447"
FT                   /product="ABC-2 type transporter"
FT                   /note="identified by match to protein family HMM PF01061"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3447"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00739"
FT                   /db_xref="GOA:D4HB87"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB87"
FT                   /protein_id="ADE00739.1"
FT                   /translation="MITYALLDIRRLLRNTGGTIFTVLMPAGFYLIFGATQSYTDAAVA
FT                   HGNVKATIMVSMAVYGAVLAVTTWGSHAALEQQRGWGRQLALTPMTPLKYVFSKVLAIE
FT                   TVALVPLAVVFATGAITNARVDGLRWLWSFLLCWVCSMPFTLFGLAVALLVRGEAATGI
FT                   TSFCTVAVAFLGNMFIPLNGFMLKLSRFTPMYGPGQLTRMPLIGQQMVTMRGVIDEPVW
FT                   CPVVSIIAWTIIMGIVAVLAGRRRQNR"
FT   gene            476081..477217
FT                   /locus_tag="HMPREF0675_3448"
FT   CDS_pept        476081..477217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3448"
FT                   /product="histidine kinase"
FT                   /note="identified by match to protein family HMM PF02518;
FT                   match to protein family HMM PF07730"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3448"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00105"
FT                   /db_xref="GOA:D4HB88"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB88"
FT                   /protein_id="ADE00105.1"
FT                   /translation="MVVIVGASHPIPLRRRNRNALAAGIWLVFLAYTVVSLQSSHLPPW
FT                   RIALGWVGLTIFALFYLTLFWWHVDGLELWYTKRQVRRSAIVGQVALVVLCALLALVSP
FT                   KMVASALVYPIAFAVFQMPEVALEITLAIEVVGIAVLVWTVPDLMPWAISWAISVALVT
FT                   VVGVLERTACRGQLACQAEQDVLARLEEREQVASDVHDLLGQTLTVMAMKAQLAERLIG
FT                   TDPDAARAQAVELHGLTRRALAQVRELVSDMAHMGVDAQLAAARTALEAAGVECVVSDT
FT                   RTDVQGGCHGEGSEFDTVRGWVLREAVTNVVRHAQAHTCCVEIDDEILVISDNGRGRGG
FT                   APEGNGLTGMRRRVEAAGGELWIGPGERGHGTRIVVTG"
FT   gene            477222..477842
FT                   /locus_tag="HMPREF0675_3449"
FT   CDS_pept        477222..477842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3449"
FT                   /product="response regulator receiver domain protein"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00196"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3449"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99686"
FT                   /db_xref="GOA:D4HB89"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB89"
FT                   /protein_id="ADD99686.1"
FT                   /translation="MIDKTPIRLVLADDQTLVRGALAALLGMEDDLEIVGTCGRGDEVV
FT                   GLVQDTYADVCLLDIEMPGLDGITVAAELRDQAPWCRILIVTTFGRPGYLRRAMDAGVA
FT                   GFLVKDTPAEDLAQVVRKVHAGGRAIDPALAAESLIEGHNPLSGREREILRLAESGASI
FT                   SLIASELCLSVGTVRNHVSSAIGKTGAANRTEAAVTARRRGWL"
FT   gene            complement(478115..478684)
FT                   /locus_tag="HMPREF0675_3450"
FT   CDS_pept        complement(478115..478684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3450"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /note="identified by match to protein family HMM PF00300"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3450"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01113"
FT                   /db_xref="GOA:D4HB90"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB90"
FT                   /protein_id="ADE01113.1"
FT                   /translation="MSRIVIVRHGQSTWNRQGRIQGQTMGVRLTMRGRSQARQAARTVA
FT                   DLVPHGTPTIASDQKRAVQTARPIARVLGVQVMTDPRLREQGLGAMEGHTADELEPLPQ
FT                   PTGVHPADVRWAGGESLADVAERCHSLLDDLAARHLSAIALVTHGDTMRILLGILDGRS
FT                   HRDLDWDLSLTNGSVMVRNVDLGELH"
FT   gene            478739..479767
FT                   /gene="cobD"
FT                   /locus_tag="HMPREF0675_3451"
FT   CDS_pept        478739..479767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobD"
FT                   /locus_tag="HMPREF0675_3451"
FT                   /product="cobalamin biosynthesis protein CobD"
FT                   /EC_number="6.3.1.10"
FT                   /note="identified by match to protein family HMM PF03186;
FT                   match to protein family HMM TIGR00380"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3451"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99790"
FT                   /db_xref="GOA:D4HB91"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB91"
FT                   /protein_id="ADD99790.1"
FT                   /translation="MSITPRRHVAVGLLCRAAGLGLGIIADHIVPDPQTHHPVAVFGAA
FT                   VARLEKTMYADSTRRGTLFTVTCLTPLAVIGGAVDRLTRNRPALRIATTALATWAVVGS
FT                   ASLAREGRAMAGHLANGDLVAARKRLPHLCGRDPDALDAAEIARGAVESMAENASDAAV
FT                   ASLWWGAVAGLPGLLVHRGANTLDAMIGHHNDRYEHFGKVAAYLDDVVNWVPARFTGAL
FT                   AAGCASTVGGDRKTTWRVVRAEHGHHPSPNGGWCESAWAAALGVQLGGRNVYYGNRVEF
FT                   RPLLGSGTRPDADKTADAARLVTTVTTAATWCAVAGLASVAHVLFYGGLIPRGLLPHST
FT                   RR"
FT   gene            479785..481239
FT                   /gene="cobQ"
FT                   /locus_tag="HMPREF0675_3452"
FT   CDS_pept        479785..481239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobQ"
FT                   /locus_tag="HMPREF0675_3452"
FT                   /product="cobyric acid synthase CobQ"
FT                   /EC_number="6.3.5.10"
FT                   /note="identified by match to protein family HMM PF01656;
FT                   match to protein family HMM PF07685; match to protein
FT                   family HMM TIGR00313"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3452"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00086"
FT                   /db_xref="GOA:D4HB92"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB92"
FT                   /protein_id="ADE00086.1"
FT                   /translation="MTGILVAGTSSDAGKSLVVTALCRVARRRGVDVVPFKAQNMSNNS
FT                   MVCADGSEIGRAQYLQATAAGVTPTSAMNPVLLKPGTDRRSFVVLRGKPGGVLEAGEYT
FT                   TGRRYLAEAAWAAYDELAASHDMVICEGAGSPAEINLRRGDYTNMGLARAKNLPVVLVG
FT                   DIDRGGVLASLFGTWALLDDDDRALLAGYIVNKFRGDDAILAPGLEEITDRTGMPSFGV
FT                   LPWVPGVWLDGEDALEVGRWRHEGDAVDPSSLRVAVVRFPRISNATDVDAMAGETGVDV
FT                   QVTTNPDTCQAADVLVLPGSRSTVSDLEWLRRSGIADVVARRAEQGRTVVGICGGYQML
FT                   CRTILDPDGQETTPGSVVEGLGLLPVEVDFAATKTLALSHGTWRGIEVGGYEIHHGVCR
FT                   SLEDAEAFLDGVHVGPVWGTMWHGAFEHDEFRRTWLADAARHAGSSWRPHSDELGYQAR
FT                   REAMIETLADALEAHVDVDRILHLVR"
FT   gene            481566..482321
FT                   /gene="cobI"
FT                   /locus_tag="HMPREF0675_3453"
FT   CDS_pept        481566..482321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobI"
FT                   /locus_tag="HMPREF0675_3453"
FT                   /product="precorrin-2 C(20)-methyltransferase"
FT                   /EC_number="2.1.1.130"
FT                   /note="identified by match to protein family HMM PF00590;
FT                   match to protein family HMM TIGR01467"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3453"
FT                   /db_xref="EnsemblGenomes-Tr:ADD98940"
FT                   /db_xref="GOA:D4HB93"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB93"
FT                   /protein_id="ADD98940.1"
FT                   /translation="MNDATSRTLFGVGVGPGDPELVTVKTVRILREADVILVPYTEATT
FT                   DGPGRAESIITAVAPEIAGRIRRIPFSMRERSGVGEKRKASWQVSSDAVVTAFDEGART
FT                   VALATVGDPTVFSTFTYLRANVEERLPDVTVELSPGITAMQALSAASGRPLVEGKEILA
FT                   LVPATVGISKLGQVLDLVDSVAIYKGGRKLPDVVEQLRSRDRQAVIGTDVTLESEQIIT
FT                   LDEVADAQTLPYFSTVLTTPERTTTGGKL"
FT   gene            482318..483289
FT                   /gene="cobM"
FT                   /locus_tag="HMPREF0675_3454"
FT   CDS_pept        482318..483289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobM"
FT                   /locus_tag="HMPREF0675_3454"
FT                   /product="precorrin-4 C(11)-methyltransferase"
FT                   /EC_number="2.1.1.133"
FT                   /note="identified by match to protein family HMM PF00590;
FT                   match to protein family HMM TIGR01465"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3454"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00772"
FT                   /db_xref="GOA:D4HB94"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB94"
FT                   /protein_id="ADE00772.1"
FT                   /translation="MSEPQAARPTQHVSEKALEDLDHNVIEPPPVPRRDIPEGAGKVVF
FT                   VGAGPGAPDLVSVRGARVIETADIIIWASSLVHPDMVARHKEGAELIDSASIPLEDLEP
FT                   LYTRARDEGLMVVRVHTGDPSIYGATAEQRDLCRRIGIDFETIPGISAFSAAAARMDVE
FT                   ITVPEVSQSLILTRLEGGRTPMPDGETVASFARHGATMAIYLSAARNKALQEALLEGGY
FT                   LPETPCIIGYAVTWPEEMMFRCDLAHLSETMRNHKLWKHAVVLVGPALAEGPISTRSHL
FT                   YHPGFRHEYRAADAQAHADLKAHGTCGVYHRNSTNPDTKGNS"
FT   gene            483286..485835
FT                   /gene="cobJ"
FT                   /locus_tag="HMPREF0675_3455"
FT   CDS_pept        483286..485835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobJ"
FT                   /locus_tag="HMPREF0675_3455"
FT                   /product="precorrin-3B C(17)-methyltransferase"
FT                   /EC_number="2.1.1.131"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift; identified by match to protein family HMM
FT                   PF00590; match to protein family HMM PF01890; match to
FT                   protein family HMM TIGR01466; match to protein family HMM
FT                   TIGR02467"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3455"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01139"
FT                   /db_xref="GOA:D4HB95"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR002750"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR021744"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036518"
FT                   /db_xref="InterPro:IPR038029"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB95"
FT                   /protein_id="ADE01139.1"
FT                   /translation="MIRVHGYLGTISDALREEVTQADLVVGGQRHLDALAVPDDKRQKL
FT                   GLIGPAIERIQSLPDDANVVVIASGDPLFFGVVRRIRQAGLRVEVVTAPTSLQAAFAAV
FT                   ALPWDDAQFVSSHSKDIETAVRLAKIHPKVGVLTAPNRGLAELVDGLAGRGKTFVLAEK
FT                   IGEEGQRVRVLDEDAAKAVIADEDILSPNVVLVLEHHPDSPEALGVNPELAGDVNVNGP
FT                   DAPQPGSDTNPDGSDRDPIIGQIINSDAAVAHAEAIDHALKRETKKYVGPSRTGLAAAW
FT                   GECDLIISHLALGATTRIIAPLLESKKTDPGVVVVDEAGRFAIPLVGGHVGGANELSRT
FT                   VAEALSGTAVVSTATDSLGVPALDQLGWAYEGDVAGVTGSIIAGRPVLVVREQPWPLPP
FT                   LPKNVTEDAETPAARVIVSERVAERVFADHGDDLPTVVLHPSCLVVGMGCNKGTEVESL
FT                   RQLLVKTLEDNGLALGSVTRLVSHEVKAGELGLVKLANQLGVEYRTESAEALAAHDVPT
FT                   PSDVVAREVGTPSVSEAAVLCQGAELLVHKTKTSDATCAIGRIPAHGHLSVVGLGPGSR
FT                   DLLTPRAVEAIRNATFVAGYAPYVRQIRDLVRPGATILATKMGTEEERTQAAIEATRDG
FT                   RNVAFVCGGDPAIYAMASPTLEMGTDGIDVEIVPGVTAELAISAILGAPLGHDHATISL
FT                   SDLHTDWDLILKRVKAAAEGDLVTTFYNPRSRTRTHQLPDALAIMAEHRPPSTPVALVS
FT                   HAERRQQQVIMSTLEEFKPEWCGMTTLVVVGSTTTKYVSSGDGRRLMVTPRDYHWMDGH
FT                   VCSEARKNYTHKDLPRADEERRISPSLRFTPLSCLSP"
FT   gene            485855..487123
FT                   /gene="cbiX"
FT                   /locus_tag="HMPREF0675_3456"
FT   CDS_pept        485855..487123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiX"
FT                   /locus_tag="HMPREF0675_3456"
FT                   /product="sirohydrochlorin cobaltochelatase"
FT                   /EC_number="4.99.1.3"
FT                   /note="identified by match to protein family HMM PF01903"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3456"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00631"
FT                   /db_xref="GOA:D4HB96"
FT                   /db_xref="InterPro:IPR002762"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB96"
FT                   /protein_id="ADE00631.1"
FT                   /translation="MTDPLASGTPLVIAAHGTRDEAGVAECRALAERVARKLPGIPVEL
FT                   GFVELAEPGIPEAVRAAVAQAPDNPEGADGDEEAAAVVVPLMFNTGGHVREDIPEAIDE
FT                   GRGDARVMYSAPLLPDVRMRKALNHRLTETLAAGEGREEWRPRDTSAVLVGRGALVPDA
FT                   NASHYTLTRMFWEENDLSRVEPAFIQVTRPSVPEALSALAAQGADQIVVQGNFLFPGLL
FT                   HVWMTEQVEAWQASHPGVEIRIAPVIGDCDEVADVVVDRYREPLDEVGLGEGAPVYMSG
FT                   LRLQGRKVLVVGAGHVAERRVVRLLEAGADVHVVAPNSGIQLTRMFRKGLVNLERRAFQ
FT                   TKDLDGVWFVQALTNDPEVNALVAEEADRRGIFCVRGDNSRKGSAFTPATQQAGGMTVS
FT                   VVGDRTPRRSARLRDEVLRALQG"
FT   gene            487165..488031
FT                   /locus_tag="HMPREF0675_3457"
FT   CDS_pept        487165..488031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3457"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99477"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB97"
FT                   /protein_id="ADD99477.1"
FT                   /translation="MTGASGGAYHRRVISHDLHALGFDAPDLDALVNSAAEAGAVGVED
FT                   VGGFDLLAAYTDPSGARLALMKQKGHDEMETMASLVAPTTHPADLVRFSPAVALVDIYS
FT                   HAGFASMLTGESVLTLPTTNRRHVARFLANVDDPVEVPLCAEPGDDTPRFVEHLRVGTV
FT                   ANQMLRVFESEEEYGRSHEGSLGSELQFAAGTLISPWLMEINAGRATRGEASAVAEMTM
FT                   VCKKVEKRTNVLTGVDWYRIVGDTSIPMTLAVSANLPRVPHVGSVVTGQVVPVVSTGTW
FT                   EGDALWG"
FT   misc_binding    488729..488905
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="cobalamin riboswitch; Rfam score 74.45"
FT                   /inference="nucleotide motif:RFAM:RF00174"
FT   gene            488780..488974
FT                   /locus_tag="HMPREF0675_3459"
FT   CDS_pept        488780..488974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3459"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3459"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00505"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB98"
FT                   /protein_id="ADE00505.1"
FT                   /translation="MNPGLLRSGDGDDVGETTGSDPGKGRPRVIRSPKTPMHGAVSFGS
FT                   RIKVLAPRRNCHALIEAIG"
FT   gene            488994..490013
FT                   /locus_tag="HMPREF0675_3460"
FT   CDS_pept        488994..490013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3460"
FT                   /product="iron chelate uptake ABC transporter, FeCT family,
FT                   permease protein"
FT                   /note="identified by match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3460"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99662"
FT                   /db_xref="GOA:D4HB99"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D4HB99"
FT                   /protein_id="ADD99662.1"
FT                   /translation="MAPLLLVLVVLIVVSAVISLAIGSEPLPLRGVLDTVGARVTGQPG
FT                   PDPTIDVIVWDLRAPRALLAVIVGAGLALAGSGMQTLVRNPLADPYLLGVSAGASVGAT
FT                   AVIALGMFTSWGTHRLTLGALVGALAAAALVYLISMAQGGMTPLRLVLSGVVLSSAFSA
FT                   LASFLVFRSPDPRAAQSVLFWMLGSVAGATWDSLWVAALVTVVIAVLMIAFSGWLDALA
FT                   AGTDVARSLGIPDTRVRKALFVGNSVLVGVLVAVSGGIGFVGLVIPHMARLLVGASHRS
FT                   MLPIAAAVGSLFLLWVDVGARVIAAPQEVPLGVVTGFIGAPIFLYLMGRSQYRFSSES"
FT   gene            490010..490801
FT                   /locus_tag="HMPREF0675_3461"
FT   CDS_pept        490010..490801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3461"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3461"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00742"
FT                   /db_xref="GOA:D4HBA0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBA0"
FT                   /protein_id="ADE00742.1"
FT                   /translation="MTCLDVRNVQCRIGDRVIVDDVSFTAEAGQLTAIVGVNGVGKSTL
FT                   LRSIAGVRKVNAGDVLLDGKSVNQYTPMQRARLMAFVGQEESPSPDLLLGEMVALGRTP
FT                   HRKPWQVGQRSERAIIRDALALVGLDHLIDRRCDHLSGGERRRAVIARGLAQGADLILL
FT                   DEPTNHLDVRHQLQLLETLRASGRTVVATIHDLSMAASHFDRVVVLADGGVLATGPAEE
FT                   ALSPSNVATAFHVIAHHVTTPEGSRELVCTAALPEPSRKEI"
FT   gene            490803..491873
FT                   /locus_tag="HMPREF0675_3462"
FT   CDS_pept        490803..491873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3462"
FT                   /product="periplasmic binding protein"
FT                   /note="identified by match to protein family HMM PF01497"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3462"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99031"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBA1"
FT                   /protein_id="ADD99031.1"
FT                   /translation="MSIPRLPIAVVACLAMALAGCSSGSTSKGDDAKSSSEVTLTNCGN
FT                   KVTYPKVAQRLYVNDGNIIAMALSAGAAKQIAAVSSLGDDKTILAAKYGSHVIDNLHEA
FT                   VKGYPTLESIIANKPDVVVAGWNYGFSEEGNLTPDKLHERGIDSYLLSESCRQRGSEKA
FT                   RGVMQPWDAVRTDLSNLAKLTGNEPTGKKAVKDLDDRLDALNKAPKAAKTPVVLLFDSA
FT                   KDTVLTSGNKGGPQAIINAAGGQNAAHDVNDTWVRISWEKVATLKPDAIAFVDYDAQPY
FT                   SEKVKILQSNPATKNLAAVQKKRFLNLPYAMWTSGPLNIDAAEHLRVSLEKWGLEPKSS
FT                   IKPQLTIPASVPGHEG"
FT   gene            complement(491963..493189)
FT                   /locus_tag="HMPREF0675_3463"
FT   CDS_pept        complement(491963..493189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3463"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3463"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00323"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBN6"
FT                   /protein_id="ADE00323.1"
FT                   /translation="MQLLQRNITAWVQELLDISPIVVIEGARQVGKSTLTGMIDNANTT
FT                   FTTMDDDLTRTFAHDDPAGFLSSAKEGRLVIDEIQRCPELILPLKAVVDNDRRPGRFVL
FT                   TGSANLLRLPGAQDSLAGRAMTARLHPFSQGELEGHKEDWVSWLLSPDRRKAQEADRSN
FT                   VITRLTVGGYPLVQSMSPRVRTAWLKDYANRLVQRDASDMAQTRIPILGQLLQLLAAAP
FT                   GAELVQDRLAQKLKVTRGTVVRYSDLLESLFLIHRLPAWSRNLTKRQIQRPKVFLTDTG
FT                   LNAALSNMDAAHLSSMQGADHLGPLLEQFVVCELLRQQGWSATPFKLFHYRDRQGAEVD
FT                   IIVETPTGIIAVEVKSAVAATARHFQHFKALRDRLGDEFLAGIVLTTGTGQKAGDRLES
FT                   LPISSLWSR"
FT   gene            complement(493282..493935)
FT                   /gene="cobH"
FT                   /locus_tag="HMPREF0675_3464"
FT   CDS_pept        complement(493282..493935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobH"
FT                   /locus_tag="HMPREF0675_3464"
FT                   /product="precorrin-8X methylmutase"
FT                   /EC_number="5.4.1.2"
FT                   /note="identified by match to protein family HMM PF02570"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3464"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99221"
FT                   /db_xref="GOA:D4HBN7"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBN7"
FT                   /protein_id="ADD99221.1"
FT                   /translation="MAHEYVNNGSDIYRESFRIIRSEANLDRFPTDVEGVVVRMIHAAA
FT                   DPAIADDIAFTPAVVTAARRALGDGAPILCDSSMTATGIIRSRLPRDNETICYIKDPRL
FT                   ADIAQAKDMTKTCAAVDLWTEEGKLDGAIVAIGNAPTALFRVLEVCEETGARPAAVVGI
FT                   PVGFVGAAESKQALVDSKLGLEYLTLLGRRGGSAIAVAAVNAIASTDELTNSHR"
FT   gene            494241..494924
FT                   /gene="cbiM"
FT                   /locus_tag="HMPREF0675_3465"
FT   CDS_pept        494241..494924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiM"
FT                   /locus_tag="HMPREF0675_3465"
FT                   /product="cobalamin biosynthesis protein CbiM"
FT                   /note="identified by match to protein family HMM PF01891;
FT                   match to protein family HMM TIGR00123"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3465"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99817"
FT                   /db_xref="GOA:D4HBN8"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="InterPro:IPR018024"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBN8"
FT                   /protein_id="ADD99817.1"
FT                   /translation="MHIAEGVLSPAQCAVWYAAAAPFVVHGGYRVVKEVKEHPENKLLL
FT                   ATAGAFTFVLSAIKLPSVTGSSSHPTGTGVGAALFKPPVMAFLGMIVLIFQALLLAHGG
FT                   ISTLGANTFSMAIAGPWAGYAFYKLTKKLRGPDALAIFLCMVFSDFITYVVTSFQLAFA
FT                   FPDATGGFWGAVGKFLGIFAITQVPLALIEGLVGILLFRFLAKVAAPQLKQLGVLDDNP
FT                   EVAHA"
FT   gene            494917..495351
FT                   /gene="cbiN"
FT                   /locus_tag="HMPREF0675_3466"
FT   CDS_pept        494917..495351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiN"
FT                   /locus_tag="HMPREF0675_3466"
FT                   /product="cobalt transport protein"
FT                   /note="identified by match to protein family HMM PF02553"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3466"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99625"
FT                   /db_xref="GOA:D4HBN9"
FT                   /db_xref="InterPro:IPR003705"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBN9"
FT                   /protein_id="ADD99625.1"
FT                   /translation="MPENTVAKAHRDSSLTSKSKWVTPVIIVLVVGLFIISMVLGAKKT
FT                   SGGEEGFGGTDDAAAEAAEKAGAKKWIKPIFEPNSSEVESGLFALQAALGAGIVGYALG
FT                   RMSGRTKGREEAERASDLNSVDDVPQAAVTSSEDTSTSKS"
FT   gene            495348..496193
FT                   /gene="cbiQ"
FT                   /locus_tag="HMPREF0675_3467"
FT   CDS_pept        495348..496193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiQ"
FT                   /locus_tag="HMPREF0675_3467"
FT                   /product="cobalt ABC transporter, permease protein CbiQ"
FT                   /note="identified by match to protein family HMM PF02361;
FT                   match to protein family HMM TIGR02454"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3467"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00417"
FT                   /db_xref="GOA:D4HBP0"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR012809"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBP0"
FT                   /protein_id="ADE00417.1"
FT                   /translation="MTITSLDDAAWDSPWRRRPVGEKVALSTALLLTALCTPSMEASRW
FT                   VRSVVGSGIWPGALLAGIVSVIVVLGPARIAGRVLWQAVVAPLVFLVIGGISVLVSLGS
FT                   TPVGTVWWHAGAFSIGPVSSAQTMSLIEHGVCGTLALMVLAVTTPMVDLLTWLRKFHIP
FT                   DPLLEIASLTYRLIFVLLDTVVTASEAQHARLGDTPAGRFGGFNRRMNNTAALLGSVGI
FT                   RAWARANRLNDGLVNRGFEAALATLPIKRTGSVRYKIIVVIVIAVLWVISWTTTGRIFR
FT                   "
FT   gene            496190..497026
FT                   /locus_tag="HMPREF0675_3468"
FT   CDS_pept        496190..497026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3468"
FT                   /product="cobalt ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR01166"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3468"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01063"
FT                   /db_xref="GOA:D4HBP1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005876"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBP1"
FT                   /protein_id="ADE01063.1"
FT                   /translation="MSAKVLLSTEHLYATHPGRPMVLTDVNVSFRAGVRVAILGANGSG
FT                   KTTLMRCLSGSLKPAKGHVKRGDIVVSYGRAQLREHRRAVQLVLQDPDDQLFSADVSQD
FT                   VSFGPMNMGLKVDEVRDRVSESLELLGASHLAERATYQLSYGERKRVAVAGAVAMRPDL
FT                   LLLDEPTAGLDPVGVTQMLEALDRLRDHGTTVAMATHDVDLALAWAQEALVVVDGQVHQ
FT                   GPIGELLADADTVGRAHLHLPWPLELARRLGVRDLPRTMDDVVAMLSDNPSPAPSN"
FT   gene            497079..497768
FT                   /locus_tag="HMPREF0675_3469"
FT   CDS_pept        497079..497768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3469"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99391"
FT                   /db_xref="GOA:D4HBP2"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBP2"
FT                   /protein_id="ADD99391.1"
FT                   /translation="MDPMNRSSSSAALLVGAVAVPIAVCAVLSALIDVFVAPAAALVLV
FT                   LVIVIVCLRGSWLVDALVIVVSAIGFDFFLTYPYRSMKIASRPDIEVTIVLFVVGAAIA
FT                   GISRWALTASDLAERRQGYVTYALDARSGDMSRDEVAQRLAGLVGAEAGAWVDGAPPSG
FT                   EAVIQDATAMRTDVGLEDPSRVGFPTDRFICFPAAGGYIRISAASRHVRPTAEQMRAAC
FT                   LLASQIS"
FT   gene            complement(497795..498391)
FT                   /gene="cbiT"
FT                   /locus_tag="HMPREF0675_3470"
FT   CDS_pept        complement(497795..498391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiT"
FT                   /locus_tag="HMPREF0675_3470"
FT                   /product="precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating), CbiT subunit"
FT                   /EC_number="2.1.1.132"
FT                   /note="identified by match to protein family HMM TIGR02469"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3470"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00031"
FT                   /db_xref="GOA:D4HBP3"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBP3"
FT                   /protein_id="ADE00031.1"
FT                   /translation="MTHDPDTSLLGRTPGLAEEHFAHDGLITKHAVRAVALAALRPMPG
FT                   QLLWDLGTGAGSIAVEWCRTDPTCRAIGLERKAERAANARTNASELTLPGQFDVIDADL
FT                   AKGLPEGLPDPDAVFIGGGATKALVNQCRPRLPIGGRLVVHGVTMEAEMLVETLHCDLG
FT                   GDLIRFGVETADVIGRLHGWKPARTVVAWTWQRTE"
FT   gene            498619..499233
FT                   /gene="cobO"
FT                   /locus_tag="HMPREF0675_3471"
FT   CDS_pept        498619..499233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobO"
FT                   /locus_tag="HMPREF0675_3471"
FT                   /product="cob(I)yrinic acid a,c-diamide
FT                   adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /note="identified by match to protein family HMM PF02572;
FT                   match to protein family HMM TIGR00708"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3471"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00841"
FT                   /db_xref="GOA:D4HBP4"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBP4"
FT                   /protein_id="ADE00841.1"
FT                   /translation="MPHARTSAEPDDGLSTRQRRLRPVLVVNTGEGKGKTTAAMGTALR
FT                   AWHQGWRVGVFQFVKSGRWHVGEEDALRALGQLHEEIGVGGPVTWEVMGTGWSWTRSFD
FT                   AAENPEAAAREGWRHVSDLLAHEALDFYLLDEFTYPMDWGWLDVDEVVETLVNRPGTQH
FT                   VVITGRRAPDALVEVADIVTEMTKIKHPFDVGQRGQAGIEW"
FT   gene            499233..501656
FT                   /gene="cobB"
FT                   /locus_tag="HMPREF0675_3472"
FT   CDS_pept        499233..501656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobB"
FT                   /locus_tag="HMPREF0675_3472"
FT                   /product="cobyrinic acid a,c-diamide synthase"
FT                   /EC_number="6.3.1.-"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM PF01656; match to protein
FT                   family HMM PF07685; match to protein family HMM TIGR00379"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3472"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00257"
FT                   /db_xref="GOA:D4HBP5"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBP5"
FT                   /protein_id="ADE00257.1"
FT                   /translation="MRLPRILIAAPASGGGKTTVATGLMAALRASGRTVAPFKVGPDYI
FT                   DPGYHSMASGRPGRNLDSVMCGDELMAPLLAHGFVTPDPADIAVIEGVMGLFDGQLGTG
FT                   RGSSAEIATTTRTPVVVVVDTAHASLTHAAVVAGLATFDPDVTVAGAILNRVASPRHGA
FT                   EVARGLAQLGIPVLGQIPRTESIFVPSRHLGLVPAGEWEDSATKVAGLGGLIAEYVDLD
FT                   AVMDMAATAPDLDVEPWDPAAALESAGWQGHPFGESPLVGMFAGRAFTFRYPETTEMLI
FT                   AAGFRVVDVDPLTDRRLPDGIQGLYLGGGFPQMHATDLETNSELADDVRSHAEAGMPIV
FT                   AECAGLLYLCRHLDGHEMAGVLPMDAAMAKRLTMGYRVATRDSISVVGHEFHRTTTTPL
FT                   ADLDPAWHITMPDGTDRAEGALGDPAGLGRPTIQASYLHLHWAGQPTQAAWFASEVTKF
FT                   HEGRGDQVVEPDLNHHGDRDIADGLVDLAVNVRVSEPPQWLRDAIISTEHDWARYPDAT
FT                   PGREALAAMHGVPTDMVLPTAGAAEAFPLVATLEPRHAIVVHPQFTEPEAALRAAGISV
FT                   GRHILNVSDGFALDPDLVPDDADLVVVGNPTNPTGRLHPATDLLALRRPGRVLVVDEAF
FT                   MDATDESQSLIGSDMDDLLVLRSLTKTYGLAGIRAGYVVGDSQLVAQLAAHQTPWSVST
FT                   PAIAAMIACTCEEARRFRTQLRDDIPAARADLVDKLKGLGLSVVDSEAPFVLVNTSSLS
FT                   GDSIRQPLAERGFAVRRGETFPGLGPTWIRLAVRDSNIHAELARAISDLTAHRN"
FT   gene            501666..502442
FT                   /gene="cobA"
FT                   /locus_tag="HMPREF0675_3473"
FT   CDS_pept        501666..502442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobA"
FT                   /locus_tag="HMPREF0675_3473"
FT                   /product="uroporphyrinogen-III C-methyltransferase"
FT                   /EC_number="2.1.1.107"
FT                   /note="identified by match to protein family HMM PF00590;
FT                   match to protein family HMM TIGR01469"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3473"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00330"
FT                   /db_xref="GOA:D4HBP6"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBP6"
FT                   /protein_id="ADE00330.1"
FT                   /translation="MIYSADLVPGTVTLVGGGPGDPGLLTVAGFEAVRQADVILYDRLA
FT                   PTAIMDENPQAERIPVGKVPRGPYVPQERTNELLIEHAKAGRKVVRLKGGDSFVFGRGG
FT                   EEWQACAAAGVPVRIIPGVTSCVAGPELMGVPLTHRHMVQGFTVVSGHVAPGDTRSELD
FT                   WAQIAKTGTTLVILMGVAHIGDIATRLMDGGLAGDTPVAIIADASLPTQRSLTTTLEKA
FT                   AEDMAEAEINPPAITVVGDVAGLDLDGTQAHVPSDH"
FT   gene            complement(502462..503214)
FT                   /locus_tag="HMPREF0675_3474"
FT   CDS_pept        complement(502462..503214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3474"
FT                   /product="precorrin-6x reductase CbiJ/CobK"
FT                   /EC_number="1.3.1.54"
FT                   /note="identified by match to protein family HMM PF02571"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3474"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99806"
FT                   /db_xref="GOA:D4HBP7"
FT                   /db_xref="InterPro:IPR003723"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBP7"
FT                   /protein_id="ADD99806.1"
FT                   /translation="MDVLILGGTTKARQLATRLIDEGVDLCSSLAGRTKSPRPVPGPTR
FT                   VGGFGGIDGLKEFLTDNEVKVMVDASHPFAAAMHGHAAQACRDLNLPLARLAPPSWRTQ
FT                   PEAATWHWVDDHDGATQVLADLPDVILLTVGRQPVSHYLRLGPRRVIVRCVDAPEEELP
FT                   AGWKVLRERGPFTLDREREIFSQGVATLVSKDSGGTGLDPKLRLAAETDVQVVMVSRGP
FT                   APGWGDELSTVDDAVQWTGNHIATVIEQ"
FT   gene            503441..505108
FT                   /gene="cobT"
FT                   /locus_tag="HMPREF0675_3475"
FT   CDS_pept        503441..505108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobT"
FT                   /locus_tag="HMPREF0675_3475"
FT                   /product="nicotinate-nucleotide--dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /EC_number="2.4.2.21"
FT                   /note="identified by match to protein family HMM PF02277;
FT                   match to protein family HMM PF02283; match to protein
FT                   family HMM TIGR03160"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3475"
FT                   /db_xref="EnsemblGenomes-Tr:ADD98996"
FT                   /db_xref="GOA:D4HBP8"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR003203"
FT                   /db_xref="InterPro:IPR017846"
FT                   /db_xref="InterPro:IPR023195"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBP8"
FT                   /protein_id="ADD98996.1"
FT                   /translation="MARLPESLSAESLLARTVRGIRGADAKALEAARARQQLLTKPEGS
FT                   LGLLEDLSIRLAGMYGQVPVTVPSHPVVGLFAGDHGVWAQGVSPDPQEITTQQMINMAA
FT                   GGAAISVLSRQMGAQLWITDVGARHEVDAPIRQRCVRRGTDDISQGPAMSLDEAVEALE
FT                   VGIETGVAAVEQGADILITGEMGIANTTPASALISVFTGLPPAEVTGRGAGSDDRRHQH
FT                   KIGVVARALQVNRPEAKHPIEALAKVGGFEHAAMAGFILAAASSRIPVLIDGVIACSAA
FT                   LTATAICPEARDFIITSHAGAEPGITASTSALGLPALLDLGMRLGEGSGAILTLPIVQA
FT                   SAHILNEMATFEDAEVIDIKVSGETEIPDTVQTSVPPCRMLVIGGARSGKSTFAESRLP
FT                   RDSRVTYVATSQRNPGDAEWEERIRLHQARRPATWQTVETTDIASVLLADDDSPVLVDC
FT                   LGVWITRILDEVGAWAAAPGDEAWQNDLRRHVNDLASAIRGTRRDVIFVSNEVGMGVVP
FT                   DTPAGRLFRDELGRLNAAVGEACDEVWMCVAGIPKRWA"
FT   gene            505099..505944
FT                   /gene="cobS"
FT                   /locus_tag="HMPREF0675_3476"
FT   CDS_pept        505099..505944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobS"
FT                   /locus_tag="HMPREF0675_3476"
FT                   /product="cobalamin-5-phosphate synthase"
FT                   /EC_number="2.7.8.26"
FT                   /note="identified by match to protein family HMM PF02654"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3476"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00783"
FT                   /db_xref="GOA:D4HBP9"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBP9"
FT                   /protein_id="ADE00783.1"
FT                   /translation="MGMTDEQHPDLGRLGPLRGVAEALSLFTILPGPYLNDIDRPLARR
FT                   VITAFPWLGLCLGVVAGGIVALVLGLGAGPWLAGVLALGWLAGATGGFHLDGVADTADG
FT                   LGSRAAPEKALMIMKKSDIGPMGVMSIVLVLLVDAAAVVSLAGTAGSGAWWRVAILVGL
FT                   GPALARAAILLATMTEVPCARPGGFGSLVAGVTTPRSAAINLTVLGCVCALAGLVAGGW
FT                   MWCLVTVSCAALTLLIARGWIHHLVRRLSGMTGDTFGSINEVTQMTFWVLTALTVAVVS
FT                   "
FT   gene            505941..506705
FT                   /locus_tag="HMPREF0675_3477"
FT   CDS_pept        505941..506705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3477"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00786"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBQ0"
FT                   /protein_id="ADE00786.1"
FT                   /translation="MIDDLGVKVSVARPVQRVVSLVPSITEAIAMTCPHVLVGCTDYCI
FT                   RPTHLEEIVGHEVVRVRGTKNPDRKAIIDLRPDLVVANQEENREHDVTLLREAGVAVWV
FT                   TRIDTVEEAISSLTRLFEEGFGVRCPQWLEEAGREWREPCRGEVLSAVTAVWRDPWICV
FT                   GKDTYISDVLRRVGIELVDLPGESRYPHVELTDIAAAHPDRVILPDEPYHFGPDDVSAF
FT                   PGLDVRLVDGQKLAWYGPSMVGARRYLASALR"
FT   gene            506762..506837
FT                   /locus_tag="HMPREF0675_3478"
FT   tRNA            506762..506837
FT                   /locus_tag="HMPREF0675_3478"
FT                   /product="tRNA-Thr"
FT   gene            complement(506927..508564)
FT                   /locus_tag="HMPREF0675_3479"
FT   CDS_pept        complement(506927..508564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3479"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00097"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBQ1"
FT                   /protein_id="ADE00097.1"
FT                   /translation="MKSHKLLTFAVAAIMATSGLSTMIPTQSALASGPSQGAQSQHVGP
FT                   MTCVPFSGRPGSSGQLPLGVIPPNWGTDGWQRMDSTSRSDLPSKIVMRDNTEGFNQRMD
FT                   FALRDGKVYGRFQSENQWRHIDTPSCLDGHISAISVNDAMLAAVDSNGWVYSLNNLLSS
FT                   PKDWGWFRAWGSPFWFGRGLKLDNHDQGWWALSLIDNQTDRTYRGVDGHDHPISLAMCT
FT                   EIMMVSKDGAHIYQHDPWLPNDYSFEASTPYNSRFRVHSMSASGSVALITNDHGDMFTR
FT                   LWDYDIAGTDPAQFRYTWQDQSNLPSPSTWLQGKVDPRYAAIKLPPAGWKHQPKIPGEI
FT                   TDRLTVVSTAPGSQNRELRVEGRREGHTGYWSKMIDAKAWKFVPTGQNLKGKPLDNPQR
FT                   DTSKVDLGSASGLNYSGNLQGKANINIKDFAYQSTTRTIELTVGEKKYPVKLHSIDGRL
FT                   KTTLSMLSHRERGLTSTPRYYDAAIEVPDSYLKDPDFSPFMKGYLKGEKVHELYLEVTK
FT                   DSFKVINDRHPEIALRNGRNVSTLDRAK"
FT   gene            complement(508615..508767)
FT                   /locus_tag="HMPREF0675_3480"
FT   CDS_pept        complement(508615..508767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3480"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3480"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00713"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBQ2"
FT                   /protein_id="ADE00713.1"
FT                   /translation="MPTQGGSVSSNSYPEHGNITDDPNVTHMVDNELNPTHAHTIQCTP
FT                   LPFSE"
FT   gene            complement(508736..508867)
FT                   /locus_tag="HMPREF0675_3481"
FT   CDS_pept        complement(508736..508867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3481"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3481"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99016"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBQ3"
FT                   /protein_id="ADD99016.1"
FT                   /translation="MLITKRPLMLAATLVPLIAAAMPAPSAVATSISIADPRRVSIQ"
FT   gene            complement(509221..510810)
FT                   /locus_tag="HMPREF0675_3482"
FT   CDS_pept        complement(509221..510810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3482"
FT                   /product="putative sugar-specific permease, SgaT/UlaA"
FT                   /note="identified by match to protein family HMM PF04215"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3482"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99767"
FT                   /db_xref="GOA:D4HBQ4"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBQ4"
FT                   /protein_id="ADD99767.1"
FT                   /translation="MNIALAIVQFLVNEILNVPAFLIGIITAVGLAAMRKSIGQIAGAA
FT                   IKATLGFLLIGAGAGLVVNSLGPLGKMIEGALGAQGVVPTNEAIAGIAQQQFGSQVAWI
FT                   MLAGFLISLVLARITPLHYVFLTGHHMLFMATLITIVMASTSMPTSIVIGLGSLLLGVL
FT                   MVSLPALAHPFTRKITGGEDIAIGHFGTSAYIAAAATGRLVDPHGKSQSTENIKVPEGL
FT                   RFLRDSMVATALSMVLMYVVVAIVFLARRGEKAAFQTFSKPATGTGNYIMASVTQGLEF
FT                   GIAVAVILFGVRTILGELIPAFQGIASKVVPGAIPALDCPIVFPYAQNAVLIGFMSSFI
FT                   GGLVGLTILATVLGPAWGLALILPGLVPHFFTGGAAGVYGNATGGRRGAVAGAFVNGLL
FT                   VTFLPAFLLKVLGPFSSANTTFGDADFGWFGILIGYGARTGTVSGSIILALIGATILGS
FT                   AILMQRRAGGWDPAPARGSSSDGVTAVVTAEEVSDDPDEATRTATASTISHRRIAPPVG
FT                   APTPPSRDELGL"
FT   gene            complement(510860..511624)
FT                   /locus_tag="HMPREF0675_3483"
FT   CDS_pept        complement(510860..511624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3483"
FT                   /product="phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system, EIIA 2"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift; identified by match to protein family HMM
FT                   PF00359"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3483"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99380"
FT                   /db_xref="GOA:D4HBQ5"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBQ5"
FT                   /protein_id="ADD99380.1"
FT                   /translation="MIDLTDLLPPAAIRLDAHVKDWREALQAVGHLLVATDIATPRYTQ
FT                   AMIDNLEKNGPYIVVAPGFALAHARPDSSVLRTGMSWIRLDEPVAFGHETNDPVTLVAG
FT                   LAATDASAHQNVLAALASALADPNRRNALDTATTPQEVVSILSNEAGHRSAEASTSQNL
FT                   LLTVCGNGLGTSLFLKNTTEQVLDAWAWTPYLSVEATDTISARGRCSEADAILTSGAIA
FT                   QTLGELSIPVEVIDDFTSVSQVDAALRRIYDV"
FT   gene            complement(511692..511847)
FT                   /locus_tag="HMPREF0675_3484"
FT   CDS_pept        complement(511692..511847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3484"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00986"
FT                   /db_xref="GOA:D4HBQ6"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR037005"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBQ6"
FT                   /protein_id="ADE00986.1"
FT                   /translation="MATLRDILKLNTSPAANEVQCGWGANHSIKAAQEAAHTMLNHRDH
FT                   WKQVVA"
FT   gene            complement(511924..512100)
FT                   /locus_tag="HMPREF0675_3485"
FT   CDS_pept        complement(511924..512100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3485"
FT                   /product="hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain
FT                   one or more premature stops and/or frameshifts"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3485"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99155"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBQ7"
FT                   /protein_id="ADD99155.1"
FT                   /translation="MHFTPTYSSQINQIERLIADITRGLLQRPDHHTVQSLERDFCKLG
FT                   QSMNRKLQALYLS"
FT   gene            512187..512345
FT                   /locus_tag="HMPREF0675_3486"
FT   CDS_pept        512187..512345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3486"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3486"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99669"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBQ8"
FT                   /protein_id="ADD99669.1"
FT                   /translation="MLGGGLVDLLEEFLRLFCSVVPVDRGDHRSVVNIQCGEQAHCLAV
FT                   WSIVSTS"
FT   gene            513189..513635
FT                   /locus_tag="HMPREF0675_3487"
FT   CDS_pept        513189..513635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3487"
FT                   /product="hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3487"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99987"
FT                   /db_xref="GOA:D4HBQ9"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBQ9"
FT                   /protein_id="ADD99987.1"
FT                   /translation="MVVSKKFDDLLGMLGAIVFFLVIVILVMALFIMIPALFALVFQEC
FT                   YLDSPWTWETVVLGGLVLFALGMGVSLLMGVLARVVAPLTHPVVNRVFKEILEFLVLWW
FT                   FYSTLMHPTSYAFWASIVVMIMTTVTEPILDRAIERQKHAPNQP"
FT   gene            complement(513786..514283)
FT                   /gene="luxS"
FT                   /locus_tag="HMPREF0675_3488"
FT   CDS_pept        complement(513786..514283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="luxS"
FT                   /locus_tag="HMPREF0675_3488"
FT                   /product="S-ribosylhomocysteinase LuxS"
FT                   /EC_number="4.4.1.21"
FT                   /note="identified by match to protein family HMM PF02664"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3488"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00514"
FT                   /db_xref="GOA:D4HBR0"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR037005"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBR0"
FT                   /protein_id="ADE00514.1"
FT                   /translation="MGFVSMREDGFMAHKMNVESFNLDHTKVAAPFVRVADVKHLPAGD
FT                   TLTKYDVRFCQPNKEHLDMPAVHSLEHSFAECVRNHSDAVIDFGPMGCQTGFYLIMIGE
FT                   PDVPGTCELVETTLRDILKLDATPAANEVQCGWGANHSIKAAQEAAHTMLNHRDEWEQV
FT                   MA"
FT   gene            complement(514306..515487)
FT                   /gene="manA"
FT                   /locus_tag="HMPREF0675_3489"
FT   CDS_pept        complement(514306..515487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manA"
FT                   /locus_tag="HMPREF0675_3489"
FT                   /product="mannose-6-phosphate isomerase, class I"
FT                   /EC_number="5.3.1.8"
FT                   /note="identified by match to protein family HMM PF01238;
FT                   match to protein family HMM TIGR00218"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3489"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01005"
FT                   /db_xref="GOA:D4HBR1"
FT                   /db_xref="InterPro:IPR001250"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016305"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBR1"
FT                   /protein_id="ADE01005.1"
FT                   /translation="MKRLTGTVRTYSWGSYDAIPDILGKEADGKPWAEYWLGAHETSPS
FT                   TLDGIPLTDYIHAHPDELGDRSRKVFGARLPFLLKILSAYHPLSLQAHPDAAMARAGFA
FT                   RENQDGIGVDDPHRTFVDDWPKPEILVALSDFEGLCGFRDPHETRQLFDELEVLTPTDP
FT                   VLGSLTERSGSAALAETFLNCLAGDDVRRQIVTEVVSGAVNHVGEDTPLGEFARTAVEL
FT                   DEYFPGDPSILAALMLNRVHLKPGQALSVPPGLMHSYLSGTGIEIMADSNNVVRGGLTN
FT                   KHIDIDSLIQIVSFQTQEPRIIAAEEVDPGMRVFPGIDDQFRLWQLDLDTTCPAMMPAS
FT                   ELARILLITDGYAVCSGSHGTDEIVRGQAVWIPAGERVQIDGDCDGFIAAAGL"
FT   gene            complement(515531..515815)
FT                   /locus_tag="HMPREF0675_3490"
FT   CDS_pept        complement(515531..515815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3490"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00526"
FT                   /db_xref="InterPro:IPR021678"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBR2"
FT                   /protein_id="ADE00526.1"
FT                   /translation="MSDSITPESAESAELCASDRAILDLEESWQAGSLSVDKETAIRDS
FT                   LGLSSPRYHLRLNELIDDEKAAQYAPSLVGRLQRVRSQQRRSRSAQLLR"
FT   gene            516149..517783
FT                   /gene="groL"
FT                   /locus_tag="HMPREF0675_3491"
FT   CDS_pept        516149..517783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groL"
FT                   /locus_tag="HMPREF0675_3491"
FT                   /product="chaperonin GroL"
FT                   /note="identified by match to protein family HMM PF00118;
FT                   match to protein family HMM TIGR02348"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3491"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00755"
FT                   /db_xref="GOA:D4HBR3"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBR3"
FT                   /protein_id="ADE00755.1"
FT                   /translation="MAKLIEFNIEARRGLEAGMNTLADAVKVTLGPKGRNVVLEKSWGA
FT                   PTITNDGVSIAKEIELDDPYEKIGAELVKEVAKKTDDVAGDGTTTATVLAQAMVREGLR
FT                   NVTAGANPMGLKKGIEAAVQAVSARLSDMAIDIETKDQIASTASISAADPTVGEIIAEA
FT                   MDKVGKEGVITVEESNTFGLELELTEGMRFDKGYISPYFVTDTERMEAVLEDPYILIVN
FT                   SKISSLKDLLPVLEKVMQSGKPLFVIAEDVEGEALAGLIVNKIRGTFKSVAVKAPGFGD
FT                   RRKAMLNDIAILTGGQVISEEVGLSLDAVTLDLLGRARQVVVTKDEATIVDGAGDSEQI
FT                   AGRVSQIRKEIENSDSDYDREKLQERLAKLAGGVAVIKVGAATEVELKERKHRIEDAVR
FT                   NAKAAVEEGIIPGGGVALLQASKAAEIEGLEGDELTGAQIVLAACTAPLKQIAINAGLE
FT                   GGVVAEKVAGLPAGQGLNAANDEYVDMVEAGIIDPAKVTRSALQNAASIAALFLTTEAV
FT                   IADKPEPVKAPAGGGDMDGMGGMGGMM"
FT   gene            complement(517918..518994)
FT                   /locus_tag="HMPREF0675_3492"
FT   CDS_pept        complement(517918..518994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3492"
FT                   /product="putative transaldolase"
FT                   /note="identified by match to protein family HMM PF00923"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3492"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01199"
FT                   /db_xref="GOA:D4HBR4"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBR4"
FT                   /protein_id="ADE01199.1"
FT                   /translation="MKINYTPGPLLDASRTTPTALWNDSADLDELRQSIAFGGVGATCN
FT                   PVIGYTTIKKHPDIWEDRIRAIAENNPTWGESQIGWQAIKDMSVEAAKLLEPIFVEHKG
FT                   RNGRLSIQTDPRLHRDAKALADQAEEFSNLAPNIIVKIPCTSVGIEAIEEATYRGVSVN
FT                   VTVSFTVPQAVKSAEAIERGLQRRVAEGKPIDEMGPVVTIMAGRLDDWLKIVAERDRLF
FT                   IDPGHLEWAGIAAIKRANQIFVERGFHSRVLCAAFRNVLQWSELIGGDLVVSPPFKWQK
FT                   RINDSDYHVVPRIDEPVAAEHLDALKKIPEFMRAYDPDGMTIKEFDTFGATRRTLRQFL
FT                   QADADLDTLVRDIITPAI"
FT   gene            complement(519096..519839)
FT                   /locus_tag="HMPREF0675_3493"
FT   CDS_pept        complement(519096..519839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3493"
FT                   /product="UbiC transcription regulator-associated domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07702"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3493"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99479"
FT                   /db_xref="GOA:D4HBR5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBR5"
FT                   /protein_id="ADD99479.1"
FT                   /translation="MENEPYIADITIDRSRPEPLHTQIAEPLAQLIESGELPPGTRIED
FT                   EMSMAARLHVSRPTARRAFETLTQRGLVIRRRGIGTQVTPTRVHRSMNLTSLYDDLQAS
FT                   GQRPRTSVLDWTVETAPPAVAAALGLPSNSEVAHFRRLRMSQDEPLAIMTNWVPVDLAP
FT                   SAEELRTTGFYDYLRSRDVVVAVGHQRFSARLALPDEARLLNEPPGAALLTMQRTACDE
FT                   SNRVIEFGQHVYRASIYAYENTVYA"
FT   gene            520054..521043
FT                   /locus_tag="HMPREF0675_3494"
FT   CDS_pept        520054..521043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3494"
FT                   /product="kinase, PfkB family"
FT                   /note="identified by match to protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3494"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99143"
FT                   /db_xref="GOA:D4HBR6"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR023314"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030830"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBR6"
FT                   /protein_id="ADD99143.1"
FT                   /translation="MVSSRRRDLDVLTMGRIGVDIYPLQYGVGLEDVTSFGKFLGGSPT
FT                   NVAVAAARLRHSAAVVTAVGDDPFGRFCRREMARLGVYDNYVLVNSELPTPVTFCEIFP
FT                   PDDFPLYFYRRPTAPDLRITPDDVPEDAVRNAQILWLSVTGLCQQPSYDAHCRALEVRG
FT                   KAEHTVLDLDYRSMFWQSAAKAHEAVSAVLPHVTVAIGNREECEMAVGESDPDRAAHAL
FT                   LDAGVQLAVVKQGPKGTLAMTREERVAVAPTPIDVTNGLGAGDSFGGSLCHGLLEGWSL
FT                   AETIQAASAAGALVATRLECSTAMPSEPELFAMMAKHPDIAIKEEHLS"
FT   gene            521040..521927
FT                   /locus_tag="HMPREF0675_3495"
FT   CDS_pept        521040..521927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3495"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /note="identified by match to protein family HMM PF01791"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3495"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00500"
FT                   /db_xref="GOA:D4HBR7"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBR7"
FT                   /protein_id="ADE00500.1"
FT                   /translation="MTRTPLIDKLLDRRLADPVRFADRVRQRPRATWSPTEPLMVVAAD
FT                   HPARGALAAGGRADAMADREHLLERCVTALGRPGVNGFLGTADMVADLANLDALGGKVV
FT                   FGSMNRGGFAGASFELDDRMTGYDVQGILDEDLTGGKMLLRFDLSDPGTATTAQACAEA
FT                   VTTLARARRIAMVEPFISYRADDGKVVNDLSADAVVKSVVMASGLGADTSWTWLKLPAV
FT                   DDMERVVRATSLPILLLGGEVSTDPEETRRRWATALAARHVRGLVLGRSVLYPPDSDVA
FT                   TAIDNAVQLLGVQA"
FT   gene            521924..522796
FT                   /locus_tag="HMPREF0675_3496"
FT   CDS_pept        521924..522796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3496"
FT                   /product="myo-inositol catabolism protein IolB"
FT                   /note="identified by match to protein family HMM PF06845"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3496"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00159"
FT                   /db_xref="GOA:D4HBR8"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR021120"
FT                   /db_xref="InterPro:IPR024203"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBR8"
FT                   /protein_id="ADE00159.1"
FT                   /translation="MTELVLRSGSTASGCRDVVVDPKCAGWTYSGLTIASLTKDETLEL
FT                   TTDDHEYLVLPLEGSFTVQGDGFRADLAGRSTIWGEVTDYAFVPRHRTITVTAVSGGRV
FT                   ALPNALASEDLEPRYCPSTEVRVELRGAGNCSRQVVNYAVANPVHTSRLLACEVLTPGG
FT                   NWSSYPPHKHDEESQVEHELEEIYYFEIRGDEHGPGMAFHGTYGTPDRPIHVAEMISNG
FT                   DVALVPHGWHGPCAAAPGYDLYYLNVMAGPGAAEWKSVDDPHYGWIRQTWQDQDIDPRL
FT                   PLAVDDSKE"
FT   gene            522799..524697
FT                   /locus_tag="HMPREF0675_3497"
FT   CDS_pept        522799..524697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3497"
FT                   /product="thiamine pyrophosphate enzyme, central domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00205;
FT                   match to protein family HMM PF02775; match to protein
FT                   family HMM PF02776"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3497"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00671"
FT                   /db_xref="GOA:D4HBR9"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR030817"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBR9"
FT                   /protein_id="ADE00671.1"
FT                   /translation="MTEQTVRLSIGQAIVRYLTHQYTERDGVERRFIRGVFGIFGHGNA
FT                   TGLGQALLQNEAAPDDEEGRLEYWMGRNEQGMVHACSAYARATNRLQALAATASIGPGS
FT                   LNMVTGAALATTNRVPVLLFPSDIFANRAPDPVLQQLEDPTNPDVSCNDAFRPVSKFWD
FT                   RVNRPEQLMVSLPRAMRVLTDPVDTGAAVICLPEDVQTEVYDWPVSFFAKKVWYIDRRL
FT                   PDRAAVVRAAQAIRAARCPLIISGGGTIYSEASQELRDFASATGIPVADTQAGKGAINW
FT                   DHPCAVGGVGATGSDSANALAAQADLIIGIGTRYSDFTTGSQTAFKNPDVTFVNVNVGA
FT                   FDAAKQGAQMLVADAREALTALSKELDGYRVPQEWSDLASAKAKAWAEVTDRCYHLGHG
FT                   PLPAQTEVFGALNELMGDDDVVINAAGSMPGDLQCLWRASTPVQYHVEYAFSCMGYEIP
FT                   ASLGVKMALPDSEVVAIVGDGTYQMLPMELATIVQEGAKVILVLLQNYGFASIGALSES
FT                   HGSQRFGTKYRQHDDGQGHVVGDDALLPLDIAANARSWGIDVLEVRTIKEFREAYRKAE
FT                   ASDHATMIHIETDLYGPNPPASGWWDVPVTSQSRLKSTQKAYAEYTGQVAAQRRFF"
FT   gene            complement(524842..525078)
FT                   /locus_tag="HMPREF0675_3498"
FT   CDS_pept        complement(524842..525078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3498"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3498"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99474"
FT                   /db_xref="GOA:D4HBS0"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBS0"
FT                   /protein_id="ADD99474.1"
FT                   /translation="MSLSYVDSGIILRTPAGMGSVMHSQAVTLLRFVPAALVLFALAIA
FT                   GVINQAPILTIVSGLMTVALTITLSMVHFFDNA"
FT   gene            525445..526938
FT                   /gene="mmsA"
FT                   /locus_tag="HMPREF0675_3499"
FT   CDS_pept        525445..526938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmsA"
FT                   /locus_tag="HMPREF0675_3499"
FT                   /product="methylmalonate-semialdehyde dehydrogenase
FT                   (acylating)"
FT                   /EC_number="1.2.1.27"
FT                   /note="identified by match to protein family HMM PF00171;
FT                   match to protein family HMM TIGR01722"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3499"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99980"
FT                   /db_xref="GOA:D4HBS1"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBS1"
FT                   /protein_id="ADD99980.1"
FT                   /translation="MKTIRQWVGGEYYEGSPLGVIPVENPATGEVTAELLQASKEDLDH
FT                   TVEVARDAQKEWANYSLSKRVAIMFKMRQLVLDHQDEMARLIVEEHGKNYSDAIGEIQR
FT                   GRETFDFATAINVALKGEYSHDVSTGVDIHTTRQPVGVVAGICPFNFPAMVPMWMHPLA
FT                   VATGNAFILKPASPTPSASLLTAELYKEAGLPDGVFNVLSGDRRSVQDILVHPGIDAIS
FT                   FVGSTPVAHIVQDTGVSHGKRVQALGGANNHAIVMPDSDLDFAAQHISASAFGAAGERC
FT                   MALPVVVAVGGCGPQVAEKVKKHAEAIKVGEGMGEGVEMGPVISAKAKDRIVGLIDDAE
FT                   KRGSKVVLDGRGLTVPGYENGHFLGPTVLDDVPLDAPVYTEEVFGPVLAIVHADTYEEA
FT                   LKIVNAQPFGNGSAIFTNDGGVARRFTLDVEAGMVGVNVPIPTPVAFYSFGGWKESLLG
FT                   DTHIHGPEGVTFYTRAKAITERWPTEKTYAATMSFQREE"
FT   gene            527034..528014
FT                   /locus_tag="HMPREF0675_3500"
FT   CDS_pept        527034..528014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3500"
FT                   /product="sugar-binding domain protein"
FT                   /note="identified by match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3500"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99244"
FT                   /db_xref="GOA:D4HBS2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBS2"
FT                   /protein_id="ADD99244.1"
FT                   /translation="MRNPTQTDVARMAGVSRGLVSLALAGRPGVSSATRRRLQDAADRL
FT                   GYSRDLSAASLATGSSPVLGIILPNLRNPFFETVVSYLSVAAERVGWLPLVGTASDDTR
FT                   HEEAVLRRFREFRAVGVIVVSPVGDLESLAALSGPTSPLVLLGAENQSGVVPCVHVDED
FT                   TAAQLIVEHLGSQGVRRVVSLAEECGSGMVWVLRRRAALIAACQSAGIECVPAIVERGE
FT                   AVAPILARFIDDAQTDVGVVAHNDVVALDALSVLRSVGLESRRWIPVVGFDDTHLASRP
FT                   EFDLTSVNQQPGALVDVALDMVAGAVRGLDHTVEPRLVVRSSSKR"
FT   gene            528151..529365
FT                   /locus_tag="HMPREF0675_3501"
FT   CDS_pept        528151..529365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3501"
FT                   /product="oxidoreductase, NAD-binding domain protein"
FT                   /note="identified by match to protein family HMM PF01408;
FT                   match to protein family HMM PF02894"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3501"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99907"
FT                   /db_xref="GOA:D4HBS3"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBS3"
FT                   /protein_id="ADD99907.1"
FT                   /translation="MSALSQPATSQRHPLSVAVIGAGMAGRTHANAWRQVGTVFGSEGI
FT                   PPIRLAAICDSYEPFARSARDSYGYERAVTDWHDIVDADDIDVVSVVVSNALHRQVAED
FT                   LVRAGKHVLCEKPLSDSLENARAMAELEANSQVVTGVGFSYRRHPSVAAIAELVRQGRL
FT                   GDVTTFSGRYWCGYGVDPTVPMAWRYRGPQGSGALGDLGSHIIDVAEFVCGPIRSVRGG
FT                   AFATIIDKRPPALEGVAGGRGMTVSAQAIETVENDDIAVFNMTFESGAIGTIVVSRVAF
FT                   GLPNSMEFDVFGTQGRASFDLARSGEIIVDDTSTPEGFSGPRQVLSNPTFPYYKGGSSM
FT                   DFAGVGSTQIEQFTYQARAFLDQVLGLDEGFPLVLSFAHGYRTMCIADAVARSAAAGGK
FT                   TIDLT"
FT   gene            529410..530408
FT                   /locus_tag="HMPREF0675_3502"
FT   CDS_pept        529410..530408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3502"
FT                   /product="AP endonuclease, family 2"
FT                   /note="identified by match to protein family HMM PF01261"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3502"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00138"
FT                   /db_xref="GOA:D4HBS4"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBS4"
FT                   /protein_id="ADE00138.1"
FT                   /translation="MSMNIGAYTACLHNYDLAEALDILKTNGLTGAEVNVGGFIPSPHC
FT                   PVDTLMTSQTAREDYMGIFEDKEMRLAGLNTSGNPLSPLPDVGPRHAYDLRRAIELAGK
FT                   LGITDLVCMSGTPGSDRHAKYPSWVVNPWNGVELEVLEYQKSVVDPFWREMDLRAQNAG
FT                   VKLALELHPHNLVFTPVNFLEFAERIDARNIGVNMDPSHLMWQGMDIIAAIELLGDHIF
FT                   HVHAKDTVILPGIATRGVLDSSFGPVPDDPDVRVQTGMEHYCSSWPSDPAWRFVAIGNG
FT                   HDVTWWTNFLRAIRDVNPGMNINIEHEDQSLAQLDGIAVSARNLLAAEQAV"
FT   gene            530480..531046
FT                   /gene="iolH"
FT                   /locus_tag="HMPREF0675_3503"
FT   CDS_pept        530480..531046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iolH"
FT                   /locus_tag="HMPREF0675_3503"
FT                   /product="protein IolH"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift; identified by match to protein family HMM
FT                   PF01261"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3503"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99598"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBS5"
FT                   /protein_id="ADD99598.1"
FT                   /translation="MVDIALDPNMYYCSMSTADTLRKAADLGFRYVELSPNEEFHFWHR
FT                   YPKADDAFVTEMRKAVRETGVTIRTLNPVFNWSSPDEAERRNQMRNWRRLLELADQLDV
FT                   HEITSEFSGDPNSPRECEVAWYRSIEELAPSFERYGIRLNMEAHPYDFIELHDDACRTV
FT                   RGTNLDWIGLRVLLPAHFPSVERGR"
FT   gene            531057..531347
FT                   /locus_tag="HMPREF0675_3504"
FT   CDS_pept        531057..531347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3504"
FT                   /product="hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3504"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99251"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBS6"
FT                   /protein_id="ADD99251.1"
FT                   /translation="MIHGCADRLREVHVADAFNHAAHDGNRYIINPPGADVRVHQHNEI
FT                   GLGDVPFDDVFEALRDVGFDGVMSVCVFGWHERADEINKSMLARLNREFVA"
FT   gene            531557..532768
FT                   /locus_tag="HMPREF0675_3505"
FT   CDS_pept        531557..532768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3505"
FT                   /product="oxidoreductase, NAD-binding domain protein"
FT                   /note="identified by match to protein family HMM PF01408;
FT                   match to protein family HMM PF02894"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3505"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01119"
FT                   /db_xref="GOA:D4HBS7"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBS7"
FT                   /protein_id="ADE01119.1"
FT                   /translation="MGVVMEKRRTIGVGVVSLGWMGRLHTCAYKALAEKFPEIDVNIRL
FT                   VSCCDVVAENRRQAVDRLGFCTAVEDYHDLIGNPEVDVVSICAPNFLHRDIALAAAEVG
FT                   KPFWIEKPMGTNAKQSRQIAEAAEVKGLVTSVGFNYRHTPSIEFARQLIADGRLGTVTN
FT                   ARAWLIADYASDPHGPLTWRYDRERAGAGVILDLMGHGEDLVQYLLKGRFTEVSAVSET
FT                   FIRQRPKPLKEGIGHTGWVVSDELGPVGNEDYCAVIARMENGVMCTLESSRVSVGPRAE
FT                   YIVEIYGTDGSIRWNFEDLNHLQVCLGRNNRALQGYVNCMAGPDFPEFMRFQPGAGTSM
FT                   GFDDMKVVEAAKFVRGVLDGQQYGPSVADGWASAEVNDAIVASCGDHAWHPVKPVSGRT
FT                   TFDK"
FT   gene            532917..534524
FT                   /locus_tag="HMPREF0675_3506"
FT   CDS_pept        532917..534524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3506"
FT                   /product="MFS transporter, SP family"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690; match to protein
FT                   family HMM TIGR00879"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3506"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01070"
FT                   /db_xref="GOA:D4HBS8"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBS8"
FT                   /protein_id="ADE01070.1"
FT                   /translation="MVDETPPSGKHRGIGALAAVATLGSLLFGYDTGVISGALPYLYMP
FT                   HLPGGLALTPMQEGAIGGTLLIGAAIGAVTGGIMSDRWGRRHNITILAVIFLLGALGTT
FT                   FSPNVFVMYVFRFVLGFAVGAASATVPVYLAENAPKRIRGSIVAIDQLMIVTGQLLAFS
FT                   MNAIINAAHGGPQLIIKANNNPDSLGITKGTYSWDQILALQASKGGPLEGDQYRAFVEN
FT                   LVIQSGNGAAWRWMLVLCSIPAIALWIGIRLMPESARWYLAKGRVADAVGALKRVRDPQ
FT                   KDGPLDAEVEEMLVTQQRELENKYQGNAFAHVWRTPWLRKLMLVGIFLAIVNQTTGVNT
FT                   VMYYAPKVLEYAGMTTSASITAQVANGVMSVIGSVGGLWLILKFSRRSLLIFDVSAVGI
FT                   TLLVIAGTFQFTIAPHIADKTTPPTWAPYLILGLMAVFMLIVQSTNGTVVWTMLGEMFP
FT                   ANVRGIMNGTAIFFMWVINAVITFTFPSMMASLGGGLTYTIYGMMNLVIAVVLFKIMPE
FT                   TRNKSLEQIETYMEERYS"
FT   gene            534549..534665
FT                   /locus_tag="HMPREF0675_3507"
FT   CDS_pept        534549..534665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3507"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3507"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00414"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBS9"
FT                   /protein_id="ADE00414.1"
FT                   /translation="MWLWPYTPHPRTAVLRKFGEPFFEMSRLNGTVYDGCAL"
FT   gene            534698..534853
FT                   /locus_tag="HMPREF0675_3508"
FT   CDS_pept        534698..534853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3508"
FT                   /product="hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3508"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99799"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBT0"
FT                   /protein_id="ADD99799.1"
FT                   /translation="MTAYRAVRRGADLRYGESEAVVATGAGSNILHFARAMGSDPIIAI
FT                   DVKDGR"
FT   gene            534887..535015
FT                   /locus_tag="HMPREF0675_3509"
FT   CDS_pept        534887..535015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3509"
FT                   /product="hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3509"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99309"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBT1"
FT                   /protein_id="ADD99309.1"
FT                   /translation="MQDARQKVFEITDSRGVEIAFEALGIPVTWMSFADGVGTWCQ"
FT   gene            complement(535134..535997)
FT                   /locus_tag="HMPREF0675_3510"
FT   CDS_pept        complement(535134..535997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3510"
FT                   /product="AP endonuclease, family 2"
FT                   /note="identified by match to protein family HMM PF01261"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3510"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99905"
FT                   /db_xref="GOA:D4HBT2"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBT2"
FT                   /protein_id="ADD99905.1"
FT                   /translation="MKIAGAPISWGVCEVPNWGYQMTPERVLTEMKQIGLTATEFGPQG
FT                   WLPIEAEARATEVKKYGLKPVGAFFLSVMHDPDFDPIPMVNKELDAFEAAEGDYLILAT
FT                   DSGRDGYDDRPVLDEAGWKTLFTNLDQIREVCASRNVTACLHPHWGTMVQNRDEVIRVL
FT                   ENSSIGLCLDTGHLACGGTDVVELVRKYANRVDIVHAKDVHKEMADKLLPGEITWSEGI
FT                   RAGMFAPIGDGDIDFAAIVRLLDEAGFDGYYVLEQDIMIDEEPPADDGPIINAKKSYEA
FT                   LASLGR"
FT   gene            536195..537181
FT                   /gene="idhA"
FT                   /locus_tag="HMPREF0675_3511"
FT   CDS_pept        536195..537181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="idhA"
FT                   /locus_tag="HMPREF0675_3511"
FT                   /product="inositol 2-dehydrogenase"
FT                   /EC_number="1.1.1.18"
FT                   /note="identified by match to protein family HMM PF01113;
FT                   match to protein family HMM PF01408; match to protein
FT                   family HMM PF02894"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3511"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00578"
FT                   /db_xref="GOA:D4HBT3"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR030827"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBT3"
FT                   /protein_id="ADE00578.1"
FT                   /translation="MIRIAIIGAGRIGHVHARAIQGRNDVTLALVCDPFEQNARALAGE
FT                   YDVRYCLDPDEVFDDSTIDAVVIGSPTQFHVDHILKAVNGGKRVMCEKPIALDVESAKR
FT                   CINELGDRADQVMMGFNRRFDPTFSALKSRLDDGEIGSLQQLTVISRDPAAPSASYIAG
FT                   SGGIFKDMTIHDFDMVRHFLGDIAEVNAVGTNVSPEIAEQGDFDQVIVTLKSRDGKLAT
FT                   IINSRTCAFGYDQRLEAFGADGMLSADNLTDAAVRMATSTQTDAKTAIMDFFLERYEDA
FT                   YRIELETFLDSIAIGGAVSPSVRDGYEALVLADAATRSAQEHRVVAL"
FT   gene            537387..538196
FT                   /locus_tag="HMPREF0675_3512"
FT   CDS_pept        537387..538196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3512"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /note="identified by match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3512"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00597"
FT                   /db_xref="GOA:D4HBT4"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBT4"
FT                   /protein_id="ADE00597.1"
FT                   /translation="MVILGVGQAGFDLVLTALVGGHPDAQTSTILLLASFAGVWLVLWA
FT                   WMRFVEQRPMSCLGFRGPGSDVWIGVAIAIAILAIDVVVMTVSGQVTMSWARPSIMAAV
FT                   FIVAAILLFLVQGCAEEAVLRGYLMQSVAAKWGIPAGLAIQAVVFAALHGANPGTTWVA
FT                   LVNVTGFGLMQGLLVVWRGNLLAAMGFHTVWNWLQGMVLGFDVSGLELHHSVMTTARTT
FT                   GSHSWLTGGTFGAEGSVINTIVLAILITCLLVTMRHDWRDNEAYGIA"
FT   gene            538183..538869
FT                   /locus_tag="HMPREF0675_3513"
FT   CDS_pept        538183..538869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3513"
FT                   /product="CutC family protein"
FT                   /note="identified by match to protein family HMM PF03932"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3513"
FT                   /db_xref="EnsemblGenomes-Tr:ADD98916"
FT                   /db_xref="GOA:D4HBT5"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBT5"
FT                   /protein_id="ADD98916.1"
FT                   /translation="MALLEVICLHEHDAKRAAAGGADRIELVGTMDDGGLAPSPELLAR
FT                   TLSAVHIPVRPMLRLDGGFRADPRRRDEILRLASAYRDLGADGPVLGFLDEATGVDVET
FT                   VIELTEGCQRWTFHRAIDNCLEPDKAWAQLLGLHGLDQVLTAGSPRGVEHGLDDLIARA
FT                   SADLRVADLIMAGGGLRAEHVPWLYRAGVRAFHIGSPARPQGSWKAWVDADLVRSWRDL
FT                   LDRLAG"
FT   gene            complement(538883..539842)
FT                   /locus_tag="HMPREF0675_3514"
FT   CDS_pept        complement(538883..539842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3514"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3514"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99243"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBT6"
FT                   /protein_id="ADD99243.1"
FT                   /translation="MLVATGAAIGVPVVRATNRPQKKAPRKPVPTTVTSPAAPGPYVPF
FT                   PYQDELSTYLNTRDGEQSVAMRVHGQREIQVFNHGATTYITASIIKLAIMETVMIQAIG
FT                   EKRQLTEGEKNLLVPMIENSSNDAATALWKKVGKADGVRTAMRRMGATHTTFDPEGRWG
FT                   LTSTTAADQVALADHIFCPNTIIPESMRAYARELMSNVEDDQNWGMTAGMKSPFVKNGW
FT                   LSLDDGWHVNSVASTGTAGYTVVGLTHSATASMDDLVETIEGMARIIARHQPRSVTTPS
FT                   SSTAPTQTTAPKPQGVEDDHGHVSFRAPGTRDIWIQAF"
FT   gene            complement(539931..541592)
FT                   /locus_tag="HMPREF0675_3515"
FT   CDS_pept        complement(539931..541592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3515"
FT                   /product="helicase C-terminal domain protein"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF04851"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3515"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99912"
FT                   /db_xref="GOA:D4HBT7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032438"
FT                   /db_xref="InterPro:IPR032830"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBT7"
FT                   /protein_id="ADD99912.1"
FT                   /translation="MMTSVPGPLIVQSDHTLLLEVDHPQADECRHAIAPFAELERAPEH
FT                   IHTYRLTPLGLWNAMAAGHDAEQVVDILMRYSRYPVASGLLIDVTETMSRYGRLRIEKH
FT                   PTHGLVLVSTERAILTEVLRSKSVRGLVGNQIDDETAVVHPSQRGTLKQALLKLGWPAE
FT                   DLAGYVDGEHHDIDLDEDGWSLRPYQKVAAQSFWDGGSGVVVLPCGAGKTVVGATAMSL
FT                   ARCTTLILVTNTVSARQWKEELVRRTSLAPDDIGEYSGSRKQVRPVTIATYQVITTKRH
FT                   GVHPHLELFEARDWGLVIYDEVHLLPAPVFRMTADLQARRRLGLTATLVREDGHEDDVF
FT                   TLIGPKRYDAPWKEIEAQGWIAPADCVEVRVSLSESDRMACAMAEPDVRYRMAATLPIK
FT                   NKVVRDLVERHRGQPTLVIGQYVDQLEELAAELKCPIITGSTTPTRRQEIYQDFREGQI
FT                   DLLVVSKVANFSIDLPSAEVAIQVSGAFGSRQEEAQRLGRLLRPKEGLVARFYAVVSRD
FT                   TVDTDFASHRQRFLAEQGYSYRIIDADDLDALDRTA"
FT   gene            542014..542169
FT                   /locus_tag="HMPREF0675_3516"
FT   CDS_pept        542014..542169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3516"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3516"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00259"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBT8"
FT                   /protein_id="ADE00259.1"
FT                   /translation="MSAHAYWEYIQFQGRPVTVFTTVTGAASSGSVATIVRVDLASHDI
FT                   GWVHRR"
FT   gene            complement(542221..544350)
FT                   /locus_tag="HMPREF0675_3517"
FT   CDS_pept        complement(542221..544350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3517"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3517"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00948"
FT                   /db_xref="InterPro:IPR032830"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBT9"
FT                   /protein_id="ADE00948.1"
FT                   /translation="MSPSEEPTTLASTIRNLDAQSLSRLLTLRPDLANPTPRDLTEVSS
FT                   RASTHASIIAAISSLDRWRLSLLTALAALGDLRFTELAEALCQGWPIKPEAIQADVADG
FT                   ISDLLNMALVLEDSGQLHVIQIVTAHLSGYPAGLAPASVLPMNPNEVAEKLAAAGSKAR
FT                   SVLERLVWSPTGHVPNARRAVTPATATTPVETALAHRLLRPLSDDTVILPREVSLMLRG
FT                   NRLFAEQPSPTPPPWSEPHQTNLVNRAGLGTALEAVSAMSALLEAMERHNCALLASGGI
FT                   AKRDARIVLSRVAPGDDGWVYLALAAAGGLIGADGRSWLPTPLADRWRTDSLWGQWVSL
FT                   REAWRHIPQLPGNLGNALDASAPATAQAWRRLIHRELHSAEPGTPIETKVIANRIRWRQ
FT                   PGTTVDDSLVEAVLDECRVLGMVALDARTDLVDARTCADMPERTDEVILQSDLTAVAPG
FT                   PLTPDTAADLALLADRESTGIAGVRRFNRSSLRRALDAGWTGERVRQWWAEHSLGDVPQ
FT                   SLLVLLNDVVRDHGRVSVAAAGALLEVDDPATVEAILRSSLTTDVGLRRVGPQVLVAQA
FT                   EPDQVLAGLRQLGMSPVARDAHGDVFSAPPPPRAKVDVPASSAPQADPEELAASLLDKR
FT                   GRGFSDRRQLIAQLHQAQQDGTWMYIERVVDDGTSVRQTVRIMAATAGAVRCVIRGGGG
FT                   VTIVPVSRITSCQPV"
FT   gene            complement(544347..545102)
FT                   /locus_tag="HMPREF0675_3518"
FT   CDS_pept        complement(544347..545102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3518"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01232"
FT                   /db_xref="GOA:D4HBU0"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBU0"
FT                   /protein_id="ADE01232.1"
FT                   /translation="MARSITAPVDVVDPRPAPRAFQAPRADPLETPTQPVNPAAGKPCS
FT                   APHHYQGGDHRPLTELIPRRRSSRQPLEPFSTQAGLTGPRIEHHDPHEPIRTSRLTSGY
FT                   STWSAPTEAPVSTTPPPRIKSVRMPSRLDPRTPSKAGSRSFLDLCQGLGWLWIVVLVLG
FT                   CAWSPLSIPALFITWWLAWRHPFAAGRLTKALTAVTVAVIIGGAIESPVRTVLAQFAWM
FT                   SRLGCVIMLGLGFILIDRQLTPDDPGSSR"
FT   gene            545276..546061
FT                   /gene="nagB"
FT                   /locus_tag="HMPREF0675_3519"
FT   CDS_pept        545276..546061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagB"
FT                   /locus_tag="HMPREF0675_3519"
FT                   /product="glucosamine-6-phosphate deaminase"
FT                   /EC_number="3.5.99.6"
FT                   /note="identified by match to protein family HMM PF01182;
FT                   match to protein family HMM TIGR00502"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3519"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00624"
FT                   /db_xref="GOA:D4HBU1"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBU1"
FT                   /protein_id="ADE00624.1"
FT                   /translation="MEVIICSDEQAVGRIAADRIAKVLGRAKAPVLGVATGSTPLTTYS
FT                   SLAALAAEGKADFTDLRAFALDEYIGLPADDERSYAATIRHTVTEQLGLDPANVHTPDG
FT                   MADDLDAACAAYETAIQEADGVDVQILGIGANGHIGFNEPTSSLSSRTRVKTLAERTKA
FT                   DNARFFEEGEKVPSHCVTQGLGTIMDARNVVLLAIGANKADALAGAVEGPVSAMCPASV
FT                   LQFHPHVLMIADDAAASKLTMAEYFRWTDSQRGDLSGAM"
FT   gene            546208..546591
FT                   /locus_tag="HMPREF0675_3520"
FT   CDS_pept        546208..546591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3520"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="identified by match to protein family HMM PF00313"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3520"
FT                   /db_xref="EnsemblGenomes-Tr:ADD98977"
FT                   /db_xref="GOA:D4HBU2"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBU2"
FT                   /protein_id="ADD98977.1"
FT                   /translation="MPTGKVRFYDATKGFGFLTKDGGGDVYVNASALPAGVNTLKPGQK
FT                   VDFGIVEGRRGEQALSLQIIETPASLSKASRKKPQDMAVICEDLIKMLDKMGNGYRHGR
FT                   HSDSRTAGAVAKMLRAVADELEL"
FT   gene            546591..547391
FT                   /locus_tag="HMPREF0675_3521"
FT   CDS_pept        546591..547391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3521"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00867"
FT                   /db_xref="InterPro:IPR021391"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBU3"
FT                   /protein_id="ADE00867.1"
FT                   /translation="MTQVTSKPRTATRTIKADATIAKAVDQAREAAEYRAGDFGVGEHV
FT                   GTIAEGERVLTHLFECPHPGYRGWRWAVTMSRALRGRNVTVNEVVLVPGEDSLLAPPWV
FT                   PWRDRVRAGDIAAGALMPTADNDPRLEPGYTGGELAADEDPAEWAATRAVASELGLGRE
FT                   RLLSREGRDSTAERWLAGEGGPDNATSHHAPASCVTCGYFVRLQHSLGRVFGVCSNEYS
FT                   PSDGSVVHVDHGCGGHSDVVEKRRGIELPEPVFDTISVDESLFD"
FT   gene            complement(547429..547701)
FT                   /locus_tag="HMPREF0675_3522"
FT   CDS_pept        complement(547429..547701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3522"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00880"
FT                   /db_xref="GOA:D4HBU4"
FT                   /db_xref="InterPro:IPR019681"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBU4"
FT                   /protein_id="ADE00880.1"
FT                   /translation="MTCHNNVAGHYDGAVSNHHLLTQANVAPVDENGVTVGIVGTIAFA
FT                   VASLICWIMLDRLTETGYRDWLWICLTGTGLGVVGTAYCWQRSRH"
FT   gene            547717..549228
FT                   /locus_tag="HMPREF0675_3523"
FT   CDS_pept        547717..549228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3523"
FT                   /product="putative permease"
FT                   /note="identified by match to protein family HMM PF00860"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3523"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99769"
FT                   /db_xref="GOA:D4HBU5"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBU5"
FT                   /protein_id="ADD99769.1"
FT                   /translation="MPSNTASARFDQWFHLTERGSTTSREVRGGIVTFFTMAYILALNP
FT                   LIIGTAADKNGKLLNGAPKFLDAAGTSLNTAGIDDNKIMVMAVTAFVAAIMTIAMGVWG
FT                   RFPMGIATGLGINSLLAYVVAPTMTWSQAMGLVVWEGIFILVFVLTGVREMIFRAVPNS
FT                   LRSAISVGIGLFIAFVGFVDSGVIRPGSGTPVTLGVGGSLEGWPILLCLFGFLLLVVLH
FT                   QRHIKGSMLIAIIGTSLVGVAIEAVGNIGAQSDKNPTGWALNVPRLPGASDFRWPDLGL
FT                   LGHVDLFGGFLANGHFRIGVFLGTLLVVFSLMLADFFDTMGTVVAIGDHAGLLDETGNP
FT                   EHLKGILVVDALAAVAGGLGSASSATGYVESAAGVGEGARTGIASIVTGLGFLLAMFLS
FT                   PIVSIIPSEAAAPVLVFVGFLMMAQVTRIDWKHVEEGLPAFLGMVLMPFAYSITTGIGA
FT                   GLIMFCITKVIAGKARSVHPLLWVVALLFVVYFSQTLLMKLFGQL"
FT   gene            complement(549203..549913)
FT                   /locus_tag="HMPREF0675_3524"
FT   CDS_pept        complement(549203..549913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3524"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00363"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBU6"
FT                   /protein_id="ADE00363.1"
FT                   /translation="MGGLRFNAIAIDEVRDIFGADEGLAMKLRRWAEARFSVPVHHHRR
FT                   PRWRSPFHPLYKPNVECSMLPTGWPTPHDVEDLVCGRYIESDRSARCWRLVNEWLTHLS
FT                   WGWTEIPMSVARFEELDRDLAAAGLPSTYSLKRLMDEDPQIPLRPAPGMKIGYAGTRQI
FT                   LATWVELSEVIGTVPIARRGEVNAVLKFLSSYPGWNHLAVDLGRPAPGLLVVWQPDTVE
FT                   DAHPTGLRAGRTAS"
FT   gene            550074..551060
FT                   /locus_tag="HMPREF0675_3525"
FT   CDS_pept        550074..551060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3525"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01115"
FT                   /db_xref="GOA:D4HBU7"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBU7"
FT                   /protein_id="ADE01115.1"
FT                   /translation="MTQRSRTRRRASRAASALLALGCAWGLSVSPAAAADFTVRTDKKL
FT                   GKPVGMAADLHHDWYWITDGSSSTVHSLLAVDKTGKEVHRVVWEPAFHDVEAMSWARGV
FT                   LYVADIGDKKAQRRGIRVMSPTSTAAKQSTYYEWMFTYPDGAHDAKALTVSPKGSFYII
FT                   TDGPHPAIYRGGPQVSRTESNPLEKVADAPAGVKDATFLPDGSRMALLTDHEVRVVDAY
FT                   SWKTVANAAFSGGQAIATDTTQKTLEIATSGNKVRGIKFPTTLTSITPTPSHSPKAKVV
FT                   TPANGKPTSKARSGTFIAVMGAVVVALCAGVVTFFYGRSRDTTWRHR"
FT   gene            complement(551057..552265)
FT                   /locus_tag="HMPREF0675_3526"
FT   CDS_pept        complement(551057..552265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3526"
FT                   /product="putative phosphoserine transaminase"
FT                   /EC_number="2.6.1.52"
FT                   /note="identified by match to protein family HMM PF00266;
FT                   match to protein family HMM TIGR01366"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3526"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99345"
FT                   /db_xref="GOA:D4HBU8"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR006272"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBU8"
FT                   /protein_id="ADD99345.1"
FT                   /translation="MPPNRVSLILPHDHSMNSAVIDDMICKDRIMAQPMIPRDLLPSDP
FT                   RFGCGPSRIRREVVASLSEPGSVMGTSHRQPPVRHVVAAIREELTELYNLPTDYEVALG
FT                   NGGATLFWDMATVSLVEKRAATGVYGEFTRKFSSALQRAPFLADPAVFQAEPGKLALPK
FT                   AVSDVDTYAWAHNETSTGVVAPVRRPNDIDDNSLVLVDATSAAGGVAADMSTIDAYYFS
FT                   PQKNLSSDGGLWLAILSPAAIERSNRVTSSARWVPQMLDLSLAVTNSRADQTLNTPALA
FT                   TLVMLEAQCRWLLDQGGMAWAASRTASTSGILYRWAEDNPLTTPFVADPALRSPVVVTI
FT                   DIDESVDAARLCARARDNGILDIEPYRKLGRNQIRIATFSSIEPSDVEALTACLDWLLE
FT                   NRD"
FT   gene            552268..553398
FT                   /locus_tag="HMPREF0675_3527"
FT   CDS_pept        552268..553398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3527"
FT                   /product="putative N-acetylglucosamine-6-phosphate
FT                   deacetylase"
FT                   /note="identified by match to protein family HMM PF01979"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3527"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00440"
FT                   /db_xref="GOA:D4HBU9"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBU9"
FT                   /protein_id="ADE00440.1"
FT                   /translation="MITRIASHHVVDRDGSDSPATITVEAGRISDVSEGIDPKAELVDE
FT                   WILPGYVDTHCHGGAGADFTDPDREAALRAVHYHRSQGSTTLFASTVTAAIDDVVAQIG
FT                   RLRQLVDLDEIAGIHLEGPFLAESRKGAHAVELLCDPDPVSVGRLIEAGGSALKMVTIA
FT                   PERAHGLEAVTTFTTAGVHAAIGHTECDNTTASAAVDAGADVITHLFNAMPSIHHRKPG
FT                   PVPPMLTDSRVVCELICDGVHLAPDVIRMAMSSAGPKRIALVTDAMSATGQPDGDYILG
FT                   SLPVKVVDGRARLLAADGSLGAIAGSTLTMGRAVEFVTSVVGIPLGQVAVMAATTPAKL
FT                   HGLNEVGVIEEGHWADLCLTDAKGHLVRVIHRGEAV"
FT   gene            553552..554250
FT                   /locus_tag="HMPREF0675_3528"
FT   CDS_pept        553552..554250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3528"
FT                   /product="iron dependent repressor DNA binding domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01325;
FT                   match to protein family HMM PF02742"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3528"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99649"
FT                   /db_xref="GOA:D4HBZ6"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBZ6"
FT                   /protein_id="ADD99649.1"
FT                   /translation="MSSELVDTTEMYLRTFYELLEEGVELRRARIVERLHQSGPTVSQT
FT                   VARMERDGLVVVESDRSISLTQEGHDVAQTVMRKHRLAECLLTQIIGLRPDLVHDEACR
FT                   WEHVISGEVEKRLTGLLENPDVSPYGCPLPPEQAGCRPDGSARFRDDSKPLDEVIAETG
FT                   CPVSVTVTRLSEFFQATEGNLADVYAAGLLPGKSVEVDDDADGIRLTGPSGSIVVDPEI
FT                   LSGLFVAQNS"
FT   gene            554271..555350
FT                   /locus_tag="HMPREF0675_3529"
FT   CDS_pept        554271..555350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3529"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3529"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99007"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBZ7"
FT                   /protein_id="ADD99007.1"
FT                   /translation="MGVPQVVCPSQLPDLDQIAALCESGWYDTADSMLRMAHASESANP
FT                   HVVQAAGVMAVARRVLALDAEDFEDIGEALPADLRSRLVYSGFPHHPCAAERGALGDLI
FT                   PLYELMLEVLDIRMRREEPQQVVVTCHILGEYLAQLAWQPVLGDGGDPLTLPGKVGQKW
FT                   GGDGQGCAHTSAMNATARRSMHAAQGDEEGYTSYLDKFHSRLGEALGVCAMNHATIDAG
FT                   ERPDVGITCPDPCRWVLAGTWEERRALDARVRLARIFQESGLVALRHHAPVGHFFGVPS
FT                   GSEIGNAWVMTWNKLNEQWADGSNPMLDPSAPGYDVDASDGALPGLARMVSVIAARPIR
FT                   AGHLLRDLGVTAIAELKAV"
FT   gene            555472..555837
FT                   /gene="trxA"
FT                   /locus_tag="HMPREF0675_3530"
FT   CDS_pept        555472..555837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /locus_tag="HMPREF0675_3530"
FT                   /product="thioredoxin"
FT                   /note="identified by match to protein family HMM PF00085;
FT                   match to protein family HMM TIGR01068"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3530"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00043"
FT                   /db_xref="GOA:D4HBZ8"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBZ8"
FT                   /protein_id="ADE00043.1"
FT                   /translation="MATVALTKDNFSSTIDSNDVVLIDFWASWCGPCQRFSPIYEDASG
FT                   RHSDVTFAKVDTEDQQELSAGLEITSIPTIMAFRAGYLVFRQSGLLQGRQLDELIEKVK
FT                   EIDVEDLKKQAAAQNQG"
FT   gene            556009..557625
FT                   /locus_tag="HMPREF0675_3531"
FT   CDS_pept        556009..557625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3531"
FT                   /product="MFS transporter, SP family"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690; match to protein
FT                   family HMM TIGR00879"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3531"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99317"
FT                   /db_xref="GOA:D4HBZ9"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D4HBZ9"
FT                   /protein_id="ADD99317.1"
FT                   /translation="MTSRIEVAELVETTQPAGPKRRMGVVAAVATLGSLLFGYDTGVIS
FT                   GALPFMYLPHGAGGLALTVGHEGAIGGTLTLGAAFGGLIGGMMSDRWGRRHNLLILAVL
FT                   FVVGALGTAGAPSVWVMYPFRVVLGFAVGAASATVPVYLSETSPKRMRGRIVALDQFMI
FT                   VFGQLLAFSVNAAISAAHGGPSLMVTADPTGRLSPGTYSWDTLQAMTTSHGGAMTDQAF
FT                   HAFLTQLSVSAGSGGAWRWMLVVCTLPAIALWIGMRKMPESARWHLSHGQLRETVACLK
FT                   QVRVEGVDEPIVDEVTEMVELNGEGGRLSHRQQWAVVMESRWTRRLLLVGIFLAVVNQT
FT                   TGVNTVMYYAPKVLEFAGMSTQASIISQVANGVMSVIGAAAGLWLIERFDRRHLLIFDV
FT                   TAVGVCLLGIAATFGLAIAPHVGQGVPKWAPILVLVLMSIFMLIVQSTNGTVVWTMLGE
FT                   MFPTRMRGAMNGAAVFCGWLANATITWTFPAMLAGLGGAGTYLTYGLVNLMIALVLVKV
FT                   MPETKGRSLEEIEVEMKQRYA"
FT   gene            complement(557705..557777)
FT                   /locus_tag="HMPREF0675_3532"
FT   tRNA            complement(557705..557777)
FT                   /locus_tag="HMPREF0675_3532"
FT                   /product="tRNA-Arg"
FT   gene            557951..558088
FT                   /locus_tag="HMPREF0675_3533"
FT   CDS_pept        557951..558088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3533"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3533"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01056"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC00"
FT                   /protein_id="ADE01056.1"
FT                   /translation="MTRVGLGRLSRSANELVVLATWRTDDVVACSGLSVGSSRYIFSVQ
FT                   "
FT   gene            558119..559516
FT                   /locus_tag="HMPREF0675_3534"
FT   CDS_pept        558119..559516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3534"
FT                   /product="UTP--glucose-1-phosphate uridylyltransferase"
FT                   /note="identified by match to protein family HMM PF01704"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3534"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99198"
FT                   /db_xref="GOA:D4HC01"
FT                   /db_xref="InterPro:IPR002618"
FT                   /db_xref="InterPro:IPR016267"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC01"
FT                   /protein_id="ADD99198.1"
FT                   /translation="MSEEGLAAARQKMTEAGVDPVAIEVFTSYYHQLETGDTGLIREDT
FT                   ISPLTNPPMLDDVEVSEEQAAEALDKTVIIKLNGGLGTSMGLDRAKSLLEVRDGKSFLD
FT                   IIATQVLSARKTFGARLPLMFMNSFNTREDTLKALEKYPELAVDGLELDFLQDQEPKLD
FT                   AETLAPVEWPKDSSLEWCPPGHGDLYTALLGSGVLDHLLEAGYQYASVSNGDNLGAVPD
FT                   GRLAGWFAASGAPYAAELCRRTINDKKGGHLAIRKSDDQLILRDTAQTAEEEMDYFTDE
FT                   HRHPFFHTNNLWFDLEALKKVLDERHGVMGLQIIRNEKTVDPKDSSSTPVIQIESAMGG
FT                   AIEVFEGATCICVHRSRFLPVKTTNELLLLRSDVYDLDDSDHLVKTTDMTCAVDLDKDF
FT                   YKKIGDFDDRIPEPPSLRRATSLKVKGDWTFGSEVVVAGDVSLDTEKPQTIPDGTVLTG
FT                   EVLGAKK"
FT   gene            559543..559884
FT                   /locus_tag="HMPREF0675_3535"
FT   CDS_pept        559543..559884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3535"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99992"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC02"
FT                   /protein_id="ADD99992.1"
FT                   /translation="MAAVLTGQRLTAPDNPGWQAVDVVEWLAEEGWPANRLANRRAEFQ
FT                   QAGRSWPGPIPDDLSPGLEFARYGAVLAQARRIAGLDGLTATVHRGAVVIGPDEARLLA
FT                   ERPPHSLLH"
FT   gene            complement(559907..560275)
FT                   /gene="mscL"
FT                   /locus_tag="HMPREF0675_3536"
FT   CDS_pept        complement(559907..560275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscL"
FT                   /locus_tag="HMPREF0675_3536"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01741;
FT                   match to protein family HMM TIGR00220"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3536"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00211"
FT                   /db_xref="GOA:D4HC03"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC03"
FT                   /protein_id="ADE00211.1"
FT                   /translation="MKGFKDFLMRGNLIELAVAFILGGAFSTVVKSFTTIIMDLIGKLG
FT                   GTPNFSGWVPGGVHVGSFITDVISFFVMSFVIYFGLIKPIELATEKLKRTKDEPVAAPT
FT                   TADLLIEIRDELRSRPVK"
FT   gene            complement(560376..560960)
FT                   /locus_tag="HMPREF0675_3537"
FT   CDS_pept        complement(560376..560960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3537"
FT                   /product="SAF domain protein"
FT                   /note="identified by match to protein family HMM PF08666"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3537"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00205"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC04"
FT                   /protein_id="ADE00205.1"
FT                   /translation="MHVMVARHRRGLAALLAALAVLLVASPGMATSSSGREVIVAAHAI
FT                   EGGRVIQRSDLHTVRIDPGVLPHETATLAQVEGRQASIRITEGTILTSSAVLSGSAVGS
FT                   GKALVGIHLADSSMVGMLQVGQRVSVVSPSEDGTPHVLTRGAIIRSLPTSGGGLIQGSP
FT                   STELVVVSTGSADAAAIAVAGQGQPLGLVVE"
FT   gene            complement(561112..561414)
FT                   /locus_tag="HMPREF0675_3538"
FT   CDS_pept        complement(561112..561414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3538"
FT                   /product="putative regulatory protein (CxxC_CxxC_SSSS)"
FT                   /note="identified by match to protein family HMM PF09723;
FT                   match to protein family HMM TIGR02605"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3538"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00768"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC05"
FT                   /protein_id="ADE00768.1"
FT                   /translation="MPTYQYQCNDCGRDLEVVQRFSDPSLTICPSCEGDLRKVFSAVGV
FT                   VFKGSGFYSTDNHTKGASKAATGDSSSPTASEPSTKSEPASSSSSSTAKASESAS"
FT   gene            complement(561492..562079)
FT                   /locus_tag="HMPREF0675_3539"
FT   CDS_pept        complement(561492..562079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3539"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /EC_number="6.3.3.2"
FT                   /note="identified by match to protein family HMM PF01812;
FT                   match to protein family HMM TIGR02727"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3539"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99072"
FT                   /db_xref="GOA:D4HC06"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC06"
FT                   /protein_id="ADD99072.1"
FT                   /translation="MDPRSGKEELRRRCLAHRAALDHRTRMSRDDRRTEHAMSRLLWAH
FT                   KVALYLSRGDEPDTVDLADTLIMMGKKVLAPVLTDGHGRSLHEPAWAWYDSKNVRTGLW
FT                   QIPEPIAPILPASAIDQVEVVLCSALFVDRSGYRVGVGGGWYDRVLAHRADDVPVWAVV
FT                   NDDEILDEVPHDPWDESVTAALTPSGLHMLGQ"
FT   gene            562189..563496
FT                   /locus_tag="HMPREF0675_3540"
FT   CDS_pept        562189..563496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3540"
FT                   /product="MoeA N-terminal region (domain I and II)"
FT                   /note="identified by match to protein family HMM PF03453"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3540"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99675"
FT                   /db_xref="GOA:D4HC07"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC07"
FT                   /protein_id="ADD99675.1"
FT                   /translation="MALFHRKKQVEAPEPEAEPLGLPGAPETDMSGRRSVDDHRDYLCS
FT                   LVQAVPPVAVEVPRAVGLAVCEDVHAPHDVPVVTTAVIDGYALDSASTRMAGRPDAVEI
FT                   QVDRRPPSPVIPGTAVRVMAGSLLPEGTDCVLPPDLLNVDGDIVLFSPVKRWAGARLAG
FT                   SDYGRGEVLVRNGTILHPGIISVLASAGIDEVFVRPRPKVVIVAVRADEDQRAEIERKA
FT                   RANGAEDIASLDATAAAIESATRALDVNVTVVSTNTSSDSELTRLLANAGRGADLVIAT
FT                   SDRIVVGQQDPVPSVLPPMGGTDFARVAMEPGANQVFALIDPGLVPLIVLPVGPGPALV
FT                   SFMAFVQPLLRKLSGLPPVEELKAETDRPIARHPESTTFVPVRLARVGGRPVLSRAGMG
FT                   DVTHVVDLSMADAIAVVGAGDEPVPTGMPLTCWRLG"
FT   gene            563534..564208
FT                   /locus_tag="HMPREF0675_3541"
FT   CDS_pept        563534..564208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3541"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3541"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99306"
FT                   /db_xref="GOA:D4HC08"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC08"
FT                   /protein_id="ADD99306.1"
FT                   /translation="MPRHHHWPVTMQAGGVVLRPMRRADEARWTTTRELDWDWLGPWEA
FT                   TKPPGSHERVGGYRMMITRNRRRAKEGTFLPWAIGWDDGWPDRPALNRDTTPLIGQLTV
FT                   SSISLGSAMSCSMGYWVASAYAGRGVAPTAVALACDYVFQVMGLHRVEICVRPENTKSL
FT                   RVVEKLGLAEEGMRPAYLHIDGQWRDHRVFRLLTDDYPDGVLRNYLVNHLLPGFALEED
FT                   EG"
FT   gene            564290..565084
FT                   /locus_tag="HMPREF0675_3542"
FT   CDS_pept        564290..565084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3542"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99842"
FT                   /db_xref="GOA:D4HC09"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC09"
FT                   /protein_id="ADD99842.1"
FT                   /translation="MQALQAVLIAIVLVGWIAYLVPMVVNRRRSQEVTDDKHEDFPDTM
FT                   SVVSRGSCTVTPNDTDENPRVELSTPYTRSYARWDLRRSWAVAARRRMATMLVLLGLTA
FT                   LAMVLAITDVTPWWLVAIFVLLLVGFFALARWSVVAMAKRFDRRYALIDKGWDEDTVEL
FT                   EVGTEPFRAEDEPTSWTIDLDRPVTAPEGSLWDDVVVTAPTYVSTPLGARTVRTIDLSA
FT                   PGPVPGQVDTPVVAEKPVERSDGEHVAEAHEGPSGIVGVASA"
FT   gene            565300..565372
FT                   /locus_tag="HMPREF0675_3543"
FT   tRNA            565300..565372
FT                   /locus_tag="HMPREF0675_3543"
FT                   /product="tRNA-Ala"
FT   gene            complement(565823..566500)
FT                   /locus_tag="HMPREF0675_3544"
FT   CDS_pept        complement(565823..566500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3544"
FT                   /product="cytoplasmic chaperone TorD"
FT                   /note="identified by match to protein family HMM PF06192"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3544"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99751"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC10"
FT                   /protein_id="ADD99751.1"
FT                   /translation="MSPEQVTEPVTGSLDDELDQFAAVFTILGSLHYQVPDADHLHELL
FT                   QMIDEWPLSRPRSPSRMEEGLQMWRLSREEAESRQVVVADHDRLYGDSAVALVPPYESA
FT                   HRNREGLVFDEHTLQVRAAYARLGLAAPHLHREPDDHIGLELEFLAQGCLRVLDAREDG
FT                   HADESHQTLAIVANFLRTHVLAWAPSFLSRVSEQAQTSFMKGVALLTIATLDEFDRCLD
FT                   SVT"
FT   gene            complement(566497..566982)
FT                   /gene="moaC"
FT                   /locus_tag="HMPREF0675_3545"
FT   CDS_pept        complement(566497..566982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaC"
FT                   /locus_tag="HMPREF0675_3545"
FT                   /product="molybdenum cofactor biosynthesis protein C"
FT                   /note="identified by match to protein family HMM PF01967;
FT                   match to protein family HMM TIGR00581"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3545"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01182"
FT                   /db_xref="GOA:D4HC11"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC11"
FT                   /protein_id="ADE01182.1"
FT                   /translation="MTSNPFTHLRGNGSAHMVDVTTKTPTVRVATAECCVVCSEPIMTA
FT                   LRDESVPKGDVLAVARIAGIQATKHTPDLIPLAHRIGVHGAEVDLWLEPDRVRIRATTR
FT                   TTDLTGVEMEALTAVTVAALTVADMVKGVDRGFAIEHAVITHKAGGRSGEWTRSDDQ"
FT   gene            complement(566948..568237)
FT                   /locus_tag="HMPREF0675_3546"
FT   CDS_pept        complement(566948..568237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3546"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="identified by match to protein family HMM PF00994;
FT                   match to protein family HMM PF03453; match to protein
FT                   family HMM PF03454; match to protein family HMM TIGR00177"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3546"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99344"
FT                   /db_xref="GOA:D4HC12"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC12"
FT                   /protein_id="ADD99344.1"
FT                   /translation="MSIARHLQLVSSLATAPKTVELPLAECLGLVSAEPVTARLTVPPF
FT                   TNSAMDGFAVRHADVSEATVHTPVTLPVTNDVPAGSPAHRPLDPGTAQRIMTGARMPEN
FT                   ADTVIKVEDTDHAPGTVDAPATVTIFRTPSTGANVRRRGEALATGATVLPAGRRLTPEA
FT                   LAAAAAVGHGSLRVHPAPRVGVLATGSELGGAGEPLHRGKIPDSNGIMLGGLVRTHGGV
FT                   VEQTRVPDDPERLRELVRSWRVDLIVTAGGISMGAYEVVRQGLPELTFHHVAQQPGGPQ
FT                   GAGMVAETPVLALPGNPVGAYVSFHVYVAPLLARLRGLSPDLIDATPAGVTAPIDPLLG
FT                   RRLVRARAGAPWRSPAAKTQFMPVCWNGENVEPVHALGSKSHLVTSLPLVEGLAVAGPG
FT                   IDHVDSGDELSILLTGGVTHDLKPIHPPAW"
FT   gene            complement(568279..568701)
FT                   /gene="moaE"
FT                   /locus_tag="HMPREF0675_3547"
FT   CDS_pept        complement(568279..568701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaE"
FT                   /locus_tag="HMPREF0675_3547"
FT                   /product="molybdopterin converting factor, subunit 2"
FT                   /note="identified by match to protein family HMM PF02391"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3547"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00822"
FT                   /db_xref="GOA:D4HC13"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC13"
FT                   /protein_id="ADE00822.1"
FT                   /translation="MHAKISDEPLNVAKVVSLVSDDRSGAVVTFTGVVRNHDGGQSITA
FT                   IDYSAHPHATQILADLVEQCATRDGVHGVAAEHRIGHVEVGGTAMVVAVSADHRGQAFE
FT                   AACEFVDAVKESLPVWKCQWLTDGSHEWAGLPGEEP"
FT   gene            complement(568702..568941)
FT                   /locus_tag="HMPREF0675_3548"
FT   CDS_pept        complement(568702..568941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3548"
FT                   /product="ThiS family protein"
FT                   /note="identified by match to protein family HMM PF02597"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3548"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99921"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC14"
FT                   /protein_id="ADD99921.1"
FT                   /translation="MQVHYYGGTAEAAGTSEETVETPTGLSVNQLLDHLRNLHPGLGRL
FT                   LGVCTLFVDGSAVRGEQIVPARAQVEVLPPFAGG"
FT   gene            complement(568944..570023)
FT                   /gene="moaA"
FT                   /locus_tag="HMPREF0675_3550"
FT   CDS_pept        complement(568944..570023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaA"
FT                   /locus_tag="HMPREF0675_3550"
FT                   /product="molybdenum cofactor biosynthesis protein A"
FT                   /note="identified by match to protein family HMM PF06463;
FT                   match to protein family HMM TIGR02666"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3550"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99509"
FT                   /db_xref="GOA:D4HC15"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC15"
FT                   /protein_id="ADD99509.1"
FT                   /translation="MTTPQADREDGEVMSAATGQSAAHHGLPDRFGRLATDLRVSVTDH
FT                   CNLRCTYCMPAEGMDWLANRDLLTDDEIIRVIGIGIERLGITKVRFTGGEPLLRPSLEN
FT                   LVAATSTLRRTNGTPPITALTTNGIGLDRRVDGLVEAGLDRVNISLDTVDRERFATISR
FT                   RDRLADVVTGIDAALAARLLVKINAVPQIDSYRRDIPELLVFCLDRGLELRFIEFMPIG
FT                   ANGWKREATVSADDILTVVRDAGFSITADQAARGSSPAQRWSVSSRHTRPGWLGIIASV
FT                   TRPFCANCSRTRLTADGQIRNCLFADQEADLRSLLRSGASDDEIIAVWQGEMWCKSAHH
FT                   GVDNGSFANSRRRMSAIGG"
FT   gene            569949..570086
FT                   /locus_tag="HMPREF0675_3549"
FT   CDS_pept        569949..570086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3549"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3549"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00317"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC16"
FT                   /protein_id="ADE00317.1"
FT                   /translation="MVGGTLARRGAHDLTVLPVCLWCGHVIANVAELLSTRGYTSALYR
FT                   "
FT   gene            570236..570655
FT                   /locus_tag="HMPREF0675_3551"
FT   CDS_pept        570236..570655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3551"
FT                   /product="TOBE domain protein"
FT                   /note="identified by match to protein family HMM PF00376;
FT                   match to protein family HMM PF03459"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3551"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99494"
FT                   /db_xref="GOA:D4HC17"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC17"
FT                   /protein_id="ADD99494.1"
FT                   /translation="MSPHPPSHRVSDVAALLGVSDDTVRRWIDQRHVRAAKDTTGRLRV
FT                   DGASLAAFLVTQQQERQDLADGAQTQSMRNHIRGIVAKVISDKVMSQVELVTGNLSIVS
FT                   LVSTEAVRELGLQVGSIAVAQVKATNVSLQLPVTR"
FT   gene            570652..571431
FT                   /gene="modA"
FT                   /locus_tag="HMPREF0675_3552"
FT   CDS_pept        570652..571431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modA"
FT                   /locus_tag="HMPREF0675_3552"
FT                   /product="molybdate ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="identified by match to protein family HMM PF01547;
FT                   match to protein family HMM TIGR01256"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3552"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00309"
FT                   /db_xref="GOA:D4HC18"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC18"
FT                   /protein_id="ADE00309.1"
FT                   /translation="MIEMSRVSLRTCAIAAVAAVLLAACGSGPSSTQPSAAPTRLTVFA
FT                   AASLTRSYEQIGEQFERKYPRVDVQFSFEGSQNLVAQMAQGAPADVLATADQRSMNKAV
FT                   EQNLVNVPRQFASNVLTLVTPAHNPARVTGLNSSLRGAKLVICAPEVPCGNATRKLANK
FT                   LGVTLKPVSEEQKVTDVRGKVESGEADVGIVYRTDALAAGNKVDVIPIGRANEVVNHYP
FT                   IATAVGATHQGLAKRFVEYVMSADAQKILSDDGFSGP"
FT   gene            571591..573369
FT                   /locus_tag="HMPREF0675_3553"
FT   CDS_pept        571591..573369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3553"
FT                   /product="NifC-like protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00528; match to protein
FT                   family HMM TIGR01581"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3553"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00662"
FT                   /db_xref="GOA:D4HC19"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006469"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC19"
FT                   /protein_id="ADE00662.1"
FT                   /translation="MPMWIVILAVVGICVLVLPLVGMGNEVPWARIPAIMASPEAQDAL
FT                   WLSVRTCVIATVIDVFLGVPIALLLARDWNGVAAVRVLVLLPLSLPPVVAGLALLATFG
FT                   RRGMIGASLHAAGISIAFSTAAVVMAQVYVSLPFLVTALESSIRTRSWKLEQTAAALGA
FT                   GPWRVLRTITMPTVASALGRGTALAAARCLGEFGATITFAGSLQSVTRTMPLQVYLARE
FT                   TDSDTAMALGLVLVVVGAIVAGLTQWQPSQRSWRRNEPPLVEEGLTGQGNYELAGTRGT
FT                   PYEQHVCEQSDPGKDLPEQSSITTNLGTSAVTVWSPQAHDDSVSRVRGASAGHEPIGSA
FT                   AAAIHVDGQVSARSWDVRLDVEPGEVVAVMGPNGAGKSTLASVVTGLLALDRGRVCIGR
FT                   QLVDAGDGRIVLPGRRGVGLLTQDALIFEHMSVLDNVAYGPRCHGLSRAQAQKVAYAQL
FT                   AAVGCAHLAARRGGELSGGQAALVGLARAFAVEPAVLVLDEPTAALDIDAQIRVRDLLK
FT                   SQLDRTNMTALIITHDVADTMTVAGRLVVLEHGRIIEDGVVSQLLENPKKAFTAQLAAL
FT                   VKFGVRTNSQGAESSS"
FT   gene            complement(574024..574737)
FT                   /gene="narI"
FT                   /locus_tag="HMPREF0675_3554"
FT   CDS_pept        complement(574024..574737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narI"
FT                   /locus_tag="HMPREF0675_3554"
FT                   /product="respiratory nitrate reductase, gamma subunit"
FT                   /EC_number="1.7.99.4"
FT                   /note="identified by match to protein family HMM PF02665;
FT                   match to protein family HMM TIGR00351"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3554"
FT                   /db_xref="EnsemblGenomes-Tr:ADD98979"
FT                   /db_xref="GOA:D4HC20"
FT                   /db_xref="InterPro:IPR003816"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC20"
FT                   /protein_id="ADD98979.1"
FT                   /translation="MNTNLLVWLVLPYLSIILLIGGMIWRYRTDQFGWTSRSSQWNEPS
FT                   ILRWSSPLFHFGILFVFLGHVLGLVIPQSWTSTIGITEDTYHVMATVLGSAAGLAALVG
FT                   LLGLLYRRFMTKSVCLTTTTMDIVTYVLLTLTVTLGCWATVHQQMIVGGYNYRDTIGPW
FT                   FRSIALFQPRPELMATVPLDYKLHVMAGMVLFSVWPFTRLVHVVSAPVSYPTRPYVIYR
FT                   SKNGHLGSSSRHYGW"
FT   gene            complement(574734..575405)
FT                   /gene="narJ"
FT                   /locus_tag="HMPREF0675_3555"
FT   CDS_pept        complement(574734..575405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narJ"
FT                   /locus_tag="HMPREF0675_3555"
FT                   /product="nitrate reductase molybdenum cofactor assembly
FT                   chaperone"
FT                   /note="identified by match to protein family HMM PF02613;
FT                   match to protein family HMM TIGR00684"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3555"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99371"
FT                   /db_xref="GOA:D4HC21"
FT                   /db_xref="InterPro:IPR003765"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="InterPro:IPR042290"
FT                   /db_xref="InterPro:IPR042291"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC21"
FT                   /protein_id="ADD99371.1"
FT                   /translation="MGVFLGAPRIPVSTHVDASLAQRRVVHMATSLLLDYPDEQLTQII
FT                   TAVRHDRDLMPAVVADEITAFCGVAESWGLRALQEHYVETFDQHRRCALYLSYYSAGDT
FT                   RERGAAILGFREVMRSAGFELDHANELPDYLPVVLEFSARASEGDTLLRANREALEVIR
FT                   SALVTASSPYAHLLEGLCLILSPLDKKTLARYQKLISQGPPVEMVGLAATDPVSTLGRQ
FT                   L"
FT   gene            complement(575407..576930)
FT                   /gene="narH"
FT                   /locus_tag="HMPREF0675_3556"
FT   CDS_pept        complement(575407..576930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narH"
FT                   /locus_tag="HMPREF0675_3556"
FT                   /product="nitrate reductase, beta subunit"
FT                   /EC_number="1.7.99.4"
FT                   /note="identified by match to protein family HMM TIGR01660"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3556"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00638"
FT                   /db_xref="GOA:D4HC22"
FT                   /db_xref="InterPro:IPR006547"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR029263"
FT                   /db_xref="InterPro:IPR038262"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC22"
FT                   /protein_id="ADE00638.1"
FT                   /translation="MKVMAQIAMVMNLDKCIGCHTCSVTCKQAWTNREGTEYMWFNNVE
FT                   TRPGVGYPRGWEDQERWRGGWKRTRSGKLVPYQGGRLATLGKIFANPNLPAKKDYYEPW
FT                   TYEYDQLLASPSTQHIPTARAKSALTGEHKDTIDWGPNWDDDLGGSMETLDQDPVLHQM
FT                   NLTVRKSIEDSFMFYLPRICEHCLNPTCVSACPSGAIYKRAEDGIVLVDQDHCRGWRMC
FT                   VSGCPYKKVFFNHHSGKAEKCTLCYPRLEVGQPTVCSETCVGRLRYLGVLLYDADHVTW
FT                   AASQPDPRTLYAAQRDILLNPNDPEIITQAKANGVPHSWIKAAQASPVWQLISRYQIAL
FT                   PLHPEYRTLPMVWYVPPLSPVVDAVSASGNDGEDHRVLLAAISQMRIPLEYLAGLFTAG
FT                   ATAPVELSLRRLAAMRSYMRDIFLGNEADETIPEAVDMTGEDIQSMYRLLSIAKYDDRY
FT                   VIPTTCSGLPDGIADLGRCPVSGSLEAFHSISSPVSAPEGTPTLPLEVI"
FT   gene            complement(576930..580667)
FT                   /locus_tag="HMPREF0675_3557"
FT   CDS_pept        complement(576930..580667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3557"
FT                   /product="nitrate reductase, alpha subunit"
FT                   /EC_number="1.7.99.4"
FT                   /note="identified by match to protein family HMM PF00384;
FT                   match to protein family HMM PF01568; match to protein
FT                   family HMM TIGR01580"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3557"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01214"
FT                   /db_xref="GOA:D4HC23"
FT                   /db_xref="InterPro:IPR006468"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR037943"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC23"
FT                   /protein_id="ADE01214.1"
FT                   /translation="MTEYDETSDAESPSGSALLKMGTWLRRGTTSPDTRQLFLEGGRDA
FT                   DVFYRKCWSHDKVVRSTHGVNCTGSCSWKIYVKEGIISWESQQTDYPSTGPDMPDYEPR
FT                   GCPRGASFSWYEYSPTRIRHPYVRSVLLDAWRDKLAEFGDPVDAWASITNDPELSQAYK
FT                   CARGHGGMVRVSWEEATQIIAAAYVHTIKAYGPDRIAGFSVIPAMSMVSYGAGSRFTEL
FT                   LGGTMLSFYDWYADLPPASPQVFGDQTDVPEAGDWFNSQYLIMWGSNVPVTRTPDAHFM
FT                   TEARYHGQKVVVVSPDYADNTKFADEWLRVASGTDGALAMAMGHVILSEFHVTRREPMF
FT                   LDYMRRYTDSPFLVELDRFDGPQADGAAYVPGKFLTADKVNLQTRPDHPEFRPLVMEAD
FT                   GSLKDPGGTLADRFSESGVGHWNLDLDGVNPVMSMMDVNSWEAVEIALPRFDLPSSPDQ
FT                   TSLGAGIVHRGVPARRIGDRLVTTVYDLLLAQYAVSREGLPGQWPSGYDDPTVPGTPAW
FT                   QAELTGVPAAAAERIGREFALNSLETGGRSMIVMGAGVNHFYHADEIYRTFLALTNMCA
FT                   TQGVNGGGWAHYVGQEKVRPFTGWANYSFALDWARPARQMIATAWYYLTTDQWRYDGAR
FT                   AESIASPLGSGSFAGRTTADCMVYSARRGWTPSYPTFTRNPLDLADEAAAAGMEPAEYI
FT                   AQKLTDGSLGFACEDPDATQNYPRLLANWRTNLLGSSAKGTEFFMKHMLGCENDVNATE
FT                   LTEGKRPTDIRWRDDTPPGKLDLMWTADFRNTSTTLHSDVVLPAATWYEKHDLSSTDMH
FT                   PYVHSFNPAVDPPWEARTDFEVFRTLAYSVSQMAVKHLGTRTDIVAAPLMHDTPDEMTT
FT                   PAGSVSREQEAWIPGVTMPKLVTVERDYTQIGAKFDTLGPLTESLGMVTKGVPFHPDPE
FT                   VADLAQRHGVATSGPGAGRPLLDTAIKACDTILATSGTTNGRLATAGFEQLEARTGTKL
FT                   TDLSVGSQDRRVTFTDTVIQPQPVITSPEWSGSEHGGRRYSAFVINMERHKPWHTLTGR
FT                   MHYYLDHDWMRDMGESLPIFRPPLDVAHIYDEPPAGYTGTDADGAAVVSVRYMTPHNKW
FT                   GIHSQYYDNLHMLTLARGGQTIWMSPADAAKIGVSDNDWVEAYNRNGTVDARAIVSHRI
FT                   PEGTVFMYHGQERTVNTPLTERSGKRGGTHNSLTRILLKPSHFIGGYAQLSYAFNYYGP
FT                   TGNQRDEVTLIRRRGQEVTF"
FT   gene            complement(580725..582041)
FT                   /locus_tag="HMPREF0675_3559"
FT   CDS_pept        complement(580725..582041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3559"
FT                   /product="transporter, major facilitator family protein"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3559"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99207"
FT                   /db_xref="GOA:D4HC24"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC24"
FT                   /protein_id="ADD99207.1"
FT                   /translation="MSTSPSHHLIENWDPEENWDSGIAWRTLTISTFSMIIAFCVWFLV
FT                   SAIAPKLNAIGFHLTKSQLYWLTAMPGLSGGFIRLVYMFLPPVIGTRRLVGYSSLLYLI
FT                   PMLGWFFAVQNTSTGYGTLLLLAFLCGVGGGSFSGYMPSTGYFFPKSKQGTALGVQAGI
FT                   GNLGMSIVQLLGPWLMGFGLLGLTWIAPQHTAGSPLWVHNIAIVFVPWTILATILAFTM
FT                   LKDVPVKANFRRQIDIFTNPDTWIMTLMYVMTFGLFSGFSAQFGLLIENTYGNSSNLAH
FT                   GFSNLPAGASYAFLGPLIGSLVRVVWGPLCDRFGGAIWTLVSGIGMALTFGFCVFFLNP
FT                   TSPSQFGYFLWGMLTMFFFSGIGNAGTFKQMPMIMPARQAGGAIGFTAAIGCFGPFVVG
FT                   VALSSMSAVAWFWICTVFCIVCSIICWIRYARPGAPCPG"
FT   gene            582021..582902
FT                   /locus_tag="HMPREF0675_3558"
FT   CDS_pept        582021..582902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3558"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99693"
FT                   /db_xref="GOA:D4HC25"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC25"
FT                   /protein_id="ADD99693.1"
FT                   /translation="MGRACAHNVSAWDRAINTDIIRKNHRREGRPALCPNAGVATSRGL
FT                   LFLAGRIVGTLRRCVGWSYWSETLVKSVAGGLLRIGMRHDHDMTNRRLDAVILAGGCAH
FT                   RLGGVAKANLRVGTRRLLDVVLDAVDGAREGLEGSNVVVARESVEVPWSVIRTMEDPPG
FT                   SGPLAGIRAGLQALPPAQPDDLVLVCAVDSPGIGRSIRQLREALEDDPLNHFAGAVTFG
FT                   GVPKPHRQLLQGLYRRVPLEASIAAADTVVNRSVHSVLGGLCLLDLPVEPEACRDLDTP
FT                   GDVEWWLRHIGD"
FT   gene            583199..583699
FT                   /locus_tag="HMPREF0675_3560"
FT   CDS_pept        583199..583699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3560"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="identified by match to protein family HMM PF00994;
FT                   match to protein family HMM TIGR00177"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3560"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99538"
FT                   /db_xref="GOA:D4HC26"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC26"
FT                   /protein_id="ADD99538.1"
FT                   /translation="MDEIRARVITVSDRCAAGAALDRSGPLAASLLAELGCSWLKVDPV
FT                   TVVPDGIDSVGGALRDALENGCRLVVTTGGTGISPRDLTPEATEPLLVARLDGLAEQVR
FT                   ALGAHGSALAGLSRGLVGVTSRGDQAALIINAPGSTGGVRDTLTVIGPMLEHIFRQLAG
FT                   GGH"
FT   gene            583869..584144
FT                   /locus_tag="HMPREF0675_3561"
FT   CDS_pept        583869..584144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3561"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3561"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00216"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC27"
FT                   /protein_id="ADE00216.1"
FT                   /translation="MSHHDDNPEKMARMRDWLEIAAREVDVDPSVLTDVEQPLLDMVSV
FT                   ISHGPSRPGAPLTVFLVGIATAQGGDTLQLVKKLMQAAEQRGQTRD"
FT   gene            complement(584208..585218)
FT                   /locus_tag="HMPREF0675_3562"
FT   CDS_pept        complement(584208..585218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3562"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3562"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99916"
FT                   /db_xref="GOA:D4HC28"
FT                   /db_xref="InterPro:IPR007059"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC28"
FT                   /protein_id="ADD99916.1"
FT                   /translation="MNTHDVPMILFTVVTQMCVGAFLVLGTAHVGAAIRGRENSVVERT
FT                   SRPVLYAIGPTMVFGLFVSMFHMGYPAHTLNVLRHPQTSWLSREIMFGSGFALLGFVFA
FT                   MLSWFKRPAFAIQRVLAVVTAIVGIGLLVCESMIYYSLVTVPAWHSWWVPFSFAATTII
FT                   LGTLSVACALMITAMVRHRHETAVPSAREKHPKTTGWWSRHVTEEIRAINAPTDDQEWD
FT                   LSLTVTKWCSIGAAVVSVALMVGYPLYTSQLASGGPVAHQASNTFSGGIYATRLILLGA
FT                   IALMLGSFVYRGALHTPREYPHSLGWLLITTLIITFAGEIVGRALHYWSLVRIGI"
FT   gene            complement(585218..585859)
FT                   /gene="dmsB"
FT                   /locus_tag="HMPREF0675_3563"
FT   CDS_pept        complement(585218..585859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dmsB"
FT                   /locus_tag="HMPREF0675_3563"
FT                   /product="dimethylsulfoxide reductase, chain B"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM TIGR02951"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3563"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00886"
FT                   /db_xref="InterPro:IPR014297"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC29"
FT                   /protein_id="ADE00886.1"
FT                   /translation="MGEKNYTAKGAKYGFFFDQTLCTGCKACQIACIDKHDLPTGVRWR
FT                   RVVEYSGGTWQISGDTFNPSVFTYYTSVSCNHCEDPICMKVCPTTAMSRRDDGTVYVDQ
FT                   DKCVGCRYCEWACPYSAPQYRKDTGRMSKCDLCYDYRSKGKEPACVAACPSRALDWGPI
FT                   DELRSTYGNEDAIAPLPDPSVTKPHLVITAHRDAQRWDEGTGEIANTKEI"
FT   gene            complement(586026..588605)
FT                   /locus_tag="HMPREF0675_3564"
FT   CDS_pept        complement(586026..588605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3564"
FT                   /product="anaerobic dimethyl sulfoxide reductase, A
FT                   subunit, DmsA/YnfE family"
FT                   /note="identified by match to protein family HMM PF00384;
FT                   match to protein family HMM PF01568; match to protein
FT                   family HMM PF04879; match to protein family HMM TIGR01409;
FT                   match to protein family HMM TIGR02166"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3564"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99423"
FT                   /db_xref="GOA:D4HC30"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR011888"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC30"
FT                   /protein_id="ADD99423.1"
FT                   /translation="MSGGLNVESYSTNIPGLKTKASRREFMKWSAVVGGTAALAPVLHE
FT                   TKDALANKPTNDASTFVWSACTVNCGSRCPLRLEVKDGTIVRVLPDDSANNKVGSQQVR
FT                   ACVRGRSIRHRIYNPDRLKKPMKRKPGTKRGDEQWVTISWDQALDEIAEKMKKIKARYG
FT                   NEAFYINYGTGTLGSVMAKSWPPDQSAFARLMNTWGGYLDHYSDYSTTEITQAYPYFYG
FT                   SWVGSNSFDDVKNSKLQVMFGNNPAETRMSGGGQVFVSQQTRKASGVRTIVIDPRYSET
FT                   AITMADEWIPIRPGTDAALVAGLIHTMITEDLHNQAFLDHYCVGFDDKHLPEGTSAGSS
FT                   YRAYLEGKGPDHTIKNAQWASHITGVPAERIRRLAREIAAANPCAITQGWGPQRHANGE
FT                   NSARAIFLLAAVTGNIGIPGGGTGAREGAQAFQFTLPFNTEITNTKSNKIIPVFSWLDA
FT                   IDHGEQMDTFNSGVCEKPAPGVRANKVPIDEHGKPTNVKLSAPIKMVWQYAGNSLVGQT
FT                   GNNNRSVEILRDDSKCELIVVCDIQYTTSARYADYVLPGTSTAEEEDIHPGENGGPMAY
FT                   GIVSSQAIKPLYECRNIFDICAGLAKRLGTEKEFTGGLTRSQWLERTIEETRKKDPGLP
FT                   TYREWKKIGIFRKDMGPYVELDEFRKDPVANPLETPSGKIEIYSERLAAMSEAWTFGTF
FT                   RKKLAGDKLTALPEYVVTWEGPEEAKASKKYPFQVIGHHFKGRTHSSYGNVDWLLDAHP
FT                   QTVWINTRDARAKGITNGDQVFVYNDRGTIRLPARVTDRIAPGVLSVPQGAWYRPLSNT
FT                   KVAPPSKANPKQPVDINGAMNTLTSLHPSPLAKGNAVHTTIANVEKA"
FT   gene            complement(588793..588915)
FT                   /locus_tag="HMPREF0675_3565"
FT   CDS_pept        complement(588793..588915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3565"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3565"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99955"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC31"
FT                   /protein_id="ADD99955.1"
FT                   /translation="MRSFQLHQDGQDAASEQGDLGTGFCLSAGHREQRSVATIY"
FT   gene            complement(589041..589868)
FT                   /locus_tag="HMPREF0675_3566"
FT   CDS_pept        complement(589041..589868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3566"
FT                   /product="molybdopterin biosynthesis-like protein MoeZ"
FT                   /note="identified by match to protein family HMM PF00899;
FT                   match to protein family HMM PF05237"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3566"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99541"
FT                   /db_xref="GOA:D4HC32"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC32"
FT                   /protein_id="ADD99541.1"
FT                   /translation="MDDAVSRATNGHDAVEDMGSTTSLINRDLIRYARHIVLPGFGQEA
FT                   QRRLRDSRVLVVGAGGLGSPVLLYLSAAGVGYLTILDDDVVDESNLQRQVIHRQADVGR
FT                   PKALSAKDAVQRLNPHLVAEAVVARLGTDNALDLVKDHDLILDCTDNFTTRYLASDAAE
FT                   ITGTPLVWGTILQYQGQLSVFWPDRGPMLRDLFPEVPAADSVPSAVVGGTFGPVVGQVG
FT                   SMMATEAVKVLTGIGTPAVGKLVVVDALGVGARTLSFAADPDRASVTQLPEAE"
FT   gene            complement(589883..590761)
FT                   /gene="thiG"
FT                   /locus_tag="HMPREF0675_3567"
FT   CDS_pept        complement(589883..590761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="HMPREF0675_3567"
FT                   /product="thiazole biosynthesis protein ThiG"
FT                   /note="identified by match to protein family HMM PF05690"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3567"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00346"
FT                   /db_xref="GOA:D4HC33"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC33"
FT                   /protein_id="ADE00346.1"
FT                   /translation="MMTEETDVANVKETIVSCDEKAATSSDEPLRIGGLRLTSRLIMGT
FT                   GGSTSMDTLERALVASGTQLTTVAMRRFAAGPRQSVFEILQRHRITALPNTAGCYTARD
FT                   AILTANLAREALDTNLVKLEVIADEDTLLPDPVELVNAAEQLVANDFVVLAYTNDDPAI
FT                   AKRLEDLGCAAVMPAGAPIGTGLGILNPHNIELIVDRANVPVILDAGIGTASEATLAME
FT                   LGCDAVLLASAVTRAHNPVGMAQAMKMAVVAGRMARTSGRIPRRRLARASSPFDGIITG
FT                   RVRGPRENDSL"
FT   gene            complement(590758..591027)
FT                   /gene="thiS"
FT                   /locus_tag="HMPREF0675_3568"
FT   CDS_pept        complement(590758..591027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiS"
FT                   /locus_tag="HMPREF0675_3568"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /note="identified by match to protein family HMM TIGR01683"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3568"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00473"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC34"
FT                   /protein_id="ADE00473.1"
FT                   /translation="MMTANNGETTGHYPTTTVNGEPYDPSGNETILDLVSARIGKTLRA
FT                   DGRTVDGSPLGIAVAINGAVIRRAQWAATPVRGVIDVVTAVQGG"
FT   gene            complement(591034..592281)
FT                   /gene="thiO"
FT                   /locus_tag="HMPREF0675_3569"
FT   CDS_pept        complement(591034..592281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiO"
FT                   /locus_tag="HMPREF0675_3569"
FT                   /product="glycine oxidase ThiO"
FT                   /EC_number="1.4.3.19"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM TIGR02352"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3569"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00982"
FT                   /db_xref="GOA:D4HC35"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR012727"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC35"
FT                   /protein_id="ADE00982.1"
FT                   /translation="MGTAATRREFAGSTVVGHVDTKSHNHAAETSTIPPSERGRPSSVV
FT                   IAGAGIIGLTTAWRLRRRGIEVTVLDDAPVSGASFAAAGMLAPVSEVIWDQPTLYPLMV
FT                   ESGRIYRDFAAAIAHDVGHDIGYLESSTFVCAGDSADRQTLNELLELQHRMGMTVNRIS
FT                   VSQARAAEPALGPGCVGVVDIPGDHQVDPRRLCGAILEFLGDRVVPTRASEVLFNEDHR
FT                   AIGLRGANGKSYRADHVVLAAGVDTGAITGIPQALTDLLRPVRGEVLRLRVPEALRPLV
FT                   TRTIRGVVQGNAVYIVPRADGTIVLGATTREDDMVGVRAEGVHQLLRDAHRLVPGILDC
FT                   EIYEMTAKARPGSPDDVPMVGRVGDGLTVSMGYFRHGILLAAIGSRIGADIVCGTEKDN
FT                   NPALLAAVNPFRFGNR"
FT   misc_binding    complement(592274..592385)
FT                   /bound_moiety="thiamine/thiamin pyrophosphate"
FT                   /note="TPP riboswitch (THI element); Rfam score 57.08"
FT                   /inference="nucleotide motif:RFAM:RF00059"
FT   gene            complement(592663..592977)
FT                   /locus_tag="HMPREF0675_3571"
FT   CDS_pept        complement(592663..592977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3571"
FT                   /product="hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   premature stop"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3571"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99889"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC36"
FT                   /protein_id="ADD99889.1"
FT                   /translation="MDGHPERLGIIVEQSPNRTQIKRLVDPMNLDPLLAEDLAEGHQRP
FT                   KLERHGEALFLVLHPPFYIDSIEDVAFVEAEVIKQRNCVVPTLIGSIYSMNFDNMPELH
FT                   "
FT   gene            complement(593237..594682)
FT                   /locus_tag="HMPREF0675_3572"
FT   CDS_pept        complement(593237..594682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3572"
FT                   /product="putative permease"
FT                   /note="identified by match to protein family HMM PF00860"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3572"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00561"
FT                   /db_xref="GOA:D4HC37"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC37"
FT                   /protein_id="ADE00561.1"
FT                   /translation="MIWKLHNRGVLEPGEVVAPDERLGWGRTIGLGAQHVVAMFGATFV
FT                   FPVLMGLNPQLAVMMSGVATLVFIFVTQHEVPSYLGSSAAFPGVATAIYASGGKPNDVS
FT                   GALLCVGLTLLICGIIIQAAGSRVVHKVLPPTVTGAVVMLIGFNLAPVVAKTYWPTDQW
FT                   TALIVMLLVIALSVGPRGFVSRIAIFLALVIGYLLSWTEDLVFGPLHHSDGSTAPRVDW
FT                   SAVHNSAWIGLPPATNLNNWQYLPQVHNGSHYASTNVVGFHLPAFHLAFILLALPVVIA
FT                   LIAENTGHVKAVAEMTGKNLDHQVGRAVAADGATSMLATFLGAGPTTTYSENIGVMAAT
FT                   RVYSTAAYVVAAVVAILFGFSPKFGAVISATPGGVLGGITVVLYGMIGLLGAKIWKENE
FT                   VDFGNPVNLVPVAAGIIIGVGDVSLKFSKSFTLGGIALGTIVTVGVYHLARWLAPHELS
FT                   DAAGGTNIILDAPGMYVDDDTPQ"
FT   gene            complement(594765..596327)
FT                   /locus_tag="HMPREF0675_3573"
FT   CDS_pept        complement(594765..596327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3573"
FT                   /product="dolichyl-phosphate-mannose-protein
FT                   mannosyltransferase"
FT                   /EC_number="2.4.1.109"
FT                   /note="identified by match to protein family HMM PF02366"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3573"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99366"
FT                   /db_xref="GOA:D4HC38"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR027005"
FT                   /db_xref="InterPro:IPR032421"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC38"
FT                   /protein_id="ADD99366.1"
FT                   /translation="MSTIERLDDGRMTDEYTSWIITALITTVAFVLRVWNVGFPNSLVF
FT                   DETYYPKDAWTMLHQGYEATWPDAAKANADIVRGITNTWTPDAEFVVHPPVGKWLIATG
FT                   EQLFGFNSFGWRFSSVVFGSLLVLMTIRLARRLSRSTMVGAIAGILLTLDGLAFVMSRI
FT                   GLLDIFQAFFLVAGVSAVAADRDWFRHRLADHLRTIGNPHLNGDFGPALGWRPWRLVAG
FT                   IMFGLACGTKWNSMFVLATMGIVSVIWDWSARRLAGAGTKAWWSFLRDGVPAFVYLVVV
FT                   ALLTYLATWAKWLVTYPHMVFGKSWAGPAPSPGLSKVVGKPLAALWEYHRQIYDFHTGS
FT                   YMMTQTHVYASNPSGWLVIQRPLGVDAVNGIKPGQQGCKAVGDTCLRVISATGTPVLWW
FT                   FAAIALVAAVIWWIFARDWRFTLPIVAMMSTWIPWFRYDDRPLFFFYAICIIPFTVTIL
FT                   AIWLGQILGPAKASSRRRIGAIVVGTVMALVAADFAFIYPILTDGLMTRKAWLARMWFH
FT                   SWI"
FT   gene            596409..597269
FT                   /locus_tag="HMPREF0675_3574"
FT   CDS_pept        596409..597269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3574"
FT                   /product="S-adenosylmethionine-dependent methyltransferase,
FT                   YraL family"
FT                   /note="identified by match to protein family HMM PF00590;
FT                   match to protein family HMM TIGR00096"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3574"
FT                   /db_xref="EnsemblGenomes-Tr:ADD98988"
FT                   /db_xref="GOA:D4HC39"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC39"
FT                   /protein_id="ADD98988.1"
FT                   /translation="MSKTQPGRVILAGTPIGDRRSASPALIETLRDARVIAAEDTRRLR
FT                   DLLRRLGVESSARVVSYFEGNESARTPELINCLRDGDDVVVVTDAGMPSVSDPGYRLVT
FT                   AAIEHGIVVTSVPGPTAVTTALAISGLPTDRFCFEGFLPRKPGERRRRLAELAQEPRTT
FT                   VLYEAPHRLADLLDDAADALGTDRRAAVCRELTKTYEEVRRGGLGELAEWAREHARGEI
FT                   TIVIEGAPGTVVGIDEAAEMVAELTADGIKRSKAVAQVARATGVDRHDLYDAAQNALTT
FT                   DKEES"
FT   gene            597266..598174
FT                   /locus_tag="HMPREF0675_3575"
FT   CDS_pept        597266..598174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3575"
FT                   /product="hydrolase, TatD family"
FT                   /note="identified by match to protein family HMM PF01026"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3575"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99496"
FT                   /db_xref="GOA:D4HC40"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC40"
FT                   /protein_id="ADD99496.1"
FT                   /translation="MNEAIREVLGEAGAPPLPEPLTGSIVDSHTHLDTVQDVVGIEPAI
FT                   SLAAAREVGVTRIAQIGCDVAGSEFAEELARTHKNVIAAVAIHPNDAARLGREKIGDAL
FT                   KRIDELASVGNHVRAIGETGIDHFGTTDADGQALQREVFAAHIAMAHAHDLTLAIHMRD
FT                   ARNGGEGDEPPSGRQAHDDVVDVLNSEGWPDRIIMHCYSGDADLARICLDHGAYLSFSG
FT                   TITFNSAGPQRDALAIAPDNRILVETDAPFLTPAPRRGKRNGPYLLPHTARFIAKQRGW
FT                   DELRVCQQLTENAFAAYGGAW"
FT   gene            598171..599067
FT                   /gene="ksgA"
FT                   /locus_tag="HMPREF0675_3576"
FT   CDS_pept        598171..599067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="HMPREF0675_3576"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF00398;
FT                   match to protein family HMM TIGR00755"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3576"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00336"
FT                   /db_xref="GOA:D4HC41"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC41"
FT                   /protein_id="ADE00336.1"
FT                   /translation="MSETGLLNPASIRRIADQIGLRPTKTRGQNFVHDANTVRRIVSLA
FT                   QVGAADRVIEVGPGLGSLTLGLLETGAEVVAIEIDEVLANQLPGTVAERMPGAAERLEV
FT                   VLSDALDVKVIPGAEPTALVANLPYNVAVPVLLHMLAICPQWSTGVVMVQSEVADRLVA
FT                   APGSKIYGVPSAKLAWYAEAIRVGNVPPTVFWPVPNVDSGLVRITRRRPPHVDGRDPRV
FT                   TRSQVFRVVDAAFASRRKMLRSALAGLCGGSMAASELITAAGIDPTARGEALDIGDLAR
FT                   VVEALAQAGALSDSGQV"
FT   gene            599091..600062
FT                   /gene="ispE"
FT                   /locus_tag="HMPREF0675_3577"
FT   CDS_pept        599091..600062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="HMPREF0675_3577"
FT                   /product="4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="identified by match to protein family HMM PF00288;
FT                   match to protein family HMM PF08544; match to protein
FT                   family HMM TIGR00154"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3577"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99185"
FT                   /db_xref="GOA:D4HC42"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC42"
FT                   /protein_id="ADD99185.1"
FT                   /translation="MVMMDDPFDLLRPMTVTVRVSAKVNLALGVGGLAPDGFHPLATVF
FT                   EAICIYDEVAVTRRDDSRITLTVSGEDADQVPTDETNLAWRAVELVREEFASEWGKRGH
FT                   GADIHIDKSIPVAGGMAGGSADAAGALMAAAALCRLPYSPEELQPLAAQLGSDVPFCLT
FT                   GGVALGRGRGDRLAPVICRGRHRWVFATSNQGLSTPAVYRRFDELGGTPGGETVPNDLI
FT                   SALTRGDLDAVAASLSNDLQAAAIDLRPELEEVLTVGREVGALTALVSGSGPTCAFLVR
FT                   DTAGAKKVSAAVSNLPQVHRTRTARGPAAGAQLLPGPVGSFA"
FT   gene            600059..600598
FT                   /locus_tag="HMPREF0675_3578"
FT   CDS_pept        600059..600598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3578"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3578"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01066"
FT                   /db_xref="GOA:D4HC43"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC43"
FT                   /protein_id="ADE01066.1"
FT                   /translation="MTRPLHQNAVHQNSPRKDAVDGIIAAWARERPDLPVEVMEVWSRV
FT                   TRLARRLDRDRAKAFSQWDLEGWEFDVLAALRRSGEPYQLSPGQLLNELEVASGTMTNR
FT                   ITRLSNRGLVRRLPHPKDGRGVIVELTDEGRDRVDGALAALLESEGRLFDSMDAQVVEQ
FT                   VGQGLRAVLARQEELD"
FT   gene            complement(600580..601212)
FT                   /locus_tag="HMPREF0675_3579"
FT   CDS_pept        complement(600580..601212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3579"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3579"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00398"
FT                   /db_xref="GOA:D4HC44"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC44"
FT                   /protein_id="ADE00398.1"
FT                   /translation="MTSGQRREQLISVARRLFADNGMAGTSVEEIAATAGVSKPVIYEH
FT                   FGSKDGLYAVVVDREVRHLQDSLNAAMTRPKQGPKRTLESAVLALLDYIDDRPDGFRII
FT                   SRDSSVGSATGSYASILSDVASWAEGILAANFDRHGFDVSYSYLYAQALTGMVGMTGQA
FT                   WLDTREPAKEVVAAHLVDLTFNGLAHLSGSPHLSRHAERESLQSSSS"
FT   gene            601346..601424
FT                   /locus_tag="HMPREF0675_3580"
FT   tRNA            601346..601424
FT                   /locus_tag="HMPREF0675_3580"
FT                   /product="tRNA-Gln"
FT   gene            601513..602811
FT                   /gene="glmU"
FT                   /locus_tag="HMPREF0675_3581"
FT   CDS_pept        601513..602811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="HMPREF0675_3581"
FT                   /product="UDP-N-acetylglucosamine
FT                   diphosphorylase/glucosamine-1-phosphate
FT                   N-acetyltransferase"
FT                   /EC_number="2.3.1.157"
FT                   /EC_number="2.7.7.23"
FT                   /note="identified by match to protein family HMM PF00132;
FT                   match to protein family HMM PF00483; match to protein
FT                   family HMM PF01128; match to protein family HMM TIGR01173"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3581"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00206"
FT                   /db_xref="GOA:D4HC45"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC45"
FT                   /protein_id="ADE00206.1"
FT                   /translation="MTPSPSTDRAEIDGVAAVIVLAAGGGTRMKSTKSKLLHEVAGRPM
FT                   LSWAIGAARGLNPEHLVVVVGHRREQVEAHLAEDAPDVTTAVQAEQKGTGHAVACGLEG
FT                   LDELHGEVVVTYGDVPMLTGETLQRMVEVHRERRNLVTVLTAEVEDPTGYGRILRGGEA
FT                   VVGIVEHKDADEAQRAVREINSGIYVFDAEALREGVSKLSNDNVQGEYYLTDVVTMAAD
FT                   GTVEVPGRGRVGAFRIDDVWQTEGVNDRVQLARMNAEVNRRIVTGWMRAGVTIIDPTST
FT                   WIQPDVDLANDVTLYPGVFLNGATTIGAGATVGPDVTVTDSEIREEATVTRSEVTLAVV
FT                   GEGVRVGPFSNIRPGSVLDRDAKVGAFVETKNTHIGTEAAIPHMAYVGDSEVTAGSSIV
FT                   AGSVLSRECAAPATVSDITSDSQDDTLNPEADQ"
FT   gene            602808..603776
FT                   /gene="prs"
FT                   /locus_tag="HMPREF0675_3582"
FT   CDS_pept        602808..603776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prs"
FT                   /locus_tag="HMPREF0675_3582"
FT                   /product="ribose-phosphate diphosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01251"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3582"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99396"
FT                   /db_xref="GOA:D4HC46"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC46"
FT                   /protein_id="ADD99396.1"
FT                   /translation="MSGTTRPNNKHLMICSGRAYPELAEQIAAELGVELVPSRQVTYAN
FT                   SEIYVQFQESVRGCDAFVIQSHSAPVNEAMMEQLIMIDALKRASAKRITVVSPFYPYAR
FT                   QDKKHLGREPISARLMADLYQAAGADRIMSVDLHAAQIQGFFDGPVDHLWALPVLADYV
FT                   TSKYDNSDMVVVSPDAGRVRLADMWTDKIGCQLAIIHKRRDPNKANETTTHEVVGEVEG
FT                   KTCLLVDDMVDTAGTMCQAALALKKHGAKRVIAAATHPILSDPAAERINNSPIEELIVT
FT                   NTLKIRDDIDIPAMTLLSIAPLIAKAIQEVFEDGSVTSLFR"
FT   gene            603925..605202
FT                   /locus_tag="HMPREF0675_3583"
FT   CDS_pept        603925..605202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3583"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00118"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC47"
FT                   /protein_id="ADE00118.1"
FT                   /translation="MWPIRTVRAYCAGTVATAVALAAFVTSGAHAAGARETSKPQAYPV
FT                   PGLFHPCGGSVTPDWHYGETSRHYQSDGTLQFTNQTDHAVDYTASVKTSTNHKIDSNSA
FT                   SKLPPNWNTTLKTELGIVASNGWQDKETFGPVKLGPGESFRVEYGVTVKNFVGMFLGCR
FT                   DGYLEPSGGANVIQGTAPAERYAYALVIHKDGSISDRALAIPSRGSGKNSRIVDDHDIV
FT                   MAGPNLEKLADPSKDVPVEPTSPLQRDPSWPKQGERCPARGWYPLDISGIDPLIRQPGY
FT                   SQDFLNWSKGQYHFTPVTDTVVGAQFAGYVNWNPAADGPPRGWLESVGAIYRAYLPVRT
FT                   ELKGVDLAPGEKVHVEYGTLLRRVNYREVGCKNGVASIVSHYGLASAPAGFWAEATITG
FT                   TDGTKRTVDVTPDAWKHLPVPTQTTR"
FT   gene            605238..605807
FT                   /locus_tag="HMPREF0675_3584"
FT   CDS_pept        605238..605807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3584"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3584"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00050"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC48"
FT                   /protein_id="ADE00050.1"
FT                   /translation="MIRSLVATLAVGAIVTAGAQMPAQALPVQHQNPANPTTIGAPCSN
FT                   PGDTGQTVHVVRSYFDGSAGTWTISNYNDTPLPVTRSITETKTKNWSVSAGIDFPLLDV
FT                   IHISISSSYSTSSTYEVGETVGPYNVAPGKTAVLQAGWIVSDFEGQHTVCGPDKKWQGR
FT                   GDHFTATLPREHHVRISTRDNVQYDV"
FT   gene            606010..606423
FT                   /locus_tag="HMPREF0675_3585"
FT   CDS_pept        606010..606423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3585"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99144"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC49"
FT                   /protein_id="ADD99144.1"
FT                   /translation="MYVTASRRWFKQTDGASVENTTDTAMPVTHTVTVKRSETTEVKGE
FT                   IKADGTLTTYLNQSYGFDYINTVSWELSQKVGPYDLAPHTQGRLVWGFIMLDVDAQNVS
FT                   CGADLTWHAVGKPFSGTNPESRYAELRSEGSIG"
FT   gene            606602..607219
FT                   /locus_tag="HMPREF0675_3586"
FT   CDS_pept        606602..607219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3586"
FT                   /product="ribosomal protein L25, Ctc-form"
FT                   /note="identified by match to protein family HMM PF01386;
FT                   match to protein family HMM TIGR00731"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3586"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00777"
FT                   /db_xref="GOA:D4HC50"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC50"
FT                   /protein_id="ADE00777.1"
FT                   /translation="MADIIHLKAEQRTEFGKGAARRIRRDDKVPAVMYGHDHDPIHVTL
FT                   DGHATLLALRTENPLLSIEIEGQKPMLALPKDVQRDVLKGFVRHVDLLTVRRGEKVDVN
FT                   VALRITGESAPGTIAMTEFNEIEVQADLLNIPEVIEIDVTGLEAGTTIYLGDLKLPEGT
FT                   SLLGDAEDVAATVAFPETEPVEDEESAGEDAQGESEEKAAKE"
FT   gene            607216..607818
FT                   /gene="pth"
FT                   /locus_tag="HMPREF0675_3587"
FT   CDS_pept        607216..607818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="HMPREF0675_3587"
FT                   /product="aminoacyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="identified by match to protein family HMM PF01195;
FT                   match to protein family HMM TIGR00447"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3587"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99473"
FT                   /db_xref="GOA:D4HC51"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC51"
FT                   /protein_id="ADD99473.1"
FT                   /translation="MSPSWLVIGLGNPGPRYDGTRHNVGADVIAELCRRAGEKLSPARG
FT                   QRAELVRTRLSSAGLGVPAVDAQTVILMRSRTYMNESGIAVSKVASFAGITPDHLIVVH
FT                   DEIDLDPGRLRLKKGGGDNGHNGLKSIRAHLRTGDFIRVRLGVGRPPGHQDPADWVLAR
FT                   VPARQRAEMGVQVALAADAVESIIIQGLAAAQNRFNS"
FT   gene            complement(607858..608007)
FT                   /locus_tag="HMPREF0675_3588"
FT   CDS_pept        complement(607858..608007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3588"
FT                   /product="hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   premature stop"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3588"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00966"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC52"
FT                   /protein_id="ADE00966.1"
FT                   /translation="MLRSFPNVVVTPHIAFYSDNVTAEMVHCAMEYLRDFSQTGEPLME
FT                   VHPD"
FT   gene            608017..608325
FT                   /locus_tag="HMPREF0675_3589"
FT   CDS_pept        608017..608325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3589"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3589"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00195"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC53"
FT                   /protein_id="ADE00195.1"
FT                   /translation="MVIQNVKTVILVKIPVVVLDDVNSFRIHGIYQCSGVYEFTTDAVD
FT                   EKNALAHHGELLCVDRVVVHRHSGHMQGDGVAVVEQCLQVDELDDVVLLWVRQEVAG"
FT   gene            complement(608374..608493)
FT                   /locus_tag="HMPREF0675_3590"
FT   CDS_pept        complement(608374..608493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3590"
FT                   /product="hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   premature stop"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3590"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99996"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC54"
FT                   /protein_id="ADD99996.1"
FT                   /translation="MVVRRMKLILDRGEIQDYSLEGSDGRQLSEMTVGIIGAG"
FT   gene            complement(608855..609910)
FT                   /locus_tag="HMPREF0675_3591"
FT   CDS_pept        complement(608855..609910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3591"
FT                   /product="GroES-like protein"
FT                   /note="identified by match to protein family HMM PF00107"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3591"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00921"
FT                   /db_xref="GOA:D4HC55"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC55"
FT                   /protein_id="ADE00921.1"
FT                   /translation="MKAALVEQYHEPLAIRDIPEPAHDSDGVVVEVKACGVCRSDWHGW
FT                   QGEWPGFTGGSLPHIFGHEFVGLVSDIGNNVSRYRVGDRVIVPFTLGCGHCEYCRSGHS
FT                   NVCPTVSMPGFSYDGGFAQYVTVPDADANLVKLPDAVDFTDAAGMGCRLMTAYHGIVEV
FT                   GQIHPGDWLVVYGAGGVGLSATLVATSAGANVIAVDIADDKLALARKVGAIATINSRET
FT                   DPVEAVRELTDGGADKSVDALGISETLHNAVNSLRSRGTHIQIGMTAEGPVGDVALTIN
FT                   DLIAKEIDFRGSFGMPAVEFRYLLNQVAAGKMKPGQLVTKTIALSEVNDALTAMSTYNT
FT                   VGTTVITDFTR"
FT   gene            complement(610285..611424)
FT                   /locus_tag="HMPREF0675_3592"
FT   CDS_pept        complement(610285..611424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3592"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3592"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00376"
FT                   /db_xref="GOA:D4HC56"
FT                   /db_xref="InterPro:IPR026898"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC56"
FT                   /protein_id="ADE00376.1"
FT                   /translation="MQYPLTPKPVRRSGALPIVITVLGAIAILLIVALISAGSPVTFIV
FT                   GAIPSTAALIVCLLCYRWLDRWEPEPTRLTVMALIWGGSAGVIFSFLVEMAIPASEFVT
FT                   MAIVAPLAEELAKASVFILVATGARKLELTSLTDHIFYAGICALGFAFVENLGYFALSS
FT                   SAGEFVVMALVRTGFGVFGHPLYTTATAVGIWAWRTKGGLWKAAVGYIAACLLHGLWNG
FT                   GPTLLAGSLGLDDTGQLAAMILVYIVLFVPVFIGTIIMTTRNRRNEYEAVRSQLPLMVE
FT                   AGLVTPAEADMIADPRKRRAILADSGKYGRVAKRNQKRTITAATEAALAQHRIAAGEGG
FT                   PELIKRRDQLSEWLRSRPDKLGQLPLMPQFPPIQPPATW"
FT   gene            611446..615114
FT                   /gene="mfd"
FT                   /locus_tag="HMPREF0675_3593"
FT   CDS_pept        611446..615114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="HMPREF0675_3593"
FT                   /product="transcription-repair coupling factor"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF02559; match to protein family HMM PF03461;
FT                   match to protein family HMM TIGR00580"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3593"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00037"
FT                   /db_xref="GOA:D4HC57"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC57"
FT                   /protein_id="ADE00037.1"
FT                   /translation="MLWGGESSRTTSRVMVSVGTTTYPMLVTFGGLTSLLSREPVLSHV
FT                   VEDALTRRTPTLDLQVAASARPAVAAVLGRSLDGSGRLPVLLVTSTFREAEESVATLKT
FT                   WLGADAVCYYPSWETLPHERLSPRTDTVGRRMEVLRRLCGTEGEVPQVVVAPVRSLLQP
FT                   QVAGLGRVAPVRLAVGEEHDLTELATELVNAAYSRVDMVERRGEFAVRGGIVDVFPPVL
FT                   EHPVRIDFFGDEIEEMTSFAVADQRSTDETHQELICAPCRELILTDEVRSRAKALLTDH
FT                   PELADMLERIGNGQAVEGMEALMPALVDEMELLVDVLPEHAMVVLSDPEMVRSRAADLV
FT                   RTSEEFLGAGWAAAAGGGQAPIDLAASGYRSLAQVRSHCLERGMAWWSMSSFSLDSSAT
FT                   DVLVDDDITSAPQTVNPQLVAVEPWHGDVEAAVKDLTARLDDGWTVLLCAEGEGMAKRM
FT                   SELLGEHNVAARLVDDVDPDATEPCVQVIRLHQRHGFAAESVKLLVASTGDLAESQDPG
FT                   GTGERRMPRRRRNQIQPLELKPGDLIVHEQHGVGRYVEMVQRTVGGATREYLVIEYAPS
FT                   KKGQPGDRLFVPVNSLDQVTRYVGGDAPSLDRMGGGDWRKRKARARKAVREIAAELIKL
FT                   YAARQATKGHAFGPDTAWQRELEGAFAYVETPDQLTTFADVKRDMEQVVPMDRLVCGDV
FT                   GYGKTEIAVRAAFKAVQDGKQVAVLVPTTLLVQQHFQTFTERYAGFPVKVAALSRFQTD
FT                   TEARETLEGLQRGTVDVVVGTHRLLAKEVEFKDLGLVIVDEEQRFGVEHKEALKRMRVN
FT                   VDVLAMSATPIPRTLEMAVTGIREMSTIATPPEERHPVLTFAGPYDEGQVVAAIRRELA
FT                   REGQVFYIHNRVQSIEKTAAKLRELVPEARIVTAHGQMNEKQLEQIMVDFWERRADVLV
FT                   CTTIVESGIDISTANTLLIDRADLMGLSQLHQLRGRVGRSRERGYAYFLYPADKPLSQT
FT                   AHDRLATMAAHTDLGSGMAIAMKDLEIRGAGNLLGGEQSGHIADVGFDLYIRLVGDAVA
FT                   EFRGDSTTADEPEMRIELPVDANLPVEYVETERLRLEMYKRLAEVRSDEEVDAIGAELV
FT                   DRYGPMPEPVQALLGVARFRLLCRQAGIHEVVPAGRNIRFSPVNLPESRVMRLKRLYPG
FT                   SVVKQTAGLVLVPKPMTATIGGQPLGGADLLKWSADLVTNVLAVDTPIGAGRPTEP"
FT   gene            615176..615691
FT                   /locus_tag="HMPREF0675_3594"
FT   CDS_pept        615176..615691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3594"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3594"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99065"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC58"
FT                   /protein_id="ADD99065.1"
FT                   /translation="MTMRRRLGAAAVAVALVSVASGCASSPSNAATVGNTTVTMKSVDD
FT                   AVEHCSKFINPSSELTPRQIIASTVIRGAVAQEVLDKRGAKLSDAERDQIVARNGMAAL
FT                   DSDQVCHTMVRSFAGVFHLFDLEGDRKAKADLSAVDVKANPRLGSWDANNLVVQGSSSL
FT                   SQPFTKTS"
FT   gene            615700..616338
FT                   /locus_tag="HMPREF0675_3595"
FT   CDS_pept        615700..616338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3595"
FT                   /product="MazG family protein"
FT                   /note="identified by match to protein family HMM PF03819;
FT                   match to protein family HMM TIGR00444"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3595"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01099"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC59"
FT                   /protein_id="ADE01099.1"
FT                   /translation="MAAEYARPRAEFSELVEVMARLRDECPWDRSQTHRSLVTYLVEET
FT                   GEVIDAIEAGTDDDLVEELGDLLLQVVFHSRIGEQGGRFDINEVVGGIVAKLVARHPYV
FT                   FSDEEVPEDLDAAWEARKAAAKGRTSSLDGIAYSLSSVARSAKVISRARTRGVGVKLAD
FT                   EPITAAETGDQLVTLIARAQASGVDADQALRDRLRDLEDEIRKAECRTD"
FT   gene            616454..616984
FT                   /locus_tag="HMPREF0675_3596"
FT   CDS_pept        616454..616984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3596"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3596"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00069"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC60"
FT                   /protein_id="ADE00069.1"
FT                   /translation="MRRALAALFAAVVALGALSGCKGSANDPAGVTEVSDAPTASVPSV
FT                   SQSSGPKPTPQDVNPNTKLTATPQRGGLKDFLPGVTGIISDRVVTGSTSQTVVVKAGTV
FT                   TDYYFLCDTTDALMSVTENDESTASTPCHEGFAHLSVGKRAQSGQIELHIDAPENVTYE
FT                   FVITENPAEDQRQ"
FT   gene            617072..618352
FT                   /gene="eno"
FT                   /locus_tag="HMPREF0675_3597"
FT   CDS_pept        617072..618352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eno"
FT                   /locus_tag="HMPREF0675_3597"
FT                   /product="phosphopyruvate hydratase"
FT                   /EC_number="4.2.1.11"
FT                   /note="identified by match to protein family HMM PF00113;
FT                   match to protein family HMM PF03952; match to protein
FT                   family HMM TIGR01060"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3597"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99589"
FT                   /db_xref="GOA:D4HC61"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC61"
FT                   /protein_id="ADD99589.1"
FT                   /translation="MATIEFIEAREILDSRGNPTVEVEMILDDGTQARAAVPSGASTGQ
FT                   FEAVELRDGDKKRYSGKGVLKAVENVNEKIAEEVLGCDASEQRIIDQIMIELDGSDNKG
FT                   KLGANAILGVSLAAAHAAADCAELPLYQYLGGPNSHVLPVPMMNILNGGAHADSDVDIQ
FT                   EFMIAPIGAESFKQAYEWGAAVYHSLKKVLKDKGLATGLGDEGGFAPNLPSNAAALDLI
FT                   LDAIKAAGFEPGKDVALALDVAASEFFEDGKYTFEGQAKTSAEMIAYYEGLIAKYPLVS
FT                   IEDPLDEEDWDGWAEFTKKLGEKIQIVGDDLFVTNPKRLAKGIETKAANALLVKVNQIG
FT                   SLSETIDAVELAHRNGYRCMMSHRSGETEDTTIADLAVALSIGQIKSGAPARGERIAKY
FT                   NQLLRIEEELGDSAEYAGASAFPRFQA"
FT   gene            618439..619092
FT                   /locus_tag="HMPREF0675_3598"
FT   CDS_pept        618439..619092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3598"
FT                   /product="septum formation initiator"
FT                   /note="identified by match to protein family HMM PF04977"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3598"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01141"
FT                   /db_xref="GOA:D4HC62"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC62"
FT                   /protein_id="ADE01141.1"
FT                   /translation="MATTPSNRHRPSGRSQRPAGGRTHASSPNRSGPRNRGNYQRTTRT
FT                   EPPRNRATQEEGGQPRRFGLTLRAVVMGAAVLLVLVMITPSLGIYFSQRSQISRTQDDE
FT                   ARTRASISTLQDEVKRWHDPDYVRAQARSQLGWVMPGETGYQVIGENGKVIGSTTSLDE
FT                   KDPANEASADARWWRKAAGSVQDADHPAPPHPSPGAMITPTPSAKLSSPSPSRR"
FT   gene            619100..619642
FT                   /locus_tag="HMPREF0675_3599"
FT   CDS_pept        619100..619642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3599"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04417"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3599"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00629"
FT                   /db_xref="InterPro:IPR007511"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC63"
FT                   /protein_id="ADE00629.1"
FT                   /translation="MLEEFTENDRQDVRDQLGREPRGVAGVAWRCGCGKPGVIATEPRL
FT                   PNGTPFPTTYYLTCPRAASLIGTLESSGLMARMTERLGEDEELADQYRRAHESYIADRV
FT                   QIGEDAGLDPVPEIDGISAGGMPTRVKCLHALAGHALAVGPGVNPFGDEVVAELGEFWC
FT                   DPCAPEHREPESDRRIV"
FT   gene            619639..620571
FT                   /locus_tag="HMPREF0675_3600"
FT   CDS_pept        619639..620571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3600"
FT                   /product="Ppx/GppA phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF02541"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3600"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01120"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC64"
FT                   /protein_id="ADE01120.1"
FT                   /translation="MSGSHTVAAIDCGTNSIRLLIASADSDGRLVEQARELEMVRLGQG
FT                   VDATGSFRPDALERTFSACRTFAQAIADHHCDRVRFVATSAARDVSNRDAFFAGVRQAL
FT                   GVDAEVIDGMEEASLSFAGAISGIQVIDEPVLVIDCGGGSTELVLGRGSSIDSRVSLNI
FT                   GSVRLRERFLHDDPPTVEQIDDARKYVREALDSCPVDVAAARTVIGVAGTVTSLSAIGQ
FT                   NLTDYDRAKVHRSVLTVGQISDLAGKLLSSTVDEVEQMGPLKRRRAEVLCGGAVIIDEV
FT                   CRRATAGKLVVSETDILDGMALAMLAQGS"
FT   gene            620582..620655
FT                   /locus_tag="HMPREF0675_3601"
FT   tRNA            620582..620655
FT                   /locus_tag="HMPREF0675_3601"
FT                   /product="tRNA-Leu"
FT   gene            620803..621636
FT                   /locus_tag="HMPREF0675_3602"
FT   CDS_pept        620803..621636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3602"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06539"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3602"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00607"
FT                   /db_xref="GOA:D4HC65"
FT                   /db_xref="InterPro:IPR010539"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC65"
FT                   /protein_id="ADE00607.1"
FT                   /translation="MANPVFSRAEAFQPRGNPYGQPAYAGQGYRAQYGVSGQPGGESGS
FT                   LLDGPQGQSAERAMTFDDVLGRTGLVLLIIAAIGAVSFALIGPNVVASGPALVVGSIAA
FT                   FITAMVVSTRRTVPVGGVIFYCICEGLVLGSMSAMFETAYPGIVVQAVLGTFAAAGVTL
FT                   AAYKFFNIRVTPRFRQIVIISTFGFALAMLVNLVLMLFRINIGVASFGPIGILCSALGV
FT                   VLAAMNLVVDFDYAEQGVRNQAPASESWRAAFGIAVTMVWLYTEILRILSYFRAD"
FT   gene            complement(621708..622403)
FT                   /locus_tag="HMPREF0675_3603"
FT   CDS_pept        complement(621708..622403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3603"
FT                   /product="hydrolase, NUDIX family"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3603"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01230"
FT                   /db_xref="GOA:D4HC66"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC66"
FT                   /protein_id="ADE01230.1"
FT                   /translation="MLITAVGTPGSGQTHAFRVRHGMNPHVELWRHGLVVREYLSADRV
FT                   DDEIVVTAHVAPRTSSSQPPRTRKSVPDLSEDRQADEPVRPYQRIAAYAVVRSRRGLLG
FT                   TECSPRTAVPGLWALPGGGLEPGESPAQAVTREVMEESGQRVRLNRIIDLQSDHWIGRS
FT                   PTGVLEDFHALRIIYSATSENPTDPYVIDVGGTTQSAQWIPLWRWRRLSWGAATRMCLE
FT                   THLRDVPST"
FT   gene            complement(622480..623319)
FT                   /locus_tag="HMPREF0675_3604"
FT   CDS_pept        complement(622480..623319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3604"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3604"
FT                   /db_xref="EnsemblGenomes-Tr:ADD98997"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC67"
FT                   /protein_id="ADD98997.1"
FT                   /translation="MVPSSKVTASVSPLDGIHTRAIINELVAASGNGPITKVDITKGAL
FT                   SITVQIGNSPTIWTWQNGKIDSSATQSTQTASRPFNPGDFAVEKLPVILSRAADISGSH
FT                   MNQNLQIVEYNQGTVLMTVSTKPETQTVFFRPNGSAINHIDFASTSGMTEALSDAVASA
FT                   KQVDQISYQPGKAIIVDTPTTTPGIVMRRTRSADMPAWAVQRRSDASATFSPGLLNPHV
FT                   IVRIMNLAAAQAHQKPSDMEWTISQDTKLDTPVLRVDINGLTRAFNTDGTDVTDKIK"
FT   gene            623519..623653
FT                   /locus_tag="HMPREF0675_3605"
FT   CDS_pept        623519..623653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3605"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3605"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99591"
FT                   /db_xref="GOA:D4HC68"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC68"
FT                   /protein_id="ADD99591.1"
FT                   /translation="MKMRLFCGFVLVVGVCVVCVSGFALVGVGLVGVLVVPLVGLLGA"
FT   gene            623749..623883
FT                   /locus_tag="HMPREF0675_3606"
FT   CDS_pept        623749..623883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3606"
FT                   /product="hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3606"
FT                   /db_xref="EnsemblGenomes-Tr:ADD98998"
FT                   /db_xref="GOA:D4HC69"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC69"
FT                   /protein_id="ADD98998.1"
FT                   /translation="MWAGLCDLVCAGMVFRAAALVVVWLAGSAGWFWDRGFVVSGLVW"
FT   gene            624158..625664
FT                   /gene="rrsA"
FT                   /locus_tag="HMPREF0675_3607"
FT   rRNA            624158..625664
FT                   /gene="rrsA"
FT                   /locus_tag="HMPREF0675_3607"
FT                   /product="16S ribosomal RNA"
FT   gene            625900..628978
FT                   /gene="rrlA"
FT                   /locus_tag="HMPREF0675_3609"
FT   rRNA            625900..628978
FT                   /gene="rrlA"
FT                   /locus_tag="HMPREF0675_3609"
FT                   /product="23S ribosomal RNA"
FT   gene            629092..629208
FT                   /gene="rrfA"
FT                   /locus_tag="HMPREF0675_3611"
FT   rRNA            629092..629208
FT                   /gene="rrfA"
FT                   /locus_tag="HMPREF0675_3611"
FT                   /product="5S ribosomal RNA"
FT   gene            630234..630635
FT                   /locus_tag="HMPREF0675_3612"
FT   CDS_pept        630234..630635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3612"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3612"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01006"
FT                   /db_xref="GOA:D4HC70"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC70"
FT                   /protein_id="ADE01006.1"
FT                   /translation="MSGLPVTFIGYCIINGLGFLIDMSLLAVFFRGVGLPYPVSVSLGY
FT                   GLSAVYSFVVNRWLNFHSHGNLGRQSGRYVVTMVTNYVCLTLGLSSLLESLGVHFELAR
FT                   FTAACVEGLYVYLMLSIWVFPKSGRRQLA"
FT   gene            630710..632698
FT                   /locus_tag="HMPREF0675_3613"
FT   CDS_pept        630710..632698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3613"
FT                   /product="oligopeptide transporter, OPT family"
FT                   /note="identified by match to protein family HMM PF03169;
FT                   match to protein family HMM TIGR00728; match to protein
FT                   family HMM TIGR00733"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3613"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99508"
FT                   /db_xref="GOA:D4HC71"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="InterPro:IPR004814"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC71"
FT                   /protein_id="ADD99508.1"
FT                   /translation="MSDLSSSSAPARRPGTSVRELTFRGIVLGGLMTLIFTAANVYLGL
FT                   KVGLTFATSIPAAVISMAVLRHFKGHSVEENNIVQTIASAAGTLSAIIFVLPGLIMVGW
FT                   WSGFPYWTTLAICLVGGILGVMYSIPLRRALVTGSDLPYPEGVAGAEVLKVGDSAGAAE
FT                   ANKVGLRVIIVGSVVSAAYALLSDLKLVKSALTKPFKTGDSSGSMVGVSMSMALIGVGH
FT                   LVGIAVAAAILVGLFISYGAILPWRVSGKVGSDLTVIQDVFTSDVRFVGAGTIGVAAIW
FT                   TLVKVIGPIVKGISDSISSSKTRHEGGEVPLTERDLPVSVVLTVVLISMIPIGFMLWGF
FT                   ARDMVVSRSMTGVIIVSLAFILLVGLAVASVCGYMAGLIGASNSPISGVGILVVLVAAL
FT                   LIKLTYGAVGGGETVKLVAYTLFTASIVFGIATISNDNLQDLKTGQLVGSTPWKQQIAL
FT                   IIGVIFGSAIIPPVMQLMQSAFGFQGAPGAGPNALQAPQATLISSLATGVFGGALDWGL
FT                   MGIGALVGIGVIVVDEILTHTTKKFSLPPLAVGMGMYLPMTLSLTIPIGAALGWLFDKW
FT                   AAHTAGDVEGKKRTGILLATGLIVGESIFGVIYAAMIAAAGSEDAIAIAPESWDSGAGI
FT                   VGVITFAAAIAFLYRWTKRQAKERVEA"
FT   gene            complement(632741..633604)
FT                   /locus_tag="HMPREF0675_3614"
FT   CDS_pept        complement(632741..633604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3614"
FT                   /product="oxidoreductase, aldo/keto reductase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3614"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99917"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC72"
FT                   /protein_id="ADD99917.1"
FT                   /translation="MKYRQIGPFRTSAIAYGSMPLSIEGRPDRETAINILHDVLDAGCT
FT                   HIDTAWAYYESGGVEQYGERLVTDALASWDGDHSTISVATKVGHFRCFNDAGQPVWDVD
FT                   GSPERLRRDAKLSAEALRTDQIDLLYLHRPDPKVEYEGMVRTLAGILDDGLARTAGISN
FT                   ANPDQIRLAHSILGDRLVAVQNQFSPGFLSSRPELELCGELGLAFVAWSPLGGYRRPLD
FT                   EDAFAAFQRIADARGISRAQVILAWELSKGPHVIPIPGSHRSQTILDSLRSVDVTLNDE
FT                   ELAQLP"
FT   gene            complement(633719..634351)
FT                   /gene="msrA"
FT                   /locus_tag="HMPREF0675_3615"
FT   CDS_pept        complement(633719..634351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrA"
FT                   /locus_tag="HMPREF0675_3615"
FT                   /product="peptide-methionine (S)-S-oxide reductase"
FT                   /note="identified by match to protein family HMM PF01625;
FT                   match to protein family HMM TIGR00401"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3615"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99360"
FT                   /db_xref="GOA:D4HC73"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC73"
FT                   /protein_id="ADD99360.1"
FT                   /translation="MNKTEMVSSENALPGGHTPVLAMPFFHRVTGDRLDRPFPSSETIY
FT                   LAMGCFWGAEKLFWNTNGVLQTAVGYMGGLTPNPTYREVYTGCTGHAETVRVTYDPTQV
FT                   STEAILTIFLENHDPTQGMRQGNDVGTQYRSAIWCTTTEQFMTATTVKGSYQANLLNAG
FT                   YGAITTAISMANGVEFYLAEAEHQQYLEDNPFGYCPVHATGVCLAGS"
FT   gene            634508..636127
FT                   /locus_tag="HMPREF0675_3616"
FT   CDS_pept        634508..636127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3616"
FT                   /product="Sodium:neurotransmitter symporter family protein"
FT                   /note="identified by match to protein family HMM PF00209"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3616"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00306"
FT                   /db_xref="GOA:D4HC74"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC74"
FT                   /protein_id="ADE00306.1"
FT                   /translation="MSDPAQSGATVAGGGRATRKPQRRESFAGRGAFLIAAIGSAVGLG
FT                   NIWRFPYVAYSNGGGAFIVPYLVALLTAGIPLLFLDYAVGHKFRGSPPMALRRLHRRME
FT                   AIGWWQTLICWVIVIYYAVIIAWAIRYVGFSVTKTWGHDPEGFLTGSFLHVASNVDVEF
FT                   HFVSGVFWPLLLLWLFVLAIMATGVEKGITRASWIFMPLLAVMFITLVIVALTLDGASV
FT                   GLNALFTPSWGALGNYRVWMAAYGQIFFSLSVGFGIMVTYASYLKPKSDLTGSGLVVGF
FT                   ANSSFEILAGLGVFAALGFMATASGKPVSEVAGSGIGLAFIAFPQIISQAGAVGPILGV
FT                   LFFVSLVFAGITSMISLLEVVIAAFREKTGISRKAATWIIGGVTAIASIVLFPTTTGLN
FT                   LLDVTDHFINNIGIVGVALLACLVISWALRKLPVLRDHLNEYSSFQVNKVWMALVSVVA
FT                   PLVLLSLWITEIITVASKGYGEMPRNFVGIFGWGMSILVVVLAIVLSLIPWPHRSAIHH
FT                   ELTHEEELACENFQETEEGALS"
FT   gene            complement(636256..636939)
FT                   /locus_tag="HMPREF0675_3617"
FT   CDS_pept        complement(636256..636939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3617"
FT                   /product="putative uracil-DNA glycosylase"
FT                   /note="identified by match to protein family HMM PF03167"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3617"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99840"
FT                   /db_xref="GOA:D4HC75"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC75"
FT                   /protein_id="ADD99840.1"
FT                   /translation="MVAHPVAELVTPDWAEALTGVEPRIHEMGDFLRAETAAGRGFLPH
FT                   GDRILRAFSRPMADVRVLIVGQDPYPTPGHPVGLSFSVERDVRPLPRSLQNIYTELQSD
FT                   LGIAPCEHGDLTGWFEQGVLLLNRCLTVQPGRPASHRGKGWEEVTQTAIEALVARGGPL
FT                   VAILWGRDAQSLEPMLGKVPIVKSSHPSPMSARYGFFGSRPFSRTNELLVQQGADPINW
FT                   DLSSH"
FT   gene            637041..638267
FT                   /locus_tag="HMPREF0675_3618"
FT   CDS_pept        637041..638267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3618"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01594"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3618"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99001"
FT                   /db_xref="GOA:D4HC76"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC76"
FT                   /protein_id="ADD99001.1"
FT                   /translation="MKLFSSGRKTPTSSPASSHAGAMDETVGVTSTSEAANVATQPVPT
FT                   PVEDVPNGVRTAAGWCWRMIVIAAFIYGLYQVLHAASEVSVPVAVALMLTAAMWPLANW
FT                   LSRHHIHRGIASGICLLLLVILVGGVFTLVGAQIALQWRQLGDQSVASFKQALQWLAKS
FT                   PLHTNEAQLTHLMQKAEAAMAGSQGRIASTAAAAGSQIGRFGAGLVMALFATFFFVYEG
FT                   DKLAEKSAVLIPREHRAAILDAAKRGWVALVAYVRAAVIVAFVDGLGAGIGAAIIGSSM
FT                   SVAIGALTFILAFVPIVGALTAGVVAVGVVLVTLGFFKAFIMLIVFVAVMQIEGHVLQP
FT                   FLLGKAVSIHPLIVLLGIAVGAIISGIVGALFAIPIVAFGVAFIKALNPETPANEVPPN
FT                   HDDLAAEHT"
FT   gene            complement(638271..638660)
FT                   /locus_tag="HMPREF0675_3620"
FT   CDS_pept        complement(638271..638660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3620"
FT                   /product="hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3620"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00839"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC77"
FT                   /protein_id="ADE00839.1"
FT                   /translation="MSTLLSESLPPLARRDPDDTVEATVSPTLSAIPDTTRHADRSPSF
FT                   ASEGMVNPPSELLSAPGASSSEAPCRGPGPQSGPLVTPDVGWSCPAAAIRRLASAVSIL
FT                   PAARSSRIAVMSALMTSTLRGSPTG"
FT   gene            638659..639288
FT                   /locus_tag="HMPREF0675_3619"
FT   CDS_pept        638659..639288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3619"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3619"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99514"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC78"
FT                   /protein_id="ADD99514.1"
FT                   /translation="MTTDLDRVRINCSGRRIRLIGDRSIPGVQIGGKHTRRRIGRVVEI
FT                   GIDGHLAPDLGVLKRFRFPTGMDGVKDLSFGREVTVRVHSDLPVDIELSGGSLRASGVE
FT                   RFGRVRVTAGVTEIDGVHQIEDGLFQAGSGSITGRIDTGRSQIRVESGNLNIKLAGGSN
FT                   VSVRGKAQTGMISWPEGGEVDEYVMGNGSARLDLTCLVGRIAVRAL"
FT   gene            complement(639393..639899)
FT                   /locus_tag="HMPREF0675_3621"
FT   CDS_pept        complement(639393..639899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3621"
FT                   /product="prokaryotic transcription elongation factor,
FT                   GreA/GreB domain protein"
FT                   /note="identified by match to protein family HMM PF01272;
FT                   match to protein family HMM PF03449; match to protein
FT                   family HMM TIGR01462"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3621"
FT                   /db_xref="EnsemblGenomes-Tr:ADD98981"
FT                   /db_xref="GOA:D4HC79"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC79"
FT                   /protein_id="ADD98981.1"
FT                   /translation="MPESEDTVWLTQEAFDKLTQELEYLKGEGRTAIANKIADARSEGD
FT                   LSENGGYHAAREEQGQAEARIRQLEQMLRNAEVGEAPSSPDEVVPGSKVTVCYFDDESD
FT                   TDTFLLGSRQVMGLDDSVNVSVYSPQSPLGGAILGHSKGESTEYQAPNGKTIKVTILNV
FT                   EPFEE"
FT   gene            complement(639921..640346)
FT                   /locus_tag="HMPREF0675_3622"
FT   CDS_pept        complement(639921..640346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3622"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3622"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99331"
FT                   /db_xref="GOA:D4HC80"
FT                   /db_xref="InterPro:IPR025443"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC80"
FT                   /protein_id="ADD99331.1"
FT                   /translation="MGHVPTPDHSLTDEARERIANRYPSPRRAPWVVLIIVLAVILIGW
FT                   TVWTGLYHADQPIRASLHGYQAVSDSRVDVTIKLHRPDPSVAGSCTLVATGADHVRVGE
FT                   TTVTFPASSSQDETIRASVKTFSRAVTADLEKCGPIR"
FT   gene            640642..642657
FT                   /locus_tag="HMPREF0675_3623"
FT   CDS_pept        640642..642657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3623"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03190"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3623"
FT                   /db_xref="EnsemblGenomes-Tr:ADD98957"
FT                   /db_xref="GOA:D4HC81"
FT                   /db_xref="InterPro:IPR004879"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR024705"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC81"
FT                   /protein_id="ADD98957.1"
FT                   /translation="MPNYLGESTSPYLIQHAANPVDWFPWGEEAFDEARSRDVPVMVSV
FT                   GYSSCHWCHVMALESFSDPEVAEVVNANVVPVKVDREERPEVDAALMQVTLAMTGQGGW
FT                   PNTVFLTPEGKPFFAGTYFPPVRRGRLPGFVELVEALGGAWRERRDEVVSSAEAIVEHL
FT                   RPVEKDPEVARPIAGELIDAVGADYDIVHGGFGSPTKFPMPTLLDALLVKGDPTSLDMA
FT                   QNTCEHLVRGGIFDQVGGGFHRYSTDSQWVVPHFEKMLYDNALLLATMARCWRRTADHD
FT                   SDRRDLYSHAARRTVAWLNREMRLPNGLYAAGLDADSDDAAGHTHEGIYYLWNQDLITD
FT                   ALGTDEAEWLRPLVHLEPCNDNGLGTLQLRGRVEWERINADMDTLLEARGRRSAPARDE
FT                   KAITAWNAMLIDGLVEAGMILREWSWVEQARELADSLWTAHWDHGMALRTSFHDRPGVP
FT                   AVCEDYAWVALSFAGLAGATGESVWLDHAVEVLGEAVARFSAVDGSFLDAEDSFLLTVT
FT                   AHTLTDDACPSPTAAMVMALRRVGLMAERADFIERANKASVALLPVVSATPRFAGWAVA
FT                   DFLITDEARRGLKPAGVVIADTTDEPSDLAAAAWRMAPAGSAIMRRLNEDSGFGTWFNE
FT                   RVPRDGQPTCWVCRGAVCFEPVTDYLDLKEPLWRRA"
FT   gene            complement(642679..643500)
FT                   /locus_tag="HMPREF0675_3624"
FT   CDS_pept        complement(642679..643500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3624"
FT                   /product="putative
FT                   di-trans,poly-cis-decaprenylcistransferase"
FT                   /note="identified by match to protein family HMM PF01255;
FT                   match to protein family HMM TIGR00055"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3624"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99580"
FT                   /db_xref="GOA:D4HC82"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC82"
FT                   /protein_id="ADD99580.1"
FT                   /translation="MSSLDHRLSKVSETLDRMHPSGLLYTTYEARLLDQLDRSRLPQHV
FT                   AVLADGNRRWARLNAPGEPLVAGYEAGADRLREFCTWCDAVGIPIITLWVLSTDNLQRA
FT                   ETGELGPLLKVIESLVDSLADNSRWRVQAVGDLDLLPDDMAESLCRAGRTSIGHVGMHI
FT                   NVAVAYGGRHELRDAFRSLLAEEAEKGTSLADLARTLEIDQIEDHLYTRGQPDPDLIIR
FT                   TSGEQRLSGFLMWQSAHSEFYFCEALWPDFRKVDFLRALRSFTQRERRYGR"
FT   gene            643627..644316
FT                   /locus_tag="HMPREF0675_3625"
FT   CDS_pept        643627..644316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3625"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03006"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3625"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00249"
FT                   /db_xref="GOA:D4HC83"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC83"
FT                   /protein_id="ADE00249.1"
FT                   /translation="MRGGRRMATGCSSKTKNRSSVLPKPRLRGWVHTVMAPLILLAGVG
FT                   LMIATPTWGNRFAVGVWMLTGLELFGNSAVYHRVPWGAKVKDVLRRIDHANIAVFIAGT
FT                   YTPLAVSLATGASRVILLAIIWACALLGVAFRFVWNGVPRWASTILYVVMGWTALWWLP
FT                   QFWRTCGPAVVILILIGGVFYTVGAISYARQKPNPSPTWFGFHEVFHSCTAVAAICHAV
FT                   AIGLAVI"
FT   gene            644463..645812
FT                   /locus_tag="HMPREF0675_3626"
FT   CDS_pept        644463..645812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3626"
FT                   /product="PhoH family protein"
FT                   /note="identified by match to protein family HMM PF02562"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3626"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00926"
FT                   /db_xref="GOA:D4HC84"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC84"
FT                   /protein_id="ADE00926.1"
FT                   /translation="MSVRPEGSERAHSLIPEAPEGRRTYVLDTSVLLSDPRALLNFAEH
FT                   EVVVPIVVITELEGKRHHPELGHFARAALRILDRLRLENGGLVGPVPVNNEGGVLLVEL
FT                   NHSDPLCLPDGFRLGDNDTRILAVAQSYRLAGHSVVLVTKDLPLRVKASAIGLEAEEYR
FT                   HELVPSSGWTGMVNLEVPDEMISTLYEEGSVVDSIFDEIPVHAGLVLEGPNGTALARRM
FT                   SDASARLVPNDQEAFGIRGRSAEQRIALDILLDPQVGIVSMGGRAGTGKSALALCAGLE
FT                   AVMERQLHKKVMVFRPLYAVGGQDLGYLPGDEGDKMAPWGQAVLDTLTSVTNNYVIEEV
FT                   MSRGMLEILPLTHIRGRSLHDAFVIVDEAQSLERNVLLTVLSRIGQNSRVVLTHDVAQR
FT                   DNLRVGRYDGVAAVVERLRGHDLFGHVTLTRSERSPIAALVTSMMEDMVG"
FT   gene            645832..646407
FT                   /locus_tag="HMPREF0675_3627"
FT   CDS_pept        645832..646407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3627"
FT                   /product="hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3627"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00262"
FT                   /db_xref="GOA:D4HC85"
FT                   /db_xref="InterPro:IPR025339"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC85"
FT                   /protein_id="ADE00262.1"
FT                   /translation="MGGICNNQQVPRNPRAGVKDMLLSLAIILVPVMLIVWFFTRTPDE
FT                   PNIQQVDWKPVVASARSRAGYPVLAPKEVPEVWRPTKARYANKGDRWVGNTISAGDRWE
FT                   LGFLTSKNVYLAVDQSDEPGRAFVASVTRSATEDGKVSVGRYIWTKMVSPDDRTHALVT
FT                   KIGSATAVVVADTDYRVLTDFAGMLTTS"
FT   gene            complement(646434..646670)
FT                   /gene="xseB"
FT                   /locus_tag="HMPREF0675_3628"
FT   CDS_pept        complement(646434..646670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="HMPREF0675_3628"
FT                   /product="exodeoxyribonuclease VII, small subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="identified by match to protein family HMM PF02609"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3628"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00962"
FT                   /db_xref="GOA:D4HC86"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC86"
FT                   /protein_id="ADE00962.1"
FT                   /translation="MTDTTPNSAPEEPEITYEAARDELVEIVTRLESGGISLAETMTLW
FT                   ERGEKLADICQSWLNGARARIEAARSDAETAQP"
FT   gene            complement(646667..647914)
FT                   /gene="xseA"
FT                   /locus_tag="HMPREF0675_3629"
FT   CDS_pept        complement(646667..647914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseA"
FT                   /locus_tag="HMPREF0675_3629"
FT                   /product="exodeoxyribonuclease VII, large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="identified by match to protein family HMM PF01336;
FT                   match to protein family HMM PF02601; match to protein
FT                   family HMM TIGR00237"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3629"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99263"
FT                   /db_xref="GOA:D4HC87"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC87"
FT                   /protein_id="ADD99263.1"
FT                   /translation="MVEPNAADNPRSLAWVVNAVKGWVERCGAIWVQAQVIEITRRSSP
FT                   TQFLTLRDPIEEISASATCHRRVLDAAGPIETGMTVTALIRPTVWSRTGRLSFEISEIT
FT                   PTGEGQLLAQLERRKRLLEAEGLFDVTLHRPIPVSPRGIGLITGAGSDAERDVQRHATL
FT                   RWPAARFVVHNTRVQGPMAAQQIIAALADLDADPTVDVIVIARGGGPLEDLLPFSDEAL
FT                   VRAVYATRTPVVSAIGHDRDNPILDLVADLRASTPTDAGKLIVPDAAEQSQAIETARAQ
FT                   LRQAVTRFIDVESGHLSQIRSRPVMVNPAATLDIAVERLDSTLQRLRLATHRVLDAESR
FT                   DVNHMLERVRAMSPKATLDRGYAILADTEGDSITSVNDTNARANLLVYLSDGTLSVTVD
FT                   SLDRRTPNRPTFQEDS"
FT   gene            complement(647995..649932)
FT                   /locus_tag="HMPREF0675_3630"
FT   CDS_pept        complement(647995..649932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3630"
FT                   /product="phosphoesterase family"
FT                   /note="identified by match to protein family HMM PF04185;
FT                   match to protein family HMM TIGR02276"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3630"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99911"
FT                   /db_xref="GOA:D4HC88"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC88"
FT                   /protein_id="ADD99911.1"
FT                   /translation="MVDVASHRQTATIPVNRNGSKLVGANPTGLALSQDGKRLYVTNSG
FT                   HNEVAVINAATRKVIGDIPTGWYPTQVLAHDGKLSITSAKGLGAGPNNGPGHPNPTDPR
FT                   DTAENQYSGSMIKGLLSTVSEPDAATLAKLTATVEKNNTANDPARSSAVPNQIGTTSSK
FT                   IKHVIYIVRENRTFDQELGSNGRGNADPSLNLFGEESAPNTRALARQFTTFDNFYADAE
FT                   VSANGWNWVSQANSNPWSEEMWPSNYSGRGAPYPAESNDPDSRAKEHDSYFWEHLSKNN
FT                   ISFRNYGFYTTLDKKGKAHGVDKKILDPNTDHDFIGWSLDCPDSARSFAPMAKNCGPKS
FT                   RVDEWKSDFNKQLAKGSVPTVQLVRFGNDHTQATKVGVPTPQAYVADNDQAIGQLVETV
FT                   SHSPIWKDTAIFLTEDDAQNGPDHVDAHRTIGEVISPYTRTGGVDSTFYSTVSMLHTME
FT                   GILGIGPLTQFDAFSTPMSAAFTDKPDLTPYQAASPSYDMKTLNTPKAPMAKESGEQDT
FT                   TKEDDIDEQVFNKAIWKAVKGARSTMPEPKHSVIQSGPVLTYDDDDDEGEKLKPGDVDL
FT                   DELGSYSKDAKGFPVWTPDDKRFDPAQGIDPCSPKPGPTLTPTVPTAVMPSNSTHRGEG
FT                   RHPGLPRTGV"
FT   gene            complement(649955..650803)
FT                   /locus_tag="HMPREF0675_3631"
FT   CDS_pept        complement(649955..650803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3631"
FT                   /product="hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3631"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00555"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC89"
FT                   /protein_id="ADE00555.1"
FT                   /translation="MPFLFPKFWVMSAPHDTHVSRRLRRGLASACAVVTAIAAFSPAHA
FT                   APSPNKAGPMSGSTGRTTVGQLLTPAGQLTTLGDLPLNEALSPDGRYLIVSNNGQGTQS
FT                   LQVIKTATGKVVQTIPYKSPESLYMGLAFSPDGTHLFASAAGNHKIRTYHFDCGKLVET
FT                   SAIQMPVVSPKLTKVNLYPAGLAVTNDSKRLVVADQLADAVSVIDLATNKIQTTHIGHR
FT                   PVWVTLSKDSTKAFVSSQGGADVAEVDITKSQPLATHKINVGFHPNKSVLTPRWQVPLR
FT                   R"
FT   gene            650923..651894
FT                   /gene="ispH"
FT                   /locus_tag="HMPREF0675_3632"
FT   CDS_pept        650923..651894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispH"
FT                   /locus_tag="HMPREF0675_3632"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase"
FT                   /EC_number="1.17.1.2"
FT                   /note="identified by match to protein family HMM PF02401;
FT                   match to protein family HMM TIGR00216"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3632"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00116"
FT                   /db_xref="GOA:D4HC90"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC90"
FT                   /protein_id="ADE00116.1"
FT                   /translation="MAVTGACTNKKLYLAAPRGYCAGVDRAVVTVEKALEVYGAPVYVR
FT                   KQIVHNRHVVETLEGRGAIFVDELDEVPDDALVVFSAHGVSPQVKKEATDRGLRTIDAT
FT                   CPLVTKVHHEAKRFANQDTQILLIGHAGHEEVEGTTGEAPENITLVQTPADVDGLALDR
FT                   DRPVAWLSQTTLSVDETVETVDRIRDLHPQLIDPPSDDICYATQNRQHAVKQMAPQCDL
FT                   VIVVGSKNSSNTGRLVEVALESGAKASYRVDNAGEIEETWLDGVSTIGVTSGASVPEAL
FT                   VQGVIDLLISKGWPPAEEETLIEESLSFALPPQLRKRRTTAK"
FT   gene            complement(651898..653118)
FT                   /locus_tag="HMPREF0675_3633"
FT   CDS_pept        complement(651898..653118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3633"
FT                   /product="putative flagellar protein FliS"
FT                   /note="identified by match to protein family HMM PF02646"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3633"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00493"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC91"
FT                   /protein_id="ADE00493.1"
FT                   /translation="MTNIVVGLIGLAIGVALGWLIAQLRTSQRIAEATSAARVATERLE
FT                   AAEKIATDRDALATQFKALSAQSMADQNERATQSAQRTMSDAQRLLAPVSLALERLDRR
FT                   LAEVEQERTDMTASLREQVAGVSTAGESLRKETASLVAALRKPQIRGAWGEMQLQRTAE
FT                   VAGMLEHCDFQTQQTTTAQGAPQRPDMTVKLSGRRCIHVDAKTPLAAFLEAAQCDDAEE
FT                   YDAQMARFARHVRTHIDQLSAKGYWRTDLDSPEFVVCFLPSDALLQAALQEIPDLHEYA
FT                   NRRGIVLASPSVLIPMLRTVALAWRQEAVARSATEVAALGRDLHKRLGTLAGNLDKMGR
FT                   SLTSTVRAYNSALGSLETRVLVQARRFEHLGVTADDIASPAPIEEAVRPLTSPELTENQ
FT                   TEVGLPE"
FT   gene            653197..654483
FT                   /locus_tag="HMPREF0675_3634"
FT   CDS_pept        653197..654483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3634"
FT                   /product="aminopeptidase I zinc metalloprotease (M18)"
FT                   /note="identified by match to protein family HMM PF02127"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3634"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99156"
FT                   /db_xref="GOA:D4HC92"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="InterPro:IPR023358"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC92"
FT                   /protein_id="ADD99156.1"
FT                   /translation="MVVMADKSVPTSDHIRDIISFVEASPTSYHAVAELTRRLEQAGFQ
FT                   RLEETESWPSVEGRRYVVRDGAVIAWITPEKVTPQLGARIVGSHTDSPSFKLKPNATVT
FT                   NQGWQQVGMEVYGGGLLNSWLDRDLGLSGRLVTCDGQAHLVRTGPILRISQLAPHLDRT
FT                   VNDDLKLDRQRHLMPILSVGKPDLDVEDLLCEAAGIKRDELAFHDVFAHLTQSPAVIGP
FT                   YGEFLASQRMDNLSSVHSSVAAFVDVKPTSDVAVMACFDHEEVGSATRSGACGPFLEDV
FT                   LVRIAEGFGMTGAAYRAMIAKSSCVSSDAGHGVHPNYVEKFDPANHPLLNEGPLLKINA
FT                   HQRYATDGVGGALWQRACAAAGVPTQNFVSNNSVPCGSTIGPLTATRLGMLTVDVGVPL
FT                   MSMHSTRELAGTADLTYLSKALGAYWAGA"
FT   gene            654632..655705
FT                   /gene="ychF"
FT                   /locus_tag="HMPREF0675_3635"
FT   CDS_pept        654632..655705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ychF"
FT                   /locus_tag="HMPREF0675_3635"
FT                   /product="GTP-binding protein YchF"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM PF06071; match to protein
FT                   family HMM TIGR00092"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3635"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99636"
FT                   /db_xref="GOA:D4HC93"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC93"
FT                   /protein_id="ADD99636.1"
FT                   /translation="MALTIGIVGLPNAGKSTLFNALTKNDVLAANYPFATIEPNVGVVG
FT                   VPDKRLDVLTEMFHSAKTIPATVSFVDIAGIVKGASKGEGMGNEFLSNIREADAICQVT
FT                   RCFADDDVTHVNGHVDPSDDIETITTELVLADLQTMEKQLPKLQKEAAIKKESRPKVEA
FT                   WEQAKAVLEEGKTIFSAGLDPEPLHDLFLLTTKPFIYVFNCDQDQLADADFQAKMEKLV
FT                   APAEAIFLDAEFEAELAEMEPEDAAEFLADAGIEEPGLDKLARVGFDTLGLQTFLTAGE
FT                   KESRAWTIHKGDTAPEAAGVIHTDFQKGFIKAQVVSFGDLVEFGGEKEAQAAGKLRLEG
FT                   KEYVMQDGDVVEFRFNV"
FT   gene            655812..656573
FT                   /locus_tag="HMPREF0675_3636"
FT   CDS_pept        655812..656573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3636"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3636"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00166"
FT                   /db_xref="GOA:D4HC94"
FT                   /db_xref="InterPro:IPR007759"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC94"
FT                   /protein_id="ADE00166.1"
FT                   /translation="MVSEAKEPLHYSEIAQRILDSGLRQQTGATPAATVAATISTTLRK
FT                   NVVRVDRGVYSLRTPQSVPPEEPETELPDSRGVIPPTALEAGEENNGFLNAFGMFWRRD
FT                   EVDWDKRGQTLLGAQLKVAKPVNFSGQVGVYILYSGERVICVGRITEPRLGPRLWDHTR
FT                   DRLAGRWDRFSWFGVLIAKDDGTLGDVPCGNFAVGMLVSTMEALLIEGLEPPQNRRRGD
FT                   GFNATEFIQATDPEVERRRAKQLLFKLTDSK"
FT   gene            complement(656651..657118)
FT                   /locus_tag="HMPREF0675_3637"
FT   CDS_pept        complement(656651..657118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3637"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3637"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00661"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC95"
FT                   /protein_id="ADE00661.1"
FT                   /translation="MAVPVDFTTVSAQGLETSEHPEALAGLRANEARYFHNKFKHTFEV
FT                   SPASEEPYALAWVTQILAEERDITIASPALEISINDVEGIHWVHVFYASGLAINVLWTV
FT                   ANSGKRAVGFKLCDGMDQPAELSAFKFARQRSKLAGTIRGSYFVIKGDYPY"
FT   gene            complement(657181..658407)
FT                   /locus_tag="HMPREF0675_3638"
FT   CDS_pept        complement(657181..658407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3638"
FT                   /product="transporter, major facilitator family protein"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3638"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99926"
FT                   /db_xref="GOA:D4HC96"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC96"
FT                   /protein_id="ADD99926.1"
FT                   /translation="MPEPQLRYDERSPFIVHMLLLAIIYLAFISLGLPDSLVGAGWPAM
FT                   HESLGVPLSCAGFITFIIATGTIISSLMSDRLTTRFGPGRVTAASVALTAAALFGFSFS
FT                   TQFWVLCLWAMPYGLGAGTVDAALNNYAALHYTARHMNWLHGCWGLGASISPFIMSQAL
FT                   SSGHGWPSAYRTVGTLQAILTAIVTVSLPLWNKTRKINGGGSAKLFDHVPTRAALATPG
FT                   VPAVLGAFFSYCAVESTSMLWAASYLVSVRGTDGATAAAFASLFVLGITAGRFLAGFVA
FT                   ERIGDRMLVRGGFITVGVGVVLVGLPGVPSWVALAGLVIAGLGSAPIYPAIIHSTPTTF
FT                   GAHNSQAIIGIQMAAAYVGTTLAPPLFGAISANTGLWTLPLYLIVLVIFGLVMSEHVTR
FT                   RERARAQDG"
FT   gene            complement(658474..658905)
FT                   /locus_tag="HMPREF0675_3639"
FT   CDS_pept        complement(658474..658905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3639"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="identified by match to protein family HMM PF01047;
FT                   match to protein family HMM PF03551"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3639"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00457"
FT                   /db_xref="GOA:D4HC97"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC97"
FT                   /protein_id="ADE00457.1"
FT                   /translation="MHDQTLDLDDQFCFSLYRASRAVTRAYRPLLEGIGLTYPQYLAML
FT                   VLWHAEGPVGVNDIGTRLHLDSGTLTPLLRRLEDAGFITRAWSNDDERRRIISLTEGGR
FT                   SLRHQAAGLPERMLALYPTPPQELAQVKAFLDDLATQLE"
FT   gene            659026..659454
FT                   /locus_tag="HMPREF0675_3640"
FT   CDS_pept        659026..659454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3640"
FT                   /product="peroxiredoxin, Ohr subfamily"
FT                   /note="identified by match to protein family HMM PF02566;
FT                   match to protein family HMM TIGR03561"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3640"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99937"
FT                   /db_xref="GOA:D4HC98"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC98"
FT                   /protein_id="ADD99937.1"
FT                   /translation="MIEIEPVYTTEAIATGAGRNGHVQSPDGRVSEDLAVPVEMGGSGK
FT                   GTNPEQLFAAGYAACFHSALQMVARQAKKDLGDSSVGARVSIGQAGEGFGLAVALEVVI
FT                   PALPHDEAQRLADKAHQVCPYSNATRGNIRVDVTVVDD"
FT   gene            659574..660263
FT                   /locus_tag="HMPREF0675_3641"
FT   CDS_pept        659574..660263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3641"
FT                   /product="DJ-1/PfpI family protein"
FT                   /note="identified by match to protein family HMM PF01965"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3641"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00126"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D4HC99"
FT                   /protein_id="ADE00126.1"
FT                   /translation="MSRILMILTSHNQLGDTGRKTGFWLEEFAAPYYVFCDAGHDVTLA
FT                   SPRGGQPPIDPTSSLPQMQTDATRRFDVDEQAKRALATTTPLSEVDIATFDAVFYPGGH
FT                   GPLWDLADDPTSQQIILDSDAVGRPLGLVCHAPGVLHTVKKHDGTLFVTDRSVTGFTDG
FT                   EEEAAGLTGVVPFLVEDSLKQAGARYSKGPDGDSYVVTDKTLVTGQNPASSAATAQRLL
FT                   DLLCVRV"
FT   gene            660673..660795
FT                   /locus_tag="HMPREF0675_3642"
FT   CDS_pept        660673..660795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3642"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3642"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99009"
FT                   /db_xref="UniProtKB/TrEMBL:D4HCA0"
FT                   /protein_id="ADD99009.1"
FT                   /translation="MIGIHGWMGFISMEECVLRGGSDLVGVPAASRLAIAGSRG"
FT   gene            660979..662535
FT                   /locus_tag="HMPREF0675_3643"
FT   CDS_pept        660979..662535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0675_3643"
FT                   /product="putative arginine/ornithine antiporter"
FT                   /note="identified by match to protein family HMM PF00324;
FT                   match to protein family HMM TIGR00905"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3643"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00838"
FT                   /db_xref="GOA:D4HCA1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004754"
FT                   /db_xref="UniProtKB/TrEMBL:D4HCA1"
FT                   /protein_id="ADE00838.1"
FT                   /translation="MVILGPGASPAGHRNNGVAKGYEVSMAEQVVGQASTEVSMGEDVN
FT                   VGKLSFPAMLSLVVGSMIGGGIFSLPQNIAAAASPGPMVIGWTITGIGMICLAMVYQKL
FT                   AIRRPDLDNGIYAYAKAGFGDFIGFNSAWGYWLSALIGNVGYLVLLFSTVGKFVPAFAG
FT                   GNTVWAVLAASVLLWLTHALVLAGVRTAAFVNTIATIAKIVPLITFIAICAVAFDVGVF
FT                   TEDFWGSHAGLGSVFAQTKSMMLVTVWVFIGIEGASIYSKRARKRSDVGKATVGGFLFV
FT                   LVLLIGVNLLSMGIMHRAKLAGLPDASMGDVLSSVVGPWGSVLVSAGVIISLLGALLAW
FT                   ILLCGETMQVPGEDGTMPKLFGRINKHEAPAPALWITNIVSQICLVMTVLWDGAYLAMA
FT                   TLAAALILVPYLLSAAFALKMVIKGETYENGPRSQRVRDAVVATVATLYGIWLVVAAGA
FT                   DALMLAALLYLPGAAVFVWAKRELRAKRIFKPYEIGVLVLLALISVVSIISIVTGRLSL
FT                   T"
FT   gene            662666..663910
FT                   /gene="arcA"
FT                   /locus_tag="HMPREF0675_3644"
FT   CDS_pept        662666..663910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcA"
FT                   /locus_tag="HMPREF0675_3644"
FT                   /product="arginine deiminase"
FT                   /EC_number="3.5.3.6"
FT                   /note="identified by match to protein family HMM PF02274;
FT                   match to protein family HMM TIGR01078"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3644"
FT                   /db_xref="EnsemblGenomes-Tr:ADE01157"
FT                   /db_xref="GOA:D4HCA2"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="UniProtKB/TrEMBL:D4HCA2"
FT                   /protein_id="ADE01157.1"
FT                   /translation="MTTPIGAWSEVGKLREVMVCEPRLAHRRLTPSNCRELLFDDVLWV
FT                   EKAQEDHRDFVAKMRERGIVVHEMHQLLSEVLDISEGRSWVLDRKLSPNAVGLGVDEDV
FT                   RDWLNDMPSDTLAEYLIGGVAYGEVPADRRKHVLGALIKAHSENEFLIPPLPNTQFTRD
FT                   TTAWIFGGVTFNPMRWPARQQETVLASAIYTHHPIFAERDFKIWYGCAEADHGMSTLEG
FT                   GDIMPVGNGTVLIGMGERSSWQAITQVARSLFAHNAARRMVVAAMAPDRASMHLDTVFS
FT                   FCDVDLVTLYKPVVDTITPLVLEPSSEAAGFSVRVDDRHFTDVVASSLGLDGLRTVETG
FT                   GDCWEAQREQWDDGNNVVALEPGVVVGYDRNTATNALLAKAGVEVVEIKAAELGRGRGG
FT                   GHCMTCPITRDPVDY"
FT   gene            663984..664988
FT                   /gene="argF"
FT                   /locus_tag="HMPREF0675_3645"
FT   CDS_pept        663984..664988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argF"
FT                   /locus_tag="HMPREF0675_3645"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="identified by match to protein family HMM PF00185;
FT                   match to protein family HMM PF02729; match to protein
FT                   family HMM TIGR00658"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3645"
FT                   /db_xref="EnsemblGenomes-Tr:ADE00653"
FT                   /db_xref="GOA:D4HCA3"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:D4HCA3"
FT                   /protein_id="ADE00653.1"
FT                   /translation="MAFNLKNRHLLSLAHHSTEEIKFLVGLAADLKEAKYCGTEQPLLK
FT                   GKNIALIFEKASTRTRCAFEVAAHDQGAHVTYLGPSGSHIGHKESMKDTARVLGRMYDG
FT                   IEYRGFHQSVVEELAEYAGVPVFNGLTDEFHPTQMLADALTMREHAEKPFHEIKFAYVG
FT                   DGRNNMGRSLLLLGAKLGMDVRIGAPEGLQPEAELVERCREWAEQSGGKVLVTASAEEA
FT                   VRDVDFIHTDVWVSMGEPVESWSERVGTLLPFQINDALVKAAGNPRVKVMHCLPAFHNS
FT                   ETAVGAEVAKTYPELANGIEVTESVFESPACIAFDQAENRMHTIKAVLVSSLA"
FT   gene            665009..665914
FT                   /gene="arcC"
FT                   /locus_tag="HMPREF0675_3646"
FT   CDS_pept        665009..665914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcC"
FT                   /locus_tag="HMPREF0675_3646"
FT                   /product="carbamate kinase"
FT                   /EC_number="2.7.2.2"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM TIGR00746"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0675_3646"
FT                   /db_xref="EnsemblGenomes-Tr:ADD99220"
FT                   /db_xref="GOA:D4HCA4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT