(data stored in ACNUC7421 zone)

EMBL: CP001992

ID   CP001992; SV 1; circular; genomic DNA; STD; PRO; 2146480 BP.
XX
AC   CP001992; ACCQ01000000-ACCQ01000216; GG668321-GG668517;
XX
PR   Project:PRJNA31519;
XX
DT   15-JUN-2010 (Rel. 105, Created)
DT   14-NOV-2013 (Rel. 118, Last updated, Version 6)
XX
DE   Mobiluncus curtisii ATCC 43063, complete genome.
XX
KW   .
XX
OS   Mobiluncus curtisii ATCC 43063
OC   Bacteria; Actinobacteria; Actinomycetales; Actinomycetaceae; Mobiluncus.
XX
RN   [1]
RP   1-2146480
RA   Muzny D.M., Qin X., Buhay C.J., Dugan-Rocha S., Ding Y., Chen G.,
RA   Hawes A.C., Holder M., Jhangiani S.N., Johnson A.J., Khan Z.M., Li Z.,
RA   Liu W., Liu X., Perez L.M., Shen H., Wang Q., Watt J.E., Xi L., Xin Y.,
RA   Zhou J., Deng J., Jiang H., Liu Y., Qu J., Song X.-Z., Zhang L.,
RA   Villasana D., Liu J., Liyanage D., Lorensuhewa L.M., Robinson T., Song A.,
RA   Song B.-B., Dinh H.H., Thornton R., Coyle M.D., Francisco L., Jackson L.,
RA   Javaid M., Korchina V., Kovar C.L., Mata R., Mathew T., Ngo R., Nguyen L.,
RA   Nguyen N., Okwuonu G., Ongeri F., Pham C., Simmons D., Wilczek-Boney K.B.,
RA   Hale W., Jakkamsetti A., Opheim D., Pham P., Lucas F.San., Warren J.,
RA   Zhang J., Zhao Z., Zhou C., Zhu D., Lee S.L., Bess C.M., Blankenburg K.P.,
RA   Forbes L., Fu Q., Gubbala S., Hirani K., Jayaseelan J.C., Lara F.,
RA   Munidasa M., Palculict T., Patil S.S., Pu L.-L., Saada N., Tang L.-Y.,
RA   Weissenberger G.M., Zhu Y., Hemphill L., Shang Y., Youmans B., Ayvaz T.,
RA   Ross M., Santibanez J., Aqrawi P., Gross S., Joshi V., Fowler G.,
RA   Nazareth L., Reid J., Worley K.C., Petrosino J., Highlander S., Gibbs R.A.;
RT   ;
RL   Submitted (25-MAR-2010) to the INSDC.
RL   Human Genome Sequencing Center, Baylor College of Medicine, One Baylor
RL   Plaza, Houston, TX 77030, USA
XX
DR   MD5; 5b590d2ab7a02dcfdceaefc0f5bfb4e6.
DR   BioSample; SAMN00001505.
DR   EnsemblGenomes-Gn; EBG00001065453.
DR   EnsemblGenomes-Gn; EBG00001065454.
DR   EnsemblGenomes-Gn; EBG00001065455.
DR   EnsemblGenomes-Gn; EBG00001065456.
DR   EnsemblGenomes-Gn; EBG00001065457.
DR   EnsemblGenomes-Gn; EBG00001065458.
DR   EnsemblGenomes-Gn; EBG00001065459.
DR   EnsemblGenomes-Gn; EBG00001065460.
DR   EnsemblGenomes-Gn; EBG00001065461.
DR   EnsemblGenomes-Gn; EBG00001065462.
DR   EnsemblGenomes-Gn; EBG00001065463.
DR   EnsemblGenomes-Gn; EBG00001065464.
DR   EnsemblGenomes-Gn; EBG00001065465.
DR   EnsemblGenomes-Gn; EBG00001065466.
DR   EnsemblGenomes-Gn; EBG00001065467.
DR   EnsemblGenomes-Gn; EBG00001065468.
DR   EnsemblGenomes-Gn; EBG00001065469.
DR   EnsemblGenomes-Gn; EBG00001065470.
DR   EnsemblGenomes-Gn; EBG00001065471.
DR   EnsemblGenomes-Gn; EBG00001065472.
DR   EnsemblGenomes-Gn; EBG00001065473.
DR   EnsemblGenomes-Gn; EBG00001065474.
DR   EnsemblGenomes-Gn; EBG00001065475.
DR   EnsemblGenomes-Gn; EBG00001065476.
DR   EnsemblGenomes-Gn; EBG00001065477.
DR   EnsemblGenomes-Gn; EBG00001065478.
DR   EnsemblGenomes-Gn; EBG00001065479.
DR   EnsemblGenomes-Gn; EBG00001065480.
DR   EnsemblGenomes-Gn; EBG00001065481.
DR   EnsemblGenomes-Gn; EBG00001065482.
DR   EnsemblGenomes-Gn; EBG00001065484.
DR   EnsemblGenomes-Gn; EBG00001065485.
DR   EnsemblGenomes-Gn; EBG00001065486.
DR   EnsemblGenomes-Gn; EBG00001065487.
DR   EnsemblGenomes-Gn; EBG00001065488.
DR   EnsemblGenomes-Gn; EBG00001065489.
DR   EnsemblGenomes-Gn; EBG00001065490.
DR   EnsemblGenomes-Gn; EBG00001065491.
DR   EnsemblGenomes-Gn; EBG00001065492.
DR   EnsemblGenomes-Gn; EBG00001065493.
DR   EnsemblGenomes-Gn; EBG00001065494.
DR   EnsemblGenomes-Gn; EBG00001065495.
DR   EnsemblGenomes-Gn; EBG00001065496.
DR   EnsemblGenomes-Gn; EBG00001065497.
DR   EnsemblGenomes-Gn; EBG00001065498.
DR   EnsemblGenomes-Gn; EBG00001065499.
DR   EnsemblGenomes-Gn; EBG00001065500.
DR   EnsemblGenomes-Gn; EBG00001065502.
DR   EnsemblGenomes-Gn; EBG00001065503.
DR   EnsemblGenomes-Gn; EBG00001065504.
DR   EnsemblGenomes-Gn; EBG00001065505.
DR   EnsemblGenomes-Gn; EBG00001065506.
DR   EnsemblGenomes-Gn; EBG00001065507.
DR   EnsemblGenomes-Gn; EBG00001065508.
DR   EnsemblGenomes-Gn; EBG00001065509.
DR   EnsemblGenomes-Gn; EBG00001065510.
DR   EnsemblGenomes-Gn; EBG00001065511.
DR   EnsemblGenomes-Gn; EBG00001065512.
DR   EnsemblGenomes-Gn; EBG00001065513.
DR   EnsemblGenomes-Gn; EBG00001065514.
DR   EnsemblGenomes-Gn; EBG00001065515.
DR   EnsemblGenomes-Gn; EBG00001065516.
DR   EnsemblGenomes-Gn; HMPREF0573_nc10001.
DR   EnsemblGenomes-Gn; HMPREF0573_nc10002.
DR   EnsemblGenomes-Gn; HMPREF0573_nc10003.
DR   EnsemblGenomes-Gn; HMPREF0573_nc10004.
DR   EnsemblGenomes-Gn; HMPREF0573_nc10005.
DR   EnsemblGenomes-Gn; HMPREF0573_r10001.
DR   EnsemblGenomes-Gn; HMPREF0573_r10002.
DR   EnsemblGenomes-Gn; HMPREF0573_r10003.
DR   EnsemblGenomes-Gn; HMPREF0573_r10004.
DR   EnsemblGenomes-Gn; HMPREF0573_r10005.
DR   EnsemblGenomes-Gn; HMPREF0573_r10006.
DR   EnsemblGenomes-Gn; HMPREF0573_t10001.
DR   EnsemblGenomes-Gn; HMPREF0573_t10002.
DR   EnsemblGenomes-Gn; HMPREF0573_t10003.
DR   EnsemblGenomes-Gn; HMPREF0573_t10004.
DR   EnsemblGenomes-Gn; HMPREF0573_t10005.
DR   EnsemblGenomes-Gn; HMPREF0573_t10006.
DR   EnsemblGenomes-Gn; HMPREF0573_t10007.
DR   EnsemblGenomes-Gn; HMPREF0573_t10008.
DR   EnsemblGenomes-Gn; HMPREF0573_t10009.
DR   EnsemblGenomes-Gn; HMPREF0573_t10010.
DR   EnsemblGenomes-Gn; HMPREF0573_t10011.
DR   EnsemblGenomes-Gn; HMPREF0573_t10012.
DR   EnsemblGenomes-Gn; HMPREF0573_t10013.
DR   EnsemblGenomes-Gn; HMPREF0573_t10014.
DR   EnsemblGenomes-Gn; HMPREF0573_t10015.
DR   EnsemblGenomes-Gn; HMPREF0573_t10016.
DR   EnsemblGenomes-Gn; HMPREF0573_t10017.
DR   EnsemblGenomes-Gn; HMPREF0573_t10018.
DR   EnsemblGenomes-Gn; HMPREF0573_t10019.
DR   EnsemblGenomes-Gn; HMPREF0573_t10020.
DR   EnsemblGenomes-Gn; HMPREF0573_t10021.
DR   EnsemblGenomes-Gn; HMPREF0573_t10022.
DR   EnsemblGenomes-Gn; HMPREF0573_t10023.
DR   EnsemblGenomes-Gn; HMPREF0573_t10024.
DR   EnsemblGenomes-Gn; HMPREF0573_t10025.
DR   EnsemblGenomes-Gn; HMPREF0573_t10026.
DR   EnsemblGenomes-Gn; HMPREF0573_t10027.
DR   EnsemblGenomes-Gn; HMPREF0573_t10028.
DR   EnsemblGenomes-Gn; HMPREF0573_t10029.
DR   EnsemblGenomes-Gn; HMPREF0573_t10030.
DR   EnsemblGenomes-Gn; HMPREF0573_t10031.
DR   EnsemblGenomes-Gn; HMPREF0573_t10032.
DR   EnsemblGenomes-Gn; HMPREF0573_t10033.
DR   EnsemblGenomes-Gn; HMPREF0573_t10034.
DR   EnsemblGenomes-Gn; HMPREF0573_t10035.
DR   EnsemblGenomes-Gn; HMPREF0573_t10036.
DR   EnsemblGenomes-Gn; HMPREF0573_t10037.
DR   EnsemblGenomes-Gn; HMPREF0573_t10038.
DR   EnsemblGenomes-Gn; HMPREF0573_t10039.
DR   EnsemblGenomes-Gn; HMPREF0573_t10040.
DR   EnsemblGenomes-Gn; HMPREF0573_t10041.
DR   EnsemblGenomes-Gn; HMPREF0573_t10042.
DR   EnsemblGenomes-Gn; HMPREF0573_t10043.
DR   EnsemblGenomes-Gn; HMPREF0573_t10044.
DR   EnsemblGenomes-Gn; HMPREF0573_t10045.
DR   EnsemblGenomes-Gn; HMPREF0573_t10046.
DR   EnsemblGenomes-Tr; EBT00001668168.
DR   EnsemblGenomes-Tr; EBT00001668169.
DR   EnsemblGenomes-Tr; EBT00001668170.
DR   EnsemblGenomes-Tr; EBT00001668172.
DR   EnsemblGenomes-Tr; EBT00001668173.
DR   EnsemblGenomes-Tr; EBT00001668174.
DR   EnsemblGenomes-Tr; EBT00001668175.
DR   EnsemblGenomes-Tr; EBT00001668176.
DR   EnsemblGenomes-Tr; EBT00001668177.
DR   EnsemblGenomes-Tr; EBT00001668178.
DR   EnsemblGenomes-Tr; EBT00001668179.
DR   EnsemblGenomes-Tr; EBT00001668180.
DR   EnsemblGenomes-Tr; EBT00001668181.
DR   EnsemblGenomes-Tr; EBT00001668182.
DR   EnsemblGenomes-Tr; EBT00001668183.
DR   EnsemblGenomes-Tr; EBT00001668184.
DR   EnsemblGenomes-Tr; EBT00001668185.
DR   EnsemblGenomes-Tr; EBT00001668186.
DR   EnsemblGenomes-Tr; EBT00001668187.
DR   EnsemblGenomes-Tr; EBT00001668188.
DR   EnsemblGenomes-Tr; EBT00001668189.
DR   EnsemblGenomes-Tr; EBT00001668190.
DR   EnsemblGenomes-Tr; EBT00001668191.
DR   EnsemblGenomes-Tr; EBT00001668192.
DR   EnsemblGenomes-Tr; EBT00001668193.
DR   EnsemblGenomes-Tr; EBT00001668194.
DR   EnsemblGenomes-Tr; EBT00001668195.
DR   EnsemblGenomes-Tr; EBT00001668196.
DR   EnsemblGenomes-Tr; EBT00001668197.
DR   EnsemblGenomes-Tr; EBT00001668198.
DR   EnsemblGenomes-Tr; EBT00001668199.
DR   EnsemblGenomes-Tr; EBT00001668200.
DR   EnsemblGenomes-Tr; EBT00001668201.
DR   EnsemblGenomes-Tr; EBT00001668202.
DR   EnsemblGenomes-Tr; EBT00001668203.
DR   EnsemblGenomes-Tr; EBT00001668204.
DR   EnsemblGenomes-Tr; EBT00001668206.
DR   EnsemblGenomes-Tr; EBT00001668207.
DR   EnsemblGenomes-Tr; EBT00001668208.
DR   EnsemblGenomes-Tr; EBT00001668209.
DR   EnsemblGenomes-Tr; EBT00001668210.
DR   EnsemblGenomes-Tr; EBT00001668211.
DR   EnsemblGenomes-Tr; EBT00001668212.
DR   EnsemblGenomes-Tr; EBT00001668213.
DR   EnsemblGenomes-Tr; EBT00001668214.
DR   EnsemblGenomes-Tr; EBT00001668215.
DR   EnsemblGenomes-Tr; EBT00001668216.
DR   EnsemblGenomes-Tr; EBT00001668217.
DR   EnsemblGenomes-Tr; EBT00001668218.
DR   EnsemblGenomes-Tr; EBT00001668219.
DR   EnsemblGenomes-Tr; EBT00001668220.
DR   EnsemblGenomes-Tr; EBT00001668221.
DR   EnsemblGenomes-Tr; EBT00001668222.
DR   EnsemblGenomes-Tr; EBT00001668223.
DR   EnsemblGenomes-Tr; EBT00001668224.
DR   EnsemblGenomes-Tr; EBT00001668225.
DR   EnsemblGenomes-Tr; EBT00001668226.
DR   EnsemblGenomes-Tr; EBT00001668227.
DR   EnsemblGenomes-Tr; EBT00001668228.
DR   EnsemblGenomes-Tr; EBT00001668229.
DR   EnsemblGenomes-Tr; EBT00001668230.
DR   EnsemblGenomes-Tr; EBT00001668231.
DR   EnsemblGenomes-Tr; HMPREF0573_nc10001-1.
DR   EnsemblGenomes-Tr; HMPREF0573_nc10002-1.
DR   EnsemblGenomes-Tr; HMPREF0573_nc10003-1.
DR   EnsemblGenomes-Tr; HMPREF0573_nc10004-1.
DR   EnsemblGenomes-Tr; HMPREF0573_nc10005-1.
DR   EnsemblGenomes-Tr; HMPREF0573_r10001-1.
DR   EnsemblGenomes-Tr; HMPREF0573_r10002-1.
DR   EnsemblGenomes-Tr; HMPREF0573_r10003-1.
DR   EnsemblGenomes-Tr; HMPREF0573_r10004-1.
DR   EnsemblGenomes-Tr; HMPREF0573_r10005-1.
DR   EnsemblGenomes-Tr; HMPREF0573_r10006-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10001-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10002-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10003-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10004-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10005-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10006-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10007-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10008-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10009-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10010-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10011-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10012-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10013-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10014-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10015-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10016-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10017-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10018-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10019-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10020-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10021-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10022-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10023-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10024-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10025-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10026-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10027-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10028-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10029-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10030-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10031-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10032-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10033-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10034-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10035-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10036-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10037-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10038-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10039-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10040-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10041-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10042-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10043-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10044-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10045-1.
DR   EnsemblGenomes-Tr; HMPREF0573_t10046-1.
DR   EuropePMC; PMC6036942; 29992027.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01747; msiK.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001992.
DR   SILVA-SSU; CP001992.
DR   StrainInfo; 11431; 1.
XX
CC   Mobiluncus curtisii ATCC 43063
CC    Strain source, body site: Urogenital tract, vagina
CC    Inquiries should be directed to microbe@hgsc.bcm.tmc.edu
CC    This sequence is an upgraded sequence that has been subjected to
CC   automatic finishing procedures including computational calculation
CC   with experimental execution of directed PCR experiments to order
CC   and orient many of the whole genome shotgun sequence contigs. The
CC   automatic finishing was followed by further experiments to fully
CC   order and orient the contigs within the genome and clarify the
CC   remaining ambiguous sequence. This sequence meets the quality
CC   standards for HMP grade (HTGS_PHASE3).
CC    This is a reference genome for the Human Microbiome Project. This
CC   project is co-owned with the Human Microbiome Project DACC. Source
CC   DNA provided by Sheldon Kaplan (Texas Children's Hospital,
CC   Department of Pediatric Infectious Diseases, 1102 Bates Street
CC   #1150, Houston, TX, 77030). Bacteria provided by ATCC (43063),
CC   funded by 'Genomes and Genetics at the BCM-HGSC' (U54 HG003273).
CC   ##Genome-Assembly-Data-START##
CC   Finishing Goal           :: Finished
CC   Current Finishing Status :: Finished
CC   Assembly Method          :: Newbler Assembler v. 1.1.03.24
CC   Genome Coverage          :: 64x
CC   Sequencing Technology    :: 454
CC   ##Genome-Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2146480
FT                   /organism="Mobiluncus curtisii ATCC 43063"
FT                   /strain="ATCC 43063"
FT                   /mol_type="genomic DNA"
FT                   /note="type strain of Falcivibrio vaginalis; synonym:
FT                   Falcivibrio vaginalis"
FT                   /db_xref="taxon:548479"
FT                   /culture_collection="ATCC:43063"
FT   gene            complement(286..401)
FT                   /locus_tag="HMPREF0573_r10001"
FT   rRNA            complement(286..401)
FT                   /locus_tag="HMPREF0573_r10001"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(590..3684)
FT                   /locus_tag="HMPREF0573_r10002"
FT   rRNA            complement(590..3684)
FT                   /locus_tag="HMPREF0573_r10002"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(3518..3674)
FT                   /locus_tag="HMPREF0573_nc10001"
FT   ncRNA           complement(3518..3674)
FT                   /locus_tag="HMPREF0573_nc10001"
FT                   /note="similar to 5.8S ribosomal RNA"
FT                   /ncRNA_class="other"
FT   gene            complement(3966..5493)
FT                   /locus_tag="HMPREF0573_r10003"
FT   rRNA            complement(3966..5493)
FT                   /locus_tag="HMPREF0573_r10003"
FT                   /product="16S ribosomal RNA"
FT   gene            complement(5961..7241)
FT                   /locus_tag="HMPREF0573_10001"
FT   CDS_pept        complement(5961..7241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10001"
FT                   /product="N-acylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.8"
FT                   /note="COG: COG2942; Pfam: PF07221; InterPro: IPR012341"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10001"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66320"
FT                   /db_xref="GOA:D6ZHX1"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZHX1"
FT                   /protein_id="ADI66320.1"
FT                   /translation="MCKILDLPSLAARELLSLCEFGMRSQVPAGFGYLGPEGAVMPEMG
FT                   AQLWINCRMTHMFSLFALAGIHPERSRELAIHGIHSLRTHFVDHEYGGWFSWIETELDA
FT                   SGQPRPNLEKGPRKEAYAHAFVILAASSATVAEIPGARELLDEARRIQDAYWWDKAAGR
FT                   VRESYARDWTDLENYRGANANMHTLESCLAAFDATADTEYLRRGASIATKIINDSAREY
FT                   DWKVPEHYTGSWRIDLDYNRDRPTDPFRPWGATPGHGFEWVRLILQLQGAVEAAGLNLK
FT                   LEWVHEAAAGLYRSALAAWGTDDAAGIPYTTDFEGRPVSSQRMHWVICEALGASLVTAK
FT                   CFTRWAGQGSADLVITADKWVERFSEYAQSSLIESPGRWCHELDGHNRPAALTWSGKPD
FT                   IYHAGQAMFLVNLPVQPGFAAALKKTK"
FT   gene            complement(7377..7646)
FT                   /locus_tag="HMPREF0573_10002"
FT   CDS_pept        complement(7377..7646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10002"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10002"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66321"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZHX2"
FT                   /protein_id="ADI66321.1"
FT                   /translation="MSTQPVVSDCAVSDCSYNHDGCQATAMTMGTKGCSTFIALPEVGG
FT                   LGKQAAVGACQKSDCSFNEHLECQASAVKVGGKTGECLTYHQAA"
FT   gene            8089..9321
FT                   /gene="trpB"
FT                   /locus_tag="HMPREF0573_10003"
FT   CDS_pept        8089..9321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpB"
FT                   /locus_tag="HMPREF0573_10003"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /EC_number="4.2.1.20"
FT                   /note="COG: COG0133; Pfam: PF00291; InterPro: IPR006654"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10003"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66322"
FT                   /db_xref="GOA:D6ZHX3"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZHX3"
FT                   /protein_id="ADI66322.1"
FT                   /translation="MNKYRDFDNYLKEYPDEKGYFGKYGGNYLQDPELVKAFDQYAEAY
FT                   QTIAQSAQFIAELRRIRKDFQGRPTPVYHCQRLSQKLGRTQIYLKREDLNHTGAHKLNH
FT                   CMGEGLLAKYMGKKKLIAETGAGQHGVALATAAAYFGLECDIYMGEVDIAKEAPNVARM
FT                   KVLGARVIPVSFGLKTLKEAVDAAFMAYSEEYHDAIYCIGTAAGPHPFPVMVRDFQEVV
FT                   GVEARAQFLEQTGHLPDKIMACVGGGSNAIGLFVPFLADPVEIYGVEPQGRGTALGDHA
FT                   ATLTYGGEGVMHGFNSIMLSDEKGNPAPVYSNASGLDYPSVGPEHSLLHDMERVNYVTI
FT                   RDEEAIEALFLLSRLEGIIPAIESSHALAYAIKEARKGKPGSILVNLSGRGDKDLDFVI
FT                   EHYGTGEDYVK"
FT   gene            complement(9403..10902)
FT                   /gene="gatB"
FT                   /locus_tag="HMPREF0573_10004"
FT   CDS_pept        complement(9403..10902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="HMPREF0573_10004"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase,
FT                   B subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="COG: COG0064; Pfam: PF02934,PF01162,PF02637;
FT                   InterPro: IPR004413"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10004"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66323"
FT                   /db_xref="GOA:D6ZHX4"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZHX4"
FT                   /protein_id="ADI66323.1"
FT                   /translation="MSDKLMSYEKATERFDPVLGLEVHVELGTKTKMFDAAPNAFGGEP
FT                   NTYITPVSLGLPGCLPVVNKRAVEYAIRIGLALNCQIAEYCRFARKNYFYPDLTKAFQT
FT                   SQYDEPICYDGWLDVELEDGTVYRVEIERAHMEEDAGKNTHIGGEDGRIQGADHSLVDY
FT                   NRAGVPLVEIVTKPITGTGDRAPEVAAAYVRTLRDIFRAIGVSEARMERGNVRADVNVS
FT                   LRDNPEDPMGTRTETKNVNSFRGIEKTVRYEMRRQAAILAEGGKIVQETRHYHAADGTT
FT                   SSGREKSDAEDYRYFPEPDLVPVAPSREWVEEIRKSLPELPAVRRKRLQGVWGFTDIEM
FT                   RDIVNAGAVDLIEETVSAGTDAGGARKWWMGEIARLAKGEEKDLEEMAITPAQVAELQH
FT                   LVEDGKINDKLAKQVIAGVLAGEGNPGEVVKARGLEVVSDTGALETAVKQAIADNPDVV
FT                   AKIKGGKMAAIGALMGPIMKATRGQADAGTVKSLIMKELGL"
FT   gene            complement(10899..12422)
FT                   /gene="gatA"
FT                   /locus_tag="HMPREF0573_10005"
FT   CDS_pept        complement(10899..12422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="HMPREF0573_10005"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase,
FT                   A subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="COG: COG0154; Pfam: PF01425; InterPro: IPR000120"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10005"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66324"
FT                   /db_xref="GOA:D6ZHX5"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZHX5"
FT                   /protein_id="ADI66324.1"
FT                   /translation="MSNAELYLLSAHELAAKLVAKEVTSEELVRIFAERIEHLEKDVHA
FT                   FLFVDVEGALQTAKQVDADRAAGKKLHPFAGVPIAIKDNMVQRGKPTTCASKILEGWLP
FT                   PYDATIVLKLQEAGLPILGKTNMDEFAMGSSTEHSAFGPTRNPWDLERIPGGSGGGSAA
FT                   AVAAFMVPWALGSDTGGSIRQPGAVTGTVGAKPTYGAVSRYGLIAMGSSLDQIGPVTRD
FT                   VRDAAALQMIIGGHDPLDSTSLDEPVPDITGALAKIGTDATGLRVGVVKQLQGEGYQAG
FT                   VLQRFQQAVERLQEAGANVVEVDCPSFEYALAAYYLIMPAEVSSNLARFDGVRYGLRVL
FT                   PQEGEVTTERMMAATREAGFGDEVKRRIILGTHVLSAGYYDAYYGSAQKVRTLLQRDLA
FT                   AAFEQCDVLLTPTAPTTAFKFGDKLDDPMSMYLNDVATIPANMAGIPGISVPAGVAPED
FT                   GLPVGVQILAPARGDVTMYEVAARMEAQLAKSSEPMPPCPAAAWKEGAK"
FT   gene            complement(12425..12721)
FT                   /gene="gatC"
FT                   /locus_tag="HMPREF0573_10006"
FT   CDS_pept        complement(12425..12721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="HMPREF0573_10006"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase,
FT                   C subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="COG: COG0721; Pfam: PF02686; InterPro: IPR003837"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10006"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66325"
FT                   /db_xref="GOA:D6ZHX6"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZHX6"
FT                   /protein_id="ADI66325.1"
FT                   /translation="MSTIDADEVRRVAGLARIALTDEEIQKFAAELDVITQAVAKVNEV
FT                   AKPDIPATSHPIPLTNVWREDVVGECLDHDEVLQAAPQPDRGMFGVPKIIGEE"
FT   gene            12942..14297
FT                   /locus_tag="HMPREF0573_10007"
FT   CDS_pept        12942..14297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10007"
FT                   /product="phospholipase D domain protein"
FT                   /EC_number="3.1.-.-"
FT                   /note="COG: COG1502; Pfam: PF00614"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10007"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66326"
FT                   /db_xref="GOA:D6ZHX7"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZHX7"
FT                   /protein_id="ADI66326.1"
FT                   /translation="MGKRVGDPHSNLRNHYSPEPRGEVFRQIARFFTRLSELAVQTPQQ
FT                   LPRVMARIFGGFLLFEFVAGVITVAIDTLRTWRQSPVKPFPVTQLPEIRFAADKMQVYT
FT                   SGIEVYTAMLEAIRSAQSHVFFETFIWKNDEIGHLFKEALIAAAKRGVEVFIIWDAFGN
FT                   INVPPAMTRFPHLHHLHVLRFGLFRSFFLSLRSTGRDHRKILTVDNKIGFIGGYNIGSL
FT                   YATQWRDTHLRLTGPSVWELTDAFTDFWNAHKTRNLPQLPQFLPRQWSPEIEVARNEPN
FT                   RLLFPVRGLYIKALNKARKRFWITQAYFIPDQDILDELIAAAWRGVDIKVLMPETSNHI
FT                   AADWVARSYYSPMLEAGIEIWLYKEAMVHAKTATADGCWTTIGTANIDRLSMTGNYEIN
FT                   MEIFSTDLANQMEQVFLNDLTNARQLTLDQWEERPVVNRVIERLLRPLGSVL"
FT   gene            complement(14421..16820)
FT                   /gene="ligA"
FT                   /locus_tag="HMPREF0573_10008"
FT   CDS_pept        complement(14421..16820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligA"
FT                   /locus_tag="HMPREF0573_10008"
FT                   /product="DNA ligase (NAD+)"
FT                   /EC_number="6.5.1.2"
FT                   /note="COG: COG0272; Pfam: PF01653,PF03120,PF03119,PF00533;
FT                   InterPro: IPR001679"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10008"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66327"
FT                   /db_xref="GOA:D6ZHX8"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZHX8"
FT                   /protein_id="ADI66327.1"
FT                   /translation="MVKKKTSIPESALAQHADLVDQIEAARTDYYDQTPETGVTRLSDA
FT                   EYDALFVQLQLLEAAYPDLVTPDSPTQTVGGSGETANTEGFPPHHHLCQMGSIDDVFSY
FT                   AEVDAWWARVEKSLEGQDFSVSAEVKVDGLAMSLTYLHGTLAVGATRGDGFTGEDVTEN
FT                   VKTIATVPVRLSGENVPELVEIRGEVYLPLADFAAMNAARERDGEKLFANPRNAATGSL
FT                   KQKDPVQAAKRPLAFLAHGVGKVRWADPGAAAHLETQEDFYELLESWGLHSVRETPASL
FT                   GLSLAGIHSLAEIHTVLDQMTAHRHDFAHQIDGVVLKVDSFAQRDALGSTARAPRWACA
FT                   YKFPPEEVHTRLLGIEVQVGRTGRVTPFGVMERVLVDGSYVSRATLHNAKEVARKDVRP
FT                   GDTVVLRKAGDIIPEILGPVMSLRTAGLPEWVMPDTCPSCGTELGAQKEGDIDLRCPNQ
FT                   SGCPAQITERLIHVGSRNALDIEGLGEEGALALTQPEFGRGDVAAALAAGGHCELEDGT
FT                   IVAVPSGEPRSLEAIEDLLPPPQSPVLTSEAGLFALQPEDLRDVMVWREIPGTGGRDWQ
FT                   QVRFFWAKPRPLPKAAQEATGQRFGPPVAGKVVQTFFEQLQAAKSKELWRVLVALSIRH
FT                   LGPVAARTIARQFVTMSALRVASAEQLGEAEGIGEVIAASIRDWFTVPWHQEIVDAWEA
FT                   AGVGAVSKAEGASEASLAGDTNLAPTLEGLTVVITGNIPGYTRESAQLAVEARGGKATG
FT                   SVSKKTDLVVAGAGAGSKLSKAQALGIPVIESAGFEALLEKGISGA"
FT   gene            17000..17563
FT                   /locus_tag="HMPREF0573_10009"
FT   CDS_pept        17000..17563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10009"
FT                   /product="DJ-1/PfpI family protein"
FT                   /note="COG: COG0693; Pfam: PF01965; InterPro: IPR002818"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10009"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66328"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZHX9"
FT                   /protein_id="ADI66328.1"
FT                   /translation="MEASIFIANGVEECEALLVVDLLRRGGIEIQTVAVNDATGTDEKA
FT                   RTIVSSHQVPLICDVHLNSYVPSDEKVLVIPGGKLGVDNLKASAKLSQILRSHQENLAA
FT                   VCAGPTVLGALGLLDEHKATVYPGFQDGLGSADYTDTGLIHDGRVITARALGASIDFAL
FT                   EIIALLRDESQAQQVAAQICYQTH"
FT   gene            18144..21026
FT                   /locus_tag="HMPREF0573_10010"
FT   CDS_pept        18144..21026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10010"
FT                   /product="FtsK/SpoIIIE family protein"
FT                   /note="COG: COG1674; Pfam: PF01580; InterPro: IPR002543"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10010"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66329"
FT                   /db_xref="GOA:D6ZHY0"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZHY0"
FT                   /protein_id="ADI66329.1"
FT                   /translation="MFLPLLLMLGLGAFLRWRLLVIVGIAGTIALVVFIRRALAVPTPD
FT                   KLWLAAATPLAVPSQKVSEIRVFTGRKLHRRILQIQPGETLCFTGTQGADQARWVIAQA
FT                   ILFGQARLSANNPDPWRGLKPREESEKSALRTLTIRVFDPSETPHLERDEVGITICAEM
FT                   PPPWAQRILATHPHRLAITATWFSSLMDALGENPQRLSLTAMPPTETLPDLVDVTQWRH
FT                   TSPETIARNWQEPPPGLCAQLGVSTAERPWAVDLVKEGPHALVAGTTGAGKSELLTTWL
FT                   LALALHYSPRDLRFILLDYKGGAAFAALGALPHTHGVLTDLTPQLTSRALASLEAFLKQ
FT                   RETVLSQVKARDLEHYHQLTGQRLPRVLIVVDEFRALATDHPETLENLIRLATHGRSLG
FT                   LHLILATQKPGGVVNGQILANTNLRIALRVRSPQDSTEILSDTRAASLPHIPGRLYWEG
FT                   LTSGVAQAAWCGKANWVRHCVEQVCQAWEKCHGNAPLPEIWCPDLPLVVPCPPQSFALL
FT                   DFPHQARQTWRFPQSSLGIFGNPGSGRTTALTTLTTMWLCQSRSTIVITPDPSTFWNQW
FT                   RGHSSDPSPGSFQRFLTVFAPQDLWKLEQFMSLAANRGLEGAAVAIDRADLLADELERL
FT                   YPGQGVKRLETLLSETGSGSYALAFTAPLSAGHSGWGALAGEKFVLCPRDTVDLHSAGV
FT                   ESNGVHGRLRESLPAVITPGRGVWQIGNACVTAQIGISTCESLVEISDPESSASSPENT
FT                   PNTPGNKEIVLVDLPKAFSHREMPHSALQVTLGWSSSRRDWLSLSAAQRHWVVDDLPEL
FT                   RPLVAQLKREYRRLGYQLIEAEDLAPEHINRNSFIIVSKSERNISKLNVLWETIESSLK
FT                   FDLTFLELRSPGIMSENLALSLPNSANRKVTITQLGNTIEARHRVANYLNVEMDHVRKL
FT                   QTIGGFPAFYRHGPEVGALATPDGSVTHIT"
FT   gene            21163..21426
FT                   /locus_tag="HMPREF0573_10011"
FT   CDS_pept        21163..21426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10011"
FT                   /product="transcription factor WhiB"
FT                   /note="Pfam: PF02467; InterPro: IPR003482"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10011"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66330"
FT                   /db_xref="GOA:D6ZHY1"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZHY1"
FT                   /protein_id="ADI66330.1"
FT                   /translation="MDWRDQAACLTVDPELFFPVGNTGPALAQIEEAKAVCATCQVVDI
FT                   CLKWALDNNQDAGVWGGTSEDERRSLKRRNARNARARRASSL"
FT   gene            complement(21542..22987)
FT                   /locus_tag="HMPREF0573_10012"
FT   CDS_pept        complement(21542..22987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10012"
FT                   /product="ATPase/histidine kinase/DNA gyrase B/HSP90 domain
FT                   protein"
FT                   /note="COG: COG3920; Pfam: PF08448,PF07568,PF02518;
FT                   InterPro: IPR003594"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10012"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66331"
FT                   /db_xref="GOA:D6ZHY2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR022066"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038424"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZHY2"
FT                   /protein_id="ADI66331.1"
FT                   /translation="MREPPFQELSADAVEQLYRLVSDWQIISDLSQADLLLWLPNRYDG
FT                   MSCAAHCRPATGPTVHLDDVIGLNLPATRLSLLEQVLIKGEIIENPVHRWTGMNTVSEV
FT                   LVPVPFDGRNIGVLAIETNLAFQVGEIGGEGWFKAVSRTLLKMVAAGDFPFEVTPTTGK
FT                   HGNPRVADGALMLDGEGVVEHCSPNGISAFKRLGFYNQLYGEKLSDSVLPLLEKGSVID
FT                   EDLSTVLRGRSSALAEIDVRGVDLTVRSLPLVEEGERIGALLLCRDVTEKRHREKELLS
FT                   KDATIREVHHRVKNNLQTVSALLRLQARRSDNSVVQEALSQAERRISIIAMVHEALSHT
FT                   VDETVSFDDTFRRLLALVATAASSDHFVETRFVGSFGTLGADAASALGLVLTELVTNAI
FT                   EHGLEDRDGVVEVEAHRDDTNETLVVTVTDDGHGLTGNSVGSGLGTQIVQTLVKTELVG
FT                   TVQWENREPPATGTIVRLTATKL"
FT   gene            23069..23584
FT                   /locus_tag="HMPREF0573_10013"
FT   CDS_pept        23069..23584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10013"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66332"
FT                   /db_xref="InterPro:IPR019639"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZHY3"
FT                   /protein_id="ADI66332.1"
FT                   /translation="MKLQESLDMKFTQTLVYSGSRAQVTEMLKNPEYYKKRWAALDDCA
FT                   QVDLSLTENRIRVSSTVSVSAENLEQLANKLNSGLNLKVVEVWDLNQSGWVENGTMSGS
FT                   MAGVPVKFSATMVANSGSIPQSDTEITLEGEVTCAIPFFAAGVERAVIKTIQNAFTKET
FT                   AKADEFLL"
FT   gene            23621..24439
FT                   /gene="thyA"
FT                   /locus_tag="HMPREF0573_10014"
FT   CDS_pept        23621..24439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thyA"
FT                   /locus_tag="HMPREF0573_10014"
FT                   /product="thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /note="COG: COG0207; Pfam: PF00303; InterPro: IPR000398"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10014"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66333"
FT                   /db_xref="GOA:D6ZHY4"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZHY4"
FT                   /protein_id="ADI66333.1"
FT                   /translation="MFKRGNMTITDHQYEDLLADIMSHGVEKPDRTGTGTRSIFGRQLR
FT                   YDLSQGFPAITTKSLYWHGVVGELLWFLQGGTNNRWLQENNIHIWDEWADESGDLGPIY
FT                   GHQWRAWPTAAGPVDQVKKLLETLQNDPSSRRMLVSAWNVSDLDQMALAPCHAFFQCWV
FT                   GQGRLSLQIYQRSADMFLGVPFNIASYALLTHMLAQQSNLQVGELVWTGGDCHIYSNHV
FT                   DQVSLQLSREPYPFPILELDKAESIDGYTFDMIRLANYQHHPKISAPVAV"
FT   gene            24594..25094
FT                   /gene="folA"
FT                   /locus_tag="HMPREF0573_10015"
FT   CDS_pept        24594..25094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /locus_tag="HMPREF0573_10015"
FT                   /product="dihydrofolate reductase"
FT                   /EC_number="1.5.1.3"
FT                   /note="COG: COG0262; Pfam: PF00186; InterPro: IPR001796"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10015"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66334"
FT                   /db_xref="GOA:D6ZHY5"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZHY5"
FT                   /protein_id="ADI66334.1"
FT                   /translation="MIWAEDKAQVLGAGGKMLWHVPADFKHFKDTTMGSPIIMGRASFL
FT                   SLGQALPGRRNIVLTGSREFTAPDVEIAHSLEEALELCARTPQVWITGGAKVYREVMEL
FT                   GLADLLVVTQLDMTAMVPPMSTVAYAPVIDPVRWQLDLTRSDENWRPKSGDAAWRVRYY
FT                   IPR"
FT   gene            complement(25185..26804)
FT                   /gene="gabD"
FT                   /locus_tag="HMPREF0573_10016"
FT   CDS_pept        complement(25185..26804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /locus_tag="HMPREF0573_10016"
FT                   /product="succinic semialdehyde dehydrogenase"
FT                   /note="COG: COG1012; Pfam: PF00171; InterPro: IPR015590"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10016"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66335"
FT                   /db_xref="GOA:D6ZHY6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZHY6"
FT                   /protein_id="ADI66335.1"
FT                   /translation="MSDTETETIYPSASAEAQARQMQQRCEASFRHVVSDLERAVGLPE
FT                   GRPLRTVKSPFTGMDTLGVPQATLADLDQAIVRARAAGRRWGNAPAATRARFLYKLHDL
FT                   LWEYSDEILDVIQWETGKSRYHAYDEIQDIALNCRYYARILSRAVREERRRGAFPGVTR
FT                   TFVMYEPKGVVGVIAPWNYPLSMGITDAIAALAAGNAIVTKPDSNTPLSVVIGKVLMMK
FT                   AGLDPDLFILVPGRGSELGTPLIQQVDFMMFTGSTATGRVIAKQSGENLIGVSAELGGK
FT                   NPMIVLEDARVDDAVAGLVRSAYANTGQLCVSIERLYVQDSIYDEFKAKLIKRINDMKV
FT                   AVSFDWETDMGVLISEHHLETIDTQVQDALGKGAVALTGGHALPEISYTAYAPTLLEGV
FT                   EEGMTLFNHETFGPVVSLYRFHTDEQAIALANDTNYGLNASVWGQPSHAVAVARRIEAG
FT                   TVNVNEGFTAAWGSTDAPMGGWKDSGLGRRHGIEGIRKYMESRTIAVQNRAVPIAPIMG
FT                   LSQEQYVKVLKFALKAMRRLHL"
FT   gene            complement(26916..28193)
FT                   /gene="tyrS"
FT                   /locus_tag="HMPREF0573_10017"
FT   CDS_pept        complement(26916..28193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="HMPREF0573_10017"
FT                   /product="tyrosine--tRNA ligase"
FT                   /EC_number="6.1.1.1"
FT                   /note="COG: COG0162; Pfam: PF00579; InterPro: IPR002307"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10017"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66336"
FT                   /db_xref="GOA:D6ZHY7"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZHY7"
FT                   /protein_id="ADI66336.1"
FT                   /translation="MKEVNVSDLIDELTWRGLIKQHTDMDALRRALSEGPLTFYCGFDP
FT                   TAASLHHGHLVQLIMMRHLQLAGHHPIALVGGATGLIGDPRMTAERQLQDKETVAGWAD
FT                   RLQCQIERFLDFEGENPARMVNNLEWTAPLSAIDLLRDLGKNFRMGTMLAKDAVARRLK
FT                   SDEGISFTEFSYQILQANDYLQLYRKYGVTLETGGNDQWGNLVGGMDLIRKVEGKDVHV
FT                   MTTPLITKSDGTKFGKSEGGAIWLDPEMFSPYAFYQFWLNTEDADVVNLLKVFTFLSRG
FT                   EIEALETETKENPGKRAAQRALAEAVTTLVHGADQTERVKAASTALFGRGDLREVDGKT
FT                   LVAATVDLPRTQVVLGQTNILHLLVDSGLEKGIGAAKRTVASGGAYLNNEKVEDEGRVI
FT                   TAEDVLPGGVVLFRKGKRQLGVAVTE"
FT   gene            complement(28352..29902)
FT                   /gene="agcS"
FT                   /locus_tag="HMPREF0573_10018"
FT   CDS_pept        complement(28352..29902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agcS"
FT                   /locus_tag="HMPREF0573_10018"
FT                   /product="amino acid carrier protein"
FT                   /note="COG: COG1115; Pfam: PF01235; InterPro: IPR001463"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10018"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66337"
FT                   /db_xref="GOA:D6ZHY8"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZHY8"
FT                   /protein_id="ADI66337.1"
FT                   /translation="MLPFPAIVPVKPEELSPFEKFNQLVANALGTVYGMSIGYVLIVVL
FT                   LGFGIYATIRTGAVQITMFSKMWKTVMGSRKGSHGGISSFQAFAVGLADRVGTGNIAGV
FT                   AIAITLGGAGSIFWMWIVALVGMASAFVEATLAQMFKVRNPDGTFRGGPAFYIERGLGS
FT                   RAWGSVFAVLLIFTYAFTFQLIQANTLAGLAKANFGMPTYATGLLLVAITAPFFIAGIR
FT                   SVARIAEYLAPLMAVIYMTLAVIVIIENIGQLGTVFDMIIQGAFGVNSVAGGTLGGLFA
FT                   ALMNGTKRGLYSNEAGMGSAPNAAATATVSHPVKQGMIQSLGVFVDTILVCSATAFIVL
FT                   LGGVYDPNAAEQPSDGAALTVDSLAALGPWTKPIILIVIFMFVYSTLLGNFSYSEGNIK
FT                   YLLGIENNAWIVKAISIIAVFLGSVLSLEMVWNLGDWTAALLAIMNLVACTLLFKWAVG
FT                   ALKDYQHQLQTKTEDEIQFCSSDNEFLPGELPTDVWTKEAIAQGRNISSDPASWEHGD"
FT   gene            complement(29994..32078)
FT                   /locus_tag="HMPREF0573_10019"
FT   CDS_pept        complement(29994..32078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10019"
FT                   /product="oligopeptide transporter, OPT family"
FT                   /note="COG: COG1297; Pfam: PF03169; InterPro: IPR004813"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10019"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66338"
FT                   /db_xref="GOA:D6ZHY9"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="InterPro:IPR004814"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZHY9"
FT                   /protein_id="ADI66338.1"
FT                   /translation="MQKLKRFTKEGEKSLSNQPAAAATNNAEAQSAHPYRELTFRAVII
FT                   GGLITLIFTAANAYLGLKVGLTFATSIPAAVISMAILRYFHDHTVVENNIVQTIASAAG
FT                   TLSAIIFVVPGLVMVGYWSGFPYWETTAVCMVGGILGVMYSIPLRRALVTGSDLPYPEG
FT                   VAAAEVLKVGDENGSTEENRRGLLVIIWGGLASAGMALLTALKATAGSLSANFRIGAGG
FT                   TMIGGSLSLALMGVGHLVGPAVGTAMLVGLLISYGILLPVLTQGQIANQDLGDAVSTIF
FT                   AHDVRMIGAGAMAVAAVWTLLKIIGPILRGIADSLKSSKLRETGSQVPLTEQDIPFKYV
FT                   AAITLLSMIPIGLLLWNFLRNSPISHHLVALIMLSILFVLVLGLLIASICGYMAGLIGA
FT                   SNSPISGVGIIVIIAASLLILLVTGNTSQTHPTELTAYALFTTAIVFGIATISNDNLQD
FT                   LKTGQLVGATPWKQQVALIVGVIFGSLVIPPVLQLLMTSFGFSGMEGVDETTALQAPQA
FT                   TLLSTIAKGIFGGDMNWQLFGLGALIGVGVVIVDEIMGRVSRFNLAPLAVGMGMYLNIT
FT                   TTLVIALGALVGWIYNRWAQRQEKAEQSKRLGVLLATGLIVGDSLFGILNAGIIGATSN
FT                   ANALGIVPDSFAPVAKVVGVVIFVGLLAVSYRWVMKKSGESAPMPASDMTNEETTESQA
FT                   "
FT   gene            complement(32290..32706)
FT                   /locus_tag="HMPREF0573_10020"
FT   CDS_pept        complement(32290..32706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10020"
FT                   /product="mutator mutT protein"
FT                   /EC_number="3.6.1.-"
FT                   /note="Pfam: PF00293; InterPro: IPR000086"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10020"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66339"
FT                   /db_xref="GOA:D6ZHZ0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZHZ0"
FT                   /protein_id="ADI66339.1"
FT                   /translation="MFQPIVVAAAILDDLSQPTQVLGAQRSYPEQWRGFYEFPGGKTEP
FT                   GETPEQALRRELREELSAEIIVGERLQETWPAHGGFQMFVYLCALAPHSTPQVGVAHLS
FT                   LHWVDLKHSESLPWLPADYPILTAIARHFGIAQN"
FT   gene            complement(33082..34485)
FT                   /gene="argH"
FT                   /locus_tag="HMPREF0573_10021"
FT   CDS_pept        complement(33082..34485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="HMPREF0573_10021"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="COG: COG0165; Pfam: PF00206; InterPro: IPR009049"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10021"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66340"
FT                   /db_xref="GOA:D6ZHZ1"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZHZ1"
FT                   /protein_id="ADI66340.1"
FT                   /translation="MSEKLALWGGRFQGGPAQALAALSVSTQFDWRLADYDLQGSLAHA
FT                   QALRAAGLLTESEYTDLSAALRRLRADVADGTFTYSPDDEDVHTALERGLLQENYAGPE
FT                   LGGKLRAGRSRNDQIATLVRMYLRDAAAHLQGLIAALCQAILSQADRAGTHIMPGRTHM
FT                   QHAQPVLVAHQLMAHFWPQLRNLERLRDWAKRNDASPYGGGALAGNTLGLDPELVAREL
FT                   GFSQVCPNSIDATASRDGVVEFLYVLTQVAVDMSRLAEEIIIWNTAEFGYVTLDDSYST
FT                   GSSIMPQKKNPDVAELARGKAGRLLGDLTGLLTTMKGLPLAYDRDLQEDKEPVFDAIDT
FT                   LEVLLPAMTGMVDTMTLHYERMETLSTAGFSLATDVAEWLVKRGMPFRHAHEVSGACVA
FT                   LAEGRGVGLEDLSDADFAGIDPLLTPEVRDVLTAAGSVQGRRGVGGTAPERVAEQISAA
FT                   RQQLQAFQY"
FT   gene            complement(34598..35830)
FT                   /gene="argG"
FT                   /locus_tag="HMPREF0573_10022"
FT   CDS_pept        complement(34598..35830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="HMPREF0573_10022"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="COG: COG0137; Pfam: PF00764; InterPro: IPR001518"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10022"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66341"
FT                   /db_xref="GOA:D6ZHZ2"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZHZ2"
FT                   /protein_id="ADI66341.1"
FT                   /translation="MTERVVLAYSGGLDTSVAIGWMKDKLGVDTIAVSVDVGQGGEDMD
FT                   VIRQRALDCGAVEAYIADAKDEFATEYCMPSLQANGLYQGQYPLVSALSRPLIAKHLVM
FT                   AAKQFGATTMAHGCTGKGNDQVRFEVSFTSLAPDLKCVSPIRDLSLQRDVSIAYAEEHH
FT                   LPIETTKHNPFSIDQNLWGRAIETGFLEDLWNAPTKDVYNYTDDPAFAGIPDEVVITFE
FT                   KGIPVAIDGVKMTPLQVIQEMNRRAGAQGIGRIDVVEDRLIGIKSREIYEAPGAMALLT
FT                   AHQALEAVTLERMQLRYKRQMVEPAWSDLVYEAQWNSPLKKSLDAFVAHTQEYVSGDIR
FT                   MEMHAGRAVVNGRRSEASLYDFKLATYDSGDSFNQGAARGFIELYGLQSKLAAARDGKY
FT                   GKGITLQASSL"
FT   gene            complement(35909..36400)
FT                   /locus_tag="HMPREF0573_10023"
FT   CDS_pept        complement(35909..36400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10023"
FT                   /product="arginine repressor, C-terminal domain protein"
FT                   /note="COG: COG1438; Pfam: PF01316,PF02863; InterPro:
FT                   IPR001669"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10023"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66342"
FT                   /db_xref="GOA:D6ZHZ3"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR036251"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZHZ3"
FT                   /protein_id="ADI66342.1"
FT                   /translation="MPENSVVQSKISRHSAISRLLADNVVRSQGVLQTLLENAGFSVTQ
FT                   ATLSRDLEELAATKVRDENGSLRYVLGGARATTERLLQLPGTLERWCAPLLIQATQAMN
FT                   QVVLRTPPATAGTLASVIDKENLDHVLGCLAGDNTILVICDSVESATELCDKLRGLAKR
FT                   "
FT   gene            complement(36393..37643)
FT                   /gene="argD"
FT                   /locus_tag="HMPREF0573_10024"
FT   CDS_pept        complement(36393..37643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argD"
FT                   /locus_tag="HMPREF0573_10024"
FT                   /product="aminotransferase,
FT                   acetylornithine/succinylornithine family"
FT                   /note="COG: COG4992; Pfam: PF00202; InterPro: IPR004636"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10024"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66343"
FT                   /db_xref="GOA:D6ZHZ4"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZHZ4"
FT                   /protein_id="ADI66343.1"
FT                   /translation="MDVKEWITRYENSIMNTFGTPKTVLTRGAGCFVWDEDGHQYLDLL
FT                   GGIAVNALGHGHPNIVTALHEQVETLGHVSNYFATQPQIEAAERILSIVEPGGAPQGSR
FT                   VFFTNSGTEALEAAFKLARARGGANRNRFLALENSFHGRTMGALSLTYKSIFRDPFQPM
FT                   PAEVDFLPYNIAALERAFEGARGESVAALFIEPIQGEAGVRPISDDFLKVAREVTSRAG
FT                   ALLVLDEVQTGMGRTGTWMAHHSSGIVPDVVTLAKGLGAGFPVGACVALNAEAASVLKP
FT                   GMHGSTFAGNPLAGASVLAMINTVTEEGLLSNVQNVGEIWKREILELEHPLISEVRGRG
FT                   LLLGIGLRNPLAKPLADELFRAGFIVNAPDTFTIRLAPPLIINPSQTRMFTQALPEVLD
FT                   RVQRQADEEIRLGGTRA"
FT   gene            complement(37682..38611)
FT                   /gene="argB"
FT                   /locus_tag="HMPREF0573_10025"
FT   CDS_pept        complement(37682..38611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="HMPREF0573_10025"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="COG: COG0548; Pfam: PF00696; InterPro: IPR001048"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10025"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66344"
FT                   /db_xref="GOA:D6ZHZ5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZHZ5"
FT                   /protein_id="ADI66344.1"
FT                   /translation="MITPIQKTEVLLEAMPWLRSYRGATVVIKYGGNAMINEDLRRAFA
FT                   ADIQFLHQVGLRPVVVHGGGPQITKMLDRLGLEAPFINGYRVTTPEVMEVVRMVLTGKV
FT                   QRELVGLLNVEESLAIGLTGEDAGLFGARKRHCEPGSDLGLVGDIVTVHPRAVVDMLEQ
FT                   GNIPVISSIAPSVDDPNVVLNVNADAVAAALAIGLKARKLIILTDVEGLYQDIDNPASL
FT                   IRYLTASELERMLPTIKSGMVPKMQACLDAVQGGVSRATIIDGRLAHSMLLEIVTDQGT
FT                   GTEVIPDNVLPLRPHDGEPLPTMQFRKA"
FT   gene            complement(38681..39844)
FT                   /gene="argJ"
FT                   /locus_tag="HMPREF0573_10026"
FT   CDS_pept        complement(38681..39844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argJ"
FT                   /locus_tag="HMPREF0573_10026"
FT                   /product="glutamate N-acetyltransferase/amino-acid
FT                   acetyltransferase"
FT                   /EC_number="2.3.1.1"
FT                   /EC_number="2.3.1.35"
FT                   /note="COG: COG1364; Pfam: PF01960; InterPro: IPR002813"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10026"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66345"
FT                   /db_xref="GOA:D6ZHZ6"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZHZ6"
FT                   /protein_id="ADI66345.1"
FT                   /translation="MSVTYPRGFKAAGDHVGLRGKLHPDMAIVRNLGPDSTVAGVFTSN
FT                   RVFAAPVGWDRKVVAGGRAQAVVINSAIANACTGEQGDRDAAAMAAHLGQVLGVAENEC
FT                   LVCSTGIIGRALNMPKMTAGIDTVAAKLSENGGAEAAEAILTTDTKAKTVTHESTAGWR
FT                   IGGMAKGAGMLAPALATMIVVLTTDAVGDSATMQTILSQAVDRTFNRLDSDGCMSTNDT
FT                   VLLLASGASGVKPDPDEFAAALLQVCEDLALQLLRDAEGAHHDIEIRVTGAASEAGALE
FT                   AARTISRSNLVKTAVYGNDPNWGRILSQLGTVPEDVLPFDPARVDVSINGVKVCKNGGI
FT                   GEDPYLADMSPRECHILVELHAGQEEAHLWTSDLTHEYVHINGDYTT"
FT   gene            complement(39988..40341)
FT                   /locus_tag="HMPREF0573_10027"
FT   CDS_pept        complement(39988..40341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10027"
FT                   /product="TM2 domain protein"
FT                   /note="Pfam: PF05154; InterPro: IPR007829"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10027"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66346"
FT                   /db_xref="GOA:D6ZHZ7"
FT                   /db_xref="InterPro:IPR007829"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZHZ7"
FT                   /protein_id="ADI66346.1"
FT                   /translation="MSNPQYGMQPQPQQPQQPQPPQPQFQQYQQMPYGVNVGAPGQFRE
FT                   VSKVLYILMCFFFGNLGVHRFLRGQVGLGILMIITIGCFGIWTLIDFIISLVKLGSYQG
FT                   DNFQFYQNGAWVN"
FT   gene            complement(40495..41577)
FT                   /gene="argC"
FT                   /locus_tag="HMPREF0573_10028"
FT   CDS_pept        complement(40495..41577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argC"
FT                   /locus_tag="HMPREF0573_10028"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="COG: COG0002; Pfam: PF01118,PF02774; InterPro:
FT                   IPR000706"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10028"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66347"
FT                   /db_xref="GOA:D6ZHZ8"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZHZ8"
FT                   /protein_id="ADI66347.1"
FT                   /translation="MAEVTGKKVKVAVAGASGFAGGELLRLLLNHPQVEIGALTAASSV
FT                   GEPLGKHHPHLFPLAQRVLQPTDVENLAGHDVIFLGLPHGASGQVTRTLRDGGVKSLLI
FT                   DCGADHRLTDPAAWRDYYHSEPEEPWAYSMPELLHAKESSARAQREILRQASEIAVPGC
FT                   NVTAVTLALLPAVWAGLVDASDLVANLAVGYSGAGKAMKSHLLAVSALGNAQGYAMAGV
FT                   HRHIPEIAQNFRVAGATKVNLSFTPVLVPMNRGILATVTAPLVGTGDLGELRRVYHEVC
FT                   DSEPLLEFLPEGIWPTVSMVSGCAKAAIQVAVDKRAGKVVAQCAIDNLGKGTAAAAVQG
FT                   MNLALGFPELTGVPTVSTAP"
FT   gene            complement(41672..42325)
FT                   /locus_tag="HMPREF0573_10029"
FT   CDS_pept        complement(41672..42325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10029"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3738; Pfam: PF06940; InterPro: IPR009706"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10029"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66348"
FT                   /db_xref="InterPro:IPR009706"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZHZ9"
FT                   /protein_id="ADI66348.1"
FT                   /translation="MLLVIVVLAGGVVFLLSNWRSSGPWRLDDAWGGQNLNHPGPVGTK
FT                   MLSGAVAYLDTAPKYDGSKVYPGGVPNDGTGVCTDVVWYAAKAAGMDLRELVDADRRAD
FT                   PQAYAAMAPEGEAPNPDIDYRRVRNLIVYFDRHAQSLSTDTTDVASWQPGDIVVWKEHV
FT                   AIISDRRNAQGLPYVLHHEGNGFWSRYEADVLGNRGKVWRHYRLESLGAKIAGH"
FT   gene            complement(42443..45061)
FT                   /gene="pheT"
FT                   /locus_tag="HMPREF0573_10030"
FT   CDS_pept        complement(42443..45061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="HMPREF0573_10030"
FT                   /product="phenylalanine--tRNA ligase, beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="COG: COG0072; Pfam: PF01588,PF03483,PF03484,PF03147;
FT                   InterPro: IPR004532"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10030"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66349"
FT                   /db_xref="GOA:D6ZI00"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI00"
FT                   /protein_id="ADI66349.1"
FT                   /translation="MAFVSIEWLRRWAAVPADTSASQLAKDLVKVGLEEEAIHTSGVTG
FT                   PLVCGRVVSMVPETASNGKTVNYCRVDVGEEFNDAPGTGKEPSDIPSRSIICGAHNFKE
FT                   GNHVVVSLPGAVLPGDFAIATRKTYGHISDGMICSARELGLGQDSNGIIVLEEYLGERG
FT                   MEVPAPGTDMLPILGLNQELLEINITPDRGYCFSMRGVGREYSHSTGAKFTDWGLAENL
FT                   KNGLPAVNDSGFPVEIEDAAPIRGHVGCDRFVARIVRGLNPNAPTPQWMVARLESAGMR
FT                   SISLPVDVTNYVMLDLGQPMHAYDLDKVTGPLVVRRARQGEQHTTLDDVERTLDAEDLL
FT                   ITDCQGGHGARVLGIAGVMGGADTEMTESSTNVLLEAAHFDAVSVARSARRHKLPSEAS
FT                   KRFERGSDPELPPVAAQYAAELLVEYGGGTIDPGVTDVNHVKPQPTVALPFTAATRLIG
FT                   VEYSPQRVEELLRAIGCNVTKSDADTFSVVPPSWRPDLAGGPAHLIEEIARLDGYEKIP
FT                   SVVPVGPAKIGNPAPLRTRREVSDTLAEAGLTEVMTYPFLGNEHDLMGLPVDDPRRDTV
FT                   KLANPLADDSPALRSSLLDTLLNTASRNVSRGNPRVAIFELDQVVSAHGVIPAPIPGVE
FT                   EKPSDEAMQALRAGVPKQPWHVAAVLAGNAIEASPHDAARAWDWADAIELAIRVAVSQG
FT                   LAVRPEALGVGGQAAIAAPFHPGRVAQIRVGAFTGGKVLGYAGELHPKVCQNFGLPPRT
FT                   CAFELDLDAIEKSRPKDAFQLRPVSTFPAAKEDLAFVVKQDVPALKVANAIAKAGEGLV
FT                   EELRLFDVFENVEQLGEGRKSLAFALRLRAADRTLSPQEIKETRNRIIKKVEKTCQATL
FT                   R"
FT   gene            complement(45064..46143)
FT                   /gene="pheS"
FT                   /locus_tag="HMPREF0573_10031"
FT   CDS_pept        complement(45064..46143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="HMPREF0573_10031"
FT                   /product="phenylalanine--tRNA ligase, alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="COG: COG0016; Pfam: PF02912,PF01409; InterPro:
FT                   IPR004529"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10031"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66350"
FT                   /db_xref="GOA:D6ZI01"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI01"
FT                   /protein_id="ADI66350.1"
FT                   /translation="MSENVLSPLDTEGLEREVAAALQAIAAAADVDTLKAVRSRYNGDK
FT                   APLTQAKKLIGKLDSQDKATAGQNLGAAQGRVRAALDAKQTELQEAAQEAALAAETVDV
FT                   SVLSARHPLGSRHPLMVLEEEVADFFVSLGWDIAAGPQVEHEWFNFDALNFDADHPARQ
FT                   MQDTLYIDSASVGGSAENPANLVLRTHTSPVQARLLTTRELPIYVAIPGKVFRADELDP
FT                   THSPVFNQVEGLAVDQGLTMADLKGTLDHFARAMFGPEAKTRFRPSFFPFTEPSAEVDL
FT                   WFPQKKGGPGWIEWGGCGMVNPNVLRACGIDTEVYQGFAFGMGIERTLMLRHGIEDMHD
FT                   IVEGDVRFSDQFGVNGKGR"
FT   gene            46384..47442
FT                   /locus_tag="HMPREF0573_10032"
FT   CDS_pept        46384..47442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10032"
FT                   /product="methyl-accepting chemotaxis protein signaling
FT                   domain protein"
FT                   /note="COG: COG0840; Pfam: PF00015; InterPro: IPR004089"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10032"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66351"
FT                   /db_xref="GOA:D6ZI02"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR025991"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI02"
FT                   /protein_id="ADI66351.1"
FT                   /translation="MRKAKTAVETQQLQAEIERLRAELAELQAEKESQEKALNDLNQKQ
FT                   SFTQSTNDPLARCFGSAENVRDSLGKIVSELDAGSADTAETRRVMAESTHDLHDMADGA
FT                   QDISKKLQDMGGNMEELSKASESIHNFVQQIEGIASQTNLLALNATIEAARAGEAGRGF
FT                   AVVAGEVRTLAERTASATQEIGALVSSITEGTSMALENITQAIDESKEFEEKSSQTATA
FT                   VGEKVSSMADSIARVTTESFVSVVKLDHFIFKLGIYRQITGISEPNPEGISSSHTCRLG
FT                   KWYYEGRGHLDYSGQPCFQKLEGVHEGTHVSGKAAVEAYMAGDSELMKKHLQTMEDNSA
FT                   QVGALLDQLMSN"
FT   gene            47497..48369
FT                   /locus_tag="HMPREF0573_10033"
FT   CDS_pept        47497..48369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10033"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66352"
FT                   /db_xref="GOA:D6ZI03"
FT                   /db_xref="InterPro:IPR025576"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI03"
FT                   /protein_id="ADI66352.1"
FT                   /translation="MTLPPARENRKVRSVLRNWLPNQHGAWFIVTVPALFGATLGGWAW
FT                   QQAVLLSAWMFGFCFVFSALRLIKNPRRKSLRYPVMVYGILVGLLGLGVLAALPLLCCW
FT                   IPAFALLIGVWAGEVYRGRERDLGARLTIILAAGLMTLVAYHCGLMATALRMGQDAMYG
FT                   VREASALGGHALSTVLRGWSAAAAIAVQLTAYYAASVPYVKTIFRQRGNRRFLAISVVS
FT                   HALGFTAALLSAALSWVSPLVAVAWLVTLARSIWFPWQAHRRGKPWRPRVIGLTEVAIS
FT                   VLIFVAAAL"
FT   gene            complement(48432..49331)
FT                   /locus_tag="HMPREF0573_10034"
FT   CDS_pept        complement(48432..49331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10034"
FT                   /product="diacylglycerol kinase catalytic domain protein"
FT                   /note="COG: COG1597; Pfam: PF00781; InterPro: IPR001206"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10034"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66353"
FT                   /db_xref="GOA:D6ZI04"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI04"
FT                   /protein_id="ADI66353.1"
FT                   /translation="MKVGDEDEFKTSLSAVAQQHGFVVKYLTTSVDDPGFAMAAQARKL
FT                   QPDLVIAAGGDGTVRVVSTEMRHSEIPVAVLPAGTTNLLARNLNVPLDMKAAMELAFTG
FT                   QQVSMDIVKVHNEKSRKPWYFTGMAGIGIDAEVMHHVDEGLKKVVGPVAYVMSFFRQVN
FT                   NSVQRCRFRIDGKQVLKRNVIIFMVGNTSQLTGGIQLFPEATPFDGSLDLLIGAPQGIS
FT                   GWWRVVKNVVLRLGRRSTLEYFSGKRFEVLLHKPAVWEMDGDPEAAARHWVFQVVPQAI
FT                   TVVAGEPGPLARIRSRIR"
FT   gene            complement(49394..50947)
FT                   /locus_tag="HMPREF0573_10035"
FT   CDS_pept        complement(49394..50947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10035"
FT                   /product="peptidase, C69 family"
FT                   /note="COG: COG4690; Pfam: PF03577; InterPro: IPR005322"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10035"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66354"
FT                   /db_xref="GOA:D6ZI05"
FT                   /db_xref="InterPro:IPR005322"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI05"
FT                   /protein_id="ADI66354.1"
FT                   /translation="MGCTTILVGKHASADGSTIMARTDDSGHGSFEAKRFEVIAPEDLP
FT                   KTYRSVLSHVEIPLPETGLRYTRFPDASPHKGLWAGAGINSARVSMTATETLTSNERVL
FT                   GADPLVELRESQGVEGQDGYVPEQPGGIGEEDMVVLVLPYIKTAREGVLRLGELLQKYG
FT                   TYEMNGIGFADNDDVWWLETVGGHHWLARRLPEECYAVIANQFSLDDFDFEDALGEGRD
FT                   YLCSPDLREFVADNHLDTAQTDGQPVQRFNPRLAFGSRSDSDHTYNTPRVWALQRFLNP
FT                   TDASRFGFQGDSRPDSDDLDWCLIPERLITMEDVKYTQSYHYQGTPFNPYARAEQARIG
FT                   GADQRGMYRPIGINRTNFVAALQIRPDKPATTTGLNWIAYGAMPFNALVPFYANVRHTP
FT                   EYLEATTERVTTENHYWANRIIAALVDAHYHQTIPHVERYQQKVVAAALQVVARTDRAV
FT                   AELGEDAANNMEDSRVYELLEAANAEIADMLKRETDDLLDKVLFDASLNMHNSFSRDDA
FT                   "
FT   gene            51111..51941
FT                   /gene="panB"
FT                   /locus_tag="HMPREF0573_10036"
FT   CDS_pept        51111..51941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panB"
FT                   /locus_tag="HMPREF0573_10036"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="COG: COG0413; Pfam: PF02548; InterPro: IPR015813"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10036"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66355"
FT                   /db_xref="GOA:D6ZI06"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI06"
FT                   /protein_id="ADI66355.1"
FT                   /translation="MHKHHPDIGPKPGKPFRVQHVQQYFTAGRPLTMLTAYDAITARII
FT                   DSAEIDMILVGDSYGTTMLGMSSTVGVTLDDMVRATAAVAAGASRALVVADMPFGTYES
FT                   SPAQAVDTAVVLVRAGAAAVKLEGGRRILPQVKAIVNAGINVMGHLGFTPQSENHLGGK
FT                   RLQGRSDAAPELIADALALQDAGAFSIVFEMVPAATTRAAVNQLNIPIIGIGAGPDAAG
FT                   QVLVWTDMAGMQDWKPSFAQVFGQVGAELKHAAQNYRDAVVNRTFPAPENYHEN"
FT   gene            52113..52904
FT                   /gene="map"
FT                   /locus_tag="HMPREF0573_10037"
FT   CDS_pept        52113..52904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="HMPREF0573_10037"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /note="COG: COG0024; Pfam: PF00557; InterPro: IPR000994"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10037"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66356"
FT                   /db_xref="GOA:D6ZI07"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI07"
FT                   /protein_id="ADI66356.1"
FT                   /translation="MFHDGPERVTASDVKSEETIEKIRQAGRIAADAIVETAKHIAPGV
FT                   TTDALDRVAHEFICDHGAYPSCLGYMGFRKSICTSVNECICHGIPDDRPLEEGDIINLD
FT                   ITAYKDGVHGDTCAMFPVGEIDPESQQLIDCTKEAMMRAIKVCKPGRSINVIGRIIESY
FT                   ASRFEYGVVQDFTGHGVGEAFHSGLVIPHYDSPRYDTIMEEGMVFTIEPMLTMGSIAWE
FT                   QWRDGWTVVTRDRGRTAQFEHTLVVREDGGEILTWPSNHQD"
FT   gene            53032..53775
FT                   /locus_tag="HMPREF0573_10038"
FT   CDS_pept        53032..53775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10038"
FT                   /product="ROK family protein"
FT                   /note="COG: COG1940; Pfam: PF00480"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10038"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66357"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI08"
FT                   /protein_id="ADI66357.1"
FT                   /translation="MATGFGIDVGGSGIKGAYVDLETGDFIGDRLRIKTPAHSTPQAVA
FT                   EVCRQIIEEKGVPEDMPLGLTIPAPVKNDLVPFIANLDQGWAGIDVRVLLRKYTGHMVK
FT                   CVNDADAAGYAEVRYGAARDVPGLVIVTTLGTGIGTALIYNGILVPNSELGHIEIDGKD
FT                   AESRASSGVKAAKKLSFKQWSKRLQKYYSTMEMLFSPDLFVVGGGVSRQHNKFLPLLDL
FT                   KTPIIPAQLRNQAGIAGAAALAAGV"
FT   gene            complement(53939..54259)
FT                   /locus_tag="HMPREF0573_nc10002"
FT   ncRNA           complement(53939..54259)
FT                   /locus_tag="HMPREF0573_nc10002"
FT                   /product="bacterial RNase P class A"
FT                   /ncRNA_class="RNase_P_RNA"
FT   gene            complement(54319..55044)
FT                   /locus_tag="HMPREF0573_10039"
FT   CDS_pept        complement(54319..55044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10039"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66358"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI09"
FT                   /protein_id="ADI66358.1"
FT                   /translation="MKAAPEDQEKLLDLQVLDRKIAGLKHSLASIPAAVRAEQIKVEQD
FT                   ELRTKLALATSARNDLNRALKQAEGEVSKVQERAKTQRERLDSGQMSPKEMERIQAELA
FT                   QLATRQGELEDSALDALDALERASKKVKLVENRRAELAVELDEAQTEAGSVAGELQQEL
FT                   VGQQTERDELVATIPADLLREYETCKRATGGIGVVAVSGNQSVGMDLEFSMAEISRLNV
FT                   AAPDDVIVSEDHEVILVRK"
FT   gene            complement(55099..55989)
FT                   /locus_tag="HMPREF0573_10040"
FT   CDS_pept        complement(55099..55989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10040"
FT                   /product="dinuclear metal center protein, YbgI family"
FT                   /note="COG: COG0327; Pfam: PF01784; InterPro: IPR002678"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10040"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66359"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI10"
FT                   /protein_id="ADI66359.1"
FT                   /translation="MSNEALTVCDLCEWMDAHFAPELQEDWDRVGLICGDRGDPVTRIL
FT                   LAVDPVEPVVDEALEWGAQLVITHHPLFLRGTSFVSTDTAKGRVVHRLIRGGAALFNAH
FT                   TNADSAHDGVAEALAQAAGLDPQTWRPLQPAPADTSLGIGRVGPVTPTTVGEVASRLAN
FT                   LLPSSPAGLLVAGESDRPVKTVAVSGGSGQSLLPAALDAGADVFVTADLRHHPALDFLE
FT                   MDGAPALIMPSHWASEWMWLPRLETALNLWAGEIGKPLETKISTVISEPWDAYIPTVAD
FT                   EETTPDDAGCSSVNY"
FT   gene            complement(56054..56434)
FT                   /locus_tag="HMPREF0573_10041"
FT   CDS_pept        complement(56054..56434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10041"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66360"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI11"
FT                   /protein_id="ADI66360.1"
FT                   /translation="MDFGIEKHDTDGMIYYAWSKQLSQFTDLGHGELKMIESGNAICLT
FT                   DSQSGQNYGIVLPEEANFTNDLFSFENGASWSVGETAEQHNFFVKEPRLYNISESMKKS
FT                   QQEIIKACKMDNQRIFFLIPGL"
FT   gene            complement(57021..57785)
FT                   /locus_tag="HMPREF0573_10042"
FT   CDS_pept        complement(57021..57785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10042"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66361"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI12"
FT                   /protein_id="ADI66361.1"
FT                   /translation="MFPKAEEDTMYYKIIPILVIGFSLVCLGNAPALGVGDTSLVKDSI
FT                   NSQDFMTRFEQKYPEIFSFGKWDQETNKFVMGVKGEMPLEAELAAKKFATDFKVDENTG
FT                   YSQKELFDAAAFLVRHVESAVGVIDSDSVFTTIDPTTPSIGLQIDNSVQQKLKSDLIFG
FT                   LESISDDLQDRSATNLGSKLLNTDNPKLLAKLKIDMNIGNVSREEQALYGGGRISGSDI
FT                   GYCTTGFTASKSGYSSGILTAGHCLVGTSPIV"
FT   gene            57860..59521
FT                   /locus_tag="HMPREF0573_10043"
FT   CDS_pept        57860..59521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10043"
FT                   /product="AMP-binding enzyme"
FT                   /note="COG: COG0318; Pfam: PF00501; InterPro: IPR000873"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10043"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66362"
FT                   /db_xref="GOA:D6ZI13"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI13"
FT                   /protein_id="ADI66362.1"
FT                   /translation="MLILPIQQSWYDSTVVDYSPMKFLQAAALRHPGRTSMIWIAQGIS
FT                   AETIAEPSFAPPTWNVAQTLARATRLAAQFRSWGVVPGERVVVIGKNSPWHLLTFVAAA
FT                   AIPAITVPLDQNLPAPELAKILAHCEPKIIICDPTQNEKLADCDPTATPRPRLVTYSDL
FT                   EDCLEPRDDSTPPVTLALAVTKMLDDLPECGDDVPGAIIYTSGTSAHPKGTLLTYKNLW
FT                   WGCTNFREVFEYSAATVEAVTAPLSHIGGFNGTTTDIFSHGGTVVIFEKFDAAAILAAI
FT                   EKYRVQMMFAVPTMYRMLVREVRQAAQSGRPVDTSRFTKALVGGAPWDEQLAADMIGLG
FT                   WNPINIWGMTEQSASGAALTTDVMAGRELVVGRAFPHIELRAVDGAGNPVKPGVIGQLE
FT                   CRGPSVTREYFRNPELNAALIDPQTGWLRTGDLGFFDADSFLHLVGRLTDTINSGGEKV
FT                   FSQRVAAVLSRHPGVSEARVVGVPDPTWGEIVAAVVVQTPDTPENAEPLSLEQLQDFAR
FT                   PYLTKAELPRALRLVSRIPLNSNGKPDRQGLLTLFQ"
FT   gene            complement(59546..60580)
FT                   /gene="lipA"
FT                   /locus_tag="HMPREF0573_10044"
FT   CDS_pept        complement(59546..60580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipA"
FT                   /locus_tag="HMPREF0573_10044"
FT                   /product="lipoyl synthase"
FT                   /EC_number="2.8.1.8"
FT                   /note="COG: COG0320; Pfam: PF04055; InterPro: IPR003698"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10044"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66363"
FT                   /db_xref="GOA:D6ZI14"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI14"
FT                   /protein_id="ADI66363.1"
FT                   /translation="MSTLESAQHRKLLRLEVANARKPREDHPRWLRVVAKAGTEYQEMR
FT                   SLMQGAGLHTVCAEAGCPNIFECWEDREATFLIGGAVCTRRCGFCDVASGKPEGYDRDE
FT                   PRRLAETVKHLGLKYVTVTGVSRDDLENGASWLYAESVRQIRALCPETGVELLVDDFQG
FT                   KSVALEEIFASDPQVFGHNLETVARLMHTVRPAFTYARSLDVITQAKQFGLITKSNLML
FT                   GLGEEPEEIEATMRDMLNAGVDILTLTQYLRPSERYLPVVRWVKPEEFVRLKELALDMG
FT                   FAACMSGPLVRSSYRAGKLWAQAMRHYERCIPPQFAHLEQDRPPARQEAEAVVEREKQR
FT                   QSCA"
FT   gene            complement(60742..62550)
FT                   /locus_tag="HMPREF0573_10045"
FT   CDS_pept        complement(60742..62550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10045"
FT                   /product="FAD binding domain protein"
FT                   /note="COG: COG1053; Pfam: PF00890; InterPro: IPR003953"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10045"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66364"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI15"
FT                   /protein_id="ADI66364.1"
FT                   /translation="MNTKKSSARKPFDRPSKDTYDVIVVGSGAAGLSASLTAARRGLKV
FT                   LMVEKSDQWGGSTSKSAGMVWVPGNNVFARLGGSDSTDLGRQYMKATVGDCTSDEMIDT
FT                   FLEEGKKCMDFLTASCPHLEFRRMEGYPDYWLDAPGAAKTGRGVEAGAFDSRLLGPWEK
FT                   THVKAYFRPMSPVDMNSYDSADLLLAMTDPRPWIRGMKLLWRNLKHYAKGARPLTMGAG
FT                   LTAAIMYSVLREGVEVKLQNALVDFLIGDGDAGKKGKGEQRVTGVVLEHNGTRYPINAT
FT                   HGVILACGGFERNEVMRQKYQRHPITGTWTVGVEGNTGDGIELGMKHGAAIDNMADAIW
FT                   SPVIKLPRTEGFQPIVIEDEERFIIPDRSLPHTMMVNGKGKRFMNEALPYCAAGQGLYG
FT                   GVFGKGEGDAENMPAWLIFDQQFRDKYFFAYGHMPRVELPDVYYESGALVRRDTLDELA
FT                   EAIDVPSAALAETIERFNGFADRGIDEDFHRGENEHDKFYANRYHHPNPSLGRLEKGPF
FT                   YATQVYPGDIGTAGGLVIDTKARVTREDGSVIPGLMAAGNTTKSVIGHTYTAGGTSIGA
FT                   ALVFGYIAANTAADEAFADNPVFVAH"
FT   gene            complement(62600..63280)
FT                   /gene="lipB"
FT                   /locus_tag="HMPREF0573_10046"
FT   CDS_pept        complement(62600..63280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipB"
FT                   /locus_tag="HMPREF0573_10046"
FT                   /product="lipoyl(octanoyl) transferase"
FT                   /EC_number="2.3.1.181"
FT                   /note="COG: COG0321; Pfam: PF03099; InterPro: IPR000544"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10046"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66365"
FT                   /db_xref="GOA:D6ZI16"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI16"
FT                   /protein_id="ADI66365.1"
FT                   /translation="MENLLPRGLVSYLDADRIQRETWAQVRDGELDHTLILGQFEPTYT
FT                   AGRNTHDSDLINKDLPVIRTDRAGSLTWHGPGQLVIYPVVRLREPVDLIAYIRAVEGAV
FT                   IDAVRGNWGLDVEIVQGRAGVWLRYRDAAGRTATERGTGRDRKLCAIGLKVVQNATLHG
FT                   LALNIHPDFSHAFTGIIPCGLNDAGVTSLFEEGIETDFDTAAKVVVDQLTVKLTPLLAP
FT                   FSEI"
FT   gene            complement(63750..65621)
FT                   /locus_tag="HMPREF0573_10047"
FT   CDS_pept        complement(63750..65621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10047"
FT                   /product="efflux ABC transporter, permease protein"
FT                   /note="Pfam: PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10047"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66366"
FT                   /db_xref="GOA:D6ZI17"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI17"
FT                   /protein_id="ADI66366.1"
FT                   /translation="MLELANLATRLLKGHKSLYLSCAVTISIVTILSSAQVALGMNLSN
FT                   PALVHVDGVSSEEVSLELIPLRGVLIFLGIILLVLSSFLIFSAIVQVVQLRSEEIQLLK
FT                   LSGASKTQLNSLIAFEAFALGLFVGIPSAVIGSFFSIPQLQFLGAIGFFGKSLHVTYEF
FT                   NFMQVLFVVGLVIFECAVAGYFATIKVGSEKETKSAIKRISPVTVVWRVLLALAIGIFL
FT                   FAVNLDAFGGLYILLVPLMIVIAILLVAPLFIPIVSKLIGNAIGLFRPGIGLLVSQVSQ
FT                   KNVFRFSHYAAPPIICLGIVGTFMALDFPTSEMLYQDFYNSSKASSVFITEGSADANKI
FT                   YDLVSAKSADVSRIRERLISDKRGYWSLYYVDFKENFNLLNQKLIQGQLDNVGNTNVAS
FT                   SISGSVIGDKVTIYNENGESFELTVTALLHDSVHEGYFIDWSMLSHFPKFAKSKNTETM
FT                   VFARGITPQMSQDIAKSVNSEVKVLTRYGYAKYLQNMRHVLAFRGNVGMFGVILIMTLI
FT                   ALLQLTISEEIARRKQCQQLHALGVDNKDILSFGLATVFSTQLVSLLLTLLSLLFTAYR
FT                   CSSVAKTSTIADFMYVMPLILICWVSILLFTLVIQTLATHHSLRAVL"
FT   gene            complement(65614..66336)
FT                   /locus_tag="HMPREF0573_10048"
FT   CDS_pept        complement(65614..66336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10048"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="COG: COG1136; Pfam: PF00005; InterPro: IPR003593"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10048"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66367"
FT                   /db_xref="GOA:D6ZI18"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI18"
FT                   /protein_id="ADI66367.1"
FT                   /translation="MALFDINNISFRYHSKQGDILKGVSYTVESGDYLAIMGPSGSGKT
FT                   TLLKCIAGLLSPTGGEVLYKGKDTTRVKQSVLNRLRRTDWGFVFQEYNLVDAINVVDNV
FT                   RLPAYFNHQRLSKDAVMTALESVNLGSFASRFPDELSGGQQQRVAIARAIASKREVVFA
FT                   DEPTGALDSKSSKEVISNLTELNKTGATVLMVTHDPMVAAAASKVLFLYDGKIVQQGNY
FT                   QSAQEISNILLDMENANA"
FT   gene            66591..67763
FT                   /locus_tag="HMPREF0573_10049"
FT   CDS_pept        66591..67763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10049"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10049"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66368"
FT                   /db_xref="GOA:D6ZI19"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI19"
FT                   /protein_id="ADI66368.1"
FT                   /translation="MDMPRSQLSRLFRLDVAARAGLQWLMTTLTLRGLLLSTSLAVFAL
FT                   WQVWTWIKTPPHSLWLWLLILPIVTAWILMVFRPAPGRWILLAVCVLYIFLPVQTPILL
FT                   QSMASLVLCAEGTVHRQRWLVIATVLSSFASFQHFDYQIESLISQLILSLITVGLSWAA
FT                   RVIVEERETAKENVRRIQEETEQRIAAAIHDTTARDLTRLVLRLQHWEESNTCDRQIIQ
FT                   QELQQEAAESLSRLRHLIRVLEGVQLGIDQEALTLKETLEQAHKHLTHANISLTTDIDP
FT                   RLYNLPVENTLIVTETVAELLANAEKYAAPLSEVELSLNLEGQTVMLFQSNSIGQSPKP
FT                   PDVSGGTGLQRLAYRLDNLGGNLETSTIGAMWLTEAQIPLIPDLEKLLKG"
FT   gene            67766..68440
FT                   /locus_tag="HMPREF0573_10050"
FT   CDS_pept        67766..68440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10050"
FT                   /product="response regulator receiver domain protein"
FT                   /note="COG: COG2197; Pfam: PF00072,PF00196; InterPro:
FT                   IPR001789"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10050"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66369"
FT                   /db_xref="GOA:D6ZI20"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI20"
FT                   /protein_id="ADI66369.1"
FT                   /translation="MTTDTHHHYQVILIDDDHEILEDLRLVIEADPEISVAGIGFDGSY
FT                   VLDLVQTHHPDVVLMDVEMPKVDGIAATRQLKSRYPNLGVIMLTNFRHDTWLKEALDAG
FT                   ADGFLTKDTPRADLSAAIKRVAHGGRFMSTKPLNMLIANYEDPNFTPDPRFRAGEKALT
FT                   ATERQVWQEALRGKSNAQIAKVMQSKESTIKTHMSAIMQKFSVRSRAELLVFSAKNGAI
FT                   RE"
FT   gene            complement(68537..68824)
FT                   /locus_tag="HMPREF0573_10051"
FT   CDS_pept        complement(68537..68824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10051"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66370"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI21"
FT                   /protein_id="ADI66370.1"
FT                   /translation="MVILRSKITESFWVHFFVGRVYPVRKYLKGLGTRTREGQRRVNLD
FT                   LLDIRKGYRTGDKAGKGWENPNKKHTINPKILSFIQKLFGSVRFFEDFFG"
FT   gene            complement(68959..69035)
FT                   /locus_tag="HMPREF0573_t10001"
FT   tRNA            complement(68959..69035)
FT                   /locus_tag="HMPREF0573_t10001"
FT                   /product="tRNA-Val"
FT   gene            complement(69116..69319)
FT                   /locus_tag="HMPREF0573_10052"
FT   CDS_pept        complement(69116..69319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10052"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66371"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI22"
FT                   /protein_id="ADI66371.1"
FT                   /translation="MQTGSAKLLCVGAYYAGVDGVDTTPGWVPYNGKRVVVAATAGDVG
FT                   WPSDTSLPVGEPRGGGEIIFAE"
FT   gene            69850..71019
FT                   /locus_tag="HMPREF0573_10053"
FT   CDS_pept        69850..71019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10053"
FT                   /product="YibE/F-like protein"
FT                   /note="Pfam: PF07907; InterPro: IPR012507"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10053"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66372"
FT                   /db_xref="GOA:D6ZI23"
FT                   /db_xref="InterPro:IPR012507"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI23"
FT                   /protein_id="ADI66372.1"
FT                   /translation="MIISLGLITVLTLAGVVWLWPDWHHLQEVRQLNFSFATAPGVSYE
FT                   RANIVKLEPKCRDTDISSSGAQSHLDDCVRLTVRLTSGPDSNQVTTLEAVGPGAHSDLK
FT                   PGDTIQVMRSPGEKPGADTYTFTGVPHDLPIILFAILFAVIVLAVARVKGALSLVGLAF
FT                   ATVVIVYFMLPSLASGRPGIWVGVVGSCAIMLIVIHIAHGISMRTASALLGTVCGLGLS
FT                   ALLGAIAVKSAHISGYIDETSFDLSAAIPHLNMSQLFVAATILAGLGVLNDVTITQASA
FT                   VWELRLAAPTYTRREIYQSAMRIGRDHIASTIYTIVFAYTGAALSTVMLIVLFFERSLS
FT                   DLFTTEALAAQALQILASGSALIASVPITTAISTLAVRKPTPPVTEICD"
FT   gene            71510..72178
FT                   /locus_tag="HMPREF0573_10054"
FT   CDS_pept        71510..72178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10054"
FT                   /product="site-specific recombinase, phage integrase
FT                   family"
FT                   /note="COG: COG0582; Pfam: PF00589; InterPro: IPR002104"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10054"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66373"
FT                   /db_xref="GOA:D6ZI24"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI24"
FT                   /protein_id="ADI66373.1"
FT                   /translation="MLLEYVSAKPWQSETRHSYYASLKQFFAWYSRIYKYENPALVLPT
FT                   VKRGSPMPRPIPDNLLAEALAGCTPRHRLALELAALAGLRSGEVARVNAGDITEDLLGY
FT                   SLVVHGKGNKQRVVPITDGLAASIRDLAEPGTGWVFPGADGGHVTPRWISKLGANLLPS
FT                   PWTMHTLRHRFGTHAYAGDRDLVAVQRLLGHASVSTTQRYVEPPSDAMRRAANSAQIIH
FT                   "
FT   gene            72201..72497
FT                   /locus_tag="HMPREF0573_10055"
FT   CDS_pept        72201..72497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10055"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66374"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI25"
FT                   /protein_id="ADI66374.1"
FT                   /translation="MSHEPIASKSSNAGRGGNATHASHARIAGKSVTEERLRLGAYLEA
FT                   ALSALKDAQLINIAHSANLPEVIETWRVEMATEQLRILRRQLKEFIESEYNEK"
FT   gene            72509..72754
FT                   /locus_tag="HMPREF0573_10056"
FT   CDS_pept        72509..72754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10056"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66375"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI26"
FT                   /protein_id="ADI66375.1"
FT                   /translation="MNESTQEAFVKKCPHCGSRDVEVSTWEAWCYACDWQLDKVDNPEL
FT                   FALYREARLAEVRGLQPILEAELAELDRVMSGRSTV"
FT   gene            72754..73518
FT                   /locus_tag="HMPREF0573_10057"
FT   CDS_pept        72754..73518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10057"
FT                   /product="CobQ/CobB/MinD/ParA nucleotide binding domain
FT                   protein"
FT                   /note="COG: COG1192; Pfam: PF01656; InterPro: IPR002586"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10057"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66376"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI27"
FT                   /protein_id="ADI66376.1"
FT                   /translation="MILAICNQKGGVGKTTLATNLAVRMKSPTGKPNLLVDCDPQGNAT
FT                   TTLGVEIKPGDFTLNDVLAAVATGSAGSVARGAILNIKESWSLDLLPADRLLASRESDT
FT                   SLGRETRLATVTEELREDYGHIIIDCPPAIGMLTTNALVAADKALIVTQARETSVDGVS
FT                   EMVSTIATIRSHYNPRLTLAGIVLNAYRPDRTDRRAWADKLREYFGNYLFDVSIPEREA
FT                   IAAAATRHEPIPASDEQTTAVITELAKQLEDA"
FT   gene            73515..73880
FT                   /locus_tag="HMPREF0573_10058"
FT   CDS_pept        73515..73880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10058"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66377"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI28"
FT                   /protein_id="ADI66377.1"
FT                   /translation="MKTPDPAALAGLRKAAVTDPVIAGNAGNTSNTGITSHASHTSTAG
FT                   KTDTKFTIRLSGELMGRVRAAYLRDLTNGFSGSLSAWAAASLESAVIQSEAAYNGGKHY
FT                   QPIETGSIPTGIMPNTN"
FT   gene            73892..74551
FT                   /locus_tag="HMPREF0573_10059"
FT   CDS_pept        73892..74551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10059"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66378"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI29"
FT                   /protein_id="ADI66378.1"
FT                   /translation="MNDEFESGALDEGGVFFRKLDDDTFAIVGSTLLPGEQVEVTSKNG
FT                   TVRQVIVGKILSEDDGIMTAEFDWVAEPHPDIDYSDCQVYFHGLDNGDYVVTGMNLVQG
FT                   ETATVSVKDGGTKEVIVTKILDVNEDGIQTATFEWPRTSPDDLVNDGRIVFTRLEGDEW
FT                   AIRGKGLETGKTVKVSRKGKTSKEKVIVAEIVEDENGIQTAKFTNPPNEKKDTDND"
FT   gene            74544..74918
FT                   /locus_tag="HMPREF0573_10060"
FT   CDS_pept        74544..74918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10060"
FT                   /product="glutaredoxin"
FT                   /note="COG: COG0695; Pfam: PF00462; InterPro: IPR012335"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10060"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66379"
FT                   /db_xref="GOA:D6ZI30"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI30"
FT                   /protein_id="ADI66379.1"
FT                   /translation="MTDTEVLTIYSAPNCMGCKMTARALQKAGVKFKLVDLTTLSPEAI
FT                   EAFKAEGLMQAPIVRTGEGDQWSGFRPDKIKQTVETMPADQVDEALAKIYEERFGKPMD
FT                   TAKPTQEATQRERKPKPRRQ"
FT   gene            complement(75110..75607)
FT                   /locus_tag="HMPREF0573_10061"
FT   CDS_pept        complement(75110..75607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10061"
FT                   /product="Virulence-associated protein D (VapD) conserved
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10061"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66380"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI31"
FT                   /protein_id="ADI66380.1"
FT                   /translation="MDEQNRRLRFAFHFDLAEAKLKERYPSESATGYKQAWADIRSFLE
FT                   ANGFTHTQYSGYESVEPMTYFDAYNILDNLQDQFSWFQPCAQGATLTEIGERYDVLEYL
FT                   RAQTVDHRAMPEKALQSDAPGVPQSREDVAKSIAEAVKVKLEERKSKGKPSPDRGKKRP
FT                   SR"
FT   gene            complement(75620..75940)
FT                   /locus_tag="HMPREF0573_10062"
FT   CDS_pept        complement(75620..75940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10062"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66381"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI32"
FT                   /protein_id="ADI66381.1"
FT                   /translation="MTDVKPWSFTIEFDAAKAARNGYDVDTLYECVDKNVQRYGLTRLD
FT                   RGTWKANESKKVESQCLSLLMLSKQKWVMQNLHSLTAYERSTDPIDIIAALRKRNPERV
FT                   YA"
FT   gene            complement(76225..77034)
FT                   /locus_tag="HMPREF0573_10063"
FT   CDS_pept        complement(76225..77034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10063"
FT                   /product="Fic family protein"
FT                   /note="COG: COG2184; Pfam: PF02661; InterPro: IPR003812"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10063"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66382"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI33"
FT                   /protein_id="ADI66382.1"
FT                   /translation="MRFFSDPWDSYFIRDTRKNLIPTLKNKLGIHDFYILSKAEYAITY
FT                   ERMSEILFDDRHDYKTFDASHVKTIHAHLFQDIYKWAGKYRTVEISKKNNGTIHSFAPK
FT                   KLIDTYLERVSETVKTTDWAHISRQAFVEQISKVFAYLNQAHPFREGNGRTARVFLMQV
FT                   AELSPFELRISRIDDKKEWNLASAESAPLPGTFEPRPEAMHKIMEGYTFQREIPGQNLQ
FT                   TPDIETKPPQTRQDLAESVSERVKTKIQARQSKTESQPRRDRKPPTR"
FT   gene            complement(77031..77249)
FT                   /locus_tag="HMPREF0573_10064"
FT   CDS_pept        complement(77031..77249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10064"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10064"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66383"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI34"
FT                   /protein_id="ADI66383.1"
FT                   /translation="MALELEKIFPDLFTGMTTEEIQRENDLWANQWLEGWQPDREQVKL
FT                   GLMRRHGELTMDEFIKAVVKDAEEKYS"
FT   gene            complement(77264..77599)
FT                   /locus_tag="HMPREF0573_10065"
FT   CDS_pept        complement(77264..77599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10065"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66384"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI35"
FT                   /protein_id="ADI66384.1"
FT                   /translation="MEYQTKKARRTADQILFAEQEKLEQKKRALRSFEKLLSRFEKIST
FT                   EIIEARDELEAAGMARANIIDAFQLDPVATKLLKTTTKKTTPAKTETETVPETNTTTET
FT                   NPDWQDN"
FT   gene            78168..79628
FT                   /locus_tag="HMPREF0573_10066"
FT   CDS_pept        78168..79628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10066"
FT                   /product="relaxase/mobilization nuclease domain protein"
FT                   /note="Pfam: PF03432; InterPro: IPR005094"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10066"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66385"
FT                   /db_xref="InterPro:IPR005094"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI36"
FT                   /protein_id="ADI66385.1"
FT                   /translation="MQWLRKLSGSCQKFKQLLNAWRMTKTMAVTKIGQIRSTLKAAIEY
FT                   VVDPKKTNGGILTSSNCGIPHLANSVYIAFREIHEKAENAHTTGSYGTVLAFHVIQSFK
FT                   PGEVTQNLAHDIGVELVEAITHGEYDYVVATHVDKDHIHNHIIFHSVNRNTLKHFRCPK
FT                   RRYFEIREISDELCRKHGLSIIENPGENVPTTELHARAHGRSKKAQLELFIDEAVRNSY
FT                   SWEAFTDNLGEMGISVHFKGGQLLYAAPKIFSREIRGKTLGVAYSESALMSRIGRQNLS
FT                   EYIVQPSMVKVLDEQRYRVQVPGHRRKRYIVVFNHQINDHGTHFRMYLPDNWEGRMTDS
FT                   FGQLAEPTTAAELYNWFSRLDPVRQSAPARTTVPIGLDSNTARERYRAVIAKKIEDVRE
FT                   EAALDGLRLEYEKAPDKQAFISGLREELATTLKQLESALIEKQRRDDLQAPYLGEDIEV
FT                   ENATRKARVLRTAIKEQEKDNRKQKKIR"
FT   gene            79638..80195
FT                   /locus_tag="HMPREF0573_10067"
FT   CDS_pept        79638..80195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10067"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66386"
FT                   /db_xref="InterPro:IPR024234"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI37"
FT                   /protein_id="ADI66386.1"
FT                   /translation="MSQLTDEAGEKVERILIDVSQQGVRVAFNAGTKLTHKTVTTSLKA
FT                   ATKAIEKIPGLPGQPEHGKMTVKALQRKTNDGLHAIEIPPEMLKGIQHELKKRGVDFAI
FT                   DKAQDGNYYVQIQGKDADTMKHALKQVQAKLSKPQTRQDLKKDIEKRAQDKKEAKAKAP
FT                   AKKKARTAKATKGVTPKPAVKL"
FT   gene            80215..80496
FT                   /locus_tag="HMPREF0573_10068"
FT   CDS_pept        80215..80496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10068"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66387"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI38"
FT                   /protein_id="ADI66387.1"
FT                   /translation="MRAAIYGEIVGAVRESDNLLTFSVKADLPGYDPVNTLVWTEGGLA
FT                   RFLHSERIATGMKVLCMGEMATKDGFPYLDAEHVAFDIYEEWAQANGY"
FT   gene            80486..81016
FT                   /locus_tag="HMPREF0573_10069"
FT   CDS_pept        80486..81016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10069"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66388"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI39"
FT                   /protein_id="ADI66388.1"
FT                   /translation="MAIRIHILTRTAKAEVLARRELGNFGFALEVEQNDPGQIDPALRR
FT                   LGLDQDQAAVLSTPNLILATNTPTELAEFLTWVKNHPPVVLEERPAPLEDANTQTIQAE
FT                   APASNTGIASLASDDSNASQDVRESRKPPQTRQELAKSLAELANAKIEAHAAAHRRSTQ
FT                   HKRQGEYNREYSS"
FT   gene            81018..82859
FT                   /locus_tag="HMPREF0573_10070"
FT   CDS_pept        81018..82859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10070"
FT                   /product="TraG/TraD family protein"
FT                   /note="Pfam: PF02534; InterPro: IPR003688"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10070"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66389"
FT                   /db_xref="GOA:D6ZI40"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI40"
FT                   /protein_id="ADI66389.1"
FT                   /translation="MFIAFLGLAAFWAANKIAFQVRTTWNKGLAFVQDHVLDDFHSPLH
FT                   VSMYTADLGAGLGAIVLMFLVWAYHNVGKMSQRVGEEHGSAQWAKPSDMKPFTDKDKRN
FT                   QLLFTGSEALSLDSRKTQRNLNALVIGSSGSGKSRYFVMPNLAQANTSFAITDPKGELL
FT                   RLTGQSLKNAGYRIRVFNLVDFAQSDQFNPLAYFNPHQAEVDCTVLTENFITNTNGQKP
FT                   TSGDGFWEKAERALLNALISYVYFTQGGEGSLVDVVDLLARMQASEEDENAESDIDLIF
FT                   EAVNEKIAEYDADPADWGSEAVSGIDGLRFAAAQYNTYLQGAGETKKSVIISLGVRMAP
FT                   LHMAQMRKLLAADTIGLDKIGTEKTALFLVIPDTHAAFNFIASIFYEQLFETNLYLADH
FT                   NETGRLKFQVQCFMDEFANIGKMPSFERKIAVMRSRGISTAIIMQNYSQGKAMYKDDWE
FT                   TIVGNCDSLLFLGGNEKSTTEYISKVLGKQTIMSEETSQSKGRTGSFSQSQRKLGRELL
FT                   TADELGRLPGGECIYILRGVRPFRSKKLPAPSFTENYTYTPTMPASLAMPATPASLAEE
FT                   DGDIEVDWEPGEPEESLLTDQSTCEPARSDDKEQEHD"
FT   gene            complement(82794..83645)
FT                   /locus_tag="HMPREF0573_10071"
FT   CDS_pept        complement(82794..83645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10071"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66390"
FT                   /db_xref="GOA:D6ZI41"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI41"
FT                   /protein_id="ADI66390.1"
FT                   /translation="MFPGSDALAQGLYTMFKFIFSPDLAGGITDLQKTIATFNVAAYGL
FT                   AGDINSTIIKPIAAVVLAIILVLELARISSRFDGDQKLAVQQVATAMIKAVLVIIAIQN
FT                   VDLILGAINQVGDNAISAVAAPGSLSSSQSYPSVQEIQQADLPSQLFTGGLLIIPWLLA
FT                   LIAGIILKVIVFVRFAEIYVLSAAATLPLVFMAHPETKSIAVGYLKKYAAAVLQGLMII
FT                   IMVKVFAEFKKACLGGGGSSISGSDLLGTTLNAVPSMALSSVVFLFLIIASGRLARALV
FT                   GE"
FT   gene            complement(83659..85371)
FT                   /locus_tag="HMPREF0573_10072"
FT   CDS_pept        complement(83659..85371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10072"
FT                   /product="peptidase, M23 family"
FT                   /note="COG: COG0739; Pfam: PF01551; InterPro: IPR002886"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10072"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66391"
FT                   /db_xref="GOA:D6ZI42"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI42"
FT                   /protein_id="ADI66391.1"
FT                   /translation="MPTQVRKTSVYHSTADTRFFNESNVRHGIRVDTRQSGHLSFGSGF
FT                   SLHRAQGRAFGRQEFNKGFRGKRFGIKPRRSRGLRVWNEANNPGKLAGVGTRFLSENAT
FT                   DDSTEALGRTIEAETGRASIAGVRKVGGSKVGKVSGYVVKQSRNRAERLTVHAGKQGAS
FT                   LAMRSAALAARSAARVIQAVAAVLSAAVSIISSLPIVLAVLAIVVVVVAIISFIFPSAG
FT                   AVSAASSLCGGDETQISAASFPDGTTGANISDSVPAGGSSVFDGHFQPPLKGALTVSSG
FT                   FNPARRNPVDGVVRSHDGVDLPAPGGTPIYAAGPGKVVNAGDGGTCGNWVRIQHPSVGG
FT                   TSYLTQYCHMSVVEAYVGQQVLAGQEIGKVGSTGRSTGNHLHFGLKVNGKYVNPYPVIA
FT                   NGTIPTTYAAAIGSEACAGAYGGLSPSNGKAMSKKFPPESMTVPDKRISGAKITPRLAK
FT                   LRDALMAQPNLIGKARNDFQCWDAHPQNPSSDHSRGRACDLPFVWYEQATGKDLADGNN
FT                   IARWLIAHQEEYGVKYVIWQAQIYYSSTGKWQPYSNSGSVIAGHRDHVHVSVY"
FT   gene            complement(85346..86428)
FT                   /locus_tag="HMPREF0573_10073"
FT   CDS_pept        complement(85346..86428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10073"
FT                   /product="hypothetical protein"
FT                   /note="InterPro: IPR009091"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10073"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66392"
FT                   /db_xref="GOA:D6ZI43"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI43"
FT                   /protein_id="ADI66392.1"
FT                   /translation="MLDDDLREENLYLIASGQDPSEELLEEIRKHPACYPKLDAWAEYV
FT                   EKTGTKIEPPPPPAMEAPVEVEDPGVDDVTAPPSEPTGHKRGLLRSKNVESGAPLPVKN
FT                   QRMIFAVAGIAGVLLVGAVISVVVLQAGSGNAKAAPTPAKTVTAQPVVEKALTVSGDGF
FT                   VCSAKGKTVTCLGQNNLGQLGDGGPSTNHTGKISLVKPVKLLSSGADFVCASSGKGVTC
FT                   WGDNRWKQSGDNVNPTIAPTEVSALHGKTVVSLASGELHTCAITSEKKLYCWGSGFSGQ
FT                   LGDGKEGEKASGVKEMPLPEGQIPLSVTSSRFGSCVTMKSGKTFCWGSNEGNRIAEGEA
FT                   QYLGMTEMGVENDADSGTQN"
FT   gene            complement(86418..88640)
FT                   /locus_tag="HMPREF0573_10074"
FT                   /note="trsE"
FT   CDS_pept        complement(86418..88640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10074"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66393"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI44"
FT                   /protein_id="ADI66393.1"
FT                   /translation="MTLRLSDIDYQLATQDVQEGIIEKYAHFLNSHLSGQHVQVTVLNR
FT                   VLNKERLARDVQLSPRGDGYDAQRGEYNDLIVQRLQNGRNNVITEKYVTLTVEAPTLEE
FT                   AKTVLSRIAAEDAAALHEVGGCHAVQLNGEERARLLQHFLRPGAETDFKYEELLAQAAT
FT                   TKDFVSPWSIDTSSREYIGLGSVRTSYWQVLVLRKLPPWMSDRVLKELSEIPVDLTVSL
FT                   HIDPLDQSEGLKLVKRQIASMDMQRGTEQRKLIKQGLTYDLLPHELQASYDEAVDLRTQ
FT                   LEQSNEKLFETTIVVGVAGETVEEMHENVKRVMRVAGKHSCQLEVLRYMQLDALNALLP
FT                   LGVCKLPISRMLTTAVAAVMVPFTTQEIMQPGGLFYGINALSKNLIVADRREGMNSNGF
FT                   ILGTTGSGKSQFAKFEMEQLFLRRPNDEILIIDPEREYPPLAAELGATRVVISAGSQDC
FT                   LNPLDLDKTTKREEGNPVNEKCTFVTSICEVLLGGNDGLSAAKRSIIDRAAQKIYRAYW
FT                   ADPTAMPPTLATLYEQLRQEPEADAAEIATGLELYASGSAAGFAQQTNVDRANRVTVYD
FT                   IADLSKDLQTFGMMVVLEEIWARIVKNKAEGRRTWLYIDEFHLLFANEYAASYTQGIYK
FT                   RVRKYGAAATGITQNIEELLANERARLMLSNSDGLFLLNQQSTDADALTDLLKLSVQQR
FT                   GYFTNVQPGCGLFKTGEAVVPFDNTMDTNSHLYKVFSTKFEETYVG"
FT   gene            complement(88753..89169)
FT                   /locus_tag="HMPREF0573_10075"
FT   CDS_pept        complement(88753..89169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10075"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66394"
FT                   /db_xref="GOA:D6ZI45"
FT                   /db_xref="InterPro:IPR024414"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI45"
FT                   /protein_id="ADI66394.1"
FT                   /translation="MALEVKVFREITDYQAKVIFGLSWRQAGTLLVAIPVLGGVYAGFF
FT                   LAGLQDLGVVVVSVLMVPAAAFGWVRPMGIPFEKYVGYFWAFRQGRKFFTFSKVDLKDL
FT                   DGEKRNEDEIKEAKALPRRGRRARKKFAAFESTN"
FT   gene            complement(89182..89394)
FT                   /locus_tag="HMPREF0573_10076"
FT   CDS_pept        complement(89182..89394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10076"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66395"
FT                   /db_xref="GOA:D6ZI46"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI46"
FT                   /protein_id="ADI66395.1"
FT                   /translation="MGGGDMLGQALQLFTKFAIIGGGLWTVWGVINLAGGLKDQNGPQT
FT                   QSGMWQAIGGGMIVAAAALFSAVAI"
FT   gene            complement(90355..90834)
FT                   /locus_tag="HMPREF0573_10077"
FT   CDS_pept        complement(90355..90834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10077"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66396"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI47"
FT                   /protein_id="ADI66396.1"
FT                   /translation="MIINKVAAAGFAGLLLVAGLAGCAQQSQEEKALKTLEDAGLYKEK
FT                   DYGKATPKDYDAAYEKLVAADKELKQLVEEATELKTECEALQYQAYSASACHELLYWKP
FT                   TSQLDPKTDITGETPEEIASVIDSLGYRQREFSRDIEKLNKDMDAVRQEMADMSQ"
FT   gene            complement(90877..90999)
FT                   /locus_tag="HMPREF0573_10078"
FT   CDS_pept        complement(90877..90999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10078"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10078"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66397"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI48"
FT                   /protein_id="ADI66397.1"
FT                   /translation="MPRFQNVYRRFGISHCGKVKDFGSGVGARFTIAGRLASFG"
FT   gene            complement(91021..92076)
FT                   /locus_tag="HMPREF0573_10079"
FT   CDS_pept        complement(91021..92076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10079"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66398"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI49"
FT                   /protein_id="ADI66398.1"
FT                   /translation="MTWAFGIQNLKPLDKLVLVSLADQANDEGLCHPSIDTLARMASTS
FT                   VRSVKRSVAFLKGNGFLEVVHRSSQDGRLPNGYRLFVGVEISLGINQRANLALSETEPV
FT                   DNLDENGTFRCEQTKGSDWHLADSESSQSANVGTLPPLNNPNLNSIPTTEPYVMCDQGG
FT                   LVGVDGLEKSSSEGAGEVAPDWGLIRACLPSVMMGVLPDSAAQVVSGLLHEALGAGWSE
FT                   REILKRLAANAFPSEVRNGAGLVIYRLRDVLAAPVPGSVAPVVAQKQRKRDEWGRAEVS
FT                   AILEGRSKLDLTAQENVMSTFLCGHFGCMPDQSEASVITAKLGEITEALYAKADAERVK
FT                   RRVREVRVGVP"
FT   gene            complement(92103..92351)
FT                   /locus_tag="HMPREF0573_10080"
FT   CDS_pept        complement(92103..92351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10080"
FT                   /product="DNA binding domain, excisionase family"
FT                   /note="Pfam: PF00376; InterPro: IPR010093"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10080"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66399"
FT                   /db_xref="GOA:D6ZI50"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI50"
FT                   /protein_id="ADI66399.1"
FT                   /translation="MGEVLSPKQAAKLLKVTTGTIYRWISEGKLAYTRLPSGYYRIPAS
FT                   EISRILTPTPATENTSAEVVDDVETESDNAVFPPELF"
FT   gene            complement(92763..92836)
FT                   /locus_tag="HMPREF0573_t10002"
FT   tRNA            complement(92763..92836)
FT                   /locus_tag="HMPREF0573_t10002"
FT                   /product="tRNA-Met"
FT   gene            complement(93004..96330)
FT                   /locus_tag="HMPREF0573_10081"
FT   CDS_pept        complement(93004..96330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10081"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1615; Pfam: PF03699; InterPro: IPR005372"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10081"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66400"
FT                   /db_xref="GOA:D6ZI51"
FT                   /db_xref="InterPro:IPR005372"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI51"
FT                   /protein_id="ADI66400.1"
FT                   /translation="MVVAIIAVLIAVVGVMSKVWAELAWYQQLGRISVVLTAWGWRIGL
FT                   VVVAMLLAAAVTWVNLMIAAQASPDASQRGKAKKRRNAERKMDAAKRQAQRNGKKTNPD
FT                   TGKQEKPDSQSDETLYPGEQSTDRKGADKPADSEKIIDLDAEFETVFDTADLEEEFRRA
FT                   TRRSERPAVAALHDTLQPWRKFLIVVLPLVVGLMVATPLISQWELFAAWFHRSNFGVKD
FT                   PIFARDSSFFVFSLPVFSELTTLLFYVVVAAGMFTLGRYYLQGNLSTKIAEIPNRTRIH
FT                   ISVLLAILAAIIGLRYYLDRFVLLLGTHDKFSGASYTDIHAVLPAKNILVGISLVIAVL
FT                   FIIGAFRKSWVIPATGVGVMVLSSVLVGGLYPWLVQRFQVDPSAQELEAPYISNNIKAT
FT                   RDAFGIADVKEETYKATTEATAGQLRSDSESTASIRLLDPSVVSRTFGQMEQNRQYYRF
FT                   ASNLAVDRYTIDGKAQDTVIAVRELDTNQLGDSQKSWVNQHTVFTHGFGVVTAYGSKVE
FT                   GDGSPAFWEKGIPSQGELGEYEPRIYFGQFSPDYSIVGAPKGAPKREFDYPSDVTQDKG
FT                   VNNTFTGKGGPSVGNLWERLMYALKFRSSEIFFSQQVNKSSQILFYRSPEERVAKVAPY
FT                   LTLDSRAYPAVVDMDGDPKTPKRVVWIVDGYTTSNSYPYSNHMDLNTSISDSRNIGYGY
FT                   QVMNNVNYMRNSVKAVVDAYDGSVHLYQWDAKDPIVNAWSNVFPGQIEPLSSVSGDLMA
FT                   HFKYPEDLFKVQRNLIARYHTTDPRSFYSGSDFWKLPDDPTHEGSQTVSSALQPPYYLT
FT                   MKAPGQESTEFSLYSTYIPYGQSDRNVLTGYLTVDSETGSEPGKIRDGYGKLRLLSLPS
FT                   DLAVPGPGQVSNKFKTTDTVSQTLNLLSQQSTEVVRGNLLTLPVGGGLLYVQPVYVQGN
FT                   SGTSYPLLRFVLTSFGDKIGFAPTLQASLDQLFGGDAGVQTSENDVPGASGADGEQSPA
FT                   EPNLTPQQQLQAALNGAWKAMDDADAAMKAGDWEAYGKAQTELKQQLQLALTFDGGAPL
FT                   PSDATQPANPGDTPSVQPTAQPSGAATPAASPKVKASAASPKAKSTAAASARPQPRKSA
FT                   S"
FT   gene            96634..97344
FT                   /locus_tag="HMPREF0573_10082"
FT   CDS_pept        96634..97344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10082"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66401"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI52"
FT                   /protein_id="ADI66401.1"
FT                   /translation="MEIMSESSNPLTNFPGGTVMGMSFTPDGDSRPTPTGEESVPPASE
FT                   QVPVPAEIPAIVRVVWEIDAHAEPLTDLQTGQLFTLHKTGDAAQMLTGHAPDELVNAMR
FT                   DTAESDPESLTALPFQLPNDDGLDFLKQLGRVVWSDEIEGVAVLYETNAMLTAADMADA
FT                   PADPQERQAYLEKKTAGQERSRFVVAATRTEAWSVVHPRFDTDPEHIEQGPALVADLLQ
FT                   LITNGINGGSNTAS"
FT   gene            complement(97372..98931)
FT                   /locus_tag="HMPREF0573_10083"
FT   CDS_pept        complement(97372..98931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10083"
FT                   /product="UvrD/REP helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="COG: COG0210; Pfam: PF00580; InterPro: IPR000212"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10083"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66402"
FT                   /db_xref="GOA:D6ZI53"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI53"
FT                   /protein_id="ADI66402.1"
FT                   /translation="MDRKRQDALPSPEVSAVQLLDDLDEQQREVAQHQHGALCVLAGAG
FT                   TGKTRAITYRIAYGVRSGQVNPENVLALTFTQKAAAEMKTRLEGLGVGQVWARTFHSAA
FT                   LAQVRHFWPQVMGGTVPTVTGLKATLVTAAGVRLGLNLGKAQVRALAGEIEWAKVSLID
FT                   PSHYALAARAAGREAVADLSTERVAELLDAYEDAKIAAEMLDFEDILLLCAGMMDERED
FT                   VARTIRNQYRYFVVDEYQDVSPLQNYLLMSWLGRRRDLAVVGDAAQTIYSFAGATPEYL
FT                   TEFTQTYPEAKVVELIRDYRSTPQIVNLANQVLAQAKGTDGRPLGGTVRLVSQRETGPE
FT                   VSWFVAPDDETEAKEIARRIQDLLAEGLSPRQIAVLFRTNAQAALFAVALGAKRIPFVI
FT                   KDQVTKLAGGTANSGTDTEDDEPGGVTLASLHSSKGLEWEVVFLAGASEGLLPISLAQT
FT                   AATIEEERRLCYVGVTRARSRLIVSFAKARRDGSSQEREACRFLAPFWPHRSATLRRSG
FT                   RH"
FT   gene            99106..100122
FT                   /locus_tag="HMPREF0573_10084"
FT   CDS_pept        99106..100122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10084"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66403"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI54"
FT                   /protein_id="ADI66403.1"
FT                   /translation="MKLNEGIHLVRLPDGSVELCAGLETMFHFPQCSEKEFQLLQRLVA
FT                   GCTRPDLSDFAKACRIPLTRVSEMLRTLADAELLQLRNPRLYGGPDDGFWSRVGGAKMR
FT                   RTYRLRQKLSVSLNRADRMAQLLAVELGAAGIGKIQVPTSTRSPEPDLETAPHPRLTTK
FT                   DLVEQRRRHATVTTQRIAADLAVQFSWGIPDPVAAQKAMQTNQSFLAVVAGHDFVEVGP
FT                   LVVPGLTPCTSCLALHQATAVTHLAERAANLHWAAFPRVETALAGVGAAIAAAQALAFL
FT                   DCRALHPGDVTRISVDGAVTTRHFESHPECDCSYLPMELDVPPEPAFAKRARTVPAA"
FT   gene            complement(100123..101637)
FT                   /locus_tag="HMPREF0573_10085"
FT   CDS_pept        complement(100123..101637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10085"
FT                   /product="putative hydrolase"
FT                   /note="COG: COG5282"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10085"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66404"
FT                   /db_xref="GOA:D6ZI55"
FT                   /db_xref="InterPro:IPR018766"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI55"
FT                   /protein_id="ADI66404.1"
FT                   /translation="MDESEMPDWAQMLRQVFGEEKAREMEEKLRSGTPFSAFSGGEGIF
FT                   AFPLQSLLSSSDEPVNWDLARMTALGRLGGATQVVTSADADRVRQALSEANLRLDPVTS
FT                   LTPPPASYAALSVPKWLDASSEVWKILVTPVAAKTSDSMKQALSAHIADGDLHVEISSG
FT                   PPELHQLMGLFSKDGDPASLNLDSLLGVLSSNLFGLQFGQAWGTLAAESFGSTDIGLPV
FT                   GEVNQAAIVLENVEKFAADISLEVEPVLTFLATREAAYVRLYHAVPWLRMHVIKAIEDY
FT                   ARDINFDLQAMESALQGLDPMDQDALHRLIAQGVLTPSQTNNQTAAKQSLETLLAIMEG
FT                   WVDMVTTRCLAGALPQIGALREMMNRRRATGGPAEKAFAALIGLELRPKRLREASALWS
FT                   KLVAKLGEAGAEGLWDHPDLLPEESDFDAPDQFVARLAGEGPKDPLEADLEAMLQGTLG
FT                   YAKGLEPGIDSEGDAEVSQDRFGTDSPDGSGDGTDPDSPQNPASDA"
FT   gene            101656..102873
FT                   /locus_tag="HMPREF0573_10086"
FT   CDS_pept        101656..102873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10086"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3480"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10086"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66405"
FT                   /db_xref="GOA:D6ZI56"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI56"
FT                   /protein_id="ADI66405.1"
FT                   /translation="MNTDALDKGADTPVPKDSLTLASGTDALPEDPADAPEPTRSRWSL
FT                   SRWVWGLVLIVLGGYFLFLYSYPVVINYPGPTFDVLGKDSKQTPLIEVKGAKTYPNHNG
FT                   QLRMTTVSSLGGPGSMVSGWDLIMAAFNPNATILPVDVVYPRNVSSKDIKKLGVQQMDQ
FT                   SQLSAEAVALETLGYNVKITWSVAEIAKKSPAFGVLHRKDVVRTIARPGQTPVTVHTVE
FT                   DLRKFLEGVPGGDTIELGIVRDGQAQTVRMKTAPAKLPKGKIGKGSQLSIYLASDVKIP
FT                   LDITFHLQDVGGPSAGTMFALGIVEQLTPEHLTGKSVIAGTGTIDLAGKVGPISGIAQK
FT                   MAGAKADGAKFFLAPTQNCDEVVGHIPKGLTVTKIGTFSEALDAVQKIRDGKTSELPQC
FT                   TVPAQK"
FT   gene            102886..103659
FT                   /gene="rph"
FT                   /locus_tag="HMPREF0573_10087"
FT   CDS_pept        102886..103659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="HMPREF0573_10087"
FT                   /product="tRNA nucleotidyltransferase"
FT                   /EC_number="2.7.7.56"
FT                   /note="COG: COG0689; Pfam: PF01138,PF03725; InterPro:
FT                   IPR002381"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10087"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66406"
FT                   /db_xref="GOA:D6ZI57"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI57"
FT                   /protein_id="ADI66406.1"
FT                   /translation="MTERIERADGRRMDQLREVTLHMDWVSAPEGCVLVSCGNTRVLCS
FT                   ASLTEGVPRWRKDSGFGWVTAEYAMLPRATDTRNTRESVKGKISGRTSEISRLIGRALR
FT                   AAVDYAALGENTIAIDCDVLQADGGTRTASITGAWIALQRAIAVGRDSGFIPGNPTRDS
FT                   VCAISVGIIDSIPRLDLPYEEDSRAETDMNVVMTGSGSLVEVQGTAEGAPFSRAELDAL
FT                   LDLAQAGCRDLTRLQRAAVDSAPGAVLTLTDGVIA"
FT   gene            103656..104351
FT                   /gene="rdgB"
FT                   /locus_tag="HMPREF0573_10088"
FT   CDS_pept        103656..104351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdgB"
FT                   /locus_tag="HMPREF0573_10088"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   RdgB/HAM1 family"
FT                   /note="COG: COG0127; Pfam: PF01725; InterPro: IPR002637"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10088"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66407"
FT                   /db_xref="GOA:D6ZI58"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI58"
FT                   /protein_id="ADI66407.1"
FT                   /translation="MSILTSVPDLRDKNAQKLKLPPEAQVVMATGNAHKVREVEEILRP
FT                   LVPSLRPGGIVAAGTLGAPEPREDGTSFSANALIKARALASVVDVPILADDSGLSVDIL
FT                   GGSPGIFSARWCGHHGDDRANLELLLNQLQDIDDGYRTAAFICAAVLLIPGGGTYLGNG
FT                   VMGGRLVREPKGKNGFGYDPIFLADGQEVTNGELSKDAKNAISHRTKAFSQIAPQLEAM
FT                   LGVRTRLTR"
FT   gene            104507..104845
FT                   /locus_tag="HMPREF0573_10089"
FT   CDS_pept        104507..104845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10089"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66408"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI59"
FT                   /protein_id="ADI66408.1"
FT                   /translation="MEGESKGLPSRSRLTSPEFQEEIMLSTDVVGAINPALTNQAFTRP
FT                   APEPSGKADKPEPISNTSKTEAAATGGHSALNGNVAEFKPVVGPSQPTHADLPHTYKSS
FT                   NSHLDVML"
FT   gene            104880..105044
FT                   /locus_tag="HMPREF0573_10090"
FT   CDS_pept        104880..105044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10090"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66409"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI60"
FT                   /protein_id="ADI66409.1"
FT                   /translation="MNPISGAAPIMDAETMKALMVTAVAAQTATATKAATAAAALKVMN
FT                   PQGGLDVYA"
FT   gene            complement(105063..105872)
FT                   /gene="murI"
FT                   /locus_tag="HMPREF0573_10091"
FT   CDS_pept        complement(105063..105872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murI"
FT                   /locus_tag="HMPREF0573_10091"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="COG: COG0796; Pfam: PF01177; InterPro: IPR004391"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10091"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66410"
FT                   /db_xref="GOA:D6ZI61"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI61"
FT                   /protein_id="ADI66410.1"
FT                   /translation="MNNAPIGIFDSGLGGLTVARSIIDQLPGESVIYIGDTANSPYGTK
FT                   PVERVKELSLSVMDKLVDRGVKMLVIACNTASATAVFAARSKYDELGIPVLEVISPAVH
FT                   RAVSATRNGHIGVIATHTTIETETYQRALHAYQQVQVSAKACPAFVDFVERGITSGPEL
FT                   LAVAREYLEPIRDAGVDTLVLGCTHYPLLSGIISYVMGPEVTLVSSAEETAHDVYRQLL
FT                   DKDWLNTDDGTDTVNPRYQFLATGDTQTFTRLARRFLGPEVTAVERV"
FT   gene            complement(105891..106715)
FT                   /locus_tag="HMPREF0573_10092"
FT   CDS_pept        complement(105891..106715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10092"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10092"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66411"
FT                   /db_xref="InterPro:IPR018561"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI62"
FT                   /protein_id="ADI66411.1"
FT                   /translation="MRAFAALNAPSEGWFSRVEPHEAVLLAGIFEELADAMEAEEQRDV
FT                   LDMMGVDLDPNSPKEHTLMFEKLLGVDTVSSITSRPELHSASEETETETDLNQPHEQPG
FT                   ESATPRRGNTGFEPNSRGMTDDQTLAALDFDPLGPRPCPANPYIAAILRPMSQDPEEAA
FT                   ELRALTTPDLAAKKTAAMRTVAESLRWAAHSNGAVMVKPEALKVWVTAINDARLALGWS
FT                   LGIDNDTRAEEVELMAESDPETGVYTAYEITIASIYNALSWWLETLMYAVDG"
FT   gene            complement(106731..107033)
FT                   /gene="clpS"
FT                   /locus_tag="HMPREF0573_10093"
FT   CDS_pept        complement(106731..107033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpS"
FT                   /locus_tag="HMPREF0573_10093"
FT                   /product="ATP-dependent Clp protease adaptor protein ClpS"
FT                   /note="COG: COG2127; Pfam: PF02617; InterPro: IPR014719"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10093"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66412"
FT                   /db_xref="GOA:D6ZI63"
FT                   /db_xref="InterPro:IPR003769"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR022935"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI63"
FT                   /protein_id="ADI66412.1"
FT                   /translation="MSIVEPGTEYAPSAVAQLDRVLPGQWNTVVWNDAVNLMSYVTWVF
FT                   KTYFGYSHERAEHLMKEVHFKGRAVVSAGTREQMEADVLAMSEYGLWATLEQEAD"
FT   gene            complement(107107..107256)
FT                   /locus_tag="HMPREF0573_10094"
FT   CDS_pept        complement(107107..107256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10094"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10094"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66413"
FT                   /db_xref="GOA:D6ZI64"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI64"
FT                   /protein_id="ADI66413.1"
FT                   /translation="MRKDDADSRKNLVPHVSNAHKLGSGRVTRAVVALLVVLLLAGLVG
FT                   LLVL"
FT   gene            107411..108748
FT                   /gene="pncB"
FT                   /locus_tag="HMPREF0573_10095"
FT   CDS_pept        107411..108748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pncB"
FT                   /locus_tag="HMPREF0573_10095"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /EC_number="6.3.4.21"
FT                   /note="COG: COG1488; Pfam: PF04095; InterPro: IPR006405"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10095"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66414"
FT                   /db_xref="GOA:D6ZI65"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI65"
FT                   /protein_id="ADI66414.1"
FT                   /translation="MNTRESTALLTDMYELTMVDSALEHGMGQRQCVFEIFTRRFPASR
FT                   RFLVMAGVARILEGLKRFQFDDSQLKYLSDHKIVGQKTIKFLEDYQFSGDIFGYPEGEV
FT                   FMVNSPILTVRGTFAETCLLETYLLSILNFDCAVASAASRMTIAAHGRPCLDMGARRVH
FT                   ERAAVSAARAAQIGGFQGTSDLEAGKRYGIRAIGTAAHAFTLLFEDEEAAFTAQIESMG
FT                   PDTTLLVDTYDVTAAVEKAVRIARAAGGELGAVRLDSGDLVAGAFKVRQQLDDLGATST
FT                   KITVTNDLDEYAIAGLGAAPVDSYGVGTRLVTGSGIPTAALVYKLVAREDANGNLESVA
FT                   KRSVEKSTRGGLKWAGRAIEDHTATTELLVTAPNREAATEYFASHEARPLQRDFVIDGT
FT                   IDKSWIGPDALQRAQQHHIEFRNELPYQAWRLSEGEVAIPTEYVDL"
FT   gene            complement(108745..109053)
FT                   /locus_tag="HMPREF0573_10096"
FT   CDS_pept        complement(108745..109053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10096"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10096"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66415"
FT                   /db_xref="InterPro:IPR021400"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI66"
FT                   /protein_id="ADI66415.1"
FT                   /translation="MSETTAGQPLTQGGTAVLERTETELKRNPGDNERYAHYVRKDRIT
FT                   ASAVTGQAVIALCGKVWVPMRDPKNFPICPACKEIMKSMNGDHNGQPGWPFFGGSES"
FT   gene            complement(109182..109466)
FT                   /gene="hup"
FT                   /locus_tag="HMPREF0573_10097"
FT   CDS_pept        complement(109182..109466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hup"
FT                   /locus_tag="HMPREF0573_10097"
FT                   /product="DNA-binding protein HB1"
FT                   /note="COG: COG0776; Pfam: PF00216; InterPro: IPR000119"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10097"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66416"
FT                   /db_xref="GOA:D6ZI67"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI67"
FT                   /protein_id="ADI66416.1"
FT                   /translation="MSVNRTELVAEIAKKAGLSKTEADGALSAFQEILIDSLKKGETVK
FT                   VTGLMNVERVSRAARTGRNPRTGEEIKIPAGYGVKISAGSTLKKAVSNK"
FT   gene            complement(109726..109878)
FT                   /locus_tag="HMPREF0573_10098"
FT   CDS_pept        complement(109726..109878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10098"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10098"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI68"
FT                   /protein_id="ADI66417.1"
FT                   /translation="MKPAGALSAEILHSQPKKTVFWMRWGKVGAVGATFVAHQPGGASD
FT                   VTRNG"
FT   gene            109893..111326
FT                   /locus_tag="HMPREF0573_10099"
FT   CDS_pept        109893..111326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10099"
FT                   /product="Sodium:neurotransmitter symporter family protein"
FT                   /note="COG: COG0733; Pfam: PF00209; InterPro: IPR000175"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10099"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66418"
FT                   /db_xref="GOA:D6ZI69"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI69"
FT                   /protein_id="ADI66418.1"
FT                   /translation="MAVPTAKSKRQRKIILVDVSVVPEQRASWSGKLGFVLAAAGSAVG
FT                   LGTIWRFPYLAAHYGGGTFIFVFFLFMLTLGVALLVLEIALGRNTGKSIIMAFASFGKQ
FT                   YRFVGMLTAAVPFIIASYYGVVGGWVTRYMFAYAAGMTKELADGGDNFGAFISDGPQSV
FT                   AFMLLFGAITFIIVALGVNGGVERANLIMMPALILVSLLIGIFTLTQPGALDGLRYFLV
FT                   PDFSKFSLELLIAALGQTFFGLSLGAATMVTYGSYMKKDVSVTSSALQTTGTTLGISLL
FT                   AGLMIIPATFATLGSANAVAKNSGPSLMFLVIPEVFEKFGRIATGIGFVFFLLVMFAAL
FT                   TSMISLVEACVSILQDTLAWKRRQALLVTVVVLSSAGIIVTLGYSSLSFIQPLGEGSTI
FT                   LDFLDFMTSSVMMPLGGLLMCLFFGWRKKPAVLIDEVRLSGEFKRAGLWGVMIKYVAPI
FT                   LLVAIFITSVLKTFGIISF"
FT   gene            complement(111371..112003)
FT                   /locus_tag="HMPREF0573_10100"
FT   CDS_pept        complement(111371..112003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10100"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="COG: COG1136; Pfam: PF00005; InterPro: IPR003593"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10100"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66419"
FT                   /db_xref="GOA:D6ZI70"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI70"
FT                   /protein_id="ADI66419.1"
FT                   /translation="MSILQLDHIDYTYKGAGAKVLDDVNYEFQKGKFYAILGASGAGKS
FT                   TMLSLLAGLDAPTAGTVLFDGADIAKKGYSYHRKHQISLVFQNYNLIDYLTPLENLRLV
FT                   NAKASTEMLEKLGLDAKEAKRNVLLLSGGQQQRVAIGRALVSAAPVILADEPTGNLDEA
FT                   TAAGVTEILQKAAHEEGKCVIVVTHSKELARNADVTLRLQRRKLVEL"
FT   gene            complement(112013..113158)
FT                   /locus_tag="HMPREF0573_10101"
FT   CDS_pept        complement(112013..113158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10101"
FT                   /product="efflux ABC transporter, permease protein"
FT                   /note="Pfam: PF02687; InterPro: IPR003838"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10101"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66420"
FT                   /db_xref="GOA:D6ZI71"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI71"
FT                   /protein_id="ADI66420.1"
FT                   /translation="MVAIITLVFTALVAQSGVKSTMLSVRDAISSNVLAGFTATSQTGQ
FT                   LPDQTLKQLADLPGVKRHAYEGEAAAKPENASLVSAASGIQLDPEFGGDLLGIKGTSDS
FT                   SLNPEFLGKIYTLEQGSHIGKPGVEAMIHRDFARKNSLHLGDTLELRHENTVVRLKIGG
FT                   IYSGKAENRTGLPSGNSENQVFTNLDALQKLGGQVSTARYFTERADQLPQVLKAAQTTA
FT                   PKLSLENNSAQFADVLQAISGVDQMLGMLLWGFCLAGALVLALVATFWVRSRLPEIGIL
FT                   LSLGKTKLEVGLQFLLEAIIFGALGAVLAVILGRLLSNSLGQLVLSKAGNETLAALEPA
FT                   NGIAGNAMSLGLGFLVIIIALGLALFPIMRQTPKSILSKLS"
FT   gene            complement(113218..114621)
FT                   /locus_tag="HMPREF0573_10102"
FT   CDS_pept        complement(113218..114621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10102"
FT                   /product="efflux ABC transporter, permease protein"
FT                   /note="Pfam: PF02687; InterPro: IPR003838"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10102"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66421"
FT                   /db_xref="GOA:D6ZI72"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI72"
FT                   /protein_id="ADI66421.1"
FT                   /translation="MLTLNTTTGGNLLSFVGRSWRYVARKRIKTIIIFAIFLAMSTVLM
FT                   SANAVSRATDATAAEIDAKTGQGFVLGNNPQFNTGTPRGAGNVKPADIKKLASLDGVQN
FT                   YVARQNVTADLVDATAQKLDRQDYDETKEAQFGNAVNVWGVNDTKMDNNFRSGALKLVA
FT                   GRHLNAQDKNKSIINQDLAKANHLTIGSKLTLKGNPYDADNQNHSTNEVTTEIVGLVSG
FT                   SNADRAVSRNELFSNTVFTDLDTTRTLYNVTPATEIYQDANFFVKKGANFDDVVKAAAA
FT                   KDIDWRSYQLSRSTQYLAGITGAIDGVRSVMTTTTIATFVLAGAILALVLCLWLNERKK
FT                   ETGTLLSMGVTKASIMAQYALELIFIAVPAFVLSYFGAGMLAQGMGTSVLSSVNHQAAQ
FT                   EMAKAGQFGADMESSASMKTLEKLTVDLSLASAGQIAITVLVLIAIVVVIVSVPMLRKS
FT                   PRALLVDNK"
FT   gene            114968..122062
FT                   /locus_tag="HMPREF0573_10103"
FT   CDS_pept        114968..122062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10103"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10103"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66422"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI73"
FT                   /protein_id="ADI66422.1"
FT                   /translation="MINRVIVQKALAIIATFALLIGTVQLVSMMVRPTPADASTNTQNI
FT                   PPDYGPLGDAENDPWTTNFPRPDNVEHAPELTNNRVALVFNFEPSYAWETMGGAYFSYK
FT                   DGKPYRNFDQSNQIIQMLSHLRGAPVSVGVYTFHRARSANGVSPNNTPNLKATSLENKD
FT                   GFDKVVAKLRTLDATDGEGYRMKAEDGSNFEWGLKQIRNDMDAYAQEYQAKHGTAPSQP
FT                   LYNNIIVFTTGLGYCYGDPSNEKCRPVLDRLNAENAAYDEAKAIADKGAHVNFLAMGPS
FT                   YYNDGRRKDFLTKLAGKAGGNITVIKHNLNGYGTKTSNTLLNYDWYHFQDPRNMDSDWY
FT                   NKPTNKKDAAQREAIRKACNQFDPSTGPEPTGNPYDLAEQRCNHVRDGKFAETVEDYLF
FT                   RDKGLEITADAVDENLVFQHPIANTDFEIIGGRKLSTGTDGIVEKPTRGERSLQIVPRP
FT                   NQEKYALTRLRLPNDKYSPEKLPREANARCVGFSSRKDPFTFAPADATGTNTRGGISLA
FT                   QADFDKYTYIKCGFYHRLLQESVLRKSVKVSNEQIRFDVLKSKFKVAWSCKDPYAVTDP
FT                   QQPFVKDSRELVLAKQNTSGPDVTLNTEYTFPDIPIGTKGRDDVHRLPVGATCQVDSSV
FT                   KYPHRCYGRDQSASCPEPWKKADWDNLMTVQDTLDHSQYFEVKETKPVAPAANGYDYSF
FT                   TASGEQLTKPEFAAPTEKSILESLTTFTSKKASVKLKVELTNKSNDPAFSSLTKPGKVP
FT                   VYYNCRYMGDPTRPPEIPESGAAAMPGYVELGAVDVPTNDTDYYELGIKRDPTTHEPIL
FT                   DKAGHTIPTWPVGTHCLFTSLPPKGAPGTATTHPWSVEGFNIIDSYSSNVCASDWKDKG
FT                   TAEKKCTNNYFWVHSGGQKSITLQQDLVRKNAQITFTKTVSGDAELVGREQTFKENLSC
FT                   THNGANIHTGTASFIAQADVPVTVTVPAAAKCSVTEENLTGVPNAITVTKPGQKTFGPI
FT                   TDTTTPVPVTTDTKFTYKTVKKQIQHVSSFDTTVSDQDLQDALQSLTKKVTATCTKPGV
FT                   AKPEVIETSINGDGTVDLGTLPIGTTCTYATEIPGLPDLTKATGANGAPRYPDANRVIT
FT                   STTVESPNVTLDGAPAKITTTYKLQTAGNITLHTESGDTLPYASLKSGLPGNYNYTINC
FT                   GNGEINVTLTRDGGVKELSGNTQIPANARCTLTQITNDDPRLTRITKMTPSNGYTVKHT
FT                   SSDTGNPVLTFTSPTASGSLSINIVNNYAVAYTQLMLSTTTDVKTSADTDSAANINVPA
FT                   KWKKALFIHKTDTGATTGDYKARAKLVCTSGSDKYTIAGDFTVNEDGWRLPNPLTVPVG
FT                   WSCQIDLKQPRFKIPGADLVGADGKALNADAPSGANFTWNAVGGSGTDATQSGLTGKVV
FT                   TRAGSAADANSLTLHIPYRMQLGSFNLKKKVGGEGTSMIPGNHQFKVDYSCTLNGVKIP
FT                   IPAARTIKGKQDVTATLGNDLNDRLADLADQQSIKMGRFEQGEWHPIDALPAGAVCAVS
FT                   EDSTVAERPHSKWDNYWELNEGFRSREPIVSNCETKGTDLCSYQTATSKAIALVKLPRD
FT                   AGTKKNEFWSDKDNPAGSTNPIVPKILPENFAGTMVPWNNYTFEKTRVKVNLKIDGNGK
FT                   RLGEGKAVSLRLYCKPPTLVANGVTIPNAGNAAAIYNTTLKLTPSKADPYTATAVSDVF
FT                   VPVDYNCVLAEIRPESYDATVDYQLHRVSSDTSTSLTDDIPADATDPLATLKDHLATLF
FT                   GDIDVNGGTADGVTYAADENLVPAQNEGILKGFRVHPDYVSAQGGEQKYTVFDLTNTYI
FT                   RPEANLRVTALVDTTTPSTTYQENVGSKLTIAGYQVNYTCTDAYLRNPAQPPATEDTPV
FT                   TYTGTVNVDSSGHAVQVQRNAETEGILPATATCAFTLKNADTTDPIANYPTLRHRLGAD
FT                   WREDTVTSDPTPSTKKVSAEQFQSEYMDDKYPCPTETDPDQQCSTQKSDLTQYQHAKGV
FT                   TLDPTGKNQTTITFTNTYLVQKADIGVVAYPQGDRAERLLAKDTTKYPYTYRCTYPTLP
FT                   VTYPETGSLQYEYTSASPVAVGDAKAAQLARAIVPVDTKCTIVPQPPSADLSSLTNKGL
FT                   THLTSLMTPPREQLLDPATGTPRTAPKFSDVLTAEGNVEWSAANRAEVPSAGFPMNAGD
FT                   DPRVVLHTIYRDKAKVQVRKVDKDFQTAIDTGAKFKIYPVDTNGQPDLNQGIEVSAQTD
FT                   VNGNTIPGVFTATLAPGGYALEETKSGMGEMLPTYWNFTVSPQNHLDSNRKFDPYTDFG
FT                   QDLEVKLAGYVSHTGMVAVRTPANDTQPWSIDVAEVSSGYLPKTGGARLWIELTGLLIL
FT                   AGGLALTYRRKTLLKENH"
FT   gene            122076..123575
FT                   /locus_tag="HMPREF0573_10104"
FT   CDS_pept        122076..123575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10104"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="Pfam: PF05738,PF00746"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10104"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66423"
FT                   /db_xref="GOA:D6ZI74"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI74"
FT                   /protein_id="ADI66423.1"
FT                   /translation="MRLVNMKSIGIPIWRRTVAIFATGAVALLGAAGMLNAPVASAAAI
FT                   NGNATGSITVHALTMPTGGRTATPTGMETTPLPAGATAIENATFKLEKSNIDITTNAGY
FT                   SSALGLTAKNFGALDPTFAAQTGKTTTDGTHKFQGLKPGVYRLTQTAAPEGKTLMAPAV
FT                   VFVPMTDPANTANWVYDIHVYPKNGDASKIKKTDITPAGTPITVGSTMTWQMDVPIPDI
FT                   DTNDTFATFKVQDLPTNMKATIVSSVTIDPEHANTGLTAGNANDYTVATDSPTANQLEV
FT                   TFTANGLTKINAAKGKTMRLIVKTEVLNSVNTTDGVTNAAKAIYTTANGGGGETTIVSD
FT                   PDNPAKTTFGKLKILNENATGTKLSGAKFKIYQCAGDPLGTKTTGNALTIGANSEFEIT
FT                   DAANGVIVGPLGATEGELCLVQTKAPDGYQQLAGPQKFEFTKAKITGAAGNTLEVTVKN
FT                   TSTSSITGLLPNTGGKGIILFVIVGLVLLGGAAVYMRRQRS"
FT   gene            123731..124603
FT                   /locus_tag="HMPREF0573_10105"
FT   CDS_pept        123731..124603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10105"
FT                   /product="sortase family protein"
FT                   /note="COG: COG3764; Pfam: PF04203; InterPro: IPR005754"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10105"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66424"
FT                   /db_xref="GOA:D6ZI75"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042002"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI75"
FT                   /protein_id="ADI66424.1"
FT                   /translation="MLLTIIGIGVLLYPVVATNFNNYVQHRHTLTYSEQIEQSRPEVLD
FT                   EMLAKAEEYNRSIPGTPVLDPWMARVSKNNYPYQGYLHQLDLLPEMGRLIIPKARVDLP
FT                   IYHGSEVETLERGIGHLYGSSLPVGGNDTHAVLTGHTGLPTATLLDHLVDVEKGDLMFL
FT                   DVMGRKMAYRVYDIRVVKPDEIKTLKVQGGRDLLTVLTCTPYGINSHRLLVTGERTTLP
FT                   PEDFPAVQAPLQTLSWWMWVLVAIATAAGVLAIVWVWGQLRRRRNENFKGDAPRETEKT
FT                   REMKSWKRN"
FT   gene            124588..125625
FT                   /locus_tag="HMPREF0573_10106"
FT   CDS_pept        124588..125625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10106"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10106"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66425"
FT                   /db_xref="GOA:D6ZI76"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI76"
FT                   /protein_id="ADI66425.1"
FT                   /translation="METKLKMRLTALGAGFALALSLGAVPALASNEEDHIHAVTGTTTG
FT                   LNVNAIAGSQTGTIEVHLTRKNPNDDPKNPTVPNGSTANYTVKISKVKDVATTGTGVDY
FT                   RKLAQLTVTQARKKGLESPQTGTTNYAGVVEFKNLALGVYLIESTPPNTPNTNFLKFCP
FT                   SLVTLPYGDTSSGSPKWSYGLGLVPKPVATAAPQPGGGTGGGGGTPGFAPTPSQSATPS
FT                   QSPKPSVSPVPSPSNTPLPKLPKGVDPNRVTDPYDIPGWIYDPKTNTYIPNPDDPRVAG
FT                   TWEEWGLTPPSQSLPGKVAGALAKTGVQIAGAMTLSAGLIVVGLVLMRRRSNSSEPAGS
FT                   DPGRS"
FT   gene            complement(125582..126799)
FT                   /locus_tag="HMPREF0573_10107"
FT   CDS_pept        complement(125582..126799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10107"
FT                   /product="isocitrate dehydrogenase, NADP-dependent"
FT                   /EC_number="1.1.1.42"
FT                   /note="COG: COG0538; Pfam: PF00180; InterPro: IPR004790"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10107"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66426"
FT                   /db_xref="GOA:D6ZI77"
FT                   /db_xref="InterPro:IPR004790"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI77"
FT                   /protein_id="ADI66426.1"
FT                   /translation="MAKIKVENPVVELDGDEMTRIIWQQIREKLILPYLDVDLKYYDLG
FT                   IENRDRTEDQVTIDSANAIKKYGVGVKCATITPDEARVEEFGLKKMWKSPNGTIRNILG
FT                   GVIFREPIIMQNVPRLVKGWDKPIVVARHAFGDQYKATDFKVPGAGKIMLSWVPDDGSK
FT                   PIEHEIIHMPEAGGVAMGMYNFNDSIRDFAHACFNYALARKYPVYLSTKNTILKAYDGA
FT                   FKDIFAEVYESEFKAKFESAGLLYEHRLIDDMVASSLKWHGGYLWACKNYDGDVQSDTV
FT                   AQGFGSLGLMTSVLMTPDGRTVEAEAAHGTVTRHYRAWQRGEQTSTNPIASIYAWTRGL
FT                   AHRGKLDNTPAVIEFAETLEDVIVKTVEGGQMTKDLALLVGGDTPWLTSDEFMNVLDQN
FT                   LQARLS"
FT   gene            complement(126924..128825)
FT                   /locus_tag="HMPREF0573_10108"
FT   CDS_pept        complement(126924..128825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10108"
FT                   /product="AMP-binding enzyme"
FT                   /note="COG: COG1022; Pfam: PF00501; InterPro: IPR000873"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10108"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66427"
FT                   /db_xref="GOA:D6ZI78"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI78"
FT                   /protein_id="ADI66427.1"
FT                   /translation="MADEKRNNRDEISTDAQNPMDKPGWVEIDGERFWHCPRLFTAEQH
FT                   QTLPWTLADRVRRLPNAKLLDRKTELGGWRSMTAVEFNEDVHSVARGLIGMGLQPGDRF
FT                   SIMGHTSYDWMLLEYAGFCAGLVVVPIYETDSAEQIAWILEDADPALVVCETNAMRELV
FT                   SSKRDCGRSLKHVLCLEDSAVVRIKKAGMDVPDFQVDELSRAVTIDDIATIIYTSGTAG
FT                   KPKGVELTHGNWIELLANGMRWMPEVAGYPSSRLLVFLPLAHVLAQYLQFLQLWGAGTL
FT                   GHAPNIRNLITDLQEFAPSYAMVVPRVLEKIYNTAQVQARAHRISRILFSRSVKVAEAY
FT                   SRALDTPEGPNRRLRAKRLVYCQLVYRRILSLFGPNLKFVICGGAPLSEELGHFFRGIG
FT                   MPVLEGYGLTETCAPLCFNNLRTNRIGTVGPAVAATDLKISPTGELLAKSPAIFHRYHN
FT                   NPEQTAAAFENGWFKTGDLATIDQDGFVRITGRAKDIIVTAGGKNVAPSVLEDPLRQYA
FT                   LINEVVVVGEGMPFVSALITLDADMLPTWLKNHGMPTMDPLTASKNPQVLQAISRAVER
FT                   VNARVSRAESIRKFKVLPTAFTVENGLLTPSMKVKRKQVAEAFAAEIEELYADKLVK"
FT   gene            complement(128877..129236)
FT                   /locus_tag="HMPREF0573_10109"
FT   CDS_pept        complement(128877..129236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10109"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66428"
FT                   /db_xref="GOA:D6ZI79"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI79"
FT                   /protein_id="ADI66428.1"
FT                   /translation="MNTPNPQAPEPAAPDWQALDSVTPDQPTLVPDSAPHPFDAPSRVQ
FT                   VLLLGAAVVALLVCSVIGWWQAAVWGLVVVLLALAVFRLTNRHAWTRARGTIFDVTMLV
FT                   AAATGITLVMLVLPG"
FT   gene            complement(129327..131171)
FT                   /locus_tag="HMPREF0573_10110"
FT   CDS_pept        complement(129327..131171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10110"
FT                   /product="putative phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /note="COG: COG0138; Pfam: PF02142,PF01808; InterPro:
FT                   IPR002695"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10110"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66429"
FT                   /db_xref="GOA:D6ZI80"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI80"
FT                   /protein_id="ADI66429.1"
FT                   /translation="MAETTNRNKDTQIPVKRALISVWDKTGLEQLAQALVEAGVQIIST
FT                   GSTAKKIAAAGLPVTPVEDVTGFPECLEGRVKTLHPHIHAGILADRRKPDHVKQLQDLQ
FT                   VEPIDLVVCNLYPFEDTVASGADFDACVEQIDIGGPSMVRAAAKNHPSVAVVVSPYTYD
FT                   AVIEAVQAGGFDLHERRLLASQAFAHTAEYDAAIATWLDDQMTRFAMENVGELDSADES
FT                   DEDSAMPEWVELSGDRIASLRYGENPHQSAALYVDLEQTADQMEENAQGECNCPACTHY
FT                   PELDDIEACDRAGSDPHSKPAPGIANAIQLHGKEMSFNNYTDGDAAIRAAYDHAEPCVA
FT                   IIKHANPCGIAVAADVATAHRKAHACDPVSAFGGVIAVNRPVTVELAKQIAPIFTEVVL
FT                   APAYEPGAVKALASKKNLRVLRVTPPARGALEVRQISGGYLAQQRDDVAESGDCSSGWT
FT                   KVCGPDVDEATLRDLEFAWQTIRATKSNAILLAHDGATVGIGMGQVNRVDSCKLAVERA
FT                   NTLGGRETGDAAASQSDTAGGARAEDLAVAAPPERARGAVAASDAFFPFADGPQILINA
FT                   GVKAIVQPGGSIRDQETIDVCEKAGVAMFTTGVRHFFH"
FT   gene            complement(131284..131928)
FT                   /gene="purN"
FT                   /locus_tag="HMPREF0573_10111"
FT   CDS_pept        complement(131284..131928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="HMPREF0573_10111"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /note="COG: COG0299; Pfam: PF00551; InterPro: IPR002376"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10111"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66430"
FT                   /db_xref="GOA:D6ZI81"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI81"
FT                   /protein_id="ADI66430.1"
FT                   /translation="MTKRVFTLPDDRPTRLVVLISGVGTNLQALYTATTNAAYGAEIVG
FT                   VVSDRDTAEGLRWAQSRGIPTATVCLGDFPDRESWDVAFTAAVQSWEPDLIVSAGFLKI
FT                   LGPKFLAQWPSRVVNTHNSLLPSFVGIHGPRDALRAGVKLAGATLFIVDPGMDTGPILA
FT                   QVAVPVHGDDDLETLTERIKVAERAQLVASVGRMVQHGWWIDEVRAGFESD"
FT   gene            complement(131925..133067)
FT                   /locus_tag="HMPREF0573_10112"
FT   CDS_pept        complement(131925..133067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10112"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66431"
FT                   /db_xref="GOA:D6ZI82"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI82"
FT                   /protein_id="ADI66431.1"
FT                   /translation="MGFQAWAISWAVLVLLAIAVWTPSATTPSEKGTKWSDALAVGNAI
FT                   FAVAFRAEFSSETMRFSLTPWGFTLLMGLLLAASLRTAKPSNPAALGWGLAAFLIPCWG
FT                   CLCFAAISLVVWRAVIFSLCFAAVVFFAVARHQTWWNLTAFFPEGEPWPWLSLAGRCLR
FT                   VLARGGMVLSAIFLVAGMFTGWEQMRTIWIGLKPDALGSVAMVLAILAYLPTLLVWGAA
FT                   WITGPGITLGQGTVFSPGQVIGGDLPPVPVLAWLPDGPVGWWPLIFPVLLAIGLGLYLG
FT                   GRHQLELADTALSLALFLAGLLLGGLLIVWFVSGSLGPGRLVNVGPLGSTLYAGVLAWG
FT                   VPFVVTALLNHPWTREATRRFAVRVSGKNPQALPTARIDL"
FT   gene            complement(133533..134456)
FT                   /locus_tag="HMPREF0573_10113"
FT   CDS_pept        complement(133533..134456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10113"
FT                   /product="succinyl-CoA synthetase, alpha subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="COG: COG0074; Pfam: PF02629,PF00549; InterPro:
FT                   IPR005810"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10113"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66432"
FT                   /db_xref="GOA:D6ZI83"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI83"
FT                   /protein_id="ADI66432.1"
FT                   /translation="MSIFLDENSKVIVQGMTGSEGRKHTTRMLAYGTKVVAGTNPKKAG
FT                   TTVEFDVVPYGPLVDSVQGGTVSVPVYGTVADAKAATGANTSVIFVPPAGAKGAIIEAV
FT                   DAGMELVVVITEHIPVQDTNAAFAYAKSHGVRMIGPNCPGIISPGKSNVGITPGDITPR
FT                   GKLGLVSKSGTLTYQMMYELRDLGFTTCIGIGGDPIIGTTHIDALEAFEQDPETELIVM
FT                   IGEIGGDAEERAAAYIKEHVTKPVVGYVAGFTAPEGKTMGHAGAIVSGSSGTAAAKKEA
FT                   LEAVGVRVGKTPSETARIAREIMQSK"
FT   gene            complement(134472..135632)
FT                   /gene="sucC"
FT                   /locus_tag="HMPREF0573_10114"
FT   CDS_pept        complement(134472..135632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucC"
FT                   /locus_tag="HMPREF0573_10114"
FT                   /product="succinate-CoA ligase, beta subunit"
FT                   /EC_number="6.2.1.-"
FT                   /note="COG: COG0045; Pfam: PF08442,PF00549; InterPro:
FT                   IPR005809"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10114"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66433"
FT                   /db_xref="GOA:D6ZI84"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI84"
FT                   /protein_id="ADI66433.1"
FT                   /translation="MDLYEYQARDLFNKHGVPVLPGKVASTVEEAKAAFTALEVPLAVV
FT                   KAQVKTGGRGKAGGVKLARSVEEAAANAQAILGMNIKGHTVYRVMVVAGADIDREFYFS
FT                   ILLDRANRQNLAMCSVEGGMEIEQLAKEKPEALAKVPIPASGMDVTVARQIADEAGFDP
FT                   ETAAKVVPVFLKLWDVYTGEDATLVEVNPLVATPQGDIIALDGKVTLDDNARYRHSEHA
FT                   ELVDQRAADERELKAQEAGLNYVRLEGQVGIIGNGAGLVMSTLDVVAYAGEKYGTKPAN
FT                   FLDIGGGASAEVMAKGLDVILTDPQVKSCFVNVFGGITACDEVANGIIGALQILGDQAT
FT                   KPLVVRLDGNKVEEGRAILKAANHPLVTMMETMDEAADKAAQLAAK"
FT   gene            135657..135776
FT                   /locus_tag="HMPREF0573_10115"
FT   CDS_pept        135657..135776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10115"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66434"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI85"
FT                   /protein_id="ADI66434.1"
FT                   /translation="MSRHRDISSVSKNIRFSTPIITAPSCNFRLCWRYISVGR"
FT   gene            135797..136780
FT                   /gene="ppk2"
FT                   /locus_tag="HMPREF0573_10116"
FT   CDS_pept        135797..136780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppk2"
FT                   /locus_tag="HMPREF0573_10116"
FT                   /product="polyphosphate kinase 2"
FT                   /EC_number="2.7.4.1"
FT                   /note="COG: COG2326; Pfam: PF03976; InterPro: IPR005660"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10116"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66435"
FT                   /db_xref="GOA:D6ZI86"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI86"
FT                   /protein_id="ADI66435.1"
FT                   /translation="MQNHDNPDKLSTAKPEPPLKVPNKIYETELYRLQTELAKLQRWVK
FT                   QTGARIVVIFEGRDAAGKGGTIKRLTEYLSPRVARVVALPTPTEREKTQWYFQRYISHL
FT                   PAAGEIVIFDRSWYNRAGVEKVMGFATPIQVQKFMQQCPTFERMLVEDGIMLRKYWFSV
FT                   SDKVQYERFSRRLHDPLRQWKLSPMDLESITRWEDYSRAKDEMLVHTDTTECPWYQVSS
FT                   DSKKAARLNMIAHFLSTIPYTDLPSDTAPITLPARPPSSGYVRTSFETVRSAPNHAAEV
FT                   VARAKSGKIPFVTLDALPEGTEPPTAGNPAQGVNNKPKKKKKKKKK"
FT   gene            complement(136823..139456)
FT                   /locus_tag="HMPREF0573_10117"
FT   CDS_pept        complement(136823..139456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10117"
FT                   /product="putative ATP-dependent DNA helicase PcrA"
FT                   /note="COG: COG0210; Pfam: PF00580; InterPro: IPR000212"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10117"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66436"
FT                   /db_xref="GOA:D6ZI87"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI87"
FT                   /protein_id="ADI66436.1"
FT                   /translation="MNDLFSSLAEGSGGEIPVSAVLPRGAVAHFETPDATSDFAGWSEA
FT                   DAAQREDWRTRKVAAIVDGLNPEQHAAVTHESGPLLVMAGAGSGKTRVLTRRIAWLLAT
FT                   ERIRPWEVLAITFTNKAAAEMRQRVESLVGNAAKYMWVSTFHSACVRILRAEADTLGVT
FT                   RSFSIYDTADTKALLNRIIKGRGLDPKRFPPKSFAAKISQAKNELITPEVFALGAGVDK
FT                   MSQLTAEIYTEYQQLLRRANAFDFDDLIASTVYLWKAHPDILARYRAKFRHVLVDEYQD
FT                   TNPAQYELIRLLTVGATGDAQPPAELTVVGDSDQSIYAFRGATIRNIEEFESDFPGATT
FT                   VYLEQNYRSTGTILSVANAIISENEGRRKKNLWTDAGQGMQAVLYAADTDRDEAAFIVR
FT                   ELQKLRQEGSSWDEFAVFYRTNAQSRSLEEMLTREGIPYRVVGGTKFYDRREIKDAIAY
FT                   LCAAANPADDGNLLRVLNEPKRGLGDKAVQTIREVSLSENLDFGQALRQFLPGGTHHGD
FT                   LSAKASAGITEFVGVLDAMRALDAAGAPLDEILDTALEDSGYLPKLRKSNDPQDDARVE
FT                   NLAELRNVAQDFSLSEPDARLADFLERISLVADADQLPDTAGQPERPADPVHPAAPPEV
FT                   TLMTVHTAKGLEFNTVFVTGMEDGLFPHSRSLESPQDIAEERRLAYVAVTRARQRLYLT
FT                   RCAARTVFGETVTMPASRFLDDIPAELVDNRREATTVDYFGGLASRGYGEPTSSAYGYG
FT                   GRGGRGGVSGGYGTYHGARQSSGSRGSSSAFGGKFANSRIGLTTARDLAGGKDSAAAPA
FT                   KKAKAKPAGKIPELHVGQRVHHDIYGEGKVTGLEGQGKGTIATVKFRTGAAKRLLLNFA
FT                   PLTPVD"
FT   gene            complement(139453..140589)
FT                   /locus_tag="HMPREF0573_10118"
FT   CDS_pept        complement(139453..140589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10118"
FT                   /product="BNR/Asp-box repeat protein"
FT                   /note="Pfam: PF02012"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10118"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66437"
FT                   /db_xref="GOA:D6ZI88"
FT                   /db_xref="InterPro:IPR011040"
FT                   /db_xref="InterPro:IPR026856"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI88"
FT                   /protein_id="ADI66437.1"
FT                   /translation="MQRTVVAPHASAGFMQARYPAIARTSSRVLLMIWEALPSECAASA
FT                   RMEQAKAKSASLEEPHYRRLCPTSLRLSRSFDNGLTWEEPRTLAAGNPQEFFGFHVPSF
FT                   LHDCVTGRMFCFYTRSLVPDWDLRQAQTALFVAWTDDDGLSWEHQDITSMIIAGRDFSM
FT                   AYIPRGRGTQLTSGQWAQRLCHAGVIVDESGDRKAVFIGSDDHGASWWASSPVGANVDY
FT                   CTAVSNSDGTEVMLLMKTQGSTVKTWAKSADAGRTFGQPAAATDSRLINIMSPLEEVFH
FT                   GACPGTPHADVFSYIGERTTDQGDCTVLMLSTDGAKSFREAEMFDVQTYGALDIVSMAD
FT                   QAKFAIAFEGADGVVCEVLPFSKLGNIDALAEQWVHQA"
FT   gene            complement(140690..141391)
FT                   /locus_tag="HMPREF0573_10119"
FT   CDS_pept        complement(140690..141391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10119"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="COG: COG2197; Pfam: PF00072,PF00196; InterPro:
FT                   IPR001789"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10119"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66438"
FT                   /db_xref="GOA:D6ZI89"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI89"
FT                   /protein_id="ADI66438.1"
FT                   /translation="MSDSDVSPQAGGEHPKCPISVLVIDDHGLFRAGVVAELSKYPKEV
FT                   QVVGEADSVEDAVAAVRQNVPTVALLDVHLPGGHGGGGAEVAAACLGVPTRFLALSVSD
FT                   AAEDVVAVIRAGARGYVTKTIATPDLVDAIVRVAGGDAAFSPRLAGFVLDAFGAARTDM
FT                   VGTDSELDSLTEREFEVMRLIARGFAYKEIASELYISVKTVETHVSSVLRKLQLSNRYE
FT                   LSKWAQDRRIS"
FT   gene            complement(141420..142652)
FT                   /locus_tag="HMPREF0573_10120"
FT   CDS_pept        complement(141420..142652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10120"
FT                   /product="PspC domain protein"
FT                   /note="Pfam: PF04024,PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10120"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66439"
FT                   /db_xref="GOA:D6ZI90"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI90"
FT                   /protein_id="ADI66439.1"
FT                   /translation="MRLPLRRPVSGTVPPGKDGVLAGVAAGLALHLGIPLWLVRLILVV
FT                   LAPTGVSILLYAWLWIFVPRGNPWGAAGLPFRTDSRLATPNASLEGHFGGNERWRNVTV
FT                   PAILLALGLIAIAGVGAYSGPKIMSDLRPLIVIIILITGIALIWAGASAGSSPSELRMG
FT                   RFLGFAIPGALLVIFAVMFGFSGTISLRDALRGGLITLVVIAALSLAVLPLWARFWMSY
FT                   KASLAEQTRQTVRADMAAHLHDSVLQTLALIRTRADDAAEVAKLARAEERQLRAWLYED
FT                   RGHVDSSLSQIIKELAGEIEDRYGVVLDTVTVGDAVPGAWSEPLVAATREALTNAARHG
FT                   APPFSVYLEVGSDAVECFVRDHGTGFDLAAIPQGHQGVKHSIIERLERHGGSATIRSGP
FT                   SGCEIAMKVPR"
FT   gene            142860..143162
FT                   /locus_tag="HMPREF0573_10121"
FT   CDS_pept        142860..143162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10121"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66440"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI91"
FT                   /protein_id="ADI66440.1"
FT                   /translation="MAAKLPAQPLLPAQPHLVPRRQTGLVTPDLAHLIRVRLAQTVQAT
FT                   ALRTTPVPAIFPTTAQTMAPRAREATPEVQIPPDRHGCGPPTGSSAEFVQELPHA"
FT   gene            143105..145156
FT                   /locus_tag="HMPREF0573_10122"
FT   CDS_pept        143105..145156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10122"
FT                   /product="PspC domain protein"
FT                   /note="Pfam: PF04024"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10122"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66441"
FT                   /db_xref="GOA:D6ZI92"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI92"
FT                   /protein_id="ADI66441.1"
FT                   /translation="MRSPNRVIGGVCAGIASRLNIDPVIVRGLAVVGLLFFGFIPLLYG
FT                   TLWLWMPNQTTGRSLWTDWRAGLLNQSGAVTGAIALMCFGAMRMLPQGIFLFNIFDIWD
FT                   GGGGFDDLLAFFFIALVLCLMLAPLVVIVLVIVHVVNQSKTGTPPVANVYVPGPTGFVP
FT                   TPQAPTPAMPNPTDGLMNTPVSPATSAAGFTQPTTGFATPSADFTVPPAAVTPPFNSAT
FT                   TMSAPPYPRPGAPLKPLIPGPSRALSLTVCGLALLSIFTGVLLPLIGVLDPLSSALLAV
FT                   GLLTMVLGGGMLIAALQKRRTGWLAVVTPLVILFVTLPLATVGMSVMPQLRVLRSSIDW
FT                   GDFPEMFSYQSNELHPGDELSAMRGSADIDLRAATPGKPIKVNLANGDVSIYTLPEQNV
FT                   DLKINLAQGKVRTSTLKNSKWNMSEAFLKSSSRDKHRPQYFTMDGNQRVEFIDRTKEYE
FT                   AASISLGSSDVTKLQIRHHVPLSDGSRNIKTKSQTIEINLAQGSVSLYERPAMDLWNGA
FT                   VLPDGHFLVNYVLNGRTLMTDELEEYNSTETGAEGESGTALQEFRRRAVSGDGVIDVKT
FT                   ADGDESVALALNGKDVSELDLNNTLTLADVQAGKAGKWTDVNQDGFNDLFQPGGSLWKP
FT                   GDNLFDPVNGTPRSAGMSNGTPSISATPVPPDSSTTPSPYRAPDIENN"
FT   gene            145169..145438
FT                   /locus_tag="HMPREF0573_10123"
FT   CDS_pept        145169..145438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10123"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10123"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66442"
FT                   /db_xref="GOA:D6ZI93"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI93"
FT                   /protein_id="ADI66442.1"
FT                   /translation="MENTTETIPLTANLKEENAAETLSKSPLEPRREHRSLAAIAFSVV
FT                   FILIGLIVVGSALGVIVSLWTLILLIFGTSGIALLIGALAESRR"
FT   gene            complement(145451..146800)
FT                   /locus_tag="HMPREF0573_10124"
FT   CDS_pept        complement(145451..146800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10124"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66443"
FT                   /db_xref="GOA:D6ZI94"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI94"
FT                   /protein_id="ADI66443.1"
FT                   /translation="MNTAEKSGAPFLPIILSGDIGTYAFARSFYEQWHVKSLIITPQVL
FT                   GPIRHSRLLDAITIDESKIDPNLSVFIEKLIEMGPELAARYPDTPLVLVANQDTHVVNI
FT                   QKNVSRLSPYYRFAFPSVDAIELTNDKAHFAQAAEKYGLRVPTTVELHLDSGTDTLMDA
FT                   ITATLGDKYPLIIKPCQSYGYERLRWPGKSKVYTAENPTRAREILQDLETHTAGTPEAR
FT                   RFVAQPRVSGNDTHSLSITAYVDSEKRVSFLGSAHVLLEDHVPTALGNPAAMITESYPD
FT                   LYRQVSDFLVGIDWHGFANFDVKVDSSTGQAYFFEVNPRIGRNLYYNTAAGNNPLPALI
FT                   NDIIYHQPTEPARHFDTILYTVLPIRLILKYTTGQVRHQVQSLHRAGKVFNPLLAPAER
FT                   QFSLRYLRRRLYVWLSTQRHWSKFKRYYPLDALEAEGRDSFDTVQLRAQR"
FT   gene            complement(146877..149369)
FT                   /gene="gpsI"
FT                   /locus_tag="HMPREF0573_10125"
FT   CDS_pept        complement(146877..149369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsI"
FT                   /locus_tag="HMPREF0573_10125"
FT                   /product="guanosine pentaphosphate synthetase
FT                   I/polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /EC_number="2.7.-.-"
FT                   /note="COG: COG1185; Pfam:
FT                   PF01138,PF03725,PF03726,PF00013,PF00575; InterPro:
FT                   IPR014069"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10125"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66444"
FT                   /db_xref="GOA:D6ZI95"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014069"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI95"
FT                   /protein_id="ADI66444.1"
FT                   /translation="MVSWTFRECLGLSGEICGEPAQWTSIDDRRAEQREGDPLEGPEIT
FT                   AAEAVIDNGKFGKRVLRFETGLLAQQAAGSAMVTLDGETVVFAATTVGKQPKDQFDFFP
FT                   LTVDVEEKQYAAGRIPGSFFRREGRPGTEAILAARLIDRPLRPAFVKGLRNEVQVVDTV
FT                   LSIHPDHAYDVVAINASSMATQLAGLPFSGPIGGTRLALIDGQWVAFPTYPEMEQSTFN
FT                   MVIAGRVVNEGTPEEDVAIMMVEAGGGEYAWDLIQEGKQAPTEDVVASALDAAKPFIKE
FT                   LCRAQSAVAAKAAKETQEYPLFPDYEDNHFEAMKSEVEADLLAAIQIADKLTRENRETE
FT                   IRDAAIEKLAVEGGEFEEQEKELKAAFKALEKKLVRARVLHEGKRIDGRGLKDIRSLSA
FT                   EVEVLPRVHGSALFQRGETQVLGVTTLNMLRMEQQLDNLSPVTHKRYMHQYNFPPYCTG
FT                   ETGRVGSPKRREIGHGHLAEMALEPVIPAREEFPYAIRQVSEIMGSNGSSSMGSVCAST
FT                   LSLLNAGVPLRAPIAGIAMGLMSEPGENGTQFATLTDILGAEDAFGDMDFKVAGTQDFI
FT                   TALQLDTKLDGIPADVLKGALGQARDARLKILDVMHAAIDGPDELAPTAPRILTVNIPV
FT                   DKIGEVIGPKGKMINQIQEDTGAELTIEDDGTVYIGADNGPAAEAARDAVNAIANPQMP
FT                   EVGERFVGTVVKTTTFGAFISLTPGKDGLLHISQIRRLVGGKRVENVEDVLQVGQQVQV
FT                   EVAEIDQRGKLSLHAVVDDEDGEAVTDSESASCAACAEDPRDREHRDPRDSSEPRRPRE
FT                   RARRRTHRSRGEDDRDFS"
FT   gene            complement(149464..149733)
FT                   /gene="rpsO"
FT                   /locus_tag="HMPREF0573_10126"
FT   CDS_pept        complement(149464..149733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsO"
FT                   /locus_tag="HMPREF0573_10126"
FT                   /product="ribosomal protein S15"
FT                   /note="COG: COG0184; Pfam: PF00312; InterPro: IPR009068"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10126"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66445"
FT                   /db_xref="GOA:D6ZI96"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI96"
FT                   /protein_id="ADI66445.1"
FT                   /translation="MALTKEEKQAIINEYATHPGDTGSPEVQIALLSKRIKDLTEHFKT
FT                   HQHDHHSRRGLMLLVGQRKRLLGYLQDIDIERYRSLKERLGLRK"
FT   gene            complement(149974..150498)
FT                   /locus_tag="HMPREF0573_10127"
FT   CDS_pept        complement(149974..150498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10127"
FT                   /product="oxidoreductase, zinc-binding dehydrogenase family
FT                   protein"
FT                   /note="COG: COG0604; Pfam: PF00107; InterPro: IPR014189"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10127"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66446"
FT                   /db_xref="GOA:D6ZI97"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI97"
FT                   /protein_id="ADI66446.1"
FT                   /translation="MQLAKALGATVGTTAGEPDRCHKLILLGADAAADYHDPDGLLRMK
FT                   QELTAGRGFDLILDVAGAGGLETNLELLAPSGILNIIGLQKGRHAQLDLGQVLSKSARI
FT                   QGSTIRGLDVASKVRLVRAVGTHVWPLVQAQRIRPVIAHTLAFSKAKRAHKYLAKATAR
FT                   PLGKIVLFTEA"
FT   gene            complement(150485..150967)
FT                   /locus_tag="HMPREF0573_10128"
FT   CDS_pept        complement(150485..150967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10128"
FT                   /product="GroES-like protein"
FT                   /note="COG: COG0604; Pfam: PF08240; InterPro: IPR014189"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10128"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66447"
FT                   /db_xref="GOA:D6ZI98"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI98"
FT                   /protein_id="ADI66447.1"
FT                   /translation="MWSVQGVDGVPVLVEVERPPVGAGEILLEVVAAGVNRADLLQVAG
FT                   HYPPPAGAPQTLGLEAAGTVVEVGPGVDPVWLGRAAVALVEGGAQAQFCVAHADLALPL
FT                   PVSGRLNGYVAGAALLEAAVTAWHNLVDCGFPADSGACRADSRRFGGSGHGSGAAS"
FT   gene            151089..152084
FT                   /gene="ribF"
FT                   /locus_tag="HMPREF0573_10129"
FT   CDS_pept        151089..152084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="HMPREF0573_10129"
FT                   /product="riboflavin biosynthesis protein RibF"
FT                   /EC_number="2.7.7.2"
FT                   /EC_number="2.7.1.26"
FT                   /note="COG: COG0196; Pfam: PF06574,PF01687; InterPro:
FT                   IPR002606"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10129"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66448"
FT                   /db_xref="GOA:D6ZI99"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZI99"
FT                   /protein_id="ADI66448.1"
FT                   /translation="MQIFRDKPSNFGPSIVTIGTFDGVHTGHKRIIEKVVTLAHQHEVA
FT                   SVVLTFDPLPRQVHHPDPKNKLICSLADRLTRIEQLGVDTTWVQQYDLDFAAQSPAEFV
FT                   HKYLVAPLRPEVVVIGEDMRFGAQNSGDAQTLRELGEEFGFTVETVSNIVDPIFGRRWS
FT                   SSWVRELLAQGRVDQAAYVLGHAHSVRGTVVHGKRRGRELGFPTANLDADFIEAIPADG
FT                   VYAGWLRMPYPPHSKTPSSLEVVPAAISVGTSPHFGDVGRTVEAHVLGRADLDLYGEEV
FT                   VIEFVHRIRDNLAFDSLDALLERMDCDLWETAVVLGVPKAQRIDPAAVTA"
FT   gene            152123..153394
FT                   /locus_tag="HMPREF0573_10130"
FT   CDS_pept        152123..153394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10130"
FT                   /product="bacterial capsule synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10130"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66449"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIA0"
FT                   /protein_id="ADI66449.1"
FT                   /translation="MGNRQITRKISYAAATTLLVLGGTWGLTGCEGAAGKTAAKDVPTK
FT                   TSLVKVKPKSTATQPAEMTFTVAATGDALTHDALMPDVSRDAAGNTHFTNLMAGIKPFL
FT                   EGADLAICHQEIAFAADGAAYQGFPNFAMPTGWAQDMKGLGYDGCSTASNHTTDQGIEG
FT                   VYQTLNVLEKAGLGATGSRRSAAEKPYQMYQLTKDGRTIKIAHLSLAWGKLGGMPYIRE
FT                   KPWLVNVDNMSEILKWAAEARQEGAKVVILSGHNGLEYELQPSSWARQWAQEAAASGLI
FT                   DLYIGHHPHVPQGIEKLPGGVDGKGMWTYWSVGNVISDMRPLATMHTDSEQIAWATIKV
FT                   PAQGNAEVISAQWVGIGLEPDSHMVVPLAAAARGQIPPGSAMSASKATKYREFLQSLVG
FT                   PETPELTEPPATPSPAQIKALPKQ"
FT   gene            complement(153439..154869)
FT                   /gene="agcS"
FT                   /locus_tag="HMPREF0573_10131"
FT   CDS_pept        complement(153439..154869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agcS"
FT                   /locus_tag="HMPREF0573_10131"
FT                   /product="amino acid carrier protein"
FT                   /note="COG: COG1115; Pfam: PF01235; InterPro: IPR001463"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10131"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66450"
FT                   /db_xref="GOA:D6ZIA1"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIA1"
FT                   /protein_id="ADI66450.1"
FT                   /translation="MDKFLEVLSTVDSFVWGPFFLIPLLLGTGLWLTIRLAGLQFRKLG
FT                   PAMHLALLKRDEAAGDSAAGKQPLDDTIEGDISHYQALTTALAATVGVGNIAGVATAIH
FT                   IGGPGAVFWMWITGLFGMASKYSEAFMAVRFRTKDAKGEMSGGPQYYLEKVTNVKWLGR
FT                   TLAVAFAVFAIIASLGTGNLTQANSVATQLQASFGINPWMTGLFMAALTGIVLLGGVKS
FT                   IGRVTSAFVPIMIILYVGAALIVLGLHLAEIPDALALIFHDAFTGTAATGGFVGSTFMI
FT                   VVQYGVARGIFSNESGMGTSAIAAAAARTREPVRQGLVSMTQTFIDTIIVVSMTALVIV
FT                   VTGAWKATDADGNPLDGSPLTAEAFNLGFPGGQGHFVVAISLVFFAFSTVLGWAYYGER
FT                   CVERLFGLNAVTVYRVLFAIVIFVGCITELKVAWTLADITNGLMALPNLIGLILASGLI
FT                   AHETRAYLKRDPKLRESR"
FT   gene            complement(155006..156940)
FT                   /locus_tag="HMPREF0573_10132"
FT   CDS_pept        complement(155006..156940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10132"
FT                   /product="trypsin"
FT                   /note="Pfam: PF00089,PF04122; InterPro: IPR001254"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10132"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66451"
FT                   /db_xref="GOA:D6ZIA2"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIA2"
FT                   /protein_id="ADI66451.1"
FT                   /translation="MKQNASLKSWWPMVTLGLLGFVGLLAGPAEMSLASPVAPADTPAI
FT                   SSTAAATVPAADETGEFPELPKNFTSLTDSELPAGSEPSGGSDYGDLMIGGGTPASAAQ
FT                   ADWVAYISISNRDNTGAICTGMLIDPSWVLTAGHCVANGPKYINVTFGPTRQANTAVND
FT                   YKINPQYDATLLHLKDPVYGITPITLASGQAKVGDVAVEYGWGGTSKALMSSSQRIVAT
FT                   CFTVVQGARQGEFSANCGVANAPGQLSYKTSWPGVKTEHGDSGGPLVVGNQVIGTLIGG
FT                   NDQGAYFGSVIPLASWLKDITGLTLGSPAPQTAEYPYESRLNRIAGADRVSTALALHAA
FT                   SGTSGDAMVLTTGRLAPDALSSAALVGARGATVLLTVSSPVEPAVISAIKASPRKTLYV
FT                   VGGGVKLSAAQRAELQQAGVTITDLAGSDRFDTAGRVAARTVRENASVIAHTKVLDVFL
FT                   VDATSDPNIPDAIAAGPAVANAHGVILFTRANNIPTPTQKAISDLGRTVTQQGGKLRLW
FT                   GIGGGAATAVTAKAAHADAAWKGAVSEVKTIVGQNRFQTSTQLAQNFFPSAGGYLVASG
FT                   MVFADGLAGSGYAHANHQAILLSRPATLDSSLQSFVPAHPQASYTIVGGAGAVSRGVAN
FT                   QIGALLTSR"
FT   gene            complement(156995..158059)
FT                   /gene="truB"
FT                   /locus_tag="HMPREF0573_10133"
FT   CDS_pept        complement(156995..158059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truB"
FT                   /locus_tag="HMPREF0573_10133"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /EC_number="5.4.99.-"
FT                   /note="COG: COG0130; Pfam: PF01509; InterPro: IPR014780"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10133"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66452"
FT                   /db_xref="GOA:D6ZIA3"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIA3"
FT                   /protein_id="ADI66452.1"
FT                   /translation="MFDAPDFLPDCPEDLPRGETCPPGLVIVDKPRGLSSNAVASRIRR
FT                   LAGQKKVGYAGTLDPLATGILICAIGKATRLLQYLTAHDKVYTARVRFGISTDTDDALG
FT                   QVLSRAGAALSTAEITAALEPWRGAVDQIPAKFSAIKIGGKRAYDLARAGKNVEIQPRP
FT                   VTIHRLELRGAPVLETVAGDDSNPPVQVTDADIVVGCSAGTYVRSLARDLGADLGVGAH
FT                   LTALRRISVGSYGLDQAHSLSEFETEVRRYGVLRPLGLDAAILGIFPEFPGDETQVRAL
FT                   SFGQAPALRDSTHAAPNIPLETANSCPNASDGALVAVTEPVTETKAGDKRVVALAERNR
FT                   DRLKPIWVLRPAKS"
FT   gene            complement(158052..158183)
FT                   /locus_tag="HMPREF0573_10134"
FT   CDS_pept        complement(158052..158183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10134"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66453"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIA4"
FT                   /protein_id="ADI66453.1"
FT                   /translation="MTRTPNLAGQGTVRGETFVGSGPEDTFGGGRLVHKGSGAGYDV"
FT   gene            complement(158167..158604)
FT                   /gene="rbfA"
FT                   /locus_tag="HMPREF0573_10135"
FT   CDS_pept        complement(158167..158604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="HMPREF0573_10135"
FT                   /product="ribosome-binding factor A"
FT                   /note="COG: COG0858; Pfam: PF02033; InterPro: IPR015946"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10135"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66454"
FT                   /db_xref="GOA:D6ZIA5"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIA5"
FT                   /protein_id="ADI66454.1"
FT                   /translation="MDDTRREKVAANILTTVASMLAGKIKDPRLGFVTITSVEVTGDLQ
FT                   HAKVYYTAYGSDTERTASGAALESAKGLIRSRVGKNLGTRLTPTLEFVSDPVPQQAAAL
FT                   ESALAEARAADAELAARKGTQYAGEANPYKTPRETEDDQDS"
FT   gene            complement(158701..161469)
FT                   /gene="infB"
FT                   /locus_tag="HMPREF0573_10136"
FT   CDS_pept        complement(158701..161469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="HMPREF0573_10136"
FT                   /product="translation initiation factor IF-2"
FT                   /note="COG: COG0532; Pfam: PF04760,PF00009,PF03144;
FT                   InterPro: IPR000178"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10136"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66455"
FT                   /db_xref="GOA:D6ZIA6"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIA6"
FT                   /protein_id="ADI66455.1"
FT                   /translation="MRVHELAKELGIESKEMLAYLKDAGEFVKSASSVVESPVVKRMME
FT                   RFAEEKLGKFSPEAAEKAEKATAKAKKPAVKTTTKSETADADSAETESSSPASPVEPTA
FT                   PETAVTPDDATPETPEAPETPAAPQPTPEKTDSSPSPAKLQAKPSAHPDIPKPGAGIPK
FT                   PGARPGNNPFASAQGMPRPGGTSGIKAKPGPRRGRLGNNPFASAQGMSQGIPRPGQGGG
FT                   PRPKPGDRMGSPRGDSGPAGRGGRGGRGSRPSPEALAGGGFGGAPAFGGPPSPPRGRGG
FT                   RGFTQGAFGHGKSRKGKSRRAKRQEIEEQNAPVIGGVTVPKGNGQEVRIRSGASVADFA
FT                   DKIHVNPAALVTVLFHMGEMVTANQSLDEDTFKLLGAELGYEIEVVSPEDEDRELLESF
FT                   DIDLEAEELDDIEAMEPRPPVVTVMGHVDHGKTKLLDAIRNTDVIDTEYGGITQHIGAY
FT                   MVTLKKADKGRKLTFIDTPGHEAFTAMRARGAQVTDIAIIVVAADDGVMPQTVEAINHA
FT                   KAANVPIVVAVNKIDKPTANPDKVKAQMSEYGVLPEEYGGDTMFVPISAKQRMGIEDLL
FT                   DAVLLTADAVLDLQANPHAPARGVAIEANLDKGRGTVATMLVQRGTLRVGDAIVAGTAY
FT                   GRVRAMFNERGQNVEEATPSTPVQVLGLTSVPRAGDNFLVAEDDRTARQIADKRAAAER
FT                   AALLAKRRKRVTLESFDEALKAGKVDMLNLIIKGDVSGSVEALEDSLLKIDVGEEVGLR
FT                   IIHRGVGAITQNDVNLATVDNAIIIGFNVRPAERVAELADSEGVEMKFYSVIYQVIEDV
FT                   ENSLKGMLKPIYEEHELGTAEIRQVFKSSKFGNIAGCLIKSGTIKRGAKARLVRDGVVV
FT                   NGELEIHSLRREKDDVTEVREGFECGIGLEFKDIQVGDRIETWEMREIPRD"
FT   gene            complement(161812..163071)
FT                   /locus_tag="HMPREF0573_10137"
FT   CDS_pept        complement(161812..163071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10137"
FT                   /product="putative cell wall binding repeat 2"
FT                   /note="Pfam: PF04122"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10137"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66456"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIA7"
FT                   /protein_id="ADI66456.1"
FT                   /translation="MRISKLMASSFAIAGIGVAGVAPIANAEDGGSATITNQTVSAKVR
FT                   LAGVDRYETSQAVSAATSLDSVLVSDKSPDGLIASLQAANDDKSAVMSPKAPSLGGVNR
FT                   YESAANVAVAGDADAPLVIANGRSDVDILAATSYAANLEANLLLSEPNQLGEYAAKALS
FT                   ELNPENITIIGGTGVVNEQTKNQIEELTGKKVSRIAGDNRYTTALAAAQVMGSHNYLLV
FT                   NGKNPVDALTLAPLAKRNNASVVLIQTSCVPQTVLGALAGKHLTAIGGTGAIADNFAAK
FT                   TCEQQAAEEAAAAAKAAAEKAAAEQAAREAAARAANPWGAGTPQGIAYDMLGEYGWGPD
FT                   QMQPLVNLWNRESGWRTNAGRRGGPYGIPQANPGRKMASAGADWATNPATQIRWGLSYI
FT                   KGRYGSPAGAWAKFCARGWY"
FT   gene            complement(163161..163298)
FT                   /locus_tag="HMPREF0573_10138"
FT   CDS_pept        complement(163161..163298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10138"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66457"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIA8"
FT                   /protein_id="ADI66457.1"
FT                   /translation="MFFAQGVTTGFRGGTVTSGTALVKVYPQVAALKIDQMDTAVTKTL
FT                   "
FT   gene            complement(163359..164345)
FT                   /gene="nusA"
FT                   /locus_tag="HMPREF0573_10139"
FT   CDS_pept        complement(163359..164345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="HMPREF0573_10139"
FT                   /product="transcription termination factor NusA"
FT                   /note="COG: COG0195; Pfam: PF08529; InterPro: IPR010213"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10139"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66458"
FT                   /db_xref="GOA:D6ZIA9"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIA9"
FT                   /protein_id="ADI66458.1"
FT                   /translation="MQIDMSALRLVEAEKGMDMNSLIDTVEQALLKAYRNQPGAEKEHS
FT                   RVEVDRKTGEVRVLVNELDEDGTELGESEITPKDFGRTAAATVKSVIIQRFQEEEDKAV
FT                   LGDFKDRVGQVVSGVVTAGRDPKLVTVNLGDVEGIIPPAEQVPGEKYQHGVRLSVYVLA
FT                   ASRGFKGPHIELSRTHPGLVQGLFKREVPEIDREEVVIESVAREPGHRTKIAVRPTEKG
FT                   INAKGACIGPNGSRVRAVMNELNGEKIDIVDWAEDPTVYVANALSPAKVISVRVIDEAK
FT                   RLARVVVPDFQQSLAIGKEGQNARLASRLTGWGIDIHSDTENGGTPA"
FT   gene            complement(164369..164962)
FT                   /locus_tag="HMPREF0573_10140"
FT   CDS_pept        complement(164369..164962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10140"
FT                   /product="hypothetical protein"
FT                   /note="Pfam: PF02576; InterPro: IPR003728"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10140"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66459"
FT                   /db_xref="GOA:D6ZIB0"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIB0"
FT                   /protein_id="ADI66459.1"
FT                   /translation="MFHTPVPFTRSDNSEKTKKGRLLQITTEAQPHTSTDPSVEAIIQV
FT                   VNPVVEAAGLYLEKIAVTGPKHQRVVAISLDLPDGVDNLGSAQLEDASRAIGAALDAAD
FT                   PLSGAYTLEISTLGAEHELTNLRLARRALGKDVEVRTGGQVRAGILTEVTETGLSVNDD
FT                   GDVTVYPFEDIESVRTVILFGKPRGSQRNGRKNK"
FT   gene            165015..165995
FT                   /locus_tag="HMPREF0573_10141"
FT   CDS_pept        165015..165995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10141"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66460"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIB1"
FT                   /protein_id="ADI66460.1"
FT                   /translation="MAGLALTGCGLRLDTPPDALPKLDAGQAGISAVSRAEAAINAGSE
FT                   KMADDASLSPGLRTAIGTVRDLSATRLAAMGGVWQPWPQGMPEGADPGPQPSPAPGSVE
FT                   DLLQLLVDAAATSCQAGARAPQAKDAQLLTALCAAQQLDASHLAGASGNPLPESKVPVD
FT                   APAGTNPEGSPEPIADRKNLQDLTAAQTALDFARFRMEVAAAHLNGDNRKWALQRASSL
FT                   AWDVQSLVDGGVEDVRASQYALDFPQIKSAADAIHLINQADADAFAAHLQIIAMISSPD
FT                   AASKQAPDQTLSALRQPWIRAVKDDVTSQNRFGIPPSQIFAQLWP"
FT   gene            166294..167031
FT                   /locus_tag="HMPREF0573_10142"
FT   CDS_pept        166294..167031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10142"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="COG: COG1136; Pfam: PF00005; InterPro: IPR003593"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10142"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66461"
FT                   /db_xref="GOA:D6ZIB2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIB2"
FT                   /protein_id="ADI66461.1"
FT                   /translation="MTNAETDLPTVPVAQLRDVTKVYGEKGTRVEALRGVNVDINAREF
FT                   TVIMGPSGSGKSTLLHVLAGLDAVTSGSITVNRMDITKLKDKPLTLWRRDNVGFVFQSF
FT                   NLVPTLSAKANIELPLRLANKPIDRHWFDQIVTGLDLTTRLNHKPYELSGGQMQRVAVA
FT                   RALLSHPAMLVADEPTGNLDTASSAEVLNLLRAAVDNFGQTVVMVTHDQHAATTGDRVL
FT                   IVRDGMIVHDLHHPEPADIAKVA"
FT   gene            167035..169749
FT                   /locus_tag="HMPREF0573_10143"
FT   CDS_pept        167035..169749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10143"
FT                   /product="efflux ABC transporter, permease protein"
FT                   /note="Pfam: PF02687; InterPro: IPR003838"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10143"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66462"
FT                   /db_xref="GOA:D6ZIB3"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIB3"
FT                   /protein_id="ADI66462.1"
FT                   /translation="MKGILRADLRKNVKSYTATALAIALAVAFLLTCLGLTAGLKTTLA
FT                   RNLTEKAAGADLIVTAPNGVPYDGEGPEPDYLQKVADQAHQAHPEWKILTRTSMSVDLS
FT                   ANRKKVSASVLGLGNPAFDPSSVVEGKRPSSESEIGIEQSNAKTLGVKVGDTINAGIYD
FT                   PATDDTKTVPLKVSGIYKARPGAFPTSYVSDSLVKTWAGDDYLADILLISGVSTTNLKA
FT                   ATAELKQLTSHIADADYYEVFTADQYLDRAVDSITGGQDVLLVLALVFPLIAGVTAIIV
FT                   VSVTYNVLFARRRRQLALLRAVGATSGQLRSLVARETLLVGAVSAMIGVLAGVIFSAIA
FT                   CRIANLADTWGHAFTVLNWQSLLAGFLCGTVISFLAGFAPSRRVAQVTPIEALATEDKL
FT                   SRRRKHRTVRAIFGSMLFFGGTATMVYATLKNHQLMMSVSEQGDMDTYTSNFFLIAMFA
FT                   GMISFLGLIMLTSIVLPYVTSALGVFSSPAAVTWRLAAENTGRNPRRTGATGAALTLGI
FT                   TLLVLLLVGAASVDATGKKVIDEHTPIDLQLVSEGEPLSQTTIANVKATSGLQHTIAVN
FT                   GLLGSAVPWGEYEKTQKLLSQPEKLTHDENGGCIVAATNEPCDPDADTQELLLESKDFS
FT                   TVSHSRIPVVTPGHVGIPQLNEEEVGTPYAVRSGDKVLKLTAEKTSLDFVSLNPQDLAG
FT                   LVSSTQVVRPAQTDSDQELKRNATVLAPRVLLMRISSDCSFSDIEQLASDIPAASEQDA
FT                   HITGSAPDRAMFTQIAQGLMWGAFAMLGVSVLVALVGVANTLALSVMERRRENGMLRAL
FT                   GMTKGRLQGMLAFEALLTALGALIVGVLAGLGYAIAGINALPVTELASAQIIVVPPLAI
FT                   VAAALTIVVALLASIGPARAAARVTPVEALAHD"
FT   gene            complement(169761..170276)
FT                   /locus_tag="HMPREF0573_10144"
FT   CDS_pept        complement(169761..170276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10144"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66463"
FT                   /db_xref="GOA:D6ZIB4"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIB4"
FT                   /protein_id="ADI66463.1"
FT                   /translation="MGLRGGHQGGAMPHRFAARFERLVDEDGRIMLLGLAACVLLCVII
FT                   LMSMAVSGVYLEQRRLQRLADQTASLAAANMADAAYYQNGIVDGVPLQIEPYHASERAA
FT                   EYLSGAAISANSGLEGIDLVDVDVASTRVQVTLRATGKIPLVLPLISSLTQVELTATGA
FT                   ASLKASFG"
FT   gene            complement(170266..170682)
FT                   /locus_tag="HMPREF0573_10145"
FT   CDS_pept        complement(170266..170682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10145"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66464"
FT                   /db_xref="GOA:D6ZIB5"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIB5"
FT                   /protein_id="ADI66464.1"
FT                   /translation="MRGESGEATVEFVGIAMMLLIPLVYLILAFFQIQSGLYAAEAGAA
FT                   GAARILTLHPVTGVDSASLAVQLAATDQGLPAGKAQYSLECVTGPCPAAGSRGIVHVSL
FT                   EVPLPLVGTILQSSFPTSLTLHADHPIQWGEHGA"
FT   gene            complement(170727..171083)
FT                   /locus_tag="HMPREF0573_10146"
FT   CDS_pept        complement(170727..171083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10146"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66465"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIB6"
FT                   /protein_id="ADI66465.1"
FT                   /translation="MPLVLILVLGLLQLSLALWVRTTLIDAAGAGAHAAALAGAPESAA
FT                   DETVRGVLASTLGSGYVHTVSAQRVGLAMLPGSFAASDLEVMEVQVKAPMPIIGLFGVG
FT                   DMTAVGHAVIEEGP"
FT   gene            complement(171166..171351)
FT                   /locus_tag="HMPREF0573_10147"
FT   CDS_pept        complement(171166..171351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10147"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10147"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66466"
FT                   /db_xref="GOA:D6ZIB7"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIB7"
FT                   /protein_id="ADI66466.1"
FT                   /translation="MQKLRALRNFVCARLGAEDGDVPGWVMVTLMTAGLVVALSAVALP
FT                   ALTNLFNDAITHVSAL"
FT   gene            complement(171384..172295)
FT                   /locus_tag="HMPREF0573_10148"
FT   CDS_pept        complement(171384..172295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10148"
FT                   /product="bacterial type II secretion system domain protein
FT                   F"
FT                   /note="Pfam: PF00482; InterPro: IPR001992"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10148"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66467"
FT                   /db_xref="GOA:D6ZIB8"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIB8"
FT                   /protein_id="ADI66467.1"
FT                   /translation="MENVVPWIVGGLAVLVGSGFIGVCLGPWIRQGAFPTWRITPYVQA
FT                   DLIGMATYRGAGLRDISFSPSGLTKFLTFISPSKESVERRLELAGLPKDVCEFRRSQLR
FT                   WATFLGVLAVVLSIIGFWGRTLPIPGAFVMLTCFVLAGLLVPDYRLTGAARRRQLSLNQ
FT                   ELPDVIELLALAVGAGEPLYGALHRVSARCTDVAGQELEKILAAADNGDSLAPSLTAAR
FT                   ARNDSEILAHLIDAIVSALERGSPLAGVLRSQVADSRAVARTQLLTEGGKKEVLMMVPV
FT                   VFLILPLTVVFALYPGLVALQL"
FT   gene            complement(172299..173186)
FT                   /locus_tag="HMPREF0573_10149"
FT   CDS_pept        complement(172299..173186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10149"
FT                   /product="bacterial type II secretion system domain protein
FT                   F"
FT                   /note="Pfam: PF00482"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10149"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66468"
FT                   /db_xref="GOA:D6ZIB9"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIB9"
FT                   /protein_id="ADI66468.1"
FT                   /translation="MNSLWLTWAAALSAASGIFLVTLSPKRHSAHRESSLKHYWSQKSA
FT                   HFNDITAVSGTRLGLGQFLVLSLLAGVSAGICLTVVTGLVMVGWLAGLLAAYLPFLGLQ
FT                   SKLHSVQGQRGKAWPNLVDDLVSGVRAGLSLGETLLEVAARAPKSLRVPFAHFAADYRA
FT                   GGNLDASLKILKRELADPVGDRIVEALRLAAQVGGNDLVILLEDLGAMLRAEERTRGEV
FT                   LARQSWTVTGARLAAASPWIILALLLSRPGTLEVYSTPVGSMILLVGALVSALAYLMML
FT                   RLGRLEVSPRTMRE"
FT   gene            complement(173179..174252)
FT                   /locus_tag="HMPREF0573_10150"
FT   CDS_pept        complement(173179..174252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10150"
FT                   /product="type II/IV secretion system protein"
FT                   /note="COG: COG4962; Pfam: PF00437; InterPro: IPR001482"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10150"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66469"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIC0"
FT                   /protein_id="ADI66469.1"
FT                   /translation="MALKYEGVIDLGLSYGKLQPLMDDPTVEEIWLNSPSQVFCSRGGQ
FT                   ARLTNLLLAEDEVEALVERMLRASGRHLDFVNPCVDATLETGERLHVVIPPVTATWSIN
FT                   IRKHSAKAVKVRDLVRLKMMPAWLASFLSEAVRIGLNIVVAGPTQSGKTTTVRALCGEI
FT                   PPDQRVITCEEVLELNLKAPDTVAMQTRNASIEGQGEITLRDLVRETLRMRPDRLIIGE
FT                   VRGAESLDMLIALNCGIPGMSTIHANTARQAITKLSTLPLLAGENVTAAFVIPTVAGAI
FT                   DLVVQLRGTWQGSRAVTEVLALDGTLRDGQIVAYPLYSVPPEGTQPVKNSANFDFLSAF
FT                   GSRAGQLSALWREAPHE"
FT   gene            174505..175602
FT                   /locus_tag="HMPREF0573_10151"
FT   CDS_pept        174505..175602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10151"
FT                   /product="phosphotransferase enzyme family"
FT                   /note="Pfam: PF01636"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10151"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66470"
FT                   /db_xref="GOA:D6ZIC1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIC1"
FT                   /protein_id="ADI66470.1"
FT                   /translation="MSDTDFLTLAALATVAIPDLEVESLCPPVGEDSDFRWTGILDNHS
FT                   ARWSVIGAKHADAETALHKQQKILTMLTNYRDAHRLPFDVPRVEGSATSKDGTSVIVYR
FT                   QLPGNPLNLNELAENPDLLRALGKAIAALHEIPANLVAHVGFPTPSVDDIRADLRKNLS
FT                   QAVATGLVPPVLQARWEQALDEDAWWHFHPTFVHGSLDPEHVLVADSRILGISGFAEVS
FT                   VGDPSQDLSWVASELTDEAVDLVFDAYHLGRAEGSDPFLRQRTDLCIELALVNWLNWGV
FT                   NQGSASIIADAQDLLNEQLERLDGDLSLTGRPLYEDQSANIPGDTADTSETSTEGITEI
FT                   TAEIAAEIATASDSESTSSPADDAS"
FT   gene            complement(175667..175786)
FT                   /locus_tag="HMPREF0573_10152"
FT   CDS_pept        complement(175667..175786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10152"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66471"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIC2"
FT                   /protein_id="ADI66471.1"
FT                   /translation="MARPSSQHRHGETKAGRGGTVTLEDPAGSVFGGRCGEET"
FT   gene            complement(175918..179493)
FT                   /locus_tag="HMPREF0573_10153"
FT   CDS_pept        complement(175918..179493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10153"
FT                   /product="UvrD/REP helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="COG: COG0210; Pfam: PF00580; InterPro: IPR000212"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10153"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66472"
FT                   /db_xref="GOA:D6ZIC3"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIC3"
FT                   /protein_id="ADI66472.1"
FT                   /translation="MTTTKPVTEIFTASELAILTGANPPTQEQSAVITAPRGQLLVVAG
FT                   AGSGKTETIANRLVYWVVNAGIVPEAILGLTFTRKAAAEMAARFSLRLDRFASLLESVQ
FT                   ERRQTAEVTAVLKAADFDLNQLRQRFDTLVQRGMTPEMLRHPVSVSTYDSYAGTLLTEF
FT                   GTLVGRESGFTTITDAARYQIMTDVVQSWTGALGTKREGENAENLVNILLSLANDTNSH
FT                   LVDLAEMKQTYRSYHAAARRLQDTEGADLNSTALRNLDTIIDTMEFGCNATNIIQAFNE
FT                   RKRELLMADFSDQTRETVRLVEQLPAVGESQRERFQLVFLDEFQDTSVAQMRFLAGIFR
FT                   DCAVTAVGDPNQAIYGWRGASAASMEDFGSIFCTDSHQLLTRTLSTSWRNDAVILAVSN
FT                   RISAELTGAPAVAAERNIPLNQDVQSAISKPLQARSGANPGIVYGIQTLTDLQQSQAVV
FT                   NFFRLWQAQRVKLQGEGVPAEKLPTAAVLCRAKNAIPGLVESLRQAGIPYQTRGMQGIL
FT                   EDPGVRLVRAALEITDNPEKSASLLLLLDRYRLGLSDLQAVGRNRHRFTPYQIVMEGGA
FT                   QVSTEAQARLEKLRGILTELKDNAPFATPLVLARLAHRLLDLDIEQQLPGSSCQAGAYV
FT                   EFLNLVRDFGRTPGATLSGFLNWLSAGEDEEASFADLDFEVDNAAVQIITMHAAKGLEW
FT                   DWVAVPNLNKSTFPSVRGEIWVTQRDVLPYPLRSDRDHLPELELKTQTLLTATGRVSKK
FT                   KGLLETFKEDAEHYALREESRLAYVAFTRAKSRLLLGHCWFERQTKKGRPPSQFFLVEQ
FT                   DPQQHIFSDADSLASSGGANIIQSDSSTVSVVESSEGGAVGAANLLTPFNAETFAQEVA
FT                   RLGIETPDVDWPDTIVTSIPDKIENPNQDRFDAGIWPALPLIQTRPDFAQAVQATEAAL
FT                   DSGKFSGGISQDADEEAERRLSQLLHQPQTRLGTGDLLGRISATGMAHLAQDSEGYLLQ
FT                   RLRPLPQQPSVAARLGTYMHAWIASQLENEDTFIFDAGTEDGFTPEQRELLHKWQQRYE
FT                   DLELLRRLRGPQVEFDGELYLEEAGGAVIPLRIDAQFEEAQTGKIWIIDWKTGRRPTPE
FT                   NYAQWLHQLGIYRLYWLQEHPETPAEDIICAYIFLNEDNPAKQLLTLQDILDELGIAEY
FT                   SRNLLVSNLTDRGEEIDAVLEKFGY"
FT   gene            complement(179490..182984)
FT                   /locus_tag="HMPREF0573_10154"
FT   CDS_pept        complement(179490..182984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10154"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66473"
FT                   /db_xref="GOA:D6ZIC4"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIC4"
FT                   /protein_id="ADI66473.1"
FT                   /translation="MRGNFMSEETTSFKVSNFRLWGYWYSQTMEIFDELADRVRQSLDV
FT                   GESVLLAGVPASGKTTLLAQLLVGNPRMLVLSPNAGAARRLSERALEIRAQSEDPGCLL
FT                   GVSKGFVAEVFARFNQWRKAEGLPEVRLATDAEVMVQIQDFLAGMPLEEELRAALETQG
FT                   FRRDLVDGIFRVRAFAGDVSSDSAASPVHPLVTRLIQAMQADREAKRSQARQSAWPLDT
FT                   ASLFEEYLLAVKAGAPVPELVGIDDLQNFNGLMIDILSLWATHGTTLVACTLPETCVNT
FT                   FRGASPHLSERLWQQLETIPGKGAIEILLTQEHVPAPLRQAWRIAVNRLGVHGISARLW
FT                   NSIQESSPASTETDSLCDADGRDRIILVEKSTDTAQYQEIGTLLQDAHIFSDRPLKYSQ
FT                   MAVLTRSSREARQVAEVLENMDIPVVVPGATGQLNEGRLTRYLLKMMQAVCVEDCDQVK
FT                   LSDLDLAGLLSSALVGWDVWRMRRMDSSLYDLRLQPPADSENAAGSTGVMDSADTADDE
FT                   EGGIQIVGNLPYIQQFLRQVISGQNDFSGRSVAEIISAIPDAAQLVDLAQALRSGWQQW
FT                   KADSGSVQLLLWKLWDGLGRGEILQARALQPGLVPAVRSTLQIDLDLVMDLFKAADWFE
FT                   ARNPGKTAADFAQGMLARDLPTGTVAPHHLVKDAVTVVSAAATVSQHWPLVAVVGLTDG
FT                   NWPAMRWPGSILGSSMFELENYGDPTNSSSAGYLWNWQNEYRHFFTALTRCTQRLILGT
FT                   TAQDGVGRSTFLTSLVQTLQLEPKQHRRLPTNLRDFVAYLRAACLGGETSWGTPTIDAP
FT                   TAAGLLAKLAAGDCPSAHPENWMGALPVSGDETESAEIHIYASGLERALENPLDYVLSW
FT                   SGYSNDEDDPYAANKVGNIVHEAAEILGRRYWWEGHGPRDDLEFEQVLTELRQEVRRLL
FT                   GPLSGETWVESNFRRHIETCLVPLATFLVNHQYPSRFEVRYPCRLEASSGKGALVYNAR
FT                   IDRVMFAHGRVIIMDYKTGNPSNFSAAKVAANLQLALYQAAYNASPDGQKQPCDMAEIV
FT                   ALQVPPDSKKLYATHGIEEPREPKVWVQQSLESGTEVIALPNRFSGEQRQILRDPLAWL
FT                   RGETPGAPDPEAMLLRDYLQDRVNLAVAAFSGPNLAQIESLGAWGAGNTLGVEVRQR"
FT   gene            183024..183251
FT                   /locus_tag="HMPREF0573_10155"
FT   CDS_pept        183024..183251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10155"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66474"
FT                   /db_xref="InterPro:IPR021456"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIC5"
FT                   /protein_id="ADI66474.1"
FT                   /translation="MVMEIKIGMKSVARELSLDIDKSFEELQKLLTDAVAGGEIIDLVD
FT                   KRESHTLINAGNIAYVEFAPERQNRIGFAI"
FT   gene            complement(183258..183881)
FT                   /locus_tag="HMPREF0573_10156"
FT   CDS_pept        complement(183258..183881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10156"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66475"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIC6"
FT                   /protein_id="ADI66475.1"
FT                   /translation="MEISEERTAHMLGLVAFTRITAYARLARDVSQTTDFADQLALARM
FT                   GVSFVTAIDDLEAFANRRGLDLADLTQPYVGFFDDMELRTRPRDWWERMVKSYIFVGIL
FT                   ADMEDLAAQFVGADMIEILGVSGSAGLTQWVRARLRDGIAADPTVESRLSMWGRRVAGE
FT                   AVAGVRAILDAYPLLLPAGVEVNDTVEEIQKQHSRRMEDLGLAF"
FT   gene            183961..186150
FT                   /locus_tag="HMPREF0573_10157"
FT   CDS_pept        183961..186150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10157"
FT                   /product="putative cell wall binding repeat 2"
FT                   /note="Pfam: PF04122"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10157"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66476"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIC7"
FT                   /protein_id="ADI66476.1"
FT                   /translation="MRISSVLNFKPTESPVRHPPVSLFAGKSRLWRHVGVTLAALGLSA
FT                   TGLVVGVPGANSVSVQRAGTPVTPGNNEATARAEFETLWNSTDQVTPFSSGTVISSCTP
FT                   GTAQPEAVQAMLSTWNYLRSLNHLAPVSLPAGYAPQGPAQEAALTAAAGPVASPVPDSV
FT                   PGAACLNEDVKLASRSGVIARLDGIVTPATEILRYITEASNTNTNDNLGHRLQMFSPIQ
FT                   ANAAIGAVSIGTSGPTATSIQLFDTTYQAAGKPAHPNFWNPAIQQPPSLAWPAAGYFPS
FT                   RILPTGAGENVSRWSYSGRCADLRNAEVRVTGPTGEIPLQVIHRAEPGIDPNQTPWQYG
FT                   GYDTILFKVPLDQLTIPDFYNVARYTVSISNINTAPNCQPVPASTSYQINLFNSDWPAD
FT                   PDGDADQDGVVNSLDSRPHIPDLHTDRIAGADRFETSAAIAKSANSRPAVAYLARSDVF
FT                   ADALVGGVLKDGPVLLVPPDSSPVPAVISETLRALKPKQVAALGGTGAISDARLYELAG
FT                   GRAALRVGGANRVDTSVMVARRAFTKANSLYIANAYGPGGSVSPDALTGAALGDGPIVL
FT                   VDSSSPAIATIRQLASDLQVKRVVALGGRAAVSDAVLRSVANGKAATRLGGRDRYETSR
FT                   EIALESARLQPSTHAYLARGDVFADAVSGGHLRNGPILLVPRGCGRLDQATLRTLAKLN
FT                   AFQVTALGGYAAICEKTLQSALDWPDYVNHNVTEF"
FT   gene            186289..187866
FT                   /locus_tag="HMPREF0573_10158"
FT   CDS_pept        186289..187866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10158"
FT                   /product="DEAD/DEAH box helicase"
FT                   /note="COG: COG0513; Pfam: PF00270,PF00271; InterPro:
FT                   IPR014001"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10158"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66477"
FT                   /db_xref="GOA:D6ZIC8"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIC8"
FT                   /protein_id="ADI66477.1"
FT                   /translation="METAETDEETAADITGINDLEANQDKTFADFDVEPEIVAALRDQG
FT                   IIHPFPIQALTLPVALNRQDIIGQAKTGTGKTLGFAIPILHDIIGPGDEGWDEIPDSGF
FT                   PQALVILPTRELAKQVAAEIRAAATHRVARIIEIYGGVGFDSQIEALRKGVEVVVGTPG
FT                   RLIDLMNQGTLKLGRIRTLVMDEADEMLDMGFLPDVEKLISQIPPHRHTMLFSATMPGP
FT                   VVALARRYMYQPTHIRATDPTDSSQTVRQVKQVVYRVHSLNKTEVIARILQARNRGLTI
FT                   IFTRTKRTCQRLSDELAERGFATGAIHGDLGQNARERALRAFRHGKVDVLVATDVAARG
FT                   IDVDDVTHVINYECPEDDKTYIHRIGRTARAGNKGSAITFIDWEDLTRWRVINRTLDLD
FT                   FADPQETYHTSPHLYSDLDIPTDATAYLPRFRRVRAGLEAEELEDLGGRDPARPGKRHA
FT                   GKGSGAGRRKSEKGRGTRKNTKKKHDFKEREKTTKRGATEEPAKKERQRKRTRRHKSDK
FT                   TGKGKGAH"
FT   gene            187866..188372
FT                   /locus_tag="HMPREF0573_10159"
FT   CDS_pept        187866..188372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10159"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66478"
FT                   /db_xref="GOA:D6ZIC9"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIC9"
FT                   /protein_id="ADI66478.1"
FT                   /translation="MIDHLTPYEGVVFGALIALGLLSMLSAEENTQMVGACLLAAGFWG
FT                   GVIALVRALLHREPGGLYVISFVAALIAGLMKFFVFSDLGEDGGNRVIWTFVIGIGIAG
FT                   LVGTALNALIRQPPEDPEAAAKQAAPDLEDSAGVAPFPEMDEDTGEPAAETDEATPEDS
FT                   APNLP"
FT   gene            188488..190002
FT                   /locus_tag="HMPREF0573_10160"
FT   CDS_pept        188488..190002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10160"
FT                   /product="aminopeptidase P domain protein"
FT                   /EC_number="3.4.-.-"
FT                   /note="COG: COG0006; Pfam: PF05195,PF00557; InterPro:
FT                   IPR000994"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10160"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66479"
FT                   /db_xref="GOA:D6ZID0"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZID0"
FT                   /protein_id="ADI66479.1"
FT                   /translation="MSEQKDTRGKNRSRQPQSKEFKKFIGENWGPRPTDGYERSAAAPY
FT                   ALRRRVTLGEKFKGVRLVIPAGALVVRNNDCDYRFRPHSAFSHLTGLGTDLIPDGVLVL
FT                   NPVRDGEVGEGEGTHVATVFFRPRASRASEEFYADSRYGELWVGVRPSLEEFERMCGIP
FT                   CAHLETLPDVLAKDAGQVQIAMISTSDSQATALVNQVREQAGIDPDDAKQLDDSLEEAT
FT                   SELRLIKDDWEIEEMRKAVAATKEGFEEAIRSFPRAVKHFRGERVVEGAFGARAREVGN
FT                   GLGYDTIAASGEHAATLHWINNDGVVREGDLILIDAGVELDSLYTADITRTLPINGRFN
FT                   EVQRRVYQAVLDAADAAFEQANQPGCIFSDVHSAAMRVIAQRLDEWGLLPVSWEESLQE
FT                   DGQYHRRWMVHGTSHHLGIDVHDCAQARREMYNGARLEPGMIFTIEPGLYFRKDDLAVP
FT                   PEYRGISVRIEDDILVGPGGKCERISQNIPRTVADVEAWIARVQAE"
FT   gene            190106..190984
FT                   /locus_tag="HMPREF0573_10161"
FT   CDS_pept        190106..190984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10161"
FT                   /product="PHP domain protein"
FT                   /EC_number="3.1.3.-"
FT                   /note="COG: COG0613; Pfam: PF02811; InterPro: IPR004013"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10161"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66480"
FT                   /db_xref="GOA:D6ZID1"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZID1"
FT                   /protein_id="ADI66480.1"
FT                   /translation="MALKIDPHVHSALSDGTDSPRDLLEKARAAGLDVIGAVDHDTFDH
FT                   WEPFRVAHAALMSTRVRPPAIILGTEISTSVELCPVHLLNYLPDPHRSNVREILKTAHR
FT                   DRRERMQRMVAKISQDYPLTWSDVEAEITGLTPGRPHIGDALVRKGYFQTRSEAFEKVL
FT                   NPGSPYYVTRPVVDSFAVVEAICADGGVPVLAHPFSVTRSKRKLDPATVRKLAQIGLRG
FT                   IEVNHREHDASARQLAAELAQELDLFVSGASDYHGAGKPNQLGENTMPAASLRQILAMG
FT                   ASPLLGELPLS"
FT   gene            complement(190981..192891)
FT                   /locus_tag="HMPREF0573_10162"
FT   CDS_pept        complement(190981..192891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10162"
FT                   /product="acyltransferase"
FT                   /note="Pfam: PF01757; InterPro: IPR002656"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10162"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66481"
FT                   /db_xref="GOA:D6ZID2"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZID2"
FT                   /protein_id="ADI66481.1"
FT                   /translation="MPRYQLRGLDGIRALAALAVLVYHVAPNWLPGGFLGVDVFFVLSG
FT                   FLITALLTREKRLTGRINLAAFWLRRFRRLVPAVTLTVLVTVPLAAVVNRDFLVGIWYQ
FT                   VLGALTYTYNWVNVAFGGSYFDRTNPQFLSNMWTLAVEQQFYLAWPLILLLIFLIPTRH
FT                   RWLVPALLALASASEMAVLKAGGGNLTRIYEGTDTHAFGLMLGATLALLFPLALENTPH
FT                   YLDRSTVQLRGLAAWIGMVGVFVSFLMLRDNDPFTYPWGVLAVSVLTIGIMQVCLEEVA
FT                   GVSGPGQILVELLSWRPLQWLGVRSYSLYLWHWPVFMLVNSLWRGLPQWAALVVIAAVS
FT                   ILAASLSYKYVENPMRRNGLLATWKRWFAPRLSQGENPADSSQSQVAWWRRSLVWTAAV
FT                   VAVLPLVISIAIAPEKTAAEQLVAAGEHFIHKGKQVDSSPRKTGATPQSPGHASPKKST
FT                   ASTKTSENVVPITGDQVDIIGDSVTLAAAPKLAEALPGANIDAAVSRSSVTGVGIMRTL
FT                   QAQGTLRPYVVFSLATNSTFRVRDGEALLAEFPQTKFVFVTGHGRASQEWITISNQTMY
FT                   ALAGAHPDRVKVASWDSAIAGHVDLLASDEVHPGPAGQDIYAATVRDALQQFATKSGRD
FT                   S"
FT   gene            193216..194352
FT                   /locus_tag="HMPREF0573_10163"
FT   CDS_pept        193216..194352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10163"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0489; Pfam: PF01883; InterPro: IPR002744"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10163"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66482"
FT                   /db_xref="GOA:D6ZID3"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZID3"
FT                   /protein_id="ADI66482.1"
FT                   /translation="MTLPTTDELMKALEKVIDPEIRRSITDLDMVQELKIDESGHVFAR
FT                   IALTIAGCPLQAQIEQDAKARLAEVPGVTSVEVEMGVMSREELDRVKEKLQGARPVIPF
FT                   TQPDSLTRVYAITSGKGGVGKSSVTANLAAAMADSGLKVAVLDCDIYGFSIPRMLGLED
FT                   VAPTPVGDMMMPPTAHGVKVISMGMFVPDGQPVVWRGPMLHRALEQFLSETFWGDLDVL
FT                   LLDLPPGTGDVAISVAQLLPNSEIVVVTTPQLAAAEVAERAGSIASGTNQKVVGVIENM
FT                   SYLTGPDGSRIEVFGSGGGEQVASRLSQILGYEVPLLAQIPLEVAYREASDSGEPLAIS
FT                   EAAKNGESVAGTALRSAATTLSQRARSLKGHRLNVTVK"
FT   gene            complement(194421..195080)
FT                   /locus_tag="HMPREF0573_10164"
FT   CDS_pept        complement(194421..195080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10164"
FT                   /product="O-methyltransferase"
FT                   /note="COG: COG4122; Pfam: PF01596; InterPro: IPR002935"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10164"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66483"
FT                   /db_xref="GOA:D6ZID4"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZID4"
FT                   /protein_id="ADI66483.1"
FT                   /translation="MPRFNESKISIDKTSSWSYAEEFLPESEIIAIARDQGRELGSVPV
FT                   SPGVGAALRMLAGASGARSVLEIGTGTGVSSLWTLAGMPADGVLTTIDFDSKLHAVAKE
FT                   ILAAAGISLTRVRMITGRALQVLTRLSRGAYDMAVVDGDPGETQAYIDLLSPALRPGGL
FT                   LILVHAMWNDSVADPARREPDTVAMREVLRHIQESPEWTENLLPVGDGLLVAIKNR"
FT   gene            complement(195080..195247)
FT                   /locus_tag="HMPREF0573_10165"
FT   CDS_pept        complement(195080..195247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10165"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66484"
FT                   /db_xref="InterPro:IPR021465"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZID5"
FT                   /protein_id="ADI66484.1"
FT                   /translation="MAAMKPRTGDGPLEVTKEPRCNVMRIPADGGGRLVIELNDEEVAT
FT                   LAKELEKFLK"
FT   gene            complement(195361..196080)
FT                   /locus_tag="HMPREF0573_10166"
FT   CDS_pept        complement(195361..196080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10166"
FT                   /product="TIGR00730 family protein"
FT                   /note="COG: COG1611; Pfam: PF03641; InterPro: IPR005269"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10166"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66485"
FT                   /db_xref="GOA:D6ZID6"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZID6"
FT                   /protein_id="ADI66485.1"
FT                   /translation="MKTSYSRRARSRLHRELADQALLRSKVDPKWTEEDPWRVLRIMGE
FT                   FVDGFESLAEVGKAITVFGSARVEPGTEYYQLGEEIGKVFAEAGFSIITGGGPGLMEAV
FT                   SKGAHTHDGSTIGLGIELPHEQGINQYVDLGVEFRYFFVRKTMFVKYAQAFVALPGGFG
FT                   TLDELFECVTLRQTSKIQQYPIVLVGHDFWDGLLGWVRQHLVAEGMVSPDEVDIIQVVE
FT                   TAAEALAAIENTLPKTR"
FT   gene            complement(196164..197240)
FT                   /locus_tag="HMPREF0573_10167"
FT   CDS_pept        complement(196164..197240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10167"
FT                   /product="nucleotidyl transferase"
FT                   /note="COG: COG0836; Pfam: PF00483; InterPro: IPR005835"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10167"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66486"
FT                   /db_xref="GOA:D6ZID7"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZID7"
FT                   /protein_id="ADI66486.1"
FT                   /translation="MEIHAIVPAGGYGRRLWPWSTAAKPKFLLNINGTQSLVQQTATRL
FT                   APICQSLTFVTGAPHRETLVAQVTALGLPVPVRCVAEPSPRDSMAAIALGAALLEHRYG
FT                   TCVVGSFAADHLITNTVAFSEALAQAVPAAAAGWLTTIGIAPTEPATGFGYIEVGPALD
FT                   GALSGVHRAQSFTEKPDESTASAWLATGNYLWNAGMFVVRSDMLLDVLEARVPGSGTAV
FT                   RKLAAAWETLSPDAKTALWERVVAAPIDTVLAEPLAQEGRVAVVPARPDLGWSDVGDWE
FT                   AVRHVVSNASELANLSPQIPVYTDAAPAALVRAENLKGVAIIGIPGAVVVESAGQLLVT
FT                   TQEFAQNVKVASNAADKW"
FT   gene            197268..197885
FT                   /locus_tag="HMPREF0573_10168"
FT   CDS_pept        197268..197885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10168"
FT                   /product="2',5' RNA ligase family protein"
FT                   /note="Pfam: PF02834"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10168"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66487"
FT                   /db_xref="GOA:D6ZID8"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZID8"
FT                   /protein_id="ADI66487.1"
FT                   /translation="MSFSVEQSRLYPVYLPPRKEGQVYLGMIIPVPEPYAGELQKVTKT
FT                   DGVPPHITILEPRAVDREQVPEIQAQAAEICRAFSPFVISFGNIGDFRPVSPVVYIEVQ
FT                   RGHEACKELAKRLRFGPLDTESRFPYYPHITLGTNVTDEDLDRVAALSKRSHGFFMVDG
FT                   IDCSLLEPNHVEQLAILQLGSGVPESVTGELPEIFAHPQLHP"
FT   gene            197964..199070
FT                   /locus_tag="HMPREF0573_10169"
FT   CDS_pept        197964..199070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10169"
FT                   /product="ribonuclease BN-like family protein"
FT                   /note="Pfam: PF03631"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10169"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66488"
FT                   /db_xref="GOA:D6ZID9"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZID9"
FT                   /protein_id="ADI66488.1"
FT                   /translation="MKAVMKRLNTTRFMRAYLRYQNASANLLAGGISYTALFSMAGIVT
FT                   LIIMTAQVMIFAFPLTRDTIFRDVNQWIPGAIQVDGQPGLIDPAAIASPSFTWGTLVVL
FT                   VVSIMAGIRVVAALRVSIQTVFGLPQRPGAGWKNTLRDVCMFLVLFLGGILASVLGSGS
FT                   VVVVQTLQRRLPLALPAPSGLINAGAFLLTGALTTLILAFTLRYLALVRAPRRDLWIGT
FT                   GTLGFLSTALQMSGVYLAGSVPPAYAPFTLILTIVLWVNVLCRLFLYMSCWIANPPAAP
FT                   APERDFPQFSERPNFVTVSAPTSLFWPHDPLSGRIWSLAQEEAAWRLSQQVIWSHQDQP
FT                   HHFATAAEKHLSGRPVAPSMMSQKLNRR"
FT   gene            199074..199958
FT                   /locus_tag="HMPREF0573_10170"
FT   CDS_pept        199074..199958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10170"
FT                   /product="putative exodeoxyribonuclease III"
FT                   /note="COG: COG0708; Pfam: PF03372; InterPro: IPR004808"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10170"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66489"
FT                   /db_xref="GOA:D6ZIE0"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIE0"
FT                   /protein_id="ADI66489.1"
FT                   /translation="MKVTTVNVNGVRAAFRKGFGDWLENDDSDLLCLQEVRATPQDTQD
FT                   LFGPAWDVHVWSCRVKGRAGVALGARRDSDWEIGQLTEGLPPDLYAEVGGEPDVDSGRW
FT                   LEAAIHGPQGTTFTLVSAYLHSGELRTEKQKQKIAYLHRVGERVQQLSARAMAGVGSDT
FT                   PQEALICGDFNIVRTARDIKNWKSNHNKTSGVMDEEIAFLDAWMADTLSGSKGLPCVDV
FT                   GRALVGDTDGPYTWWSWRGKAYDNNAGWRLDYHMATPGLAGQAQSAAVYRAPAYDARFT
FT                   DHAPVTVTYDFPA"
FT   gene            200110..201567
FT                   /locus_tag="HMPREF0573_10171"
FT   CDS_pept        200110..201567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10171"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10171"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66490"
FT                   /db_xref="GOA:D6ZIE1"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIE1"
FT                   /protein_id="ADI66490.1"
FT                   /translation="MLKMKIFQCDSRLLTRFSNRALVIGSSATLTLGLGMVGIAPAAFA
FT                   TETTIPPTDEISSQQSDAAPTSVPDPTPSVTATPVAPTTETPATPAPAEPSDPAFTVKD
FT                   VADSEIPQLEYGDFGSKSMYGDALGKLSVDKDYTTQHDDTLKVDSGDTLDIKSNLDVTV
FT                   GLQALEDWQEKVKRVKVENLTYGEADSNFQTIILVPEYLEMPSDPQSYKLEPQGGDKPL
FT                   YRIVSVLRSEKRLAITLALNEFYKTGDSKKGAYSRLKDGFKVYANKPLGLVISGVKVKD
FT                   HVASENQATLEFRTTGYLSIGGFSSTNRREKARYFGGFMGGLSRSWYTLQGQEEGNLIG
FT                   NGTDSTRPQSQGISLTMDIKPKPAPPNPVNPNSPVTPDTPSVDPDPIPGGAVVPPNEPE
FT                   PPVAGVVATPTEPQPPVAGVVATPTEPQPPVAGVFTPAAPQPPAVQSPHKALATTGSSA
FT                   GTLAGGAMIVFLAGGALMVVSRRRARR"
FT   gene            complement(201637..202542)
FT                   /gene="folD"
FT                   /locus_tag="HMPREF0573_10172"
FT   CDS_pept        complement(201637..202542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /locus_tag="HMPREF0573_10172"
FT                   /product="tetrahydrofolate dehydrogenase/cyclohydrolase,
FT                   NAD(P)-binding domain protein"
FT                   /note="COG: COG0190; Pfam: PF00763,PF02882; InterPro:
FT                   IPR000672"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10172"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66491"
FT                   /db_xref="GOA:D6ZIE2"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIE2"
FT                   /protein_id="ADI66491.1"
FT                   /translation="MRAPWEGPAQVLDGKATAAAIKAELQTRVAAVRERGVIPGLGTIL
FT                   VGEDPGSVTYVAGKHRDCAEVGIESIRIDLPATASPDEVMAAVERLNQDPACTGYIVQL
FT                   PLPQGMDTNQILEAIDPEKDADGLHPMNLGRLVLRVSEPITSPLPCTPRAVIELGRRFG
FT                   LDFNGKDVCVVGRGTTVGRSIGLLLGRKDVNATVTSCHTGTQDLATKCRQADVIVAASG
FT                   VAGIITADMVKPGAAVFDVGVSRVLDPDTGKSRLYGDVADGVDRVAAWLTPNPGGVGPM
FT                   TRALLLVNVVEAAERAAGLA"
FT   gene            complement(202539..203834)
FT                   /gene="glyA"
FT                   /locus_tag="HMPREF0573_10173"
FT   CDS_pept        complement(202539..203834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyA"
FT                   /locus_tag="HMPREF0573_10173"
FT                   /product="glycine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="COG: COG0112; Pfam: PF00464; InterPro: IPR001085"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10173"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66492"
FT                   /db_xref="GOA:D6ZIE3"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIE3"
FT                   /protein_id="ADI66492.1"
FT                   /translation="MTEVMNQPLSEVDPEIQAVLDAELIRQRDTLEMIASENFVPRAVL
FT                   QCQGSVLTNKYAEGYPGKRYYGGCENVDVAENLAIERAKKLFGADFANVQPHSGAQANA
FT                   AVLSALIKPGAKIMGLSLAHGGHLTHGMKINFSGRLYQVAAYGVEPDSKRIDMDRVREL
FT                   ALAERPDVIISGWSAYPRHLDFAAFRAIADEVGAYLWTDMAHFAGLVAAGLHPSPVPYA
FT                   DVVSTTIHKTIGGPRSGLILSRDGEKFGKKINSSVFPGQQGGPLMHVVAAKAVALKIAG
FT                   TPEFKERMQRVIQGAQILAERLMAPDCQAAGIDLLTGGTDVHLVLVDLVNSNLDGQQAE
FT                   NLLHAAGITVNRNAVPFDPRPPAVTSGLRIGTPALATRGFGEVEFREVADIIASVLVDG
FT                   AENGVQSVDASKYRARVSKLTEAFPLYPGLVQ"
FT   gene            204127..204651
FT                   /locus_tag="HMPREF0573_10174"
FT   CDS_pept        204127..204651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10174"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10174"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66493"
FT                   /db_xref="GOA:D6ZIE4"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIE4"
FT                   /protein_id="ADI66493.1"
FT                   /translation="MLLPAQVIPPDKWSAMQNLVYCLIVVGTIVLTLGVVWVIRHFHGD
FT                   PVISVAAPHQDEIKLIYEETLSAADRVVVRDNQVIEAVRYIPKDPNLVAPLQRWRDARR
FT                   EWAGEMAFLESLGKNPTPETFTDASNAETLRRLHGLAQELEASQRGLLRAIRQSIATGT
FT                   ENLPLGTDASS"
FT   gene            complement(204664..205773)
FT                   /locus_tag="HMPREF0573_10175"
FT   CDS_pept        complement(204664..205773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10175"
FT                   /product="putative Tat-translocated enzyme"
FT                   /note="COG: COG2837; Pfam: PF04261; InterPro: IPR006314"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10175"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66494"
FT                   /db_xref="GOA:D6ZIE5"
FT                   /db_xref="InterPro:IPR006314"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIE5"
FT                   /protein_id="ADI66494.1"
FT                   /translation="MSETALQKATIPFDGRVQSGVEQPPQAHLEMLGMNLEPSLDQAAF
FT                   IEMLKDLTATARELTQGNPIPNFLAPEMVAVTANLTITCGFGERIFDFLGKPELKPEGL
FT                   HDIPAFKLDQLQERWGQTDLVFQICCDDPGTLFAAGRLLLVKCQGKATLQWMQKGFTYA
FT                   YGSAPRGTTPRNPFGQVDGTVNPSTAEDFSEQVWLDGTGEQAYLDGSTIMVLRRIQNFL
FT                   NPWELLDRPARERVIGRKLSDGGPLSGGGEFDEEDMDAVDESGNFVINRRSHLALSREH
FT                   EDDGSDKLRRRAFAYDDAPEPGQSDLTNTGLVWISFQRNPDRQFTAIQKRLDMHDLLNK
FT                   FISHIGSAVYWIVPGTSTETYWGQALLEK"
FT   gene            complement(205979..207169)
FT                   /gene="ispG"
FT                   /locus_tag="HMPREF0573_10176"
FT   CDS_pept        complement(205979..207169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispG"
FT                   /locus_tag="HMPREF0573_10176"
FT                   /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
FT                   synthase"
FT                   /EC_number="1.17.7.1"
FT                   /note="COG: COG0821; Pfam: PF04551; InterPro: IPR004588"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10176"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66495"
FT                   /db_xref="GOA:D6ZIE6"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIE6"
FT                   /protein_id="ADI66495.1"
FT                   /translation="MSRKGGIIEDVSEVNLGMPTKSLSAAEPLAPRHKTRKIQVGSVAV
FT                   GGDAPVSVQSMTTTLTSDVAATLQQIAELTAAGCDIIRVACPSADDAAALPEICKRSTI
FT                   PVVADIHFQPKYVFQAIEAGCGAVRVNPGNIRSFDDQVREIARAATDHGTALRIGVNAG
FT                   SLDKRLYEKFGGATAEALAESAMWEASLFEDVDFHDFAISVKHHNPVTMIRAYRLLAQH
FT                   GDWPLHLGVTEAGPTFQGTIKSATAFGALLSEGIGDTIRVSLSAPPVEEVKVGLEILRS
FT                   MGLRKRNFEIVSCPSCGRSQVDVCTLANEVTAGLKDITYPLRVAVMGCIVNGPGEAREA
FT                   DLGVASGNGKGQIFIKGKVIKTVPEAEIVPTLIAEANRLGQELGLETGEPQVSVAG"
FT   gene            complement(207257..208285)
FT                   /locus_tag="HMPREF0573_10177"
FT   CDS_pept        complement(207257..208285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10177"
FT                   /product="Formamidopyrimidine-DNA glycosylase H2TH domain
FT                   protein"
FT                   /note="COG: COG0266; Pfam: PF01149,PF06831; InterPro:
FT                   IPR012319"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10177"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66496"
FT                   /db_xref="GOA:D6ZIE7"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIE7"
FT                   /protein_id="ADI66496.1"
FT                   /translation="MPEGHAIHRLAAQFAQVMSGEVVAASSPQGRFTAGAAVLNGQRLT
FT                   DVQAYGKHLFLGFAPRQVDTAQTTPDSKSPPTWLHIHLGIYGSWRFYGDSEFTSRHVGT
FT                   ALNLPESTQQTAEIVEIPVHTHHDDSAFAPHEHFADRWFWTPAPFTAPPPYGTVRLRLV
FT                   TAHGAADLSGPNTCELLDVEGVAAVFARLGPDPLRPDCDFSEFVKRCATRQKGIGEALM
FT                   DQSVIAGVGNIYRAEVLYAARLNPFTPAREVTSRKLRRIWDWLKEYLPLGVESGRITTA
FT                   SPDDYAVFVERELAAGREPQAIDSRYYVYQRQDRPCLRCSATVKLRIAGGRKLYWCPRC
FT                   QR"
FT   gene            complement(208278..209480)
FT                   /locus_tag="HMPREF0573_10178"
FT   CDS_pept        complement(208278..209480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10178"
FT                   /product="amidohydrolase family protein"
FT                   /note="Pfam: PF01979"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10178"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66497"
FT                   /db_xref="GOA:D6ZIE8"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIE8"
FT                   /protein_id="ADI66497.1"
FT                   /translation="MTPPGATNSENLHFTGDFLWSETPSMEGEYTGQATTVSCESRWIH
FT                   GELYIHDGIVSRTVKPGLTYRKVSGYAIPGLVDVHCHVGVTHAGSVSVETQREQAELAL
FT                   RRGTLLIRDCGVPADTRWIDQVAELPKIIRCGQHLARPKRYMRYYGLELESEADLPAAV
FT                   AQQAKRGDGWVKIVGDWIDRSDGADSDLQPLWSTAVLRDAVAAAHQNGARVTVHTFAHR
FT                   TIEGLLDAGVDCIEHGTGMDSDEILEAQRRGIRVTPTMLQIARFADFAAQAGTKYPVYA
FT                   ATMTALDQSRVAHQAALYAAGIQLLPGTDAGGYQRHDALPQELRQWLELGISAPEIIDL
FT                   ATWKARDFLGAPSLWEGAPADLVWYDSDPRADLSILERPAGVVLRGVLVAGEITKAACR
FT                   A"
FT   gene            complement(209480..211153)
FT                   /gene="ffh"
FT                   /locus_tag="HMPREF0573_10179"
FT   CDS_pept        complement(209480..211153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ffh"
FT                   /locus_tag="HMPREF0573_10179"
FT                   /product="signal recognition particle protein"
FT                   /note="COG: COG0541; Pfam: PF02881,PF00448,PF02978;
FT                   InterPro: IPR004780"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10179"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66498"
FT                   /db_xref="GOA:D6ZIE9"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIE9"
FT                   /protein_id="ADI66498.1"
FT                   /translation="MFNNLQDRLTESFKNLRKKGKLKDSDVDATVSDIRRALIEADVAL
FT                   EVVKDFTATVKEKAYGAARSEALNPAQQIVKIVNDELINILGGEDRELHFSKPGKGPTV
FT                   FMLAGLQGAGKTTLAGKLGKWLAKENRKVLLVAADLQRPNAVNQLQIVGEQAGVTVFAP
FT                   EPGNGVGDPVDVARRALALASGSGYDVMIVDTAGRLGVDEELMAQARSIRDEVQPDEVL
FT                   FVLDAMIGQDAVRTARAFQEGVDFTGVVLTKLDGDARGGAALSVRGVTGVPVLFASTGE
FT                   GLDDFERFHADRMASRILDMGDLLSLIEKAQETFDMEQAEKLAGKIQQGQLTLEDFLNQ
FT                   LQQIRKLGSMKKLLGMMPGAGKIREQLDQFDEREVDRIEAIVRSMTPAERQDVKILNGS
FT                   RRARIAAGSGTTVADVNGLVDRFQMAQKMMSGGIPGMGGGADGMGMMPGFGRMPGMGKH
FT                   SKAKQAAKSGKKTKAQRKAKSGNPAKAARQAREALEGISASSRGGTPAMPNLPGALPAG
FT                   LGGLNGTGGFGGGTQKSAPSTPALTPDDLPDDIKRMLGGL"
FT   gene            complement(211289..213079)
FT                   /gene="ftsY"
FT                   /locus_tag="HMPREF0573_10180"
FT   CDS_pept        complement(211289..213079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="HMPREF0573_10180"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="COG: COG0552; Pfam: PF02881,PF00448; InterPro:
FT                   IPR004390"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10180"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66499"
FT                   /db_xref="GOA:D6ZIF0"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIF0"
FT                   /protein_id="ADI66499.1"
FT                   /translation="MESMNILSTTLNNSQGLEGYTDPLIFMIPLAIAFIVIVIVASASQ
FT                   IDSKQRKIRSEDRLLDTLERIREDSSEDGESTAEAPPLRLRQGEKELRNIIEKTIHATG
FT                   SDEDEHSDEDTEVPEVSPDALQLASDDLDDEDDLAETEDWGEEDESFDEEEAVVKPDGV
FT                   YCDPDGLCFRPLPGQSVEEARAAARAAMEAAAAALTADTAEDAGAAETETAAESAEAVS
FT                   VEPESSEVPEEPVTPEATDSSETVETPEETTEPESAAQAEPSAADNSEPREPETEPEVE
FT                   EIEKPESKTSRLHRLKERLAGKGKFGRAILNVLSNADLEESDWEAIEDELLAADLGVEP
FT                   TVELIGKLKVKQKVAGEKDATQVRRMAKRMLTDMLDRKAERRLNLEVPEDSPTQTAGIL
FT                   LVGVNGGGKTTTVGKLARLLVAERKTVVLGAADTFRAAAGEQLQTWGDRVGVPVVRAEK
FT                   DQADPASVAFDAAKAAREAGSDVVVIDTAGRLQNKVGLMDELGKIKRVAEKQVPITEVL
FT                   LVIDATTGQNALSQAKIFTEAVGVTGIVLTKLDGSAKGGVIVPLQRELGIPVKLVGLGE
FT                   GPDDLAPFVPGDFADALLDA"
FT   gene            complement(213173..216778)
FT                   /gene="smc"
FT                   /locus_tag="HMPREF0573_10181"
FT   CDS_pept        complement(213173..216778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smc"
FT                   /locus_tag="HMPREF0573_10181"
FT                   /product="chromosome segregation protein SMC"
FT                   /note="COG: COG1196; Pfam: PF02463,PF06470; InterPro:
FT                   IPR011890"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10181"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66500"
FT                   /db_xref="GOA:D6ZIF1"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIF1"
FT                   /protein_id="ADI66500.1"
FT                   /translation="MYLKSLTLKGFKSFANTVHMSLEPGVTCVVGPNGSGKSNVVDALA
FT                   WVMGEQGAKNLRGSQMSDVIFAGTKTKAPLGRAEVQLTIDNSDGALPIEYSEVTISRTM
FT                   FRAGGSEYAINGTSVRLLDIQELLSDTGMGREMHVIVGQGQLDRILSASELERRAFIEE
FT                   AAGVLKHRQRKDRALKKLENLAVNLSRVQDLTNEVAKRLGPLGKQAEAARKAARVQAEL
FT                   ADATARLIADAVAQNKEKAGSQTASKEQISAQLADLETRLQELNTKLTGTKSSFDEVSP
FT                   QLEKLTQTWAELSTLAERLESLANQARERANALKETAELTRTADTTELEKRLEKTHAEI
FT                   SEKQAAVAKAEEALTQTQTAEVQAKEREFAVRSQIEKLQRAQADRRETLERLRGAVATA
FT                   ASLAEDAVTNLNRMEEALQAATQRESACAEELSKVEAELPPGVADGTLAAREEELATAV
FT                   ATIQEKVAQLAQELGDAREEAAIWEAKREVLAKTLQPQDAAGAVAKAELSGINAALLET
FT                   ILVESGWEDAIGAVFGQWSKALLTAGVESAADALRFVRQQSAGQVHLLVADAAGTLAGA
FT                   QKPESLEKAELPAGARWARELVHARKGQSLPPVVATLLAGVAACQDLSEARDLVLTGGV
FT                   TAAVTQVGDFLSATRIVGGGDPEAGILRRATEYDEAVSQSEAAAAAADQADSELAQAKT
FT                   ELVAAQEKYDAAAAQLKAQDAAAAAAAAAVAAAKAKRGAAQAEVERAGKHLEQARAETE
FT                   KRQESLKQAQETLDASLKVQDETGDEEPDFSAELQAAIEAVSAAQTAKSDAHIAAHVAR
FT                   QELESLESRAASLQRNIAAEKAAAQAAASRALVRERRRKRSVYVMEQAESAQQLAHAAA
FT                   ARAQAQRQASTASREQLQTEMETLRAAVDDLSRQRTDLKDASMRDEVALAEVNSKLARL
FT                   LEQAQQECGLDETTLLAQYGPHNLVPVFDEAGETIEHVPFVREEQVERKAHAQTELKRI
FT                   GKVNPLALQEHEALVARHKFLADQLADLKKSRDDLMNVVAEVDRQVEEVFGKAFADVCA
FT                   AFKDIFQVLFPGGEGKLTLSNPKDLLNTGIEIEARPAGKNVKRMSLLSGGERSLAALAF
FT                   LFAIFQARPSPFYVLDEVEAALDDVNLSRLLGVFEILRENSQLIIITHHKRTMEIADAL
FT                   YGVTMKEGTTAVISQRLVKSPSEGEGPILQSTGVN"
FT   gene            complement(216877..217335)
FT                   /locus_tag="HMPREF0573_10182"
FT   CDS_pept        complement(216877..217335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10182"
FT                   /product="putative nucleoside diphosphate kinase"
FT                   /note="COG: COG0105; Pfam: PF00334; InterPro: IPR001564"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10182"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66501"
FT                   /db_xref="GOA:D6ZIF2"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIF2"
FT                   /protein_id="ADI66501.1"
FT                   /translation="MADCHIPYDPKEEHTLVIIKPDGYRRGLIGEVISRIERRGFKIVG
FT                   LQTKTATREELEEHYFEHKDKHFFESLVSYMTSGPIVLMVIEGSRVIQAFRNMMGDTNP
FT                   AVALPGTIRGDLARDWGPDAQIQNIVHGSDSVQSADREIALWFPYMID"
FT   gene            complement(217442..218071)
FT                   /gene="dhaL"
FT                   /locus_tag="HMPREF0573_10183"
FT   CDS_pept        complement(217442..218071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dhaL"
FT                   /locus_tag="HMPREF0573_10183"
FT                   /product="dihydroxyacetone kinase, L subunit"
FT                   /EC_number="2.7.-.-"
FT                   /note="COG: COG2376; Pfam: PF02734; InterPro: IPR012737"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10183"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66502"
FT                   /db_xref="GOA:D6ZIF3"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012737"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIF3"
FT                   /protein_id="ADI66502.1"
FT                   /translation="MSLDKQWVLRWMDGCARVLEQNREMLGDLDDVIGDGDHGENISRG
FT                   FSAVDQRLSGIVVESPKQALRVTANTLLAAVGGASGSLYGTAFLRAARSVSTESLDSQA
FT                   VAMLLVKAAEGIAERGGAQPGDKTMLDAWYPAATNAAAAVAKGATLEEVLRVAADAAAK
FT                   GAEDTVSMSAAKGRASLLGERSIGHKDPGATSSALILAEAAKAAAH"
FT   gene            complement(218148..219797)
FT                   /gene="folC"
FT                   /locus_tag="HMPREF0573_10184"
FT   CDS_pept        complement(218148..219797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folC"
FT                   /locus_tag="HMPREF0573_10184"
FT                   /product="bifunctional protein FolC"
FT                   /note="COG: COG0285; Pfam: PF08245,PF02875; InterPro:
FT                   IPR001645"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10184"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66503"
FT                   /db_xref="GOA:D6ZIF4"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIF4"
FT                   /protein_id="ADI66503.1"
FT                   /translation="MENKHEEAHQHHHHHAHEHHSPAVTPEDLSVDPDLIPYLFAARTP
FT                   AEPEDHNNPTGEPCDPENGDTPRKGPLDRFGTPLSPEQRELVDEMHDRQRPEATLGPST
FT                   MDDPKARAIYETLLTRRAEHQIEPSLEPVRGVLDYLGNPQELFHSVHITGTNGKTSIAR
FT                   MIEALLAELGYRTGRFTSPHLVDVCERISIDQAPLTTEQFVQAYEDIEAQLALWEHAHP
FT                   GRRLSFFEVMTVMAYALFADVPIDVAVVEVGMGGRWDATNVIDADTAVIGPISLEHEQW
FT                   LGKGLTNIAREKAGIMRPQRVAVVAKQPDEALAVIRDTAAAEDVVLRYEGEDFEVLRRV
FT                   PAVGGQVLDIRTPAAVYQDIYLPLYGEFQAENAALALTAVEAQLGGMPLHGESVERALG
FT                   TVKSPGRLEVLHSTPMIVADAGHNPGAAQALRRAIEDDFRFEHTVGIYSAMADKDIETV
FT                   LGIMEPTIAELIVTQMPGERAAKVEDLQTLAADVFGDERVYAIGSLPEAIAKAGEIDDL
FT                   QGGVPGSTGVVIFGSVVLAGMAQDVLRKDKLN"
FT   gene            219975..220475
FT                   /locus_tag="HMPREF0573_10185"
FT   CDS_pept        219975..220475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10185"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="Pfam: PF00583; InterPro: IPR000182"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10185"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66504"
FT                   /db_xref="GOA:D6ZIF5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIF5"
FT                   /protein_id="ADI66504.1"
FT                   /translation="MSKLSLEAPSTDELTATEPKSEIKIAYRPITRDDVVQMSQLHAVA
FT                   YRDAGSSAASQLNLFWDGAYGPLLTEATLGAWHEDKLVGVVIVLHQAPDEWCTADGNSD
FT                   QPYIADLFVDPEYRRQGIGSGLVINASRAVDALGLEALTLQLDISAAPEAMQLYDALGF
FT                   STR"
FT   gene            220584..222593
FT                   /locus_tag="HMPREF0573_10186"
FT   CDS_pept        220584..222593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10186"
FT                   /product="peptidase family M13"
FT                   /EC_number="3.4.24.-"
FT                   /note="COG: COG3590; Pfam: PF05649,PF01431; InterPro:
FT                   IPR000718"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10186"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66505"
FT                   /db_xref="GOA:D6ZIF6"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR042089"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIF6"
FT                   /protein_id="ADI66505.1"
FT                   /translation="MTKNPLLGMLDPADFDETIRPQDDLYRYVNGKWLARTEIPADKAS
FT                   YGSFHLLAEEAEKQVRTIIEDCVAGRITGELSGLAAKVASLYGSFMDEATVEADSTASL
FT                   QQLQAPLDHATTKAELRDLWAQTFAEGTYEGFFDTGIDIDVNDPERYVNYFGQDGLGLP
FT                   ERAYYLEEKHASLLNQYRQHIARMFTLAGYASQSAAADAAARIVNFETEIAKLHWDNVK
FT                   TRDTDATNNPMTWDELAAKLPRFDLGAWRKASGLPDKMFTEVNVSEPDFLENMDQLWDS
FT                   TDFETLKWWMLWHALNGHTSLLSSEIVNADFEFYGQKLAGKEQLRERWKRGVSLASSVM
FT                   GEALGKLYVQRHFPAEAKSAMSHLVDNLIQAYQDSIAVLDWMGPETRDKALQKMRQFTP
FT                   KIGYPDKWRNYEKLQLGDGTLMDKVHNASVFGTNFWIDKLGGPVDHTIWHMTPQTVNAY
FT                   YNPTENEIVFPAAILQPPFFDKDADAAVNYGSIGAVIGHEIGHGFDDQGAKFDGTGKVE
FT                   NWWTDQDLAEFEKRTHALIDQYNAFVPQGLPAEFHVNGALTIGENIGDLGGLDIAWKAY
FT                   LLELKQQGIADPADAPVIEGLSAAERFFLSWALSWQTKVRPEMAKQLISVDPHSPAEFR
FT                   CNGVVANLDLFADTFQTKPGDALWLEPNQRVRIW"
FT   gene            complement(222580..223314)
FT                   /locus_tag="HMPREF0573_10187"
FT   CDS_pept        complement(222580..223314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10187"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66506"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIF7"
FT                   /protein_id="ADI66506.1"
FT                   /translation="MWSGREQQGEVFALRRKTAGDFDFQISASKLRGGRRVLVGILLSA
FT                   VALTGLSACAKKDSETSTQWNSTIVTTPAPKGWINGKDGAFRVQIPSSYLDAYDAISGS
FT                   KLPDAQVVLSLASDKALNGYVPVMVIDHAKANSDPDEVQKNLKQNPIYKDYKKFTVLNP
FT                   TQVEGLNVLEMKWSYVYQEVEMTAFMTLVSGNNHAYALKQDVPDYALETYQPIIDSVLK
FT                   TWTWNDPVKGTKPKPSPAPTKS"
FT   gene            223414..225984
FT                   /gene="pepN"
FT                   /locus_tag="HMPREF0573_10188"
FT   CDS_pept        223414..225984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepN"
FT                   /locus_tag="HMPREF0573_10188"
FT                   /product="membrane alanyl aminopeptidase"
FT                   /EC_number="3.4.11.2"
FT                   /note="COG: COG0308; Pfam: PF01433; InterPro: IPR012778"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10188"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66507"
FT                   /db_xref="GOA:D6ZIF8"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR012778"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024571"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIF8"
FT                   /protein_id="ADI66507.1"
FT                   /translation="MPGTNLTRVEAEQRSEIVSDVHYRVHLDLTQGEQIFHSVTEVDFA
FT                   AQPGASTFIDLIADSVTEVILNGTALDLSNYADSRIFLPDLQERNNLRVTANCVYMHTG
FT                   EGLHRFTDPEDGKSYVYSQFEVPDSRRVYAVFEQPDIKADFTFTFVVPPEWNAFSNSPT
FT                   PEPEIAADGVRTYRFTPTEKISSYLTAVIAGPYVGETGEVTSCDGRRIPLGVYCRASMV
FT                   KHLDATDVMDITRAGFEFYETAFERPYPFRKYDQIFVPEYNAGAMENVGCVTFRDEYVF
FT                   RSRPLQTRVERRVVTILHELAHMWFGDLVTMKWWNDLWLNESFAEFVSTKATAEATQWK
FT                   DIWTTFSCSEKIWAYRQDQLPSTHPVVATINDLEDVQVNFDGITYAKGACVLSQLVTYV
FT                   GWDNFRLGIKEYFAKHEWSNATLTDLLTELEATSGKDLKAWSRKWLEEAGMTWLRPEIQ
FT                   TDDSGEITFMRIVQEHFNADATPRPQHMAVCAYNLEQHDGKTVFVPGHREEFDMEVEEY
FT                   ILPGFYGPRPDVILVNDGDMAYGKVRLDEQSLRTACEHIDAFTDSLTRSQILSILWDMV
FT                   RDGEVGASHYVDTALQALMVETHPMVVSVTLRNLDTCVESYLAAENREAVARNVSSRLR
FT                   MLSRLAKADSDTQLQLVRAAARRAQSPEDVAASAALLDGSETLTGLLVDTELRWNLLTS
FT                   LAAVGHVDRGAIEAELSNDDTVNGRERVLQATASLPDSAVKAEFFDRAYSDTTLTNDQL
FT                   ASIIAGFNRTPDPVLLAPFAQRYFEMLRETYDGRTHEIGEQLIEGMYPAALVGFESSGV
FT                   DVLALTQEWLSNNADAPAALLRMMRENQSGAERIAKAQQRDREG"
FT   gene            complement(226153..228396)
FT                   /locus_tag="HMPREF0573_10189"
FT   CDS_pept        complement(226153..228396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10189"
FT                   /product="hypothetical protein"
FT                   /note="2.7.1.69"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10189"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66508"
FT                   /db_xref="GOA:D6ZIF9"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIF9"
FT                   /protein_id="ADI66508.1"
FT                   /translation="MLRKGSASVAGKGKAADAVSDVESDRISGAQSRTGKAKQKAQNSA
FT                   AAKKSAKRPKDAKAPETAGKRQHFARFLSPGWYERFLQYLFVAILVLCASEMSLRLGQG
FT                   HILGDQGFGKLFPAILPVADIFYYVGTTVESYFPLVVAFLLAFAAAKRANAAIGLAVLG
FT                   GWAGYLGATMALSRYSAASSQGEVSAVDLGLMGGILVGFLVAGCWSEFRFRKIAPWARM
FT                   VSGIPLVVMISATGGVVLGILVGVCYQLLYLLIAVAVGTAMVSTPGPLGAAIYGLLHPF
FT                   AEVAGFSSLLNVAPFNLYGRCQTTQGDTLNGSYRCFVYGGTQMEGQQALFLAGGYPVVA
FT                   FGLAALFLVLWLQLKGSNRQYWRIMYWFLIASTFVVGADKPALYLLFFAAPGLLLVHAG
FT                   ASAFAYALTAVFGVTIGWAGGPGMLDLLRWMGTGAGILVLLILGVIYAAIYVMIAIFTV
FT                   KAKGKRLRLGGFGVSYITKPFMGIPNNSGDAKFAPVLVSQKSEAVKNSTQTGASTPVSE
FT                   DTSAVSPAPEKRTPAKATAAKPVVTKATTTKVTPAKPAAVQPTPAKPVAATPAPTKSTP
FT                   AKVSPTKPVPNQPGIVEPVATQPVAAQPVITQPEATREPRMVRTEPAIRPAPQSPQPAV
FT                   RSAEPYSEVAATPNPAYTQQGYAQNPYGYQAPSYPEGYPAYPEYGPEYNGGYNPQLYGY
FT                   QGNGYAYPTAYNSAAMPQNTPTAQNFSAPQPPPRVPVAPAETHPKANHQSRSH"
FT   gene            complement(228573..230744)
FT                   /gene="malQ"
FT                   /locus_tag="HMPREF0573_10190"
FT   CDS_pept        complement(228573..230744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malQ"
FT                   /locus_tag="HMPREF0573_10190"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /note="COG: COG1640; Pfam: PF02446; InterPro: IPR003385"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10190"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66509"
FT                   /db_xref="GOA:D6ZIG0"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIG0"
FT                   /protein_id="ADI66509.1"
FT                   /translation="MAETTHYLEGYLPQVQDLARRLGVDTDYWDFAGNYHEVSQSTLVR
FT                   VIDALGFTLQSCDDIGRAYESLDREYWFSTLPKGLVVRQSHGANIPVHVPDGTSLEVWL
FT                   ETENGDTRPLEQLDIWVPPRDFGPEGRRGEATFRLPEGTEWGYHTLHAKTVEGDFSQQV
FT                   AVVPDRLPLGNLEHSRSWGVMTQLYSVSSRGSWGMGDFHDLGHIAEIFGRQGADFVLTN
FT                   PLHAGEPNVPLTPSPYLPVSRRFLNPLYIRPDDIAEYSQLDSTSESLVKVAFAQASNEI
FT                   FPVDAVKYIDRDRSWKAKREALEVIFKVKRSPSREAEFSDFVAVRGQDLQNFALWCALY
FT                   DRFGPGPWEDDVADVSSPRVAALREELAKRVEFYCWLQWIASTQLHAAQESAKNSGMTI
FT                   GIMNDLAVGVHKCGADVWSIPDAFVRTMSVGAPPDMYNQLGQDWSQPPMNPRYMATHDW
FT                   EPLRGIIHRALADCGALRIDHVMGLLRLWWIPQGTDPNEGTYVRYNHEATVGIMLLEAA
FT                   RANAVVVGEDLGTVEDWVRDYLKDRGILGTSVLWFERNGSDFRYPDQYREMCMAAVNTH
FT                   DLPPTLGFLRAVHLEVQDSLGILPQPLEQAKDALYDDISKLVEMLRNMGLLENEYPTES
FT                   ELILALHRFIGMTPAKLSVVSLVDAVGDLRMQNQPGTNNEYPNWRIPLTDSLGRSVKVE
FT                   ELEYYVGVGEICEAMRELVNPQHPENTEN"
FT   gene            complement(230911..232593)
FT                   /locus_tag="HMPREF0573_10191"
FT   CDS_pept        complement(230911..232593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10191"
FT                   /product="ATP-binding cassette protein, ChvD family"
FT                   /note="COG: COG0488; Pfam: PF00005; InterPro: IPR003439"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10191"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66510"
FT                   /db_xref="GOA:D6ZIG1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIG1"
FT                   /protein_id="ADI66510.1"
FT                   /translation="MSEYIYSMLKARKKVGDKLILDDVTMAFLPGAKIGMVGPNGAGKS
FT                   TILKIMAGLDEPSNGEAILSPGYTVGILLQEPPLNEEKDVLGNVEEGVWEIKSKLDRYN
FT                   EISAQMADPDADFDALMEEMGQLQEAIDAADAWDLDSQLEQAMDALRCPPADADVKTLS
FT                   GGERRRVALCKLLLEAPDLLLLDEPTNHLDAESVLWLEQHLSQYKGAVIAVTHDRYFLD
FT                   HVAGWIAEVDRGHLYPYEGNYSTYLEKKQERLEVQGRKDAKLQKRLKEELEWVRQSAKG
FT                   RQAKSKARLQAYEAMAAEAEKSRKLDFEEIQIPPGPRLGTLVLEATNLKKGFGDRTLID
FT                   GLSFSLPRNGIVGVIGPNGVGKTTLFKTIVGLEPLDGGDLKIGETVKISYVDQTRAGID
FT                   PEKTLWEVVSDGADYIEVGKVQMPSRAYVSAFGFKGADQQKPAGVLSGGERNRLNLALT
FT                   LKEGGNLLLLDEPTNDLDVETLGSLENALLQFPGCAVVVTHDRWFLDRVATHILAYEGT
FT                   EEDPAKWFWFEGNFEGYEANKIQRLGPEAARPHRVVYRKLTRG"
FT   gene            complement(232704..233285)
FT                   /locus_tag="HMPREF0573_10192"
FT   CDS_pept        complement(232704..233285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10192"
FT                   /product="single-strand binding family protein"
FT                   /note="Pfam: PF00436; InterPro: IPR012340"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10192"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66511"
FT                   /db_xref="GOA:D6ZIG2"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIG2"
FT                   /protein_id="ADI66511.1"
FT                   /translation="MSSMTVTVSGYLGNTPFLRKTSAGTHWVRFSLACNASYRDVNGNW
FT                   TSGETTWFNCKAWGTFAVNIAESLHKGDPVVAQGRLVPGTYEHADKTTGVVEKRPELAL
FT                   HLTHIGVDLVRTPSINIKYAKETSAEENSAKSSKFDISADSLNTVRDTGFAQTESDLVE
FT                   SADILDELDVEMEAADEESLISVGADAVPF"
FT   gene            233489..233564
FT                   /locus_tag="HMPREF0573_t10003"
FT   tRNA            233489..233564
FT                   /locus_tag="HMPREF0573_t10003"
FT                   /product="tRNA-Arg"
FT   gene            233640..234851
FT                   /locus_tag="HMPREF0573_10193"
FT   CDS_pept        233640..234851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10193"
FT                   /product="ROK family protein"
FT                   /note="COG: COG1940; Pfam: PF00480; InterPro: IPR000600"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10193"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66512"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIG3"
FT                   /protein_id="ADI66512.1"
FT                   /translation="MGFVTMENLLGPGSPSSLRVANQKRVLSAIIDAGGISQAEISRRT
FT                   GLAPATVSNIVRELTEAEILRLAEAASGRRGNTIAFAPEIGYAMGVSLEREQVRVGIVT
FT                   LDHEIVDTQVIPLPPEANATINKEMSVALFDSMMAAKGLENAQIVAGCIVVADAVRSDG
FT                   RMSNYTSMIPGLNGINLEDIAQEVSPFPILTENDANAGALAEHMWGVAKDVDDFVYVEA
FT                   SSGIGAGIMAGGKILYGTGGISGEIGHFPIPSHHELCKCGGSGCLEMIASVSAIMASLR
FT                   SLEIPVHTLRDLYRLIEEGDVRVTRRIQEAGRAIGYVLAQVCNILNPKMIVIGGELSFA
FT                   GESFLNQIRETINQFALPDCAADTTLRLSALGSSAPLRGAMAKAVSMVDLDVILQRFLA
FT                   DESN"
FT   gene            234899..235537
FT                   /locus_tag="HMPREF0573_10194"
FT   CDS_pept        234899..235537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10194"
FT                   /product="exonuclease"
FT                   /note="COG: COG1949; Pfam: PF00929; InterPro: IPR006055"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10194"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66513"
FT                   /db_xref="GOA:D6ZIG4"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIG4"
FT                   /protein_id="ADI66513.1"
FT                   /translation="MGDEYRMGNKKTDPMVWIDCEMTGLDLHVDELIEVAVIVTDAELN
FT                   PLDSGIDLLIKPSATAMNHMGEFVREMHTKSGLLAKLDTGLSVEEAGRQVLDYVKRLVP
FT                   EPGKAQLAGNSVHSDKAFLAKQMPELINWLHYRIIDVSTLKELAMRWYPKVYGLAPEKT
FT                   GNHRALGDIIDSLNELRYYRSVLLPAGEGPSTEELQSAAAHILQTSPFK"
FT   gene            235669..235743
FT                   /locus_tag="HMPREF0573_t10004"
FT   tRNA            235669..235743
FT                   /locus_tag="HMPREF0573_t10004"
FT                   /product="tRNA-His"
FT   gene            236480..237412
FT                   /locus_tag="HMPREF0573_10195"
FT   CDS_pept        236480..237412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10195"
FT                   /product="hydrolase, alpha/beta hydrolase fold family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10195"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66514"
FT                   /db_xref="GOA:D6ZIG5"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIG5"
FT                   /protein_id="ADI66514.1"
FT                   /translation="MLHEITFPSFNERDTVYGWIYVPAAQPKGIVQLVHGFGEHSRRYL
FT                   HLIVNLLEAGYIVAADDHVGHGKTAVENDRWGDWGDKGPHTMMEDEHRLSVLVKEKYPN
FT                   LPLFFFGHSMGSMIGRDYMVKYGNELAGITLCGVTGRFPETDAVIARLQELVAAGEGEN
FT                   SDPGIIQQFFGFSFARIPEGVKIGNEWICEDPYVQKDHAEDPFDAFTKPTSNRSMLDFA
FT                   QMLKQVEGPQWAEAVPQDLPVYLIAGSEDPIGMFGTGFMEVVNWLEDTGHQTQAQLYFG
FT                   YRHEIHNYTDIKDEVAWGIIDFFDDIVAA"
FT   gene            237608..237805
FT                   /locus_tag="HMPREF0573_10196"
FT   CDS_pept        237608..237805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10196"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10196"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66515"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIG6"
FT                   /protein_id="ADI66515.1"
FT                   /translation="MINVPRRLITLVAAFILGCSLGTSSTFADGFKGETGLTTATTAKN
FT                   VTSTQNSIVLLNNNGKYEEL"
FT   gene            237808..239238
FT                   /locus_tag="HMPREF0573_10197"
FT   CDS_pept        237808..239238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10197"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66516"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIG7"
FT                   /protein_id="ADI66516.1"
FT                   /translation="MSEIFIGSNNPSIYTQQISHTRIDSTSESNLSNSRLRAILGDVID
FT                   INSEAHFIADAFSNLSKIDTILHRSKDSLTELVTDYNHRRDLILKACSANEAYKANEHK
FT                   LLEALDSEFRERISSYADDCVGLINNVATKAASSDASLVAMDWISGYKGSEGLFLRDSE
FT                   AHGIKTDIISFFTQALSDSKGNIPTENNQRSDYHGQYLTAADLTGSSFFHKLEVFARTV
FT                   SSKQMQQDNLRINEANERKNRPHNDVLAAKYASSDWRWATRLDIKVWQHDYQIAAARLE
FT                   DTSHLDGFSDALKRILGRFDASASVYNKYTGLDPEEGPSLGLQIEDAANTLGKTTLTQG
FT                   ADTFTKYVSRIDTIANSLSSNQKALLGVMYADAESIGNDKAFLKVDAFAKALATHNFHG
FT                   FKLGNIGTVKGVHLLNQLRWYLDDESSTGIPRPNFSNSLTLNEQMAIITNKYLPWMVQS
FT                   EPTKMKLVDSALRKLHNH"
FT   gene            239426..240499
FT                   /locus_tag="HMPREF0573_10198"
FT   CDS_pept        239426..240499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10198"
FT                   /product="bile acid transporter"
FT                   /note="COG: COG0385; Pfam: PF01758; InterPro: IPR002657"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10198"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66517"
FT                   /db_xref="GOA:D6ZIG8"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIG8"
FT                   /protein_id="ADI66517.1"
FT                   /translation="MTTQTNTRTDNQSVAPKALTPEDRSALKAVTIFPVLIIAAALWGF
FT                   FSPATAGMLTPHVAILLGVIMFGMGLTLTLPDFRLVFTRPWPILLGVVAQYVIMPALAV
FT                   LIVTVLRLPDAVAVGVILVGCAPGGTSSNVISYLAKADVALSVTMTAISTLLAPMMTPL
FT                   LTQWLAGKYMPLDAGAMAVSIVKMVLVPVVAGLVLRLAFPKFINRILPALPWISTLGIS
FT                   AVLAGVVSASVDAIKATGLLVLVAVILHNMLGYGVGYGFSKLLRADNRVSRTVSIEVGM
FT                   QNSGMAATLAKTHFAMTPEAALPGAIFSIWHNLSGALLSVIYRRMAEREAARNAETSTN
FT                   KSPQPEKEVTTAPVSVG"
FT   gene            complement(240636..240845)
FT                   /locus_tag="HMPREF0573_10199"
FT   CDS_pept        complement(240636..240845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10199"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10199"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66518"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIG9"
FT                   /protein_id="ADI66518.1"
FT                   /translation="MLMLIAKVQARHPLVVARVIHRLTAKKHHNVPNVPAAAPQLPSKG
FT                   TAHLTLTRTDGVLAANRAARIPGA"
FT   gene            complement(240850..242424)
FT                   /locus_tag="HMPREF0573_10200"
FT   CDS_pept        complement(240850..242424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10200"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="COG: COG0578; Pfam: PF01266; InterPro: IPR006076"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10200"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66519"
FT                   /db_xref="GOA:D6ZIH0"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIH0"
FT                   /protein_id="ADI66519.1"
FT                   /translation="MKFSAALNAARRRNDLDEVMNANEPVDLVIIGGGITGVGTALDAV
FT                   TRGLNTVLIEKHDLGFGTSRWSSKLAHGGLRYLAKMDLQIAHNSAVERGILMTRTAPHL
FT                   IHSLPQVTALGADTNLFQKSAMRLGFIAGDLLRISAGTSSRVLPHSHYASPKQTLALCP
FT                   AVSRDRLRGAWVNYDGQMVDDARIVSAIARTAAGYGAKILTRVEALRMSAHEVQVRDTV
FT                   RGQTGVIPARAVINATGVWAAGLDTDIHIRPSRGTHLIFSAERLGNPRGSLTVPLPGSI
FT                   SRYLFILPAPHHRVYLGLTDEDNPGPIPDVPETPDADIDFLLRNINLALEQPLSCDDVI
FT                   GTFTGLRPLIDNGGGGAAADVSRKHALIRSCEGAFSVVGGKYTEYRLMAEQCLDRVLAA
FT                   SGIRAGACRTRDLPIIGAHRHPDFRGVSRDALVGLPKPLVRRFGREAPLVAQAEIARPL
FT                   EYLDGTDVTRAEVAFALTHEGAMNVADILQRRTRLGLVKDDASRVDAEVQEIIAEIAEK
FT                   GNYDVIA"
FT   gene            complement(242421..243035)
FT                   /locus_tag="HMPREF0573_10201"
FT   CDS_pept        complement(242421..243035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10201"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="Pfam: PF00440; InterPro: IPR001647"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10201"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66520"
FT                   /db_xref="GOA:D6ZIH1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIH1"
FT                   /protein_id="ADI66520.1"
FT                   /translation="MKTPGFSSKSPQREHTPDEMAIDQAIEKAARDSLIRNGFSRTTIA
FT                   QVAREAGVSRPTVYARYHNVTQLAADTLTRELLPLAQRLQTVPQTVEELVKILVQAAHD
FT                   LQQNELLAAMIERDPQLLQTYQFQRLGRVQTRFIDLLAQILEQMSRNTELRDEDPRVLA
FT                   AIVVVSVQTAAVQQNIFRAVRDDADVWTKQLEVLLKEYLLP"
FT   gene            complement(243032..243955)
FT                   /locus_tag="HMPREF0573_10202"
FT   CDS_pept        complement(243032..243955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10202"
FT                   /product="diacylglycerol kinase"
FT                   /note="COG: COG1597; Pfam: PF00781; InterPro: IPR001206"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10202"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66521"
FT                   /db_xref="GOA:D6ZIH2"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIH2"
FT                   /protein_id="ADI66521.1"
FT                   /translation="MEKTFDRHEIRHIALLVNPAAGKGKSSAAAKLAHSAFAEAGVKVT
FT                   VLAGASPQESDELIRRSIDDRSLDALVVCGGDGLVSLALQAQAKTTVPLGIIPAGTGND
FT                   HAREYRIPLDPRHAVKVITSGYATRTDLGLMRDEEGREKYFGTIACMGFDSLSSARANT
FT                   ISFPRGATRYVVAALIEWVRFRPHNTRIYVDGQEVCSGPITTCVMGNTKSYGGGLKVCP
FT                   HANPRDGLLELSILGDLTKLGMLRHAGVYSNGTWWRLPQAQTARGKVIRIEMPAVTAYA
FT                   DGDAYFDSAIECTAVPHAGYYLVPRS"
FT   gene            complement(243958..245544)
FT                   /locus_tag="HMPREF0573_10203"
FT   CDS_pept        complement(243958..245544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10203"
FT                   /product="FAD linked oxidase, C-terminal domain protein"
FT                   /note="COG: COG0277; Pfam: PF01565,PF02913; InterPro:
FT                   IPR004113"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10203"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66522"
FT                   /db_xref="GOA:D6ZIH3"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIH3"
FT                   /protein_id="ADI66522.1"
FT                   /translation="MEHNLWGTPDESKELSASVQKLLHKLLGVGELTLHRRTTAQTELS
FT                   PIRLGDADLAELGEIVGPGYVTTDKEQRIRRARGKSYPDLVDWRMNRVIEAPDAVVAPG
FT                   TETEVWEVLKFCSREKIAVVPFGGGSSVVGGLSPKKGGMRAVISIDLRRFDQLEDVDPV
FT                   SCEATFGAGLSGPHAELLLGEYGLQIGHYPQSFPYASLGGFAATRSSGQSSAGYGRFDE
FT                   MVRSLTVVTPKGIMEVGWKAPMSAAGPDLRHVFLGSEGSFGIITKLRLQVHKIPQTKRY
FT                   EAFRFPDFAAGAAAVRAVVQEGCGPTVIRLSDEIESSLNLSNTDSMGSAATSKVGCLCL
FT                   TMFEGSENHTKSRHEETRAVLLAHGGTSLGEMPVREWEQGRFGAPVLRDGLIDNGAICE
FT                   TLETATDWSNITRLKTAVTEALTTELAKTGTISVVMCHISHVYAGGCSLYFTVVAAQKG
FT                   DDPQAQWWPVKHAASQAIIDAGGTTTHHHGVGTDHRPFLKGEIGTPAVELIRAIKHELD
FT                   PVGILNPEKLV"
FT   gene            complement(245877..248228)
FT                   /locus_tag="HMPREF0573_10204"
FT   CDS_pept        complement(245877..248228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10204"
FT                   /product="YhgE/Pip domain protein"
FT                   /note="COG: COG1511"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10204"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66523"
FT                   /db_xref="GOA:D6ZIH4"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIH4"
FT                   /protein_id="ADI66523.1"
FT                   /translation="MNKVLFIIRDDFRQIRSSVMVRIFMVLLITVPLFFTWFNVLATWD
FT                   PFSNSGRLQIAVASTDEGYTSKLLNVKVNVGDTVLKELAVNDRFDWVLTSKDQALEGAR
FT                   SGEYYAAIVLPEDFSQSMFTFYAGGAAPADITLYTNEKKNPLSANLTTQGAQGVTAQIN
FT                   TTFSRTLAEVAVGIAEDVSSYLGTADTQAALDRLSNRLESLCAQLNSGANTVSSLSTVI
FT                   GSAVPLATGAKQLAAGVQDSFDEAVGDTVGSGVNSTGGTDNPFAVVSSGLDDAVSLAAG
FT                   NISNLQNQLDNLLDSANSTTQSTAAAIEELQTLLNKQISGFQKTRDVIEQSLGSDGADL
FT                   LGKDPTVDRFLAEMDAAVARQQSLSKQLGTIAADLHRGVPLDSDLRESAHLAMSDAQQA
FT                   IDTARSHYENNLQPKIESLRENLDSAGKNEEVFRSYLEAMRADLSESSGGMIASMRRSQ
FT                   KTLADTAQKMRDGASRLDRAREQITSTRGEVDLDQIATTLGADPKSFARLISSPVAVQR
FT                   NAVFPVATFGVGMAPLFTVIALWVGALLAGVFLRTDISPNVGQRYLDSVADRKHPDTAA
FT                   SADTNAAESSRSAEPSTKSGEIRPTPAAKSVVKAAVKKPVFIGAQEYLGRYFMFWAIGM
FT                   AQSTLLMIGLIVFVEIEPAHPFLLILAGWIISTVFTNIVYTLVVALSNAGKALAVVLLV
FT                   LQISAAGGAYPLELLPQWFQNISPWLPATYAINLMRSAIAGIYAGDFAYNLVIILLFLI
FT                   PNLVLGLVLRHTIAGRIHDMTKAIEKTKVM"
FT   gene            complement(248225..251119)
FT                   /locus_tag="HMPREF0573_10205"
FT   CDS_pept        complement(248225..251119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10205"
FT                   /product="YhgE/Pip domain protein"
FT                   /note="COG: COG1511; Pfam: PF01061"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10205"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66524"
FT                   /db_xref="GOA:D6ZIH5"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIH5"
FT                   /protein_id="ADI66524.1"
FT                   /translation="MLDFAWKTARTTRIPTQGYDWGVKDSWRVFTRDVKRIIAVPRSLI
FT                   IIIGILVTPALYTWLNIAAFWNPYKATENLPIAVVNNDVGAASALTGQLNVGDLVVEQL
FT                   SENKQLGWQFTDQDTANHKIRAGEVYATFVIPQTFSKDLVDIFSGQRHQPTIEYYVNEK
FT                   KGAIAPKITDVGANELDIQITSTFRGQVGEAIAQSLRDGGLEIDANVVGAQGSALDALS
FT                   GINRDLADAQVALDSASTSLTGSLETMKKVRAALAAADPALADVSAALSNSQDILGTIV
FT                   SDASEFAVTAGQASINAQKALNESSAAAGSAVSNATSKLTEMNSQLQSGIQRANASTAK
FT                   MRDQIAVLQGYPQTQKLAAKLNSQLSDMQNLLAKVGKTGSDAANASEDLQALMKAFDQA
FT                   QTDVQRVTTGLREQSNQAASTLNARVTQLSAQLGAIKSAVGVARISLTEISALTHGVDD
FT                   QIVNMQNVLDQVQGNLNGLASTTRVAQTDVATLATALRTGTLEKVIGLDPTNIGRYLTS
FT                   PVEFDQQTLFPINSYGSGMAAMFINLSLWIGALILVIIFRVEVDKEGFGWLSLRSAYLG
FT                   RFMLSGVLSIGQGLIVSVGSLLMGVQAVNAPAFIATSMLIGPCYLAIIYALAAALSHVG
FT                   RALAILLVVLQIPGASGIYPIELMPGFFRQLSPMLPFSYGINAMRETIGGFYEGRFWHV
FT                   MAVLLIMSVTVFLLGFVGRRRLGYFTQLFYDELARTELVVNENVQLQSPGYRLSNIIAL
FT                   LGNRKEFSTRISRRQENFNARYPALINGLSSVGILGLVVLGLISRLTSASKPALLGIVA
FT                   IWGLVIIGSLVNVVALKSSIERAERLSHLTEDELFESLARQRDANATKTTTRSESLNSG
FT                   HNSSRGERHLITASEQEDDAVESVLGTAVGTLDEIGGESAGNNPEETQNETVDQSADEI
FT                   PDESQDLARNDAADQSTEKPTGETDASVTGEAAR"
FT   gene            complement(251190..252077)
FT                   /locus_tag="HMPREF0573_10206"
FT   CDS_pept        complement(251190..252077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10206"
FT                   /product="phospholipase, patatin family"
FT                   /note="COG: COG4667; Pfam: PF01734"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10206"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66525"
FT                   /db_xref="GOA:D6ZIH6"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR037483"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIH6"
FT                   /protein_id="ADI66525.1"
FT                   /translation="MQRFENNVFDTALLFEGGAMRGSYSGGAVNALLEAEVYVDYVAGI
FT                   SAGATCLVNYLARLPQRSRRCFVDVSTDPAFGGWKTAIKGKGIFDTHHMYYDMTEPGGM
FT                   LELDYERFAANPALWRVGVYNAERGENVYFCADQVDTEQKLTHVCKASGSMPIATPVTY
FT                   IAGEACMDGAIGPSGGIPLDVAQADGYEKFLVILTRPRDYVKENRLPDWIYRSLLARYP
FT                   RAAQALVDRPANYNRTRAELERLEAEGKAYVFYPEHMGVANFEDNPAKLEENFAAGYEQ
FT                   MQRELPKVKEFLGL"
FT   gene            complement(252346..254052)
FT                   /locus_tag="HMPREF0573_10207"
FT   CDS_pept        complement(252346..254052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10207"
FT                   /product="UvrD/REP helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="Pfam: PF00580; InterPro: IPR000212"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10207"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66526"
FT                   /db_xref="GOA:D6ZIH7"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIH7"
FT                   /protein_id="ADI66526.1"
FT                   /translation="MPSSTNPATQEQQEIYDYEAFDMVITSPAGCGKTEALAYRAKGLL
FT                   ERFDFSGNGRKLLIVAFTNQARDNITERLAKYISVQALKRHVTVCNFHGLASRIIKAHG
FT                   NVVGIDDTWEVASFDWTRKVVQKLNCDKETRTQVENALRTAKLTCLSDDGVMEALQAES
FT                   GQIGRLATSIEYSRRERKIVTYDDQIRTALWILQDERVARLYENHFFAALVDEFQDLTP
FT                   QQLKLVKALCGNNISYAGDLAQSIFSFAGADASFTYREISKSCGKQVKLIKSFRSAPAV
FT                   LDAVNSLSTLTDSENLSTAMPFHWGDGGLSGYSCFRSEEDEARWVVAMSQAILWHCPNQ
FT                   RVGIVTRTGFRSNAIKHILASEKIGYTDWGNGLFRPEVAKTLRNICDDMEGKSFDGTLE
FT                   IYRYIMEQAAQAQGGLPEELEEASAWLFDQILQHKNGLSVIPEIRRCIAERKGNETMAT
FT                   RVGIHCLTGHAGKGQQFDWVFIVGLEQGSIPFYKAGTKEELKEEARILSVMISRARIGF
FT                   VATSTLISPYNYSREPSKFLPYLQKNPSFLNNKDRIEEWCAAADWATIAQM"
FT   gene            complement(254042..255490)
FT                   /locus_tag="HMPREF0573_10208"
FT   CDS_pept        complement(254042..255490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10208"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66527"
FT                   /db_xref="GOA:D6ZIH8"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034139"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIH8"
FT                   /protein_id="ADI66527.1"
FT                   /translation="MQQLYYSISNSDFRDAEQPLFIEAKLTNLNSDELSFFPDEVDVQD
FT                   NSLTIRLEANLNGEDLTISRFFPYGVGNAPLSSAQLKITGWNMVPSDFSTKTLAPGRRN
FT                   IVDDYLKEIDASGDQVKLGEAIDALGSAINDSNAFTGALSSLASKLNPALEGGVTTENL
FT                   RFVPGAAIEGNLLSDVRLEMKDKSGSMREVTEQSDGTKALISFAIFGLINSNGIIAIDE
FT                   PETHLHPSAQRNLMQVLQSSDRQLIIATHSGVVASEFSPDNIAAMRESMPPAQPKSGFL
FT                   EGQEDQKMLARWWISSRIELLTARNIIAVEGQSDRMVVERVAELVGNHLKRDGIEILEA
FT                   GSCNEMPYVMDIFGANGFGKQVSILIDEDAENKTASALSIALKDLASKSVFVSRVDLED
FT                   EYVAAIGSSSLWEALGKSNLFPPNRLKCCRIARGASLPSATELATFCRRKRNKIACAIV
FT                   ACSLMDGTSASRLSSVVEMLNNAV"
FT   gene            complement(256499..257386)
FT                   /locus_tag="HMPREF0573_10209"
FT   CDS_pept        complement(256499..257386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10209"
FT                   /product="hypothetical protein"
FT                   /note="Pfam: PF08843; InterPro: IPR014942"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10209"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66528"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIH9"
FT                   /protein_id="ADI66528.1"
FT                   /translation="MRYQTPAALEMAAKAATRRSALDTGRAMTGFYFHRLLCRIFSDPH
FT                   HAFVLKGGQSMLARTVDARATKDIDLLCRERSLERALEELKRLASADLGDYMRFTLTSA
FT                   DPIKVEDEYRSGLRVVFLPMLGAKSLQPIAIDLVVDEVPLERAELVTPADRIEVEGLPV
FT                   CDYLVYPVESALADKLCALVERHDRRASSRVKDLVDIAVYAVTCSIDGGKLRERVLQES
FT                   AVRGIALPETFCIPDEWGAPHERQYERLCSQTGLPHSLRSIDASVELAGRLFNLVYAGF
FT                   ADGMTWNPVTCEWE"
FT   gene            complement(257383..258030)
FT                   /locus_tag="HMPREF0573_10210"
FT   CDS_pept        complement(257383..258030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10210"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66529"
FT                   /db_xref="InterPro:IPR025159"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZII0"
FT                   /protein_id="ADI66529.1"
FT                   /translation="MTYSNHIAALNELSASEGVFTTAQAARLGITRNALSQAVVSGRAE
FT                   RIAHGAYRLAGTQGDFIDELAAVWKLTDPAAFTHERIEVGAWDGIVIGGATAASLQNLG
FT                   DFYLSPYRIYAPRRINSRMKSASFAIRRVNPDDVGWIKGLPVTLPERTLVDLCLDNEEW
FT                   SLVEDAFNSAGNLDYDRLVKIIADQPERKSVQESLSAIRGLMEQHLDKECAR"
FT   gene            complement(258127..258666)
FT                   /locus_tag="HMPREF0573_10211"
FT   CDS_pept        complement(258127..258666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10211"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0286; Pfam: PF02384"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10211"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66530"
FT                   /db_xref="GOA:D6ZII1"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZII1"
FT                   /protein_id="ADI66530.1"
FT                   /translation="MSRACIVPNGVLFRSNSKAYEQLRRELVENQKLETIIYMPSGVFK
FT                   PYSGVSTAILVFTKTDAGGTDDVWLYNMEGDGYTLDDKRDPDEKHDDIPDILSRWHNLG
FT                   AERDRARTEKSFLVSKSEIVENGYDFSFNKYTETVYERVEYPPTEEILDDLADLNRQMT
FT                   ESLAELRRMLGGGQND"
FT   gene            258650..258988
FT                   /locus_tag="HMPREF0573_10212"
FT   CDS_pept        258650..258988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10212"
FT                   /product="DNA-binding helix-turn-helix protein"
FT                   /note="COG: COG1476; Pfam: PF01381; InterPro: IPR001387"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10212"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66531"
FT                   /db_xref="GOA:D6ZII2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZII2"
FT                   /protein_id="ADI66531.1"
FT                   /translation="MQARLTAHAAMRGVSCHIYLTLREISWILFMSDIFDIYHCFAEEK
FT                   SVIQKRNERMRAARKEAGLSQAELAKDVGATRQTICSIEASNYNPSLNLCKLICKKLGK
FT                   TLDELFWD"
FT   gene            259003..259524
FT                   /locus_tag="HMPREF0573_10213"
FT   CDS_pept        259003..259524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10213"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66532"
FT                   /db_xref="GOA:D6ZII3"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZII3"
FT                   /protein_id="ADI66532.1"
FT                   /translation="MKEIITSQSEGKDERMSSVLAPVYRAGFYILAGGVLFDISSRFNY
FT                   LARTGGGSLGESVEFAALVAALALVALAKARSGAVSDSLRVLEAKTFGGTGLVWKGAGV
FT                   SLLIGVAAALGRLSSEVDLGGWTSVMWLNDVAIFVIVSALSAAAVLGYLYCCWRSYRSR
FT                   EDRLAVEDDA"
FT   gene            complement(260260..261846)
FT                   /gene="guaA"
FT                   /locus_tag="HMPREF0573_10214"
FT   CDS_pept        complement(260260..261846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="HMPREF0573_10214"
FT                   /product="GMP synthase (glutamine-hydrolyzing) domain
FT                   protein"
FT                   /EC_number="6.3.5.2"
FT                   /note="COG: COG0519; Pfam: PF00117,PF03054,PF00958;
FT                   InterPro: IPR001674"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10214"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66533"
FT                   /db_xref="GOA:D6ZII4"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZII4"
FT                   /protein_id="ADI66533.1"
FT                   /translation="MAENLQHGKPVGPVLVVDFGAQYAQLIARRVREAKVYSEIVGHNL
FT                   TAREILDKQPSAIILSGGPSSVYAPGAPTFDPAVFQANVPVLGICYGFQVMAQALGGTV
FT                   SPTGTSEYGRTNLEVTPDSRLLEGTPSEQVVWMSHGDAVSAAPSDFQVTAATDDTKVAA
FT                   FENPERGLYGVQWHPEVRHSAYGQRLLEHFLHDLVGLDPVWTPQSIIDTQVEEIRQRVG
FT                   DAQVICGLSGGVDSSVAAALVHKAIGDQLTCIFVDHGLLRAGEREQVERDYAANMGIRV
FT                   KSVDESARFLGALAGVSEPEQKRKIIGREFIRSFEAAQRELVAEIGASGGEVKFLVQGT
FT                   LYPDVVESGGGSGTANIKSHHNVGGLPEDLKFELIEPLRKLFKDEVRALGRELGLPDVI
FT                   VNRQPFPGPGLAIRIIGEVTEERLRILRAADLIVRNELSAAGLDTEIWQCPVVLLADVR
FT                   SVGVQGDGRTYGHPIVLRPVSSEDAMTADWSRLDWELVARISNLITNQVPEVNRVVLDC
FT                   TSKPPGTIEWE"
FT   gene            262329..262775
FT                   /locus_tag="HMPREF0573_10215"
FT   CDS_pept        262329..262775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10215"
FT                   /product="UbiC transcription regulator-associated domain
FT                   protein"
FT                   /note="Pfam: PF07702; InterPro: IPR011663"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10215"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66534"
FT                   /db_xref="GOA:D6ZII5"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZII5"
FT                   /protein_id="ADI66534.1"
FT                   /translation="MKADGHKPSTEVLSYGASPANQEVSAKLEVAPGTNVTTIRRLRMI
FT                   DRQPAGLMFDMIRSSIAPAATALERDSFESALAERGVVVTMARQAVSARKASGPEAQLL
FT                   RIPASSTVLSIQNVSYDESGKIAAYGEYLFRADRFALKNILFAH"
FT   gene            complement(262805..264322)
FT                   /locus_tag="HMPREF0573_10216"
FT   CDS_pept        complement(262805..264322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10216"
FT                   /product="glycosyl hydrolase family 20, catalytic domain
FT                   protein"
FT                   /note="Pfam: PF00728; InterPro: IPR013781"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10216"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66535"
FT                   /db_xref="GOA:D6ZII6"
FT                   /db_xref="InterPro:IPR015883"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025705"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZII6"
FT                   /protein_id="ADI66535.1"
FT                   /translation="MTFAFPERGVTLCASQVGISIEFIEALLERMHELELNTLIWELKL
FT                   KSPRWERANTWHYYTSSQVSQILALAQRLGIEVIPEVNAPGHMGIWLENYPQYALRRPD
FT                   GSVDPEGRLDITNPQAIEFYLRIVAEYLRIFPSRWWHMGADEYMIHDSFANYPYLAEYA
FT                   HQTFGPDASEYDVFNSFVNQVNQFVKGQGRRLRTWNDGVHETSVVHLDTDILIEYWKDE
FT                   GLRIADFRQRGHEVINNSEVLYWSRSHPPYRVDAPALWESNWDARTFIGNQYLSDPPRD
FT                   GAGRQRGLRVSIWPDESYRQTEHEVWEAIQDSLMLVAELGKDGTKCNHDWRAVRMSYPP
FT                   VPTIAGSTVSPGLYEIPGLDAVGKGPWRVQHTPDGYCTLADTACGKNLTLKDGQKHLGV
FT                   VTQAGARPSLEPPADMSVSWPAGWDEAESRNTQKWIISAAIFTDNPNLSQTDEVFCIKP
FT                   ALTGQILTHTCEGVAQWPFDSLQGEGTFTLRKVTLSTVDKKPSSDII"
FT   gene            complement(264395..265330)
FT                   /locus_tag="HMPREF0573_10217"
FT   CDS_pept        complement(264395..265330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10217"
FT                   /product="ABC transporter, permease protein"
FT                   /note="COG: COG0395; Pfam: PF00528; InterPro: IPR000515"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10217"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66536"
FT                   /db_xref="GOA:D6ZII7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZII7"
FT                   /protein_id="ADI66536.1"
FT                   /translation="MVTEHSPQGFDYIPSREGMPPRAIAPSMISRGITAFMLILVLLYF
FT                   IFPVYWVIISATKTNAELANTFGLWFATHGEDTESKSLIEAIGVNYDKLMSWTRGNFWR
FT                   WVVNSLLYSTASAAIGTLISVMAGYSLAKFTFPGKNLSTGIIMAGLLMPAALLTVPMYI
FT                   VFLHLGISNTMASIIVPCCVSPFGVFLGRVYAQTSVPTELIEAARIDGASEARIFFTIV
FT                   LRILAPAMVTIFLFIFVACWNNFLLPLMMISTDTLKPVTLGLYGMMSYFNPEKGAVMMG
FT                   ALFGVIPLIILFLGLQKYWQSGLAAGSVKG"
FT   gene            complement(265356..266375)
FT                   /locus_tag="HMPREF0573_10218"
FT   CDS_pept        complement(265356..266375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10218"
FT                   /product="ABC transporter, permease protein"
FT                   /note="COG: COG1175; Pfam: PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10218"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66537"
FT                   /db_xref="GOA:D6ZII8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZII8"
FT                   /protein_id="ADI66537.1"
FT                   /translation="MEKQVEETTSAPLTRPEKQSSLSRESRSAGNTRRKTSPQAKIQIR
FT                   AGWAFLAPFVILFVLVFLVPILVSIYSSFFQLKTTGGGAYGGGESANTFVGLQNYQYVI
FT                   TSHDFWMGIGRVILYTCLQVPVMIIAALVLALVLDSFLVRHATIYRLGYFLPFAIPGVV
FT                   AAMIWLYLYNTEVSPLVKGLAAIGINVNFLSRNVVLASMANMTTWTYTGYNMLIFLAAL
FT                   QAIPQELSEAARIDGASGLQIMTRIKMPLLRPAALLAVLLSIVGTIQLFNEPTVISSTQ
FT                   TWMGKAYTPMMMAYNTTMGTLTPSGDGPGSAVAIVMALIAGVLAVGYFFVDRKVGGND"
FT   gene            complement(266492..267808)
FT                   /locus_tag="HMPREF0573_10219"
FT   CDS_pept        complement(266492..267808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10219"
FT                   /product="ABC transporter, solute-binding protein"
FT                   /note="Pfam: PF01547; InterPro: IPR006059"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10219"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66538"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZII9"
FT                   /protein_id="ADI66538.1"
FT                   /translation="MQLTSKLRFAAIFAGVGALALTGLTACSDGGKGGDTGASGKPVTI
FT                   KYLHRLPDGEGMTKVDEVVAQWNKDNPDIQVEAVKFDGKAQELIKKLETDVKAGTAPCL
FT                   AQVGYADLAEVYVKQLVEDVSGEIDKYRDKFAAGPLDSMSIDGKYFGLPQDTGPLVYYY
FT                   NKAAFDELGLTVPTTADEFVETAKKAAEKGKFIVDFQTDEAGNMLPALSAAAGDQWFKV
FT                   DGDAWKIDTAGAGSSKVADFWQKLLDAKATATVQRWDEESWKAALNNNLIGTIGAAWEA
FT                   PLLAGDMAGTPNEGKWAVAQLPKFGDEAASGPDGGSGVAVVKGCAAPAEAMKFNAWFNT
FT                   QIDALVSQGLVVAAKGTMTTPEKVSAFYGGQDVFAELTKANSAMKPFTYIPGWSAVQAN
FT                   AEVAAKAADGSGKVADIFSWNADTAKSTLSNLNLKVSEK"
FT   gene            complement(267913..270165)
FT                   /gene="gnpA"
FT                   /locus_tag="HMPREF0573_10220"
FT   CDS_pept        complement(267913..270165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gnpA"
FT                   /locus_tag="HMPREF0573_10220"
FT                   /product="1,3-beta-galactosyl-N-acetylhexosamine
FT                   phosphorylase"
FT                   /EC_number="2.4.1.211"
FT                   /note="InterPro: IPR012711"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10220"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66539"
FT                   /db_xref="GOA:D6ZIJ0"
FT                   /db_xref="InterPro:IPR012711"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035080"
FT                   /db_xref="InterPro:IPR035356"
FT                   /db_xref="InterPro:IPR035363"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIJ0"
FT                   /protein_id="ADI66539.1"
FT                   /translation="MSGRVTLPIENGMDDEIRQIARLWGADAVRNSDGTKLPPITSELG
FT                   AKVYETYFVGRGDNDWAAAHPQDRPQIFLMSQRCPALGEEPLRISVMDGYLDKQVEPDI
FT                   QADLQRYWQVIDRTTGETLPSEKWSLTGKGADTQVCIAKPAAGHVYTVDFLAWQNWDPV
FT                   QMYNYITNHWEDDPQRIREQPYDIRNPETWEYAQAHMDKWLKDHPHVDVVRFTTFFYQF
FT                   TLVFNNREKEKMVDWFGYLGSVTKLALAEFESKYGYALTPEDFVDEGYYNSPFRLPRLP
FT                   FLNWMEFLGEFVTERARIMVDKAHQSGKEAMMFLGDHWIGTEPYGDDFPSIGLDAVVGS
FT                   VGSAATCRMISDIPGVKYHEGRFLPYFFPDVFFEGADPVPELEARWSQARRAIVRNPLD
FT                   RMGYGGYLSLPVKFPKFVQRVSEITDEFRSLHEVSGGARPAVSTIKVAVLNAWGKKRSW
FT                   MTSMVAHAKPYFQTYAYEGVLESLAGLPFTVSFINFDDVSRGALADVDVLINAGQANTA
FT                   FSGGDYWDKPDISARIREFVAGGGGFIGVGQPSACFVEGSGTFFQLSDVLGVDQEVGWT
FT                   LSTDRYVNVAESHFIIEGFDALEQRSRGRGLKEINVLEVESQLQPGREQALLDIGPGVG
FT                   SIIPTGGQVLQFIDGSVDLSVHEYGKGRSVYFAGLPYNSVNSRLLHRAIYWAGHAEERL
FT                   TENYFADRPEVEVAFYPEAHKAFVYNNSDTAQSVNVRGPKPFQVTLGARESRWETV"
FT   gene            270357..271358
FT                   /gene="pta"
FT                   /locus_tag="HMPREF0573_10221"
FT   CDS_pept        270357..271358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pta"
FT                   /locus_tag="HMPREF0573_10221"
FT                   /product="phosphate acetyltransferase"
FT                   /EC_number="2.3.1.8"
FT                   /note="COG: COG0280; Pfam: PF01515; InterPro: IPR002505"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10221"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66540"
FT                   /db_xref="GOA:D6ZIJ1"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIJ1"
FT                   /protein_id="ADI66540.1"
FT                   /translation="MELDVSDFKTLFLNGLTKKAAGSRKRIVLPESDDDRVLQAGARVL
FT                   QTGAADIVFLGETEQIAQSAKRLHLDLDAAEIVSLHDDEKLARYTAKLVELRSHKGMDE
FT                   ATARETLKDVSFFGTMMIVCGDADGMVSGAAHTTAHTIRPALQLIKTQPGVKLVSGAFL
FT                   MVFDDHFDLYADCAVTISPDAAQLADIAVVSAKTAAQFGLEPKVTMLSYSTLDSGSGPL
FT                   VDLVREATAKARAAAPELSIDGPLQFDAAVVESVAAQKAPHSPVAGQTNTFIFPDLNSG
FT                   NITYKAVQRTSGALAVGPILQGLNAPVNDLSRGATVDDISNTIVITAIQAQG"
FT   gene            271417..272604
FT                   /gene="ackA"
FT                   /locus_tag="HMPREF0573_10222"
FT   CDS_pept        271417..272604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ackA"
FT                   /locus_tag="HMPREF0573_10222"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /note="COG: COG0282; Pfam: PF00871; InterPro: IPR004372"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10222"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66541"
FT                   /db_xref="GOA:D6ZIJ2"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIJ2"
FT                   /protein_id="ADI66541.1"
FT                   /translation="MRHQTIFVINSGSSSLKYQLIEPVSGDVLAKGQAERIGTDRGEVT
FT                   HEVHASKFSAALPLPSHKEALTQIIEMFAAHGPDLQHVDLSGFGHRIVQGGWHFKGPAI
FT                   VNDDVRAKIEELCDLAPLHNPAHLIGIDTAMELWPDLPHVAVFDTAYFAGLPEKSRSYA
FT                   LNKQVAHDYRIRRYGAHGTSHEFVANKVCDYLGDDTVKQITLHLGNGASACAELGRLPM
FT                   DTSMGLTPLEGLVMGSRTGDIDPAVVFHLLRKGMSVDEVDTLFNKQSGMKGMCGDNDMR
FT                   DVWKRRDEGDSDALLALQTYQQRLLKYIGAYTFELGGLDVLTFTAGIGENDDRIRRRLC
FT                   EKLEFIGVKIDRERNENRDRSKAIWRISTDDSKVLVLVVPTNEELAIARQVVRLI"
FT   gene            272734..273243
FT                   /locus_tag="HMPREF0573_10223"
FT   CDS_pept        272734..273243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10223"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="Pfam: PF01047; InterPro: IPR000835"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10223"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66542"
FT                   /db_xref="GOA:D6ZIJ3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIJ3"
FT                   /protein_id="ADI66542.1"
FT                   /translation="MSEVAKVDKERSALSEQLVYEFHRLVFSANNLIANISADLGMHGK
FT                   DGDGLLMIWRSEIAGKPLSPSELADGLHITRAAASYLVDRLVNLGYISRQTDPEDRRRA
FT                   VLRIAESGDKLGHNFVGSVNVDLNGVFADRSNQEIKQFTEMLSEFTDQIGESHHTKSSP
FT                   KPHKNQ"
FT   gene            273334..275337
FT                   /locus_tag="HMPREF0573_10224"
FT   CDS_pept        273334..275337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10224"
FT                   /product="transporter, major facilitator family protein"
FT                   /note="COG: COG0477; Pfam: PF07690; InterPro: IPR011701"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10224"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66543"
FT                   /db_xref="GOA:D6ZIJ4"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIJ4"
FT                   /protein_id="ADI66543.1"
FT                   /translation="MTVITTIDEPAAAPAYSEAETQNDHENPTGLASLEHTVPNRWGLI
FT                   LALYLAGIFMGALDMGIVNPARTVIQNSLGVDDQAGVWVFTIYTLAYAIAIPVIGKLAD
FT                   VLGRKPVYVLAIALFGIGSLGCGLAQDFQSFGLLLASRVVQAVGGGGMMPVATAAAGVI
FT                   APPAKRGMALGLVGMVYGVASVIGGSAGSLIMDIAGTDNWQWIFYINVPIALAVVVLGA
FT                   MFLDRERAEAGRHLDIPGTVLIVVAITALLWMFQHLDFTDLGYSFQDSNVRVSLLIFAI
FT                   AGIVFWVTEHRVHDPLINFDYFANIPVGVTLLLGMVAGALMMTVMFIPQFAENSMRLST
FT                   GDGGYPTIIIGLASGIAAPISGRLTDKLGPRFVLGLGMLISAISGLLLIFWTSPYPGFL
FT                   STSVSIFVMGFGLGFLMGAPLTYLILHLVPSRDANTGQATLSLTRSLATTLAPAIMVGL
FT                   LATAMGGLSEKVMDVLPKPDMSALSSTMAAAPDGMPGVGNQSSQGQMPPSAGQDSSKNQ
FT                   TSTGNPRGDTQSSVPPRDTINPNFSMSNLPDKLLNRLQSADVTNIVARSKELANYTFAS
FT                   QSNAMKKRLGFVPPALEQARQDYLQDIDAHADTIESTFQLELNRGFIRLFWFYTLVSLF
FT                   GVLLLFGVPSKKTLDAHIMKTAKTAAKNSLRG"
FT   gene            complement(275417..276955)
FT                   /locus_tag="HMPREF0573_10225"
FT   CDS_pept        complement(275417..276955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10225"
FT                   /product="NAD(P) transhydrogenase beta subunit"
FT                   /note="COG: COG1282; Pfam: PF02233; InterPro: IPR004003"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10225"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66544"
FT                   /db_xref="GOA:D6ZIJ5"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIJ5"
FT                   /protein_id="ADI66544.1"
FT                   /translation="MNNALALVGAPAPNSLLYYAVSVVLVILVLAGLNMLSRVQTAVRG
FT                   NLLGALAMALAIVATLWNFGILSAVELYAAMLVGSLFGVIIWRKTQMIRMPQTVALLNG
FT                   LGGMASMLAGALALTGHADNNAFAQFTAGLAIAVGGATFFGSLIAAGKLHQILDQHPKV
FT                   LPAHSVWVGLSLLVSLGAALAYVFPPFSSPGGAQTVLLIVQIVAANLFGYLLAVRVGGA
FT                   DMPITISLLNSLSGVAGAIAGLAISDLLLVAIGAIVGASGLLLTQIMCRAMNRHLMEIL
FT                   LGNTSVSTAAATPTETESEKPDDSACAGETDTSETTRGDRPTLAAPVADPENTFADWVE
FT                   NAQRVILVPGYGMALSQAQAQVKRLLDYLEKSGKTVDFAIHPVAGRMPGHMNVLLAEVD
FT                   VDYEKLREMKDINDDFASADLTVVIGANDVMNPAANTAEGTPIYGMPVLNVGDCAHVAI
FT                   FNFDLKPGYAGVENPLYARAETEPERVLIFPGDAKETLAARLDALGAPPAIELF"
FT   gene            complement(276958..277284)
FT                   /locus_tag="HMPREF0573_10226"
FT                   /note="pntA"
FT   CDS_pept        complement(276958..277284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10226"
FT                   /product="hypothetical protein"
FT                   /note="1.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10226"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66545"
FT                   /db_xref="GOA:D6ZIJ6"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIJ6"
FT                   /protein_id="ADI66545.1"
FT                   /translation="MTPFQGVLLVVLVVFTLFGYKIISQVPSLLHTPLMSGMNAFSGVT
FT                   VLGCLSAAALAVSLGSKALGLLAVALAMVNIVGGFGVTDRMLRMFDKKPKSVADGGAQS
FT                   GEGE"
FT   gene            complement(277440..278642)
FT                   /locus_tag="HMPREF0573_10227"
FT   CDS_pept        complement(277440..278642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10227"
FT                   /product="putative alanine dehydrogenase"
FT                   /note="COG: COG3288; Pfam: PF05222,PF01262; InterPro:
FT                   IPR007698"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10227"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66546"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIJ7"
FT                   /protein_id="ADI66546.1"
FT                   /translation="MSCVYNEVFAEGFKMIIGVPKEIMNGEDRVAATPETVADMVGKGL
FT                   TVLVETGAGEGSFFHDPEYVSAGAEMVSDPEEIYQRADLILKVKEPLFNEAKGRSEVSM
FT                   MHKGQYLITFIHPAAPPNHEMVKEMAAQGVISLTLDGVPRISRAQNLDALTSMSTCAGY
FT                   KGILLAANYQPSFMPLIHSAIGRIDPLKVLVVGVGVGGLQALATAKRLGAVVYAADIRP
FT                   MASEQATSLGAKPVELGVDPEKAIGEGGYAQALPEDELVKERAALAQVIPDMDIIFASA
FT                   LVPGHLAPRLITEDMVKTMKPGSVIVDISIDQGGNCEITPPGKVEVKHHVTLVGIKNIP
FT                   GMLPKSSTFMFAKNIANFVDFLVKDGQIVLDRSDEIIAKTLTTIDGEIVHVGAREAMGL
FT                   A"
FT   gene            278696..278854
FT                   /locus_tag="HMPREF0573_10228"
FT   CDS_pept        278696..278854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10228"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10228"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66547"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIJ8"
FT                   /protein_id="ADI66547.1"
FT                   /translation="MYLAPDFRVKRIQVLGVLFSTSLFRKPIPPTAIGRGHPAENSLRD
FT                   ARPETNR"
FT   gene            complement(278858..280525)
FT                   /locus_tag="HMPREF0573_10229"
FT   CDS_pept        complement(278858..280525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10229"
FT                   /product="hydrolyase, tartrate beta subunit/fumarate domain
FT                   protein, Fe-S type"
FT                   /note="COG: COG1951; Pfam: PF05681,PF05683; InterPro:
FT                   IPR004646"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10229"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66548"
FT                   /db_xref="GOA:D6ZIJ9"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR011167"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIJ9"
FT                   /protein_id="ADI66548.1"
FT                   /translation="MTDFFYADILPHGEDTYTYRKLTSEGVSEVEGPDGTKFLKVSPEA
FT                   LTLLSETAFHDISHYLRTAHLQQLRKILDDPEASGNDKFVAMDLLRNANIAAAGVLPMC
FT                   QDTGTAIIKGERGQRVLTPGPDEEALSRGVYNAYTKLNLRYSQNSPLSMYEEKNTGCNL
FT                   PAQVELYAETAPGHEAEYRFLFMAKGGGSANKSYLYQMTKAILDPEHMMQFLEEKIRSL
FT                   GTAACPPYHLAIVIGGTSAEYALKTAKYASAHYLDGLPTHGGEQAQGFRDLEMEEQVLD
FT                   MTRHMGIGAQFGGKYFCHDVRVVRLPRHGASLPVAIAVSCSADRQCVAKINKDGVFIEA
FT                   LDTDPGRFMPDPSEAELGGDEAVKIDLNRPMKDVLAELTKYPIKTRLSLTGTLIVARDI
FT                   AHARLRDRLEKEGDLPQYFKDHPVYYAGPAKTPEGMPSGSFGPTTASRMDPYVDLFQAH
FT                   GGSMIMLAKGNRGQVVTDACRKHGGFYLGSIGGPAAELAAHSIKKVEVLEYPELGMEAV
FT                   WKIDVEDFPAFIVVDDKGNNFFEGLDKVVLTLKVPPKK"
FT   gene            280780..281532
FT                   /locus_tag="HMPREF0573_10230"
FT   CDS_pept        280780..281532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10230"
FT                   /product="putative 3-dehydroquinate dehydratase, type I"
FT                   /note="Pfam: PF01487; InterPro: IPR013785"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10230"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66549"
FT                   /db_xref="GOA:D6ZIK0"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIK0"
FT                   /protein_id="ADI66549.1"
FT                   /translation="MLGYDRLIRDMHPRVELVEIRLDGVWLSRGSFQGTKRDFAEIENL
FT                   LRQAREQVKRPILATFRTEGGHVSITAEVYESLVAQAAKCADWVDVESNYPYLGMTAEQ
FT                   ATAAAENPHVQEDNEKRLTSLLRNIHGNGTGVILSRHCWEPSPNSEKEVSDLLIYQLNL
FT                   GADVSKAAFSPQTPQQLANLQKGGKTTFLLTHRPTILIGMGALGQPTRLAGPQLGNWGT
FT                   FVTVGGPQSAPGQLPLAQLELRYPASGF"
FT   gene            complement(281637..283715)
FT                   /gene="dnaG"
FT                   /locus_tag="HMPREF0573_10231"
FT   CDS_pept        complement(281637..283715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaG"
FT                   /locus_tag="HMPREF0573_10231"
FT                   /product="DNA primase"
FT                   /EC_number="2.7.7.-"
FT                   /note="COG: COG0358; Pfam: PF01807,PF08275,PF01751;
FT                   InterPro: IPR006295"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10231"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66550"
FT                   /db_xref="GOA:D6ZIK1"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIK1"
FT                   /protein_id="ADI66550.1"
FT                   /translation="MVSKFDPEDLQKVRDIPIESVVSDYVSLQRKGSSLLGLCPFHDEK
FT                   TASFSVTPVRNMWHCFGCSQGGDTIDFVQLIEGLTFPEAVEFLAARAGITMHYVEGAAI
FT                   TKERVEPGTRQRLLECNRVAQDFFVSQLVSPEAQRARDFVEGRAFTSQDAAHFGMGYAP
FT                   PGWNNLTDYLRSKGFTDQEIVTVGLGKPGQRGIYDVFRDRVMWPIKDVTGAVLGFGGRR
FT                   LDDSDPQVPKYINTPESPIYHKSSVLYGLDLARPNIGKERRCVIVEGYTDVMAAHLSGI
FT                   TTAVATCGTAFTDEHAKQIRRFIGTSADSASSLKLPGGLPPRGGEVIFTFDGDAAGQAA
FT                   ALKAFRTDQDFASQAFVAVADDGLDPCDLRMQRGPGAVRDLIEGRKPLFDFVLKTIISK
FT                   YDLDSPAARIEAMRATAPVLAEIRDKALRTEYVKQVSGWLGVNVRDTWYTVNEVWRRIR
FT                   SQQRASSASSSQPGGLGGPGNAAGGSEKSANLGNLTGSDASGSPQVIPQTRLDPAVNTD
FT                   PVWRVERDVLIAALQFPGFAAQTAFDTLDPQSFTQPTLRAIFEVIAAVGGAGEYRRLAE
FT                   VAQAAGEPHPGNVALNRWAAAVKAQAGSVLVGALTNLVTRPAPLYEANQSAEETRIAAE
FT                   SWVQNAVESMERKGLNAQIASLKAQLRRLDSNSPEKAEVFGKLINLENRMRELNPEF"
FT   gene            complement(283742..285043)
FT                   /locus_tag="HMPREF0573_10232"
FT   CDS_pept        complement(283742..285043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10232"
FT                   /product="putative dGTPase"
FT                   /EC_number="3.1.5.1"
FT                   /note="COG: COG0232; Pfam: PF01966; InterPro: IPR006261"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10232"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66551"
FT                   /db_xref="GOA:D6ZIK2"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIK2"
FT                   /protein_id="ADI66551.1"
FT                   /translation="MSEIGAYPREVHERFVTETHKRGNRTDFERDRARILHSSALRRLG
FT                   EKTQVLGPIANDFSRTRLTHSLEVAQVGRELGKGLGCDPDVVDAACLAHDLGHPPFGHS
FT                   GERVLNDLAKDIGGFEGNAQTLRLVTRLEPKVIGSQGQWVGLNLTRATLDAIAKYPWLR
FT                   GEGPHGADSPKFGVYAEDREVFQWLRLGAPDNHRCIEAQVMDLADDIGYSVHDVEDAVA
FT                   LGSANLGDLENEETFVDVVDITRRWYAGSFGPGKFSADDLAAAHERLRQMPFWLTEPVS
FT                   DYRSQATLKDMTSQLIGRFALACHDATRQRYGDRPLVRYDADVIVPPETQAEILLLKGI
FT                   AVYYVMAPRETTHDHLSQKQILSDLVWALLEQEATGQRVLQEPYRAEWLRAEEHHLGRD
FT                   AGRLRAVIDQVASLTDLSAGAWHARLVGMITQPV"
FT   gene            complement(285040..286143)
FT                   /locus_tag="HMPREF0573_10233"
FT   CDS_pept        complement(285040..286143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10233"
FT                   /product="TIM-barrel protein, nifR3 family"
FT                   /note="COG: COG0042; Pfam: PF01207; InterPro: IPR001269"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10233"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66552"
FT                   /db_xref="GOA:D6ZIK3"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIK3"
FT                   /protein_id="ADI66552.1"
FT                   /translation="MFVNEMITAKALMMNSTRSWVMAQSGPGQTVRVLQLYGVVGADLA
FT                   WAARELIARDLVDVIDLNFGCPVPKVTRKGGGAALPWKTAYFGDLIGQVVQAAQESSQA
FT                   ARREVEVPVTVKIRVGIDESHETMLDAGRAAQDAGAAALTLHARTTNQYYSGHSDWSRI
FT                   GQLVNTLDIPVLGNGDVFSASDALEMFAQTGCAGIEIGRAVQGRPWIFREITAALWGQP
FT                   IPAGPTLGEIVEVIRAHACGLVEHFGNEKAALRDMRKHVGWYLRGFHLGGDTRAELTRV
FT                   ETLDDLERRLYDLLQTLDPNTPYPEAAQGKHGRSRAQRHVKLPEGWLDTREIDAAATKA
FT                   LHLAADDFDDPYAKSEAEPYPAVRLDK"
FT   gene            complement(286405..287778)
FT                   /gene="glyS"
FT                   /locus_tag="HMPREF0573_10234"
FT   CDS_pept        complement(286405..287778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="HMPREF0573_10234"
FT                   /product="glycine--tRNA ligase"
FT                   /EC_number="6.1.1.14"
FT                   /note="COG: COG0423; Pfam: PF00587,PF03129; InterPro:
FT                   IPR002315"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10234"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66553"
FT                   /db_xref="GOA:D6ZIK4"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR022961"
FT                   /db_xref="InterPro:IPR027031"
FT                   /db_xref="InterPro:IPR033731"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIK4"
FT                   /protein_id="ADI66553.1"
FT                   /translation="MDSVISLAKRRGFVYPCGDIYGGTRAAWDYGPLGVELKENIKKAW
FT                   WNYMVRSREDVVGLDSSVILPPKVWDASGHLKAFTDPLIECLSCHKRLREDDLQEEYAE
FT                   KHGVENPDDVSMDDVPCPNCGVKGKWTEPRAFSGLLKTYLGPVDDESGLHFLRPETAQG
FT                   IFINFANVMTTARKRPPFGIGQIGKSFRNEITPGNFIFRTREFEQMELEFFVEPGTDEE
FT                   WHQYWIDHRFEWYTDLGIKPENLRLYEHPKEKLSHYSKRTVDIEYAFGFENSKWGELEG
FT                   IANRTDYDLGVHMKASGQKLDYYDQANDKRWVPYVIEPSAGLTRSLMAFLIEAYTEDEA
FT                   PNTKGGVDKRTVLRLDPRLSPVKVAVLPLSRKDELPEIAHNIAAELRKHWNVEYDDAGA
FT                   VGRRYRRQDEIGTPYCVTVDFDSLEDQAVTVRERDTMTQERIGRDNLLAYLRDRLPTC"
FT   gene            288047..288817
FT                   /locus_tag="HMPREF0573_10235"
FT   CDS_pept        288047..288817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10235"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66554"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIK5"
FT                   /protein_id="ADI66554.1"
FT                   /translation="MNQTAMAAVNLRAVLRTLEKLPELDPKSKQLLEHVPLTLQFKAAN
FT                   VGSVRLKLGDGKIEFFPGGGPADISLGFPVPSMVNKMFDGKGIPVPLKGFTKLKYLTGT
FT                   FTEITDRLSYYLRPTPQLLQDPEFARINSLLTLHVAVYAMAEIANQDPKGIQVAKGMRD
FT                   GTIGLKIANGPALTMVINDHHARIVDGDAPKAAGPNGRHAFMVFSDLDTTGQVLRGELA
FT                   SYPAIGRELIKLGGYVPLLDNMNKILGMVPFYLS"
FT   gene            288847..290130
FT                   /locus_tag="HMPREF0573_10236"
FT   CDS_pept        288847..290130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10236"
FT                   /product="aminotransferase, class III"
FT                   /note="COG: COG0001; Pfam: PF00202; InterPro: IPR005814"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10236"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66555"
FT                   /db_xref="GOA:D6ZIK6"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIK6"
FT                   /protein_id="ADI66555.1"
FT                   /translation="MMKTYEHTKSHEWYERAVEVIPGGVYGHLGPAEGCFMPISAYPLF
FT                   ASKAQGAYFWDVDGNKYVDLMCAYGPMVLGYNDPDVDKAAAEQAKILNCAVQPGTLMVD
FT                   LAELMVDTVDMADWAFFAKNGGDATNYALMVARAATGRDKFIAVNGGYHGVIGWTQGWG
FT                   APGVGKKEVEDKLLVDWGDTAAVERLAAEYKGEIAAFIATPYHHPVFEDSILPPAGYWN
FT                   KIRSICDREGIVLIVDDVRCGWRLDMKGSDYHYGFKADLECFCKAIANGHNISAVTGIE
FT                   SLKDAAASVMCTGSYWMSAPPMAAAIACITKMREIDAPKICHDHGVKIIERLTEIAKHH
FT                   GFDYRFSGEPALFFHQIRGLEDKADPNLLLHQAFVGECVKRGVFMTNHHNHFTNTALTD
FT                   KDIDFIADVADEAMGVVKNKSREILAQA"
FT   gene            290145..291008
FT                   /locus_tag="HMPREF0573_10237"
FT   CDS_pept        290145..291008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10237"
FT                   /product="Transketolase, thiamine diphosphate binding
FT                   domain protein"
FT                   /note="COG: COG3959; Pfam: PF00456; InterPro: IPR005474"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10237"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66556"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIK7"
FT                   /protein_id="ADI66556.1"
FT                   /translation="MALSAKEHKELEETANRLRLLTLDTVNWAGGGHIGGAMSSMDVLT
FT                   VLYHHEMNFSADKMDDPDRDRFVLSKGHIGVGMGPVLADLGCFPKDWLPTYSHILSHLG
FT                   IHLDAGKVPGLEVSTGSLGHGLSLAVGMALGARQLGKEWRTYCLMGDGECNEGSIWEAA
FT                   MSAGQFKVDNLVGIVDVNHAMIDGMTADVMGLEPFADKWRAFNWEVIEVKGNSIPDLVD
FT                   AFDRARTIKGKPTMLLMDTVKGEGIDYMEGDYTWHYGAVDDEKYAKAVESLKRHLQKRL
FT                   ELVKGA"
FT   gene            291011..292021
FT                   /locus_tag="HMPREF0573_10238"
FT   CDS_pept        291011..292021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10238"
FT                   /product="Transketolase, pyridine binding domain protein"
FT                   /note="COG: COG3958; Pfam: PF02779,PF02780; InterPro:
FT                   IPR005475"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10238"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66557"
FT                   /db_xref="GOA:D6ZIK8"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIK8"
FT                   /protein_id="ADI66557.1"
FT                   /translation="MAGGLTYTSIDAVNLTTAEVYGQTLVQLGKEDSTIVGLSADLAKS
FT                   TKISVFAKEFPERFYNVGIAEQNMFGIAAGLAKAGLLPFVSTFGAFAALRACEQIRTDI
FT                   CYQNLNVKIIGTHSGLSFGAAGTTHHVTEDIAILRSFANLVVMCPADGLEAAYCVQAAY
FT                   EHQGPVYIRLNRGFDQIVYRDEIPTFEFGKANTLREGTDLTFIATGSGVWRALQAADIL
FT                   AKEDGLSVRVLDIHTLKPIDEDAIAKAITETRRIITVEDHNIINGLGTAVADVGATTRK
FT                   GFVLKKLGIPDEFSVIGQPEDLYSHYGWDENGCVAAAREVMHMDFEEDDDWEDEF"
FT   gene            292033..292962
FT                   /locus_tag="HMPREF0573_10239"
FT   CDS_pept        292033..292962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10239"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66558"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIK9"
FT                   /protein_id="ADI66558.1"
FT                   /translation="MTKETKQSSAPPQATQTDKACGESCEKKTKAKPFPMGPNPSIDDE
FT                   VRYANVVFLNAVIPLLKPIVAEKPELAAAFKGKEGVVQISCLTPAGTSIDGRPERYATH
FT                   LIIHGASITPKLGAHPLPNVEIEFPSPEKLNDFFKGKVNLPKIRGGLSNPGLLVATVKA
FT                   LLAMSSLLGATAAPKIEDDRKLLTKCMFYLLTTGMSQLNKAGHPGVHAWTDPSPDRVYA
FT                   YVVDGHPELGAYIRIKAGKSKAFRGEYTRSAAFFTMRFDSVTSALGTLLQTDDLLDAQA
FT                   SGRMSMEGSPEYGAELGALMMAVGDYAK"
FT   gene            292997..293683
FT                   /locus_tag="HMPREF0573_10240"
FT   CDS_pept        292997..293683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10240"
FT                   /product="glyoxalase family protein"
FT                   /note="Pfam: PF00903; InterPro: IPR004360"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10240"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66559"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIL0"
FT                   /protein_id="ADI66559.1"
FT                   /translation="MKTTCRKATKLGALVLLGYGVKLAVDNALELKKLGKEEFLERKQR
FT                   ECRNKMNSIGINWGLGHVGVTVANFERAVQWYDRVFGLKLMNYLEITGDDLKPVERLYH
FT                   VEGIKRVRLGFMCSRSGNILELFEFDPPVVTDERETWNRPGYSHIAFHVSNVPGWVNRL
FT                   RREGAEFMNEPVHSSGADWAFFRDPDGNLVELIDLHAARLGLGRLGVLIGTVMKHTALK
FT                   GFYRKV"
FT   gene            complement(293874..294356)
FT                   /locus_tag="HMPREF0573_10241"
FT   CDS_pept        complement(293874..294356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10241"
FT                   /product="isoprenylcysteine carboxyl methyltransferase
FT                   family protein"
FT                   /note="Pfam: PF04140"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10241"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66560"
FT                   /db_xref="GOA:D6ZIL1"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIL1"
FT                   /protein_id="ADI66560.1"
FT                   /translation="MLGVGPFYVSGIFIVTVSATIFRYLGWLRIGTIDNLWIRILLILI
FT                   AIVLMVESVIVWCLAVFGSRMVESVKTGQLMTTGIYAWVRHPVYTAFFLLNTGILISQT
FT                   NWCLMALPFVYWLALSILLKRTEERWLQQKFGAQYARYAARVNRVLPWPPRGPETI"
FT   gene            294609..296426
FT                   /locus_tag="HMPREF0573_10242"
FT   CDS_pept        294609..296426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10242"
FT                   /product="glycosyl hydrolase family 2, sugar binding domain
FT                   protein"
FT                   /note="Pfam: PF02837,PF00703,PF02836; InterPro: IPR013781"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10242"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66561"
FT                   /db_xref="GOA:D6ZIL2"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIL2"
FT                   /protein_id="ADI66561.1"
FT                   /translation="MNYLRSEYPRPQFERENWQNLNGTWDFRFDDDDKGLRERWYMPDS
FT                   PFPMQINVPFVYECELSGINTREQHDIIWYKRNFDAPSLTPQQHLLLHFGAVDYQTQVF
FT                   LNGQMVKEHTGGETPFSVDITPFLTEGTTQNLCLRVYDPLTNQEIPRGKQFWKSTPKGI
FT                   WYTRSSGIWQTVWTEVVNEQRIESLAIKPDLDSGSVEFTVHTKTSSSNTWLKVQIHYQD
FT                   KLFVETQIKCVGPTLKFSVDIFGSDIFRTGFHGADEYIWSPEYPNLFTVELTLSDINSN
FT                   LELDSVSSYFGMRKIHTENGIIYLNNKPYYQKLVLDQGYWPRSLLTAPTDDDYRLDISL
FT                   AKEMGFNGCRKHQKLEDPRFLYWADQLGFLVWEECSSTPLFTTESQIAIFDSWKAVYQR
FT                   DRNHPCIVAWVPLNESWGVPQIHSNQRQQHWAQALYHLLRSLDDTRLVSSNDGWDQTIT
FT                   DICAIHNYKLGKDADDSEFTQFCETLTSKEALVSQFVSGHPVYAAGFGYRGEPILITEC
FT                   GGIGFANNQNSDWSYLGVSSAAEFLATYRRLISTLRSSQYVQGFCYTQLTDVEQEVNGL
FT                   LTYERTPKFDLKELRQINAINDLPSQNLT"
FT   gene            complement(296593..298005)
FT                   /locus_tag="HMPREF0573_10243"
FT   CDS_pept        complement(296593..298005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10243"
FT                   /product="ABC transporter, solute-binding protein"
FT                   /note="Pfam: PF01547; InterPro: IPR006059"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10243"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66562"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIL3"
FT                   /protein_id="ADI66562.1"
FT                   /translation="MRLDMKNSVIAVSGRRFMVAALAAVLAGILTVGLTSCSSQVSGKP
FT                   GQTTLRYWLWDSGQLPGYRQCAADFERENPDVHIQIEQFGWDDYWTQITASMVAENAPD
FT                   VFTDHTSQFGKYSALGQLLDIDPYVKRDNYDLSHYAAGLADQWKSADGKHRYGLPKDWD
FT                   TEAIFYNEDMVKAAGYTKDDLWKLEWNPQDGGSFEKFLARLTVDVNGVHGDEPGFDKKH
FT                   VKVYGTGYNDTGGGLGQIQWSPYALSNGEWRWTEKNPWGMHFNYDDPKFQETIGWWISL
FT                   IKKGYMPPLSVATSGVGTVESLGSGSYATLLEGSWNISTIDNATDLPIQVAPTPIGPDG
FT                   HRASVTNGLADSIWVGTKHPQESWRWVKYLGSAKCQDVIAEQGTVFPAITTSTDKAIKT
FT                   FEDMGYDARAFSVHLEDKTTVPSLVVDRWAQVDALMKPAMASVMSFESEPSSLTEANRR
FT                   VNALMSANRGKR"
FT   gene            complement(298002..298982)
FT                   /locus_tag="HMPREF0573_10244"
FT   CDS_pept        complement(298002..298982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10244"
FT                   /product="ABC transporter, permease protein"
FT                   /note="COG: COG0395; Pfam: PF00528; InterPro: IPR000515"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10244"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66563"
FT                   /db_xref="GOA:D6ZIL4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIL4"
FT                   /protein_id="ADI66563.1"
FT                   /translation="MNCEELKMTTTTLKTATKQTDKHPHMGHTGKIGSKKHHGLGFYCA
FT                   WGCLIILLIITVFPFLWMLRSSLMTNTELLAHPGTIWPKNPTFDAYRRVFGMTTPEESL
FT                   TQGGAGASINFWLYLRNSCIVASTVMVGQTLFSAMAAYAFSRLRWRGREVVFAIFLSAL
FT                   MVPAIFTAIPNFVLIKQLGLLNTFAGIVLPTFFMTPFSIFFLRQFFLGIPREIDEAAMI
FT                   DGAGPFKVFFRVICPMTSAPIITLAVLTFINAWNDYMWPLLVGQSDRVRVLTVALGIFR
FT                   SQKPQGSPDWTALMAAALVSALPIIILFTILGKRIVNSVGFSGIK"
FT   gene            complement(298972..299910)
FT                   /locus_tag="HMPREF0573_10245"
FT   CDS_pept        complement(298972..299910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10245"
FT                   /product="ABC transporter, permease protein"
FT                   /note="COG: COG1175; Pfam: PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10245"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66564"
FT                   /db_xref="GOA:D6ZIL5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIL5"
FT                   /protein_id="ADI66564.1"
FT                   /translation="MLRKETRMETSSDVVSTRKQRPVIISRQARYALIFLIPAGIGLFF
FT                   FYLLPAVRGFYFSFTDYAVLTPARWTGLANYQRLIFDPLFWNAVKVTVYYVVLNIGFQT
FT                   IIAIGLAVLLQRLTNSTLIRGMALLPYFIANVVVALVWYFMMDYQIGIVNEMLNWIGLD
FT                   RVAFFGESAWAIPTVAFVNVWRHMGYTALLIFAGLQTINRTVWEAADIDGAGEIRKFFS
FT                   ITLPLLRPVLAMVMVVTITGSFQIFDTVAITTKGGPINATRVIYYYIWDLAFGQLDFGY
FT                   ASAIAMVLFVLLFGISLIQLRLMRAGESDEL"
FT   gene            complement(299934..301925)
FT                   /locus_tag="HMPREF0573_10246"
FT   CDS_pept        complement(299934..301925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10246"
FT                   /product="alpha-galactosidase"
FT                   /note="COG: COG3345; Pfam: PF02065; InterPro: IPR000111"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10246"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66565"
FT                   /db_xref="GOA:D6ZIL6"
FT                   /db_xref="InterPro:IPR002252"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031704"
FT                   /db_xref="InterPro:IPR031705"
FT                   /db_xref="InterPro:IPR038417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIL6"
FT                   /protein_id="ADI66565.1"
FT                   /translation="MVSGTSDIPPLFSLVPQQSEGWIGTPGLIGSRQSGALFSAFIPID
FT                   VQTDGQGTNGAPSEVTVTLHDEEADINLTIAVEVTPSGVIRGQAKVINTGADGYEVQSL
FT                   LLGLPTPASETYVLDQTGHHLRERDIQKHEFTIGSHQREINVARGHTISSIHGTCQPNT
FT                   SWQDGLVHYVHVAWSGNTRTIAEKDTQGYQGILAGELLFPGEVVLKRGEEYCSPWIVGT
FT                   WGHGLDEAAARMHSFVRSRTAHPATERPVTLNAWEAVYFDQSLPRLLKLVDLAAEAGAE
FT                   RFVLDDGWFSGRRDDTSSLGDWTVSAEVWPDGLSPLADAVHSKGMQFGLWFEPEMVNPN
FT                   SQVAREHPDWMLSPRTHRPQEARYQQVMDLTNPKAFEHVKGQMLEVLDSTQIEYIKWDF
FT                   NRDLYEAVSPTTGCPVYHQQTLATYRLLRDIKEAHPHLEIESCAGGGGRIDLGIMEYAV
FT                   RIWGSDCTDPIERKQIEAGTCLLLPPELIGSHVASPVSHQTGRTLNLSLRASNALFSHM
FT                   GIEWDLTTASASELKELASWVALHKELRPMLHSGRVVHLDHPDRGYWVHGVVSVDQTRA
FT                   VYAVTRLHSSPQRPSPALCLPGLEATTTYRVREMLPQGVESEIGNGQGSVPWWGTGLEL
FT                   PGSVLEHSGIRFPDLNPLQTVLLEVSAR"
FT   gene            302184..303434
FT                   /locus_tag="HMPREF0573_10247"
FT   CDS_pept        302184..303434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10247"
FT                   /product="ROK family protein"
FT                   /note="COG: COG1940; Pfam: PF00480; InterPro: IPR000600"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10247"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66566"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIL7"
FT                   /protein_id="ADI66566.1"
FT                   /translation="MKHFPHILFRFSVKTAATQRERETMTRLFDDSSLATAAHILAHGP
FT                   LSRADTARDLELSPATLTRLVRPLMKSGMITEVRSGVSKTGMGRPTQLLAVPPDQHAFI
FT                   GVNLTGTMIHCVRTDANARILSREAVPVESHAPEDCLHQLCAVIRRQIGNQDDSQLEGI
FT                   GISLGGKIDSSRIKENRFLGWQNVDLHSITHEINSSSHPDIEFVNDVTGLTMLEQWFGL
FT                   GRKCEDFVVATIGAGIGNGMVHNLRAVRSPLSGLGTTSHIPLAGAHGVCQYGHVGCANG
FT                   ALTLPAVLSRAQTGRAITNSDSAPTSAEELINLADYGDKSCRRAIIEFTENLAIYVQTV
FT                   ASAALVLDVVLDGEGVCLLESRWADNFDKHLKSYGRPNDPRIRVHRRSGSFDRWAQGAA
FT                   VAAIVKWLIRTTGSTKW"
FT   gene            303582..303716
FT                   /locus_tag="HMPREF0573_10248"
FT   CDS_pept        303582..303716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10248"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10248"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66567"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIL8"
FT                   /protein_id="ADI66567.1"
FT                   /translation="MHRNQTLNLTEMTKFRTPSAGITCATHGQVTDDLESTKYISSSL"
FT   gene            complement(304025..304189)
FT                   /locus_tag="HMPREF0573_10249"
FT   CDS_pept        complement(304025..304189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10249"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66568"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIL9"
FT                   /protein_id="ADI66568.1"
FT                   /translation="MQNHRVVVPALAGMSLRFSTNWKAWVCGPRTRGDEPEQDTVRMYI
FT                   QEWSPHSRG"
FT   gene            304550..304921
FT                   /locus_tag="HMPREF0573_10250"
FT   CDS_pept        304550..304921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10250"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66569"
FT                   /protein_id="ADI66569.1"
FT                   /translation="MRLWRSGGLIPASAGTTLAMSNATWASGAHPRECGDHSSCSWLPP
FT                   AAIGSSPRVRGPLGFPVFVVGVGGLIPASAGTTRLPRRALALTWAHPRECGDHDKRLSK
FT                   RFQRTGSSPRVRGPRCGTG"
FT   gene            305625..305789
FT                   /locus_tag="HMPREF0573_10251"
FT   CDS_pept        305625..305789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10251"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66570"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIM1"
FT                   /protein_id="ADI66570.1"
FT                   /translation="MRGPLELLENQVRAARLIPASAGTTAVAAWVESLPWAHPRECGDH
FT                   VRVLDPAGS"
FT   gene            complement(306162..306329)
FT                   /locus_tag="HMPREF0573_10252"
FT   CDS_pept        complement(306162..306329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10252"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10252"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66571"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIM2"
FT                   /protein_id="ADI66571.1"
FT                   /translation="MGLRDGSVVPALAGMSPARERFHGYGYGGPRTRGDEPISAAASPP
FT                   ACTWSPHSRG"
FT   gene            complement(306589..306735)
FT                   /locus_tag="HMPREF0573_10253"
FT   CDS_pept        complement(306589..306735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10253"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66572"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIM3"
FT                   /protein_id="ADI66572.1"
FT                   /translation="MVPALAGMSLIWRAAPSAPAGGPRTRGDEPHALVKCGAGDVWSPH
FT                   SRG"
FT   gene            306827..307006
FT                   /locus_tag="HMPREF0573_10254"
FT   CDS_pept        306827..307006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10254"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66573"
FT                   /protein_id="ADI66573.1"
FT                   /translation="MGSSPRVRGPRATVGADGEGVGLIPASAGTTFYHPAVYLLGGAHP
FT                   RECGDHPFPRFVGI"
FT   gene            complement(307235..307570)
FT                   /gene="cas2"
FT                   /locus_tag="HMPREF0573_10255"
FT   CDS_pept        complement(307235..307570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cas2"
FT                   /locus_tag="HMPREF0573_10255"
FT                   /product="CRISPR-associated endoribonuclease Cas2"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10255"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66574"
FT                   /db_xref="InterPro:IPR010152"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIM5"
FT                   /protein_id="ADI66574.1"
FT                   /translation="MTAVPAGLRGDLTKWLIEIAPGVFVGNPSARVRDLLWERTVALCK
FT                   DGRALLIFSSNNEQGMEFRTHRHSWIPTDFDGVTLMMRPSGDGQQYYSRRTGWSIARHQ
FT                   GRKRRGV"
FT   gene            complement(307582..308475)
FT                   /gene="cas1"
FT                   /locus_tag="HMPREF0573_10256"
FT   CDS_pept        complement(307582..308475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cas1"
FT                   /locus_tag="HMPREF0573_10256"
FT                   /product="CRISPR-associated endonuclease Cas1"
FT                   /note="COG: COG1518; InterPro: IPR002729"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10256"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66575"
FT                   /db_xref="GOA:D6ZIM6"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019851"
FT                   /db_xref="InterPro:IPR033641"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIM6"
FT                   /protein_id="ADI66575.1"
FT                   /translation="MEDRLSFLYVERAILNREGNALTIQDSRGIAHIPATQVGVVLLGP
FT                   GTKVTYAAMALLGDAGCSAVWVGEKGVRYYAHGRPAAKTSRMAEAHARLWANQRSRLRC
FT                   ARRMYSMRFPGEDVSNLPLSQLRGREGARMKRIYAEQSRRTGVPWTRRSYDPNDFGAGD
FT                   PINCALTEGAAALYGIAHAVVVGLGFIPSLGIIHSGTDRAFVYDVADLYKAEISIPAAF
FT                   EAVAASAEGDELNVRKRIRDKVVTTRLMQRMVRDLQYVMEIPTDDAYIDANLLLWDELE
FT                   VIAAGVNWADEDSVLR"
FT   gene            complement(308533..309195)
FT                   /gene="casE"
FT                   /locus_tag="HMPREF0573_10257"
FT   CDS_pept        complement(308533..309195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="casE"
FT                   /locus_tag="HMPREF0573_10257"
FT                   /product="CRISPR system CASCADE complex protein CasE"
FT                   /note="Pfam: PF08798; InterPro: IPR010179"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10257"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66576"
FT                   /db_xref="InterPro:IPR010179"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIM7"
FT                   /protein_id="ADI66576.1"
FT                   /translation="MATFTKILLNPARRQGRKLLTNPQAVHAAVCACFPPDMNQNQGRV
FT                   LWRLDQRSHENILYIVGPEKPTAVHIVEQAGWDTRPAQSAEYDRLLGQLKKGQQWNFEL
FT                   VANPTKSLRRGGEQRGRVVALLSAPDQLAWLHSKAESMGVSFGTLEESTAQVGERESIS
FT                   FKRNFSAESSPKVHLVKVRYRGYLEVIDAEKLRQTLVGGVGRAKGYGCGLLTLARIQ"
FT   gene            complement(309195..309899)
FT                   /gene="casD"
FT                   /locus_tag="HMPREF0573_10258"
FT   CDS_pept        complement(309195..309899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="casD"
FT                   /locus_tag="HMPREF0573_10258"
FT                   /product="CRISPR system CASCADE complex protein CasD"
FT                   /note="InterPro: IPR010147"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10258"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66577"
FT                   /db_xref="GOA:D6ZIM8"
FT                   /db_xref="InterPro:IPR010147"
FT                   /db_xref="InterPro:IPR013422"
FT                   /db_xref="InterPro:IPR021124"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIM8"
FT                   /protein_id="ADI66577.1"
FT                   /translation="MSYSLLLLLKGPLQSWGDESRYTTRATGSTPSKSGVIGLLAAAQG
FT                   RHRTDPLEDLVRLDYAVRVDQSGALLRDYQTSQPWQKDPNASAKLVSRYFLSDAAFVAA
FT                   IGAENRSILEGLQGNLYQPAYPLFLGRRSCPAPANLDLGIVEGNVVTALMEHEEWHATL
FT                   SHKKERGEEVLLPIYRDGKPGEAGTPRQDVPISFSQEHRRYGWRTVVYAGAKQIKNEYG
FT                   TSLDPFFEAVIS"
FT   gene            complement(309903..311210)
FT                   /locus_tag="HMPREF0573_10259"
FT   CDS_pept        complement(309903..311210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10259"
FT                   /product="CRISPR-associated endonuclease Cas3-HD"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10259"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66578"
FT                   /db_xref="GOA:D6ZIM9"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR010148"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038257"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIM9"
FT                   /protein_id="ADI66578.1"
FT                   /translation="MNIANRADWWEEMCSPQAKALWAKSGDERAHLSLPQHLIDAACVA
FT                   QWLWDNWVCDVLKATLARLWCLNESEVRTLYCFYAGTHDVGKATVTFQRQIENRPDAAW
FT                   LLPPLEQAGLSLDWPRGEGSNVSFPHGTASGLLLRKWLEEQGICKFLRVVLSAVPDAHH
FT                   GFTSNPMTLRLREDGIKKRETQFDTIAFQLLDGMAEITAIAPVLERLQDSGEVPTAPAL
FT                   QLMTGMVVMADWIASNEDAFPYEPVLPQVERVSRAMDYIQLPAPWRPQDISDDLPELFR
FT                   KTFAWGTDITLRPVQRAAVEAAMDAPDPTLMIIEAPTGEGKTEAGLAAAHVLGEKFGSL
FT                   PELVYVAVRDTRSVSLVNAFEEPVACERGSRVQAAVEVLANEETAIEDAYGMKPLAAFV
FT                   VDPKDYAAKLEDIAHKVTVPELTSLIVEVLASQEVA"
FT   gene            complement(311321..312232)
FT                   /locus_tag="HMPREF0573_10260"
FT   CDS_pept        complement(311321..312232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10260"
FT                   /product="ABC transporter, permease protein"
FT                   /note="COG: COG0395; Pfam: PF00528; InterPro: IPR000515"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10260"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66579"
FT                   /db_xref="GOA:D6ZIN0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIN0"
FT                   /protein_id="ADI66579.1"
FT                   /translation="MSSATAIDAGAAAITTKKVNVNGSVGKKRGGVNVGKVIRYVLLIF
FT                   FLAMVLMPVYVLLITSFKGAGDADPSRTWYLPAEWNTDNWARAWDQLQGGLLRSLMLVI
FT                   PSSIISAMLGSANGFVLSRWRFPGANVVFTLILFGMFIPYQAVMIPMMRMVVASQIGFG
FT                   IHTLILMHIIYGIPITTLIFRNYYESVPRDLIEAARIDGAGMLRTYFNVVLPISIPSFV
FT                   VVLIWQFTSAWNDFLFALFFGGGSQRGPVTLSLNELAHGSIMADYGGSMAGALIASVPT
FT                   LLVYIALGKYFVGGMMAGSVKG"
FT   gene            complement(312229..313200)
FT                   /locus_tag="HMPREF0573_10261"
FT   CDS_pept        complement(312229..313200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10261"
FT                   /product="ABC transporter, permease protein"
FT                   /note="COG: COG1175; Pfam: PF00528; InterPro: IPR000515"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10261"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66580"
FT                   /db_xref="GOA:D6ZIN1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIN1"
FT                   /protein_id="ADI66580.1"
FT                   /translation="MSGNVAVKTPEKARTPQKRQRTRSSNGIKQWGPGLLLVSPSIILV
FT                   AVFVYGLLGSNLFTSLQDNHSAPQVSGVQPVNFVGFANFVALFADKDFQHSLINLLMFT
FT                   VMFLVGTLFFGFIWAWLLDKPIKGEGIFRSVFLFPMAVSFIASGVVWRWMLNSAQGENA
FT                   SGLNRLLQMIGLGGLQNDWISNPTFGVLAVGIPAVWQLSGYVMALFLAGFRGIPDDLRE
FT                   AGRVDGANEWQLYRYIIFPQLAPVALSAAIIIGHMSLKSFDLIMAVADQTFYQTKVPAI
FT                   DMYNFMTVSDYSNAAAVGTVLLVIVALLVVPYLIHDAKESSR"
FT   gene            complement(313386..314675)
FT                   /locus_tag="HMPREF0573_10262"
FT   CDS_pept        complement(313386..314675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10262"
FT                   /product="ABC transporter, solute-binding protein"
FT                   /note="COG: COG1653; Pfam: PF01547; InterPro: IPR006059"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10262"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66581"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIN2"
FT                   /protein_id="ADI66581.1"
FT                   /translation="MRKLIAAAGALALGLTMTACSQASDAGKDGGDAAGSASQVGVVTW
FT                   WEQGSEKEGFDALKKVFAEQHPDVELVKQSESGGGGSNAKQKLAADLAAKNPPDTYQAH
FT                   AGAELSSDIAAGYLEDVSALYDEFKLRDAFPADLIDLLTVDGKIYSIPSNIHRANVVWA
FT                   NVEVMQKAGLDPKAPPKDIKGWIADMEKLKAAGVKYPITVGATWTQLELLETVLISDLG
FT                   TDAYNGLMNGKTDWKGAEVKAALEDYAKILTYADPSLLSEDWEPAMKPVIEGKSAYNVM
FT                   GDWAPPAWENAKMTWGKDYVTFPVPGNEGVFDFLADSFTLPVGAKHPDGTKAWLNTISS
FT                   KEGQIAFNSVKGSIPARSDLTDDELSKFSDYQRSAMESFGKDTIVSSIAHGAALPLAAT
FT                   EKMKSALGKFNSSKDVAALQSELAAAAAAK"
FT   gene            complement(314754..314876)
FT                   /locus_tag="HMPREF0573_10263"
FT   CDS_pept        complement(314754..314876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10263"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66582"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIN3"
FT                   /protein_id="ADI66582.1"
FT                   /translation="MTGRETGFDLTNISQIPVLMSPDRKNVMFQLFFIKTHRNV"
FT   gene            complement(314901..315674)
FT                   /locus_tag="HMPREF0573_10264"
FT   CDS_pept        complement(314901..315674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10264"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66583"
FT                   /db_xref="GOA:D6ZIN4"
FT                   /db_xref="InterPro:IPR008875"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIN4"
FT                   /protein_id="ADI66583.1"
FT                   /translation="MASSTNGVPETGPERLRGLSNFRLKVIAGVFLSFQVASTTVIPYF
FT                   FGTDLKNNFGALTAVVLSEVVSWCAVPIYAWLLAEGFTWTANRWHYLWRLVILALVCEV
FT                   PYDLVTFHRPVDWASQNPVFGLALALLVLILIDFIRRRWSGAQAWMGALAVAGAGVLWA
FT                   LLLHLGTRQGVINIGCLLIGFALIFYLLRLRENTMMMTAGLLGAVSLVTPAIGVAFLHY
FT                   RNETLGYRNSNTRWFCYAVYPLLLMLGAAWGTLLV"
FT   gene            complement(315675..316595)
FT                   /locus_tag="HMPREF0573_10265"
FT   CDS_pept        complement(315675..316595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10265"
FT                   /product="ABC transporter, permease protein"
FT                   /note="COG: COG3833; Pfam: PF00528; InterPro: IPR000515"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10265"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66584"
FT                   /db_xref="GOA:D6ZIN5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIN5"
FT                   /protein_id="ADI66584.1"
FT                   /translation="MNTSAPSTAVEVTPRAGSKTSIMGSLSKRRMVGDIVVHTFLAIMA
FT                   VIWMLPIVWVVAESFNKDPAPYTKTFFPKEFSLDNYIKIFTDRSVMDFPRMYLNTFIIA
FT                   CFTCVISVFFVLMVAYVMSRMRFRLRRTFMSVVLILGMFPGIMAVSAIYFILKAVGLTG
FT                   GGMTILALILVYSAGSGAGFYVMKGYMDTIPNSLDEAAILDGCTRSQVFWKIILPICKP
FT                   MIVYQAIVSFLGPWLDFVMAKVIARTQSDYTVALGLWLMLEKEYIHTWFARFAAGAVLV
FT                   SVPIAILFIVMQRFYQESMSGSVKG"
FT   gene            complement(316592..317995)
FT                   /locus_tag="HMPREF0573_10266"
FT   CDS_pept        complement(316592..317995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10266"
FT                   /product="ABC transporter, permease protein"
FT                   /note="COG: COG1175; Pfam: PF00528; InterPro: IPR000515"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10266"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66585"
FT                   /db_xref="GOA:D6ZIN6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIN6"
FT                   /protein_id="ADI66585.1"
FT                   /translation="MDATQTSNREARLRKKLGKDYVSPSPYSLKVAFREGDAITKASAV
FT                   IFGLGNLTHRQIVKGVIFLLLEIAFFAFLFTNGLGFLAKLPGLGDQEQGKVLVNGYWEY
FT                   SAGDNSVIILLYGVATILIILAFIGVWNLSVRSAYKAQVLTAKSGRAPSIREDIADLLD
FT                   NRSHVGFLFLPTLGILTFSVLPLIFMISMAFTSYDHKHLVLFDWVGLKNFGAIFANSSG
FT                   DVNLRIFSSVLIWTLIWAIFATFLNFFLGMFMAMLINRKTTRFKNFWRACFSMSIAVPQ
FT                   FVSLLVINLMLQPQGAINRLLMDWGWIDQALPFFTDATWARVTVIVVNLWVGIPFTIMQ
FT                   ITGILQNIPADQYEAARIDGANSWVIFRKITMPYIIFVLTPYLITTFTGNVNNFNVIYL
FT                   LSRGAPVPVGDSAGKTDLLITWLYKLTVDKNDYNLGAVIGIMTFIVLAVVSLITYRRSG
FT                   SFKNEEAFR"
FT   gene            complement(318108..319460)
FT                   /locus_tag="HMPREF0573_10267"
FT   CDS_pept        complement(318108..319460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10267"
FT                   /product="ABC transporter, solute-binding protein"
FT                   /note="Pfam: PF01547; InterPro: IPR006059"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10267"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66586"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIN7"
FT                   /protein_id="ADI66586.1"
FT                   /translation="MFASKSGGYFARHFAELSEPGRNPPRLSKGKLMSMTWKKAFGLIA
FT                   ASAVALSMSACGGGAGGNSASGKTEDVSLSVWAPQEDQADGNSWLAKMEESFEKAHPEY
FT                   KITWKNDVVSEGDAKTKVETDPTAAADVYMFANDQLGGLLDAEAIGELGENEAKQVKEQ
FT                   NEASMVDSVTGTDGKIYGVPFTSNTWFMYYNSKKFSADDVKSLDTMLEKGKVSFPLDNS
FT                   WFIQSFYTKGAGLTFFGDKGNDAAKGITFADGDAAATAVTKYLVGLANNPNFMDDAEGS
FT                   GLGALKAGDTDVVFSGTWDAASVKEALGDGYAAAKLPTYKLDGKDVQMEAFAGSKAVAY
FT                   NPHAKNAKAAAQFAAFLGSTEAQKAHYEMRGIVPTDKSLADSITDDDFAAKAQLEVISE
FT                   ASILQPTISAMGSWWDPAQAFGKGILNKEITEATAEAQTQKWSEQLAKMVG"
FT   gene            319469..321256
FT                   /locus_tag="HMPREF0573_10268"
FT   CDS_pept        319469..321256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10268"
FT                   /product="alpha amylase, catalytic domain protein"
FT                   /note="COG: COG0366; Pfam: PF00128; InterPro: IPR013781"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10268"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66587"
FT                   /db_xref="GOA:D6ZIN8"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIN8"
FT                   /protein_id="ADI66587.1"
FT                   /translation="MLAFSSLRLWGNLNIFLIFFPRHQVTNLQGVYIIFGAPDSPQPRE
FT                   RSVRYFEVFVTYLLPHPKERIFVSTSYPRPKWLNNAVFYEIYPQSFQDSNGDGIGDVPG
FT                   IISRLDYLQELGINALWLNPLFDSPFKDAGYDVRDYKLVAPRYGTNEDLVRLFEQAHAR
FT                   GIHVLLDLVPGHTSEEHAWFQSSSRPEPNEFSNRYVWTDSWIAGGDGYPFIGGETERDG
FT                   TYILNFFKCQPALNYGWAHPKYPWQDEALGEAARKTCDAMVDVMRFWLSAGADGFRVDM
FT                   ANSLVKHDDEGKPYTIKTWHYMFDQIRPEFPEAAFVAEWGVPHEAVQAGFDMDFYLDWR
FT                   WDNHPNGYNILLRNTNTPYVRENDLSYFNADAPTDICGFLEQYEPQLRDSEKAEAFFSL
FT                   ITCNHDTWRAAPRLSERELSLSWATILTLPGVPFIYYGDEIGLRHQLLPTKEGGYVRTG
FT                   ARTPMQWDSTDNLGFSTAPATDLYLPVDASADAPTVAAQRAQPDSLWHTVTRVLECKRE
FT                   LPALAADSGFSVLSAEPNQRLFVFKRENAAQSLIVAVNPAHTDAEYDLSQERSVRFSIG
FT                   SAQLTGTTLRMGPQSFAIL"
FT   gene            complement(321360..322346)
FT                   /locus_tag="HMPREF0573_10269"
FT   CDS_pept        complement(321360..322346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10269"
FT                   /product="malate dehydrogenase"
FT                   /EC_number="1.1.1.-"
FT                   /note="COG: COG0039; Pfam: PF00056,PF02866; InterPro:
FT                   IPR010945"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10269"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66588"
FT                   /db_xref="GOA:D6ZIN9"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010945"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIN9"
FT                   /protein_id="ADI66588.1"
FT                   /translation="MAKSPVNVTVTGAAGNIGYSLVFRIASGEMLGPDQPVRIKMLEIT
FT                   PALKAAEGTAMELNDCAFPLLDGIDITDDPNVAFSGCNFGLLVGSMPRKQGMERADLIS
FT                   ANGGIFGPQGKAINDNAADDVRILVVGNPANTNAVIAAASAPDVPASRFNAMMRLDHNR
FT                   ALSQLAEKLNVPVSSVKKMIVWGNHSADQYPDISFCEVDGKPACGLVDEAWLDDYFVPT
FT                   VAKRGAAIIEARGKSSAASAAAAAIDHMHSWACGTPAGDWVTAAIPSAGQYGVPEGLSY
FT                   GFPVTSDGKEWKVVEGLEISEKTQSKIKFNADKAAAEIDTVKSLGIM"
FT   gene            complement(322471..324144)
FT                   /gene="pgi"
FT                   /locus_tag="HMPREF0573_10270"
FT   CDS_pept        complement(322471..324144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgi"
FT                   /locus_tag="HMPREF0573_10270"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="COG: COG0166; Pfam: PF00342; InterPro: IPR001672"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10270"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66589"
FT                   /db_xref="GOA:D6ZIP0"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIP0"
FT                   /protein_id="ADI66589.1"
FT                   /translation="METKDPTTLAAWKDLTTMAAGFHLDLRKAFAADPARAENLSFAAA
FT                   DLHVDLSKNLITGAVFEKLLELSAQAGVRDLSEAMFNGEHINNTENRAVLHTALRAPAG
FT                   TQLMVDGKDVIAEVHEVLRRIYDFADSVRDGSWVGVSSKRIQTVVNIGIGGSDLGPYMA
FT                   YEALRPFVKPGLECRFVSNIDPTDISEKTRDLDPETTLFIIASKTFTTLETITNAKAAR
FT                   AWLLRGLQERGVIDETDAAAKDAISKHFVAVSTALEKVAAFGIDPRNAFGFWNWVGGRY
FT                   SVDSAVGTSLAVAIGREGFEEFLAGFRAIDEHFRNTPPASNVPLLMGLLNVWYSNFLHA
FT                   QTHAVLPYSQYLHRFPAYLQQLTMESNGKRVRRDGTLVSYDTGEVFWGEPGTNGQHAFY
FT                   QLIHQGTRLIPVDFIAFARPTWDLTDSETGKRQHELFLGNFFAQSAALAFGKTPDEVRA
FT                   EGTPEELVAHRTFPGDRPSTSIMAPALTPKVLGELIALYEMITLVQGAVWGIDSFDQWG
FT                   VELGKAMAINLGPAISGDAEALAQADASTRELLEYYFAHK"
FT   gene            complement(324246..326576)
FT                   /locus_tag="HMPREF0573_10271"
FT   CDS_pept        complement(324246..326576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10271"
FT                   /product="6-phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /note="COG: COG0205; Pfam: PF00365; InterPro: IPR009161"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10271"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66590"
FT                   /db_xref="GOA:D6ZIP1"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR009161"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIP1"
FT                   /protein_id="ADI66590.1"
FT                   /translation="MGGSAKTAKTGKSSAKPKSTQSGQEKRIGILTSGGDAQGMNAAVR
FT                   SAVRSAIVLGAKPFAIREGWMGAVQGGSCIHELSWGDVSNTISKGGTIIGTARCPEFRD
FT                   WEGRLKACENLVKNGIDRLVSIGGDGSLRGTEELRQDWPKLLAQLVEEKRLSPEEAKAH
FT                   SSLRIVGLVGSIDNDMAGTDMTIGTDSALNRILAALDQLSSTAASHQRTFVVEVMGRNC
FT                   GYLALMSAVAGGSDYVLFPENPPAPGWEEDMCTVLSEGRKHGRRDSIVVVAEGAKDRDG
FT                   QPITAHYVAEAIEQRTGESARVTILGHIQRGGTPSVYDRWMPTLLGYAAVQDVIEAQPG
FT                   DPAKVMGVRYNRIARLDLTQTVAATSNVHELIKSGEYDQAIASRGTSFTDMVEIFRVLS
FT                   TPPSLLKPLLRKAKKVAVMHVGGLAPGMNMAARAAVRFGLQRGLEVLGIEGSWQGLIDG
FT                   KVHKLRWKDVEGWDFRGGAELGTKREVPTVEQFYAIGRSIENHHIDALVLIGGYNAYLS
FT                   AQAISEELKHYPALQIPMVIVPASIDNNLPGAEISIGTDTALNNAVWSMDLMKESAAAS
FT                   KRCFITETMGRHCGYLALMSGIAAGAERVYLEEENISLETLGKHATEMREAFAKGRRLA
FT                   LVVRNELAGGHYDLKFMANVFKQESLGHFDVRIDSVGYLQQGGAPSPFDRLLAVRLMWE
FT                   TMRHIDVALDSGQCAIEYIGEENGQMSYHDISQMEKQVNPEKRRPINQWWMGLRPLIEV
FT                   MASSNPPIKDFPLPVIDMSGPRS"
FT   gene            326799..328265
FT                   /locus_tag="HMPREF0573_10272"
FT   CDS_pept        326799..328265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10272"
FT                   /product="putative protein, PH0010 family"
FT                   /note="COG: COG1355; Pfam: PF01875,PF01871; InterPro:
FT                   IPR002737"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10272"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66591"
FT                   /db_xref="InterPro:IPR002733"
FT                   /db_xref="InterPro:IPR002737"
FT                   /db_xref="InterPro:IPR023473"
FT                   /db_xref="InterPro:IPR027485"
FT                   /db_xref="InterPro:IPR027623"
FT                   /db_xref="InterPro:IPR036071"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIP2"
FT                   /protein_id="ADI66591.1"
FT                   /translation="MSFVRKPAVAGSFYPQDPGELQRTVDELLKKATALITNDVSRNSQ
FT                   GRPLRQLMGVQVPHAGYIYSGLIAAVGFQLVSTLRPRRVIIAGPTHRVGCHGIALSEAT
FT                   AFVTPLGEVPVDQVAQQYLVEHSSVAKFFEPSHVDEHALEVQLPFLQTVFRDVDFAIVP
FT                   MAVGDCTPEDVCDSLQTLLSIPGENPDDTLIIVSSDLSHYLGYDEARKLDTATLSQVMS
FT                   LEYPLDPRQACGAYAWSGLIRLARRVQWHPQLLMNASSGDTAGDKSRVVGYSSVAFWKY
FT                   NSPEDESGIPDRYGALLPQIAREILTDAFQDDNQIGSINAISKVSASDRALQLLLRSIG
FT                   ASFVTLTNHGQLRGCIGSLAPHRMLGEDIAANTLAAAFEDPRFPPLQASELDQIQIEVS
FT                   VLTEPKPLERFEGESNESYLSRLRPGIDGVILRRDFHRATFLPQVWSELPDVHDFISQL
FT                   MYKAGLGGAKFGPEIKLETYQVQAWGEAKA"
FT   gene            complement(328232..328792)
FT                   /locus_tag="HMPREF0573_10273"
FT   CDS_pept        complement(328232..328792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10273"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66592"
FT                   /db_xref="GOA:D6ZIP3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIP3"
FT                   /protein_id="ADI66592.1"
FT                   /translation="MLRQSSPSALTYRALGKQAGLPHSTIEYHFPTRDDLLMEAASLNV
FT                   EVWVGRARKIRDDAVQLSSAELRDKLPEVLVAAVLPQTTDTQYIRTYFLHALVLAEHQV
FT                   IVEKNREGRARFDEYVADILKAADCSCSPSVVISTIDGLAVEVVSEGGVFPKDVVEKLR
FT                   CFLCSCPALSACLQALASPQACT"
FT   gene            complement(328923..330281)
FT                   /locus_tag="HMPREF0573_10274"
FT   CDS_pept        complement(328923..330281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10274"
FT                   /product="putative proteasome component"
FT                   /note="Pfam: PF03316,PF03136; InterPro: IPR004347"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10274"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66593"
FT                   /db_xref="GOA:D6ZIP4"
FT                   /db_xref="InterPro:IPR004347"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIP4"
FT                   /protein_id="ADI66593.1"
FT                   /translation="MTRLGRVCGLETEYGVTSVYVSDDSNTEESPLGVEEAVREIFAST
FT                   ERSVRVPHGFLSNGARLYVDIGEHPEYAGPECLDLEDVVAQDLAGDAIIQDLVDIANNN
FT                   LRNRGIRIHVLKTNADSWGNSFGCHENYQYGAHTPISLPAFVSFLAARQILCGSGCIDE
FT                   EGKYCFSARAQYITEATSADPTHHKAFINTKEEPHADASHWRRLHVTCVDSAMLPVTVA
FT                   LRAFLADRFLSLLESGKEEEFIVLDDPVTAVKTWNYDPNVRMSAHRGDSAVEVSCPDLL
FT                   RESIELLPEEDDEFGLRDVATRGLAALSEGDFAALSSELDWSLKYQLLSHVSAGETNFG
FT                   GVRARRADLVFHDLSRQYGLREKLLKSGNVKLLVNESSINRAKTIPPANTRAFLRGKVV
FT                   EACDLAGRTASIGWSHVRLDDPPSPQIDLLNPLETESAEVSQLLERIEKLGRK"
FT   gene            complement(330278..330463)
FT                   /locus_tag="HMPREF0573_10275"
FT   CDS_pept        complement(330278..330463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10275"
FT                   /product="ubiquitin Pup protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10275"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66594"
FT                   /db_xref="InterPro:IPR008515"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIP5"
FT                   /protein_id="ADI66594.1"
FT                   /translation="MAKQIQESHSTSENESVEEVELAPQNKISEDKLDALIEDIEDVLN
FT                   VNALSFVQNFKQQGGQ"
FT   gene            complement(330465..332291)
FT                   /locus_tag="HMPREF0573_10276"
FT   CDS_pept        complement(330465..332291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10276"
FT                   /product="putative proteasome accessory factor PafA2"
FT                   /note="Pfam: PF03316,PF03136; InterPro: IPR004347"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10276"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66595"
FT                   /db_xref="GOA:D6ZIP6"
FT                   /db_xref="InterPro:IPR004347"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIP6"
FT                   /protein_id="ADI66595.1"
FT                   /translation="MLSVKRIMSIETEYALSDFPGSEAPAAAETQAAEQAEVLAQRLLR
FT                   SWALEEAKTPGVPVTNHVPDPAGAAVSWRMLPGAGTRFDYSGEHPELDAEGKEHRNLPP
FT                   EARTNEELGAVLTGVKTRWITKVDAFGQHYYRGNSTIAPNGARLYVDHGHPEYSAPECL
FT                   GPLQTALYDRAGDEIMVRAAQALRDNTSPDEAGARALILKNNADAHGSAWGAHENYLVE
FT                   RSVEWQLLVDLFMPFLVSRPIFCGTGRLGLGQNSETAGFQIFQRADFIETEVSLMTTRE
FT                   RPIVNTRDEPHATRRYRRFHVITADSSMFPYSTALRTGTAALLLSLAENFPEQARELAD
FT                   RWALADSVAAIKAFSRDVTLQQTCPLKAGGAATALEIQQGYLEFIREVGFEAGSGGYQQ
FT                   ADSETKWVIENWERVLKSLKTGWHEATALVEWCAKLALLDRKRNQLDCGWDDPRLALLN
FT                   LRFSMVDEGMSLARALEKGGFESLFALDEIQQASREAPAETRAGGRAELLRRFPDQLWA
FT                   ASWMAILVDIGKPQLVRVQFPDPHHPTRHEVQKAVEMCEAKLGSESENREKLVTEVLQA
FT                   LGVELPADLKYYSWDEGYYASESFKEQFEKGK"
FT   gene            complement(332327..333859)
FT                   /gene="arc"
FT                   /locus_tag="HMPREF0573_10277"
FT   CDS_pept        complement(332327..333859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arc"
FT                   /locus_tag="HMPREF0573_10277"
FT                   /product="proteasome ATPase"
FT                   /EC_number="3.6.4.8"
FT                   /note="COG: COG0464; Pfam: PF00004; InterPro: IPR003959"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10277"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66596"
FT                   /db_xref="GOA:D6ZIP7"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR022482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032501"
FT                   /db_xref="InterPro:IPR041626"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIP7"
FT                   /protein_id="ADI66596.1"
FT                   /translation="MSSSHASSNPGGQTSEPQRLENQNTLLASALTQAQSELKNLRKEI
FT                   QRLQEPPLTHGTVVKLVDSAQRLVDVSVMGRRFRVTLGNTITWGRLQLGDTILLNDKMV
FT                   GIGRETAADTGVSAVILEHVDEDRILVTVNNDSVRLLRLSDQLRGTRIRPGDTLLVDLQ
FT                   SGFAQEYLARPEIEGLELDDDPGVNWNQIGGLESVLTLIRETIELPMTHPELYESYQLR
FT                   PPKGILLYGPPGVGKTMIAKAIATSLSEMLGKKAHFLNIKGPELLDKYVGETERRVRAV
FT                   FSRARDKSANGVPVIVFFDEMEALFRTRGTGVSSDVETTVVPQLLAEIDGVEELRNVVI
FT                   IGASNREDLIDPAIVRPGRLDMHIRIPRPNKEACAEILGKYLRENLPYASGAQPAALRD
FT                   EVIDRVFTRDDTTAILRVTRRSGKEETWYLSDLVSGAMLASIVEKAKARAVQQALRGEP
FT                   GIRLEHLVAAIRDETAAHQDLPGVSDPEEWARIVGRSKRLDPIVDITPIQQD"
FT   gene            complement(333978..335291)
FT                   /locus_tag="HMPREF0573_10278"
FT   CDS_pept        complement(333978..335291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10278"
FT                   /product="transporter, major facilitator family protein"
FT                   /note="COG: COG0477; Pfam: PF00083; InterPro: IPR005828"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10278"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66597"
FT                   /db_xref="GOA:D6ZIP8"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIP8"
FT                   /protein_id="ADI66597.1"
FT                   /translation="MSDNNQTEKMETDDTIVRRVLSSSFLGNFAEWMDYGSYSYLATVI
FT                   AVVFFPDGDASVKLLATYAVFALSFLARPIGAFFWGYMGDKKGRKWSLTASILVMTGST
FT                   SLIGLIPSYATIGIAAPLLLLLLRLTQGFSASGEYAGAAIFIAEYAPVNRRGFYCSMVP
FT                   ASTAVGLMCGSFLATILTLTMSDSMMQSIGWRIPFLLAFPLGVVVLTLRLRLEDSEVYL
FT                   RMLDNLKESGKKMSSPLRLLFTKHLKETLICFGVSSLNAIGFYMVFTYLPVYIETEVKL
FT                   GTVESNIITNITLIAYVLMIFSSGKLSDKFGRKKLMIAASVSFILLTVPAFHILNTGQA
FT                   VVILIIELILAYCLTLNDGTLSSFLSETLPTEVRYSGFAISFNLANTIFGGTVGFISTL
FT                   LIKTTGNSISPAYYMCVIAIFALICMIFAKEYKDKELK"
FT   gene            complement(335335..336429)
FT                   /locus_tag="HMPREF0573_10279"
FT   CDS_pept        complement(335335..336429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10279"
FT                   /product="putative membrane protein"
FT                   /note="Pfam: PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10279"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66598"
FT                   /db_xref="GOA:D6ZIP9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIP9"
FT                   /protein_id="ADI66598.1"
FT                   /translation="MTMSTENNYVMNTKLGVITMLISATGMGLVPLFSRWATRTDMFDG
FT                   TKGLNAGNSVGALMAAGRMTMGIIFFVCIVLLTKKVQVWKELKVSPAIIMGGVMIGLSL
FT                   GCYVTSTLLTTVANAVLLIYIGPVVCIVLARIFRKEPMGAVQYICLVAVFTGMLFGNQL
FT                   IGFGDKGFFVDFNLAASTPEFPLAGLGNIFGFLSGIFYGASMFFNGYRKDADTAARGVW
FT                   NFIAATVASGSLALILHLVGTIGHVPGWALDLHLTPFNWVGTVLLWIICGPIALGFLLV
FT                   AGRNLPAADYGIIAYWEVPVALFIGLLIFGEALTINTVLGFILVVGGGMYPSISMLRQS
FT                   RKNRKQSRLSGADQPTEVVDATVS"
FT   gene            complement(336613..337740)
FT                   /locus_tag="HMPREF0573_10280"
FT   CDS_pept        complement(336613..337740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10280"
FT                   /product="Amidinotransferase"
FT                   /note="Pfam: PF02274"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10280"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66599"
FT                   /db_xref="GOA:D6ZIQ0"
FT                   /db_xref="InterPro:IPR033195"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIQ0"
FT                   /protein_id="ADI66599.1"
FT                   /translation="MAKIVSSWNDFDPLKRVIVGRADNSMIPPEEPATSEKVPVDSEMR
FT                   GMWGMRPLETVEKANAQLDNLAKILEDHGVIVDRPTPLQWNQAIGTPDFRNDSMMTCMP
FT                   PRDILLTIGNEIMSAANSFRCRYFEYLAYWPLMNQYFEEDPEFKWTQAPRPRLTDKSYK
FT                   HNYYDERISLEERLERTAAKDFVTTEVEPLWDAADVMRLGKDLFIQHGLTTNRKAMEWF
FT                   KRYYPELRVHAVNFPGDPYPIHIDATFVPLRPGLIINNPHRRLPEEQRKIFEANDWQIV
FT                   DAAQPSHTTPPPLCYSSVWLSMNCLVLDHKTVIVEASETNQLEQMDKLGMNVIPVAFRD
FT                   AYPFGGGLHCSTADVYREGTCEDYFPNQVADPTLV"
FT   gene            complement(338111..338860)
FT                   /locus_tag="HMPREF0573_10281"
FT   CDS_pept        complement(338111..338860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10281"
FT                   /product="succinate dehydrogenase/fumarate reductase
FT                   iron-sulfur subunit"
FT                   /EC_number="1.3.99.1"
FT                   /note="COG: COG0479; Pfam: PF00037; InterPro: IPR012675"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10281"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66600"
FT                   /db_xref="GOA:D6ZIQ1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIQ1"
FT                   /protein_id="ADI66600.1"
FT                   /translation="MNITLRVWRQKGPSDKGALHEYHLTDISEDASFLEMLDILNEQLF
FT                   AQGEEPVAFDSDCREGICGMCGIVINGVPHGPHKNRTTTCQLHMRTFKDGDTITVEPYR
FT                   SRAFPILRDLVVSRAALDRIIQAGGYISVNTGSAPEAHSVPVPKPDADRAFEAAVCIGC
FT                   GSCVAACPNGSAMLFTSAKVTHLGLLPQGKVENYERVVAMLNQHDAEGFGACQNIGECA
FT                   AACPKQIPMDCISFLNRQLGKAFLKGR"
FT   gene            complement(338857..340830)
FT                   /gene="sdhA"
FT                   /locus_tag="HMPREF0573_10282"
FT   CDS_pept        complement(338857..340830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="HMPREF0573_10282"
FT                   /product="succinate dehydrogenase flavoprotein subunit"
FT                   /EC_number="1.3.5.1"
FT                   /note="COG: COG1053; Pfam: PF00890,PF02910; InterPro:
FT                   IPR011280"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10282"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66601"
FT                   /db_xref="GOA:D6ZIQ2"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011280"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIQ2"
FT                   /protein_id="ADI66601.1"
FT                   /translation="MTELIDGYYTEGDKIADTRAPMDVPISERWSTRKFRGGLVNPTNR
FT                   RKLHIIVVGTGLAGGAAAASLGELGYHVDAFFYQDSARRAHSIAAQGGINAAKGYRNDN
FT                   DSVFRLFYDTVKGGDYRSRENNVYRLAEVSADIIDQCVAQGVPFAREYGGLLDNRSFGG
FT                   VQVARTFYARGQTGQQLLIGAYQALSRQVKAGTVIAHERHEMMDLIIKDGKARGIVTRD
FT                   MTNGQVETWIADAVVLASGGYGNVFFLSTNAMGCNVSAAWMAYKHGAYMANPCYTQIHP
FT                   TCIPQHGNFQSKLTLMSESLRNDGRIWVPKKAEDCSKDPREIPEEDRDYYLERIYPSFG
FT                   NLVPRDIASRQAKNMCDEGRGVGPKINGVARGVYLDFSEAIERMGRDKVSEKYGNLFDM
FT                   YQRITGDNPYEVPMRIYPAVHYTMGGLWVDYDLMSNIEGLYVAGEANFSDHGANRLGAS
FT                   ALMQGLSDGYFVLPATISDYLSHGAMPKLNQDDPVVQEARERVTSKVERLMSIQGTQSV
FT                   DSFHKRLGQIMWEKCGMERTDAGLREAITEIRELREEFWKDLRIPGRADELNQSLEKAC
FT                   RLADFLELGELMCIDALHRKESCGGHFRAESQTEEGEALRHDDEFLYVAAWEYGGSDEA
FT                   APILHKEDLIYKDIQLKQRSYK"
FT   gene            complement(340849..341631)
FT                   /gene="sdhC"
FT                   /locus_tag="HMPREF0573_10283"
FT   CDS_pept        complement(340849..341631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhC"
FT                   /locus_tag="HMPREF0573_10283"
FT                   /product="succinate dehydrogenase cytochrome B subunit,
FT                   b558 family"
FT                   /note="InterPro: IPR011138"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10283"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66602"
FT                   /db_xref="GOA:D6ZIQ3"
FT                   /db_xref="InterPro:IPR011138"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIQ3"
FT                   /protein_id="ADI66602.1"
FT                   /translation="MANTTLTTDNKAIKTTVIIKQAMAITGAFFVGFVILHAYGNLKVF
FT                   FGATVYNDYALHLRTFLMPILPYEGLLWILRGLLVVCALVHVISAIVLWRRARLARGSR
FT                   YMVKKSLATAYAGRTVRWGGIILLLFLIFHLAHFTMKFAKVGDAAAYASHQVFLDPMGN
FT                   VVDAAGPGIISVMEGNPYAMMYTTFSNWWMVLVYAIAIGALCLHIAHGVWSALQSMGWL
FT                   RRNTQYTVQIISGLIGLLVFAMFLAPPVAILAGMPMLA"
FT   gene            complement(341820..342332)
FT                   /locus_tag="HMPREF0573_10284"
FT   CDS_pept        complement(341820..342332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10284"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="Pfam: PF00583; InterPro: IPR016181"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10284"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66603"
FT                   /db_xref="GOA:D6ZIQ4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIQ4"
FT                   /protein_id="ADI66603.1"
FT                   /translation="MLRDGVIADAVCLEGAERECFGADAWEREAVASLLVHPDVSVRLS
FT                   FSESGDLAAWAVWGLGEMSVPLRDLPPADRNQAIPTEARGDRLIRVLSLATRPNWQRKG
FT                   YATQLLTDGLRRGRDWGYVGAVLEVRSGNKAAQSLYISQGFQVRAQLPFWFQNPAENGL
FT                   IMVKMFF"
FT   gene            complement(342358..343083)
FT                   /gene="yeaZ"
FT                   /locus_tag="HMPREF0573_10285"
FT   CDS_pept        complement(342358..343083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeaZ"
FT                   /locus_tag="HMPREF0573_10285"
FT                   /product="universal bacterial protein YeaZ"
FT                   /note="Pfam: PF00814"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10285"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66604"
FT                   /db_xref="GOA:D6ZIQ5"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIQ5"
FT                   /protein_id="ADI66604.1"
FT                   /translation="MSYLFIDTCAGAGVALVNPEDPSETLVKVNPDGKAQVEALSSLVA
FT                   DVVQEGGRPEKIVVSRGPAPFTGLRVGLVTARTLGFAWDVPVLGVDELLLQAQAAAGVL
FT                   SGADCPSRARGETPRWIVSLMDARRHEVYAGLFRPNPAGGPVSQCGTDWVGSAGLLKDI
FT                   TQGWDRDFTGFADGRVFLVGNAATQITGQTVDVRFADLARAATSLVNGAAGDTEAPQEL
FT                   ALQSTEPQYLRRPDIQQKS"
FT   gene            complement(343094..344224)
FT                   /locus_tag="HMPREF0573_10286"
FT   CDS_pept        complement(343094..344224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10286"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10286"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66605"
FT                   /db_xref="GOA:D6ZIQ6"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIQ6"
FT                   /protein_id="ADI66605.1"
FT                   /translation="MLSVLPVRRGHKSVLVGIIVLLSAVVMSFAAPGTGQAVADTAPRF
FT                   SVGSATVRATPDGEILEGLASRDFRSDLPDDVRVWFNSKAATLGQSLRGYLPDNAKVSP
FT                   DAQIEVGIPTQVATWSARLLRGTYNSESAVTPIDMWVAPVSIENRELGVVVYTEEEKDL
FT                   YPLRLPSRADALAPKTTAGVPEPTLSSRENNPQVMSGVVLEPKNSHLPVRLDEPGASYA
FT                   LPELAHELLTTAPDAAHHNRPVYDPIIHGWFMLDEERLLPVSNAARARVVGAVTLAQVQ
FT                   EAVQSWWGTVNPTPTPTTEALPTSSNTLVWVVVLAVAIVGIALLVVWLSFRWQSRTEES
FT                   AEVLSLPDLELILVPMSPPTSAVPTLAVNGSAGEAH"
FT   gene            complement(344244..344855)
FT                   /locus_tag="HMPREF0573_10287"
FT   CDS_pept        complement(344244..344855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10287"
FT                   /product="hydrolase, P-loop family"
FT                   /note="COG: COG0802; Pfam: PF02367; InterPro: IPR003442"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10287"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66606"
FT                   /db_xref="GOA:D6ZIQ7"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIQ7"
FT                   /protein_id="ADI66606.1"
FT                   /translation="MSHEGNLLLEVETRSAADTRLLGQALAPFLQAGDLVILEGDLGAG
FT                   KTTLTQGLGVGLQVNQRVTSPTFILARNHTKSPDAPGPNLVHVDAYRLAGSDDVETLDL
FT                   ESALETAVVVVEWGTGKVEDLSAHTLKLSLSRPETAEGPITGTIVDLPEDTTCRVVFHG
FT                   LEGTWDLSGLVQKWEALRAQENASLEPGASAEVCHAEVES"
FT   gene            complement(344902..346230)
FT                   /gene="alr"
FT                   /locus_tag="HMPREF0573_10288"
FT   CDS_pept        complement(344902..346230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alr"
FT                   /locus_tag="HMPREF0573_10288"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="COG: COG0787; Pfam: PF01168,PF00842; InterPro:
FT                   IPR000821"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10288"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66607"
FT                   /db_xref="GOA:D6ZIQ8"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIQ8"
FT                   /protein_id="ADI66607.1"
FT                   /translation="MTNVDVSQWPVRAVVNLSAYQENLAQMRRFAPHSQQMAIVKANAY
FT                   GHGIERMALAALGAGTEWLGVAKASEAFRLRKYLDKHGVPRDHLVDTPTSAMMRSRLYQ
FT                   TAAMGLPSATRPRILTWLYVPHTDLLPVVKSEIDISVSTLDQLDQVSRACDAAGKRARL
FT                   HLKVDTGLCRAGATDEDFPVLCKLARARERAGLVEVSAVWSHLARADEDTAAAEAFTKS
FT                   QLKAFDEAWEVAQEAGLRPQLRHIAATAGIIWYPESHYDLVRVGISGYGLSPNPEIASS
FT                   WQLGVRPVMRLETNVVQVKRVEKGAAVSYGGEWVAPGPRWLGLLPVGYADGLHRLAKNR
FT                   GETWIKGRRAPIVGRIPMDQIVVDLGPAVDDTGTSVPCPVEPGELAIIFGDPKDRLLGG
FT                   IPGVPALPTADDWAEWTDTINYEVITSISPNVPRVYVKDEPER"
FT   gene            complement(346297..347826)
FT                   /locus_tag="HMPREF0573_10289"
FT   CDS_pept        complement(346297..347826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10289"
FT                   /product="putative YjeF domain protein"
FT                   /note="COG: COG0063; Pfam: PF03853,PF01256; InterPro:
FT                   IPR000631"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10289"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66608"
FT                   /db_xref="GOA:D6ZIQ9"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIQ9"
FT                   /protein_id="ADI66608.1"
FT                   /translation="MEKPLVAQADREQGADALMRRAAYALAHHTHRTLSGDYADVTVTP
FT                   APRGRRRVLVLVGAGNNGGDGLYGAAYLRRRGYPVVVLPTSNHIHERGAAAARQAGVEF
FT                   WPRVLPETVAATLDLVQAWKPVAIIDAIIGIGALPPLREPALSLVRGIREWRSRLPDGA
FT                   GPLVVACDHPSGLDLYQGAESGAEPGLLPADLTVTMGAAKTGMLVGPGALTVGSLQIQG
FT                   IGLPEPAMQPSVGLVERADVRDLWPWPDFADHKYSRGVLGVMAGSSRYPGAGVLVTSAA
FT                   LNAGESFLRYLGEPAVQPVVLQACPEVVLGEGRCQARIIGPGLVAGSPQHREQMLDAWR
FT                   RRNPGELVILDAGALGLIGTEIQPDADCLLTPHAGEAAALAAQLGRETTRETIESNPYA
FT                   WASHLAADTHATVLLKGPTTTIANPGGTVYSLTHGTRDLATAGSGDVLAGILGYVFAAA
FT                   TARAEARGESLDVGKMAAVGAWLHTEAGRLAAPTPRATAIVKAIPQALAGL"
FT   gene            348007..349128
FT                   /locus_tag="HMPREF0573_10290"
FT   CDS_pept        348007..349128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10290"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66609"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIR0"
FT                   /protein_id="ADI66609.1"
FT                   /translation="MSKKDSLQLWLLSTPKRLVAGLFLLAAAGILLVLVTLFIVAPQIA
FT                   AMPNQTPSESSHSRSTTKLSSPLLVEVTGSNFRTNSTLKMTPTKSAPEDTPEPPPASLN
FT                   LEGLQDLTYPESFSNVSEVSTRPSPSQTARRMPTPTRSAETSLKKESIESGDPVQFTGM
FT                   QAFFKDLQTGNFGAMQRSCWLITPEVFTDRYTTPPAQKVLLHALSQTPKATDDGVSWSD
FT                   SNVEVRASWSELADRYSCPTAIYDGKMDSVTPEDVSYLIARIMARSSYPFNGADAEENY
FT                   PTLCEKWSPPPGITKYTPEAAQKLHYTERGLLDDDTFKTLQELRSESIHLYTVKNTYPM
FT                   YIRAAHSQLEEPSAYFFRDKDGSLCLGSVVKKS"
FT   gene            349125..350219
FT                   /gene="coaA"
FT                   /locus_tag="HMPREF0573_10291"
FT   CDS_pept        349125..350219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaA"
FT                   /locus_tag="HMPREF0573_10291"
FT                   /product="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /note="COG: COG1072; InterPro: IPR004566"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10291"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66610"
FT                   /db_xref="GOA:D6ZIR1"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIR1"
FT                   /protein_id="ADI66610.1"
FT                   /translation="MRDNFGAPTTELMEDFLTDPRGTQERLRDYQYGSAMREIMAARPH
FT                   QAPSGLEETASPFVMFTREQWSALSDQTPLPLAQADVERLRALGDPIDLAEVDAIYRPL
FT                   TALLQIYAAGTIKIRSRRADFLGESAVQHTPFVIGVAGSVAVGKSSLARLLRELMSRWP
FT                   GTPRVDLVTTDGFLYPNAELVARGIMNRKGFPESYDRRGLLRFLAAVKSGAPEVAAPVY
FT                   SHVTYDIVPGKSQLVCAPDVLILEGLNVLAPPLIADGGNNSLTVSDFFDFSIYLHARPA
FT                   DIEQWYLSRFHQLRATAFKQPDSFFREIATWTDAQADSHARQIWREVNLKNLQENVAPT
FT                   RSRATLILEKDTDHRVHRLHLRKI"
FT   gene            complement(350251..350994)
FT                   /locus_tag="HMPREF0573_10292"
FT   CDS_pept        complement(350251..350994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10292"
FT                   /product="SNARE-like domain protein"
FT                   /note="Pfam: PF09335"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10292"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66611"
FT                   /db_xref="GOA:D6ZIR2"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIR2"
FT                   /protein_id="ADI66611.1"
FT                   /translation="MLTPALPNVTLIPVLLLTAGGNGGWMPISQTITEWIHSFAGSPLA
FT                   LLFLSGLCFTDAFFPPVPAESIVIGLTSWYFAAPGNVVPLPGIFFCAVIGATLGDSFAF
FT                   FLGTRIHVQRIKSWREGKGERAFARTTKLLHKRGTSFIFAARFVPGGRVAVNMCAGATG
FT                   FPYSRFLRTDLAAVICWVAYGMCIGFTSGSILGPVNPLLATVVGMTGGVILSLLLDRLV
FT                   DWLQRRFQWGHLDSTPESGDSTPAE"
FT   gene            complement(351010..353019)
FT                   /gene="glmS"
FT                   /locus_tag="HMPREF0573_10293"
FT   CDS_pept        complement(351010..353019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="HMPREF0573_10293"
FT                   /product="glutamine-fructose-6-phosphate transaminase
FT                   (isomerizing)"
FT                   /EC_number="2.6.1.16"
FT                   /note="COG: COG0449; Pfam: PF00310,PF01380; InterPro:
FT                   IPR005855"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10293"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66612"
FT                   /db_xref="GOA:D6ZIR3"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIR3"
FT                   /protein_id="ADI66612.1"
FT                   /translation="MCGIVGAVGSESTKVAEETVLEGLSRLEYRGYDSAGIAVVDATSA
FT                   SPEITVEKEVGKLSELRKTLEKRPLPNATTAIGHTRWATHGGVTRENAHPHLSYDGKLA
FT                   LIHNGIIENAEPYRAHLETLGIKCVSETDTEVVAHLLERAYLAEPGGNAENAGEQPIAP
FT                   GTIPLCNLDPNLGCAAAATRLARAMLKVTRDLEGSFTLLVEHADAPGVIVAARRSSPLV
FT                   LGLSQGMNFLGSDVLAFAARTKQALEIGQDEVVVVAPAGVLVMDQQGSEILHTQGLDVI
FT                   AQDPAQRKRAYEVDFATDRVTKEGFDTFMEKEIREQPRAVGDTVAGRLDAAEALTLDEL
FT                   RIESEVFRSITSVIIVACGTASYAGQVARYAIEHWCRIPCEVELAHEFRYRDPVVSRRT
FT                   LVVAISQSGETMDTIMAIRHAREQGARVLAIVNTPGSTISREADAVLLTHAGPEIAVAS
FT                   TKAFTAQIAACYLLGLYLAQVRGNKYADEIEDYLEKLGQMPARMQTVLDRYASSLDLGA
FT                   NLDDIKSVIFLGRHVGFPVALEGALKLKEIAYLHAEGFAAGELKHGPIALVESGQPVVI
FT                   IVPTPRRPELHRKVVSNIEEVRARGAVTLVVAEDGDDSVNEFADVVWRVPPTPTLMRPL
FT                   VDVIPLQLLALRMAAHLGYDVDQPRNLAKSVTVE"
FT   gene            complement(353044..354531)
FT                   /gene="glmM"
FT                   /locus_tag="HMPREF0573_10294"
FT   CDS_pept        complement(353044..354531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmM"
FT                   /locus_tag="HMPREF0573_10294"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="COG: COG1109; Pfam: PF02878,PF02879,PF02880,PF00408;
FT                   InterPro: IPR006352"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10294"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66613"
FT                   /db_xref="GOA:D6ZIR4"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIR4"
FT                   /protein_id="ADI66613.1"
FT                   /translation="MVRLEHEKGKTMSQRLFGTDGVRGLANEDITAELALNLGVAAARL
FT                   VVEEKIMATGQMPIVKDLLKEQRESAMAESRTGIKRPRLIPEEPAKPRAIIGRDTRVSG
FT                   QFLDHALAAGLSSAGMDVTRVGVIPTPGVAYLTESQDIELGVVISASHNPMQDNGIKFF
FT                   ARGGYKLPDEMEDRVQAMLGQNWERPLGSGVGDVVANGKAADDAYVNHLVDTVPVSLHG
FT                   LKIVVDCANGAASEIGPRALREAGADVIVINASPDGRNINLNCGSTHPKQLQSMVVAAG
FT                   ADFGVAFDGDADRCLAVDGVGNLVDGDQIMGMLALDLHRSGMLTHDTLVLTVMSNLGLR
FT                   LAMQQVGIKTPTTAVGDRYVLEEMRAHGYILGGEQSGHVINARYATTGDGILTALQIAA
FT                   TVATHQAPLTELVSPIQKLPQTLINVPGVDKTRVNDPRLAEDIAQSEARLGDTGRVLLR
FT                   SSGTEPLVRVMVEAATQEQADAEAQTLANRVQELLAL"
FT   gene            complement(354678..355172)
FT                   /gene="rpsI"
FT                   /locus_tag="HMPREF0573_10295"
FT   CDS_pept        complement(354678..355172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="HMPREF0573_10295"
FT                   /product="ribosomal protein S9"
FT                   /note="COG: COG0103; Pfam: PF00380; InterPro: IPR000754"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10295"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66614"
FT                   /db_xref="GOA:D6ZIR5"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIR5"
FT                   /protein_id="ADI66614.1"
FT                   /translation="MAKTTAEIEELEEVPSEYTTETPTAQDEPGRGNSRIDKGTGLGRR
FT                   KEAVARVRLVPGNGNWTINGRSLEDYFPNKLHQQLVMAPFVLLDLQGRFDVKARIDGGG
FT                   ISGQAGALRLGVSRALNEIDRDANRPALKKAGFLTRDARAVERKKAGLKKARKAPQYSK
FT                   R"
FT   gene            complement(355202..355660)
FT                   /gene="rplM"
FT                   /locus_tag="HMPREF0573_10296"
FT   CDS_pept        complement(355202..355660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="HMPREF0573_10296"
FT                   /product="ribosomal protein L13"
FT                   /note="COG: COG0102; Pfam: PF00572; InterPro: IPR005823"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10296"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66615"
FT                   /db_xref="GOA:D6ZIR6"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIR6"
FT                   /protein_id="ADI66615.1"
FT                   /translation="MKAKEVRTYSPKAGDVDAKWHVVDADGIVLGRLASQVATLLRGKH
FT                   KPTFAPNFDNGDYVIVINAEKVVLTGNKWTEKTAYHHSGFPGGLKATSYQELRDKQPEK
FT                   IIEKAVKGMMPRNRLSKQQLTKLKVYAGPEHPHAGQNPEVFELTQIAQ"
FT   gene            complement(355657..355875)
FT                   /locus_tag="HMPREF0573_10297"
FT   CDS_pept        complement(355657..355875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10297"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10297"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66616"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIR7"
FT                   /protein_id="ADI66616.1"
FT                   /translation="MSFGEWACHTNNLFSRSKYVNYAVILTQARGIVKIKRLYALELVT
FT                   IPTHTAVIPGHTQTFIITKVMRPTIKN"
FT   gene            complement(356053..356961)
FT                   /gene="pflA"
FT                   /locus_tag="HMPREF0573_10298"
FT   CDS_pept        complement(356053..356961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pflA"
FT                   /locus_tag="HMPREF0573_10298"
FT                   /product="pyruvate formate-lyase 1-activating enzyme"
FT                   /EC_number="1.97.1.4"
FT                   /note="COG: COG1180; Pfam: PF04055; InterPro: IPR012838"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10298"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66617"
FT                   /db_xref="GOA:D6ZIR8"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012838"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIR8"
FT                   /protein_id="ADI66617.1"
FT                   /translation="MNLTLERVRVDTIFGTEGSTGEYRPEPSEIEVPRVRGKGLDGIAT
FT                   APEMDRSTHSKLVNAGELGSVHSWELVTAVDGPGTRLTIFLAGCPLRCVYCHNPDTWQM
FT                   REGTPILAKDLLDKIVRYKAVYKATGGGVTFSGGEPMMQPRFLKKLLRDTKAEGIHTNI
FT                   DTSGSLGFSFSDQELELLDLVMLDVKSGNPDTYQKVTGRPLQPTIDFGNRLAQAGIPAW
FT                   IRFVAVPGWTDDADNVKRVADIVANWSNVERLEVLPFHQMGRDKWEELNLDYKLETVQP
FT                   PDEKSIEQIRSIFRARGITVY"
FT   gene            complement(356972..357223)
FT                   /locus_tag="HMPREF0573_10299"
FT   CDS_pept        complement(356972..357223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10299"
FT                   /product="glycine radical domain protein"
FT                   /note="COG: COG1882; Pfam: PF01228"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10299"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66618"
FT                   /db_xref="GOA:D6ZIR9"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIR9"
FT                   /protein_id="ADI66618.1"
FT                   /translation="MAVKTFDERLKDMKANRCASGGVKGLYHANINVLNRDTLEDAMEH
FT                   PEKYPQLTVRVSGYAVNFVRLTHEQQLDIISRTFHNKK"
FT   gene            complement(357270..359372)
FT                   /locus_tag="HMPREF0573_10300"
FT   CDS_pept        complement(357270..359372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10300"
FT                   /product="putative formate C-acetyltransferase"
FT                   /note="COG: COG1882; Pfam: PF02901,PF01228; InterPro:
FT                   IPR004184"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10300"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66619"
FT                   /db_xref="GOA:D6ZIS0"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR005949"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIS0"
FT                   /protein_id="ADI66619.1"
FT                   /translation="MSQIPTATENKAEKPPAWEGFVPGNWCEEIDVRDFIQNNYTPYEG
FT                   DDSFLAEPTEKIKRLWNHLDQNYLSVERKQRVYDVDLDTPADVDAFGPGYISDDDDVIV
FT                   GLQTDVPLKRAMMPNGGWRMVETAIKEAGKEANPEIKRIFTHYRKTHNDAVFDIYTPRI
FT                   RAARSSHIITGLPDAYGRGRIIGDYRRVALYGVDKLIEEKLKAKDRVVNEPFSEHWARY
FT                   REEHAEQIKALDKLKTMAQSYGFDISGPAKTAKEAVQWTYFGYLASVKSQDGAAMSIGR
FT                   LSGFFDIYFERDFKKGILTEPEAQEIIDALVMKLRIVRFLRTKAYDEIFSGDPYWATWS
FT                   DAGFGEDGRTLVTKTSFRLLQTLVNLGPAPEPNITVFWNENLPEGYKKFCAKISIETSS
FT                   IQYEADKQIRDHWGDDAAIACCVSPMRIGKQMQFFGARVNAAKALLYAINGGRDEMTGK
FT                   LVAPGYESISGDEALDFDDVWVKYEAMLDWVIETYVEALNIIHYCHDRYAYEAIEMALH
FT                   DSDIVRTMGCGIAGLSIVADSLAAIKYAKVYPVRDETGLIVDYRTEGDFPTYGNDDDRA
FT                   DDIAATVVHTIMSKIKAIPMYRGAIATQSVLTITSNVVYGKFTGSFPSGHMKGTPFAPG
FT                   ANPENGVDTHGMLASMLSVGKLDYDDALDGISLTNTIVPSSLGRNLDEQVTSLVGIMDA
FT                   GFVRKG"
FT   gene            complement(359945..360952)
FT                   /locus_tag="HMPREF0573_10301"
FT   CDS_pept        complement(359945..360952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10301"
FT                   /product="putative L-ribulose-5-phosphate 4-epimerase"
FT                   /note="COG: COG0235; Pfam: PF00596; InterPro: IPR001303"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10301"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66620"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIS1"
FT                   /protein_id="ADI66620.1"
FT                   /translation="MTGNAGRDDETGNAIIDTARVLLREGLVARTWGNLSQRSGHDRYL
FT                   ITPSGRDYETMTPDHLVEVDFEGKWSGELKPSGERGLHTEIYRELPQVQFIIHTHQPYA
FT                   SALSVGGAPVEIPTELAERIGSETLPIADYGLPSTGKLHKSVLTTLRDTAARAILMQGH
FT                   GAVLFGRDADELVDLAQAVESACQIQFELMTGWSRAGETVRVRRFERDGIGLPPQVIHI
FT                   FMRRDDAGAVVATDDPLFLKFRETGLKAYLDDFSQLVGLKVGKTFGKNMIYGRKATYFL
FT                   GADLDEAEAVFSVAQKNALAALVAETTGAKPIRMMDGTIMRGVYKLKYSKLKDK"
FT   gene            complement(360995..362467)
FT                   /locus_tag="HMPREF0573_10302"
FT   CDS_pept        complement(360995..362467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10302"
FT                   /product="aminotransferase, class III"
FT                   /note="COG: COG0001; Pfam: PF00202; InterPro: IPR005814"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10302"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66621"
FT                   /db_xref="GOA:D6ZIS2"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIS2"
FT                   /protein_id="ADI66621.1"
FT                   /translation="MRINQPSTRAINKQLDDLIKKPIYSISAGALRDYERDYFEAKCSG
FT                   SKSMIEAAKDRIPGGVQHNLAFNHPFPLVITKASGHELTDIDGNVYFDFLQAGGPTVLG
FT                   SNPPEVREEVIKLLHDGGPSTGLFHEYEYKLADLIASRVPTVDMFRMLGSGTEACMAAI
FT                   RVARLATKKKHVLKMGGAYHGWSDQLGYGIRIPGSKFTQAHGVPWTMFRYVDEFMPGDL
FT                   GDLERKLRLKKLHGGTAAVMIEPIGPESGTWPIDQAFLKGVERLCRRYGALLIFDEVVT
FT                   AFRISDRGASGLFGIDSDLTVFGKVIAGGYPGAGGLGGKKEYMKYLAAGIQTGDKVKKA
FT                   LIGGTMAATPISCVAGYHTIKRIVETNTCEYAGEMGNRLTDGLQALVKKYNLPFVCWNE
FT                   GSVCHLETVGTMHFSIDWSKPWTIPHVLSETSKRKKEMEYMGAAYTAEGLITLAGSRLY
FT                   TSAAYTPELIDEALNRFERVFQKVEMKPVTKK"
FT   gene            362537..364144
FT                   /locus_tag="HMPREF0573_10303"
FT   CDS_pept        362537..364144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10303"
FT                   /product="carbohydrate kinase, FGGY family protein"
FT                   /note="COG: COG1070; Pfam: PF00370,PF02782; InterPro:
FT                   IPR000577"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10303"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66622"
FT                   /db_xref="GOA:D6ZIS3"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIS3"
FT                   /protein_id="ADI66622.1"
FT                   /translation="MLILAYDVGTSGVKTCLYRAGSELNLVNSRLGTYDLTIFPNGGAE
FT                   QDPDQWWDAIVETTRELTRENPREMSAVQAISFCSQMQALVLVDESGHHLRPAMSYMDQ
FT                   RAAEQKRRGLETGVKIAGMNAKKLLTSLYRTSAVSASVKDPMWKYLWVRDNEPEIYAKV
FT                   HKWLDVKEYLIARLTGRFVMSVDSAFATLLLDVRASRPAWASRLAQSFGVNPRHLAPIV
FT                   TSATAVGTLLPEVAQELGLPQTATVYAGGGDASLIGVGAGACAVSDTHIYWGTSGWVST
FT                   VTAKRVVDVNSMIATVDGADPGKYNYFAELETAGKCFEWVRKHLAEDEINVYLSHRDQA
FT                   ADMETKYTSLYEYLSEVIERSPAGSGGVIFAPWLHGNRCPFEDANARAMFFNISLETGK
FT                   TEMLRSVIEGVCFHLRWFLETEGKKIHTSDTVRFVGGGALSPVTSQILADVLGRAVETV
FT                   QDPQNVGSVGAALVALVGAKEVDNLVHATQRLVKVQHRYVPNRENRAVYDRQYEVFKGL
FT                   YRANRKAFNLLNNHNRPQ"
FT   gene            364160..364783
FT                   /locus_tag="HMPREF0573_10304"
FT   CDS_pept        364160..364783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10304"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66623"
FT                   /db_xref="GOA:D6ZIS4"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIS4"
FT                   /protein_id="ADI66623.1"
FT                   /translation="MTQTDSPTSPEPQPEQPGNSPATPSESNPSRADDSAPALDSPNPD
FT                   AVVVGQASKGKAALIQAIKFTLLSITAAGVEVASFALMAWIHSLTGWFPFWMSQSVSIA
FT                   LSVIYNFTVNRHFTFKSANNVPIAMLKVALFYVFFIPLTSWGGQVLSDLGWADWLLKGI
FT                   SLLLNFVGEFAWWKFVVFRGSENTNALAIKQAEMSQQHSATAAE"
FT   gene            complement(364826..365719)
FT                   /locus_tag="HMPREF0573_10305"
FT   CDS_pept        complement(364826..365719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10305"
FT                   /product="putative tRNA pseudouridine synthase A"
FT                   /note="COG: COG0101; Pfam: PF01416; InterPro: IPR001406"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10305"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66624"
FT                   /db_xref="GOA:D6ZIS5"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIS5"
FT                   /protein_id="ADI66624.1"
FT                   /translation="MRIRLDIRYDGTPFHGWAAQPGLPTVQGALESALTVIYRQTVELT
FT                   VAGRTDAGVHASGQVAHFTVPEVGDRIVSPDTLAPRLGAVLRAVLSGNLASPLPDSPAA
FT                   YPPNAIDALVVTAATVVPETFDARFSALARHYVYRIVDDLAARNPLSRNCCWWYPTQLD
FT                   AAAMNTSAAVLLGEHDFAAFCKPREGATTIRTLQQLETLRTAPGMMEIRVRADAFCHSM
FT                   VRSLVGALTEVGRAKRDTAWLADALAAKARIPEIPVAPALGLTLTQVDYPQTETELLTR
FT                   QQTTRARRDCGCPERR"
FT   gene            365753..365899
FT                   /locus_tag="HMPREF0573_10306"
FT   CDS_pept        365753..365899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10306"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66625"
FT                   /db_xref="GOA:D6ZIS6"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIS6"
FT                   /protein_id="ADI66625.1"
FT                   /translation="MTVSCGRTASILGLLEIISVLLVQWRIYGAALKKPEGRVQMNPTL
FT                   PEI"
FT   gene            complement(365906..366382)
FT                   /gene="rplQ"
FT                   /locus_tag="HMPREF0573_10307"
FT   CDS_pept        complement(365906..366382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="HMPREF0573_10307"
FT                   /product="ribosomal protein L17"
FT                   /note="COG: COG0203; Pfam: PF01196; InterPro: IPR000456"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10307"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66626"
FT                   /db_xref="GOA:D6ZIS7"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIS7"
FT                   /protein_id="ADI66626.1"
FT                   /translation="MLANLACALFENESVTTTEARAKRLQPLAEKLITKARRGDLHARR
FT                   QVLAKLRNKAVVAKLFEEIAPAIDKEREGGCTRIVKMGYRKGDNAPLAEISLVLEGVEK
FT                   KKKAKPAAPKKDAAKPEVTEAESDTKEAAADAPAAPAEEPAEAKTEETPEEKAE"
FT   gene            complement(366474..367481)
FT                   /gene="rpoA"
FT                   /locus_tag="HMPREF0573_10308"
FT   CDS_pept        complement(366474..367481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="HMPREF0573_10308"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="COG: COG0202; Pfam: PF01193,PF01000,PF03118;
FT                   InterPro: IPR011773"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10308"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66627"
FT                   /db_xref="GOA:D6ZIS8"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIS8"
FT                   /protein_id="ADI66627.1"
FT                   /translation="MPERKSTVLIQAQPKLTEEVINDQRSRFTIEPLEPGFGYTLGNSL
FT                   RRTLLSSIPGSAVTSIKIEGALHEFTTLPGVKEDVTQIVLNIKEIVLSSDNDEPVVMYL
FT                   RKTGEGEVTVGDIMPPAGVVIHNPEHHIATLNKDGKLEIELTVERGRGYVSASQNKDPE
FT                   AEISRIPVDSIYSPVLKVSYRVEATRVEQRTDFDRLVVDVETKKAILPRDAMASAGKTL
FT                   VELFGLARDLNHDAEGIELGPSGNDAALAEDLAMSVEDLDLTSRALNCLTREGINTVGD
FT                   LVARSQADLLDIRNFGQKSIDEIKEKLAGMGMSLKDTPMPAVEGADIPQFSDEN"
FT   gene            367513..367668
FT                   /locus_tag="HMPREF0573_10309"
FT   CDS_pept        367513..367668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10309"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10309"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66628"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIS9"
FT                   /protein_id="ADI66628.1"
FT                   /translation="MARGFEYFGLKVYLPNPGQPSYVPGEDRQRLNRVGHKRNQTRRRF
FT                   GGRQPL"
FT   gene            complement(367629..368024)
FT                   /gene="rpsK"
FT                   /locus_tag="HMPREF0573_10310"
FT   CDS_pept        complement(367629..368024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="HMPREF0573_10310"
FT                   /product="30S ribosomal protein S11"
FT                   /note="COG: COG0100; Pfam: PF00411; InterPro: IPR001971"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10310"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66629"
FT                   /db_xref="GOA:D6ZIT0"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIT0"
FT                   /protein_id="ADI66629.1"
FT                   /translation="MAGKSQATKSRRKERRNVTEGNAYIKSTFNNTIVSITDPSGAVLA
FT                   WSSSGQVGFKGSRKSTPFAAQLAAEAAARRAQEFGLKKVDVFVKGPGSGRETAIRTLTA
FT                   TGLEVGSIQDVTPQAHNGCRPPKRRRV"
FT   gene            complement(368037..368411)
FT                   /gene="rpsM"
FT                   /locus_tag="HMPREF0573_10311"
FT   CDS_pept        complement(368037..368411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="HMPREF0573_10311"
FT                   /product="30S ribosomal protein S13"
FT                   /note="COG: COG0099; Pfam: PF00416; InterPro: IPR001892"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10311"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66630"
FT                   /db_xref="GOA:D6ZIT1"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIT1"
FT                   /protein_id="ADI66630.1"
FT                   /translation="MARLVGVDLPREKRMEIALTYIYGIGRTRATETLAATGVSPDTRV
FT                   KDLTEDELIALRDFIQANYKVEGDLRREVAADIRRKIEINCYQGRRHRAGLPVHGQRTK
FT                   TNARSRKGPKRTVAGKKKAK"
FT   gene            complement(368595..368708)
FT                   /gene="rpmJ"
FT                   /locus_tag="HMPREF0573_10312"
FT   CDS_pept        complement(368595..368708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="HMPREF0573_10312"
FT                   /product="ribosomal protein L36"
FT                   /note="COG: COG0257; Pfam: PF00444; InterPro: IPR000473"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10312"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66631"
FT                   /db_xref="GOA:D6ZIT2"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIT2"
FT                   /protein_id="ADI66631.1"
FT                   /translation="MKVNPSVKPICDKCKVIRRHGRVMVICENPRHKQRQG"
FT   gene            complement(368732..368992)
FT                   /gene="infA"
FT                   /locus_tag="HMPREF0573_10313"
FT   CDS_pept        complement(368732..368992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="HMPREF0573_10313"
FT                   /product="translation initiation factor IF-1"
FT                   /note="COG: COG0361; Pfam: PF01176; InterPro: IPR012340"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10313"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66632"
FT                   /db_xref="GOA:D6ZIT3"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIT3"
FT                   /protein_id="ADI66632.1"
FT                   /translation="MIQKTFCGGLVSPMGKKDGVIEVEGTVVEALPNAMFRVQLANEHV
FT                   VLAHISGKMRQHYIRILPEDRVVVELSPYDLTRGRIVYRYK"
FT   gene            complement(369144..369812)
FT                   /locus_tag="HMPREF0573_10314"
FT   CDS_pept        complement(369144..369812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10314"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66633"
FT                   /db_xref="GOA:D6ZIT4"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIT4"
FT                   /protein_id="ADI66633.1"
FT                   /translation="MTVQSNRIVSLLNKQSQHPLRNAIIFMIGWVILILVGVVFIVTTV
FT                   IPRTQGYVATVVPDDSMSPTLSRSDLLLFQKIRQEGAQKLNPNDIIAYQPTEAVKYKIA
FT                   RISEVMGTGKDMQFGVKFDNPQAESSDGTVTLDMVRGTLRYKVPFCGTVTPLLPPPAVS
FT                   YMLIFVAQLLLIYAGWQIGTSMINARDPQRQARAARLRTAALAGNLETTRQRLRRQGLK
FT                   "
FT   gene            370518..370808
FT                   /locus_tag="HMPREF0573_10315"
FT   CDS_pept        370518..370808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10315"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66634"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIT5"
FT                   /protein_id="ADI66634.1"
FT                   /translation="MSTGSISEAKSSKSPKSKSPKSTSVSTKASSVSVIGAAISESSSG
FT                   SPSGSSAESSSEGSTVESVSAAAGCSASAAGGSSATSSSSSATGAVETASC"
FT   gene            complement(372373..373242)
FT                   /gene="map"
FT                   /locus_tag="HMPREF0573_10316"
FT   CDS_pept        complement(372373..373242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="HMPREF0573_10316"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /note="COG: COG0024; Pfam: PF00557; InterPro: IPR002467"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10316"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66635"
FT                   /db_xref="GOA:D6ZIT6"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIT6"
FT                   /protein_id="ADI66635.1"
FT                   /translation="MSVQDRRIEIKSTNQILKMRRAGMVVVAIHQALREACEPGITTGE
FT                   LDQISAAVIKRMGAKSNFLGYGGFPATVCISINEEVVHGIPGNRVLQFGDLVSFDCGAY
FT                   ITDDASRQWHGDAAFSMICGGETHARPDDLQLLSTTERALWSAIAALANAKYLGEIGDA
FT                   VEKVVAEDTLRYGWEPGIVEEYVGHGIGTAMHQAPDVLNYSTRSRGPKIKPGMVLAIEP
FT                   MLTRGGSVTKELSDGWTAVTVDGSRAAHFEHTVAVLPGGVWVLTAPDGGRAGLAPFGLS
FT                   PRAIAPRG"
FT   gene            complement(373247..373828)
FT                   /locus_tag="HMPREF0573_10317"
FT   CDS_pept        complement(373247..373828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10317"
FT                   /product="adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="COG: COG0563; Pfam: PF00406; InterPro: IPR006259"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10317"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66636"
FT                   /db_xref="GOA:D6ZIT7"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIT7"
FT                   /protein_id="ADI66636.1"
FT                   /translation="MTTNLVIMGPPGAGKGTHAKEIATHFHIPWISTGDIFRKHKAEKT
FT                   ELGKLIESYIDKGEFVPDSVTDRIVCERISQSDATAGFLLDGYPRSIPQAKVLKAVLAE
FT                   ANERVDAAIYLDVSAAEVKQRLLKRAEIEGRTDDTPEVIDHRLEVFFEATQPLLDFYEQ
FT                   EGVLRKVDGEGTIAEIAQRLLTVMEEIERN"
FT   gene            complement(373825..375120)
FT                   /gene="secY"
FT                   /locus_tag="HMPREF0573_10318"
FT   CDS_pept        complement(373825..375120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="HMPREF0573_10318"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="COG: COG0201; Pfam: PF00344; InterPro: IPR002208"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10318"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66637"
FT                   /db_xref="GOA:D6ZIT8"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIT8"
FT                   /protein_id="ADI66637.1"
FT                   /translation="MFTAFIQAFKTPDLRNKLLFTFFIMALFRWGSFIPLPGVDYATLK
FT                   SVISDVQNNGSLLDLVNMFSGGALLQLSVFALGIMPYITASIIIQLLRVVIPRFEDLHK
FT                   EGQTGQAKLTQYTRYLTIALGVLQSTSIITAARTGTLFGRASNQKIIPSDSAWIFILQI
FT                   LVMTAATGLIMWMGELITEKGVGNGMSILIFTSIIANLPRKLFAIAGGNGGIQKFLAIV
FT                   TLILLVTLAVVYVEQAMRRIPVQYAKRMVGRRMYGGTTTYIPLKINMSGVIPVIFASSI
FT                   LSLPMMLAQFGDQNAKWIQWISMNFRSSSWFYLVIYGLLTFAFAFFYTSITFNPEEVAD
FT                   NMKKYGGFVPGLRAGRPTADYLHYVMTRITTAGAVYLTIVALVPQIAMVAMNVPQLPFG
FT                   GTTILIIVGVGLQTVKDINAQLHQHHYEGFMA"
FT   gene            complement(375241..375783)
FT                   /gene="rplO"
FT                   /locus_tag="HMPREF0573_10319"
FT   CDS_pept        complement(375241..375783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="HMPREF0573_10319"
FT                   /product="ribosomal protein L15"
FT                   /note="COG: COG0200; Pfam: PF01305; InterPro: IPR005749"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10319"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66638"
FT                   /db_xref="GOA:D6ZIT9"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIT9"
FT                   /protein_id="ADI66638.1"
FT                   /translation="MSESEKEETAAEKSAAKKAPAAAKKAAASDNVQVTYLHHLRPAPG
FT                   SNKAKTRVGRGEGSKGKTSGRGTKGTKARYQVPLGFEGGQMPMHMRLPKLRGFKNPFHV
FT                   EYQVVNLDRLSEVFPEGGALTVDDLVDKGLVRKNCLVKVLGTGEATAKFDLTVDAWSSS
FT                   AKAKVEAQGGSLTARVR"
FT   gene            complement(375783..375968)
FT                   /gene="rpmD"
FT                   /locus_tag="HMPREF0573_10320"
FT   CDS_pept        complement(375783..375968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="HMPREF0573_10320"
FT                   /product="ribosomal protein L30"
FT                   /note="COG: COG1841; Pfam: PF00327; InterPro: IPR005996"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10320"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66639"
FT                   /db_xref="GOA:D6ZIU0"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIU0"
FT                   /protein_id="ADI66639.1"
FT                   /translation="MAKNLKITQVKSTIGSSRDQRATVATLGLKKIRQSVVRPDNPAVR
FT                   GQIQKVRHLVSVEEVD"
FT   gene            complement(375968..376708)
FT                   /gene="rpsE"
FT                   /locus_tag="HMPREF0573_10321"
FT   CDS_pept        complement(375968..376708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="HMPREF0573_10321"
FT                   /product="ribosomal protein S5"
FT                   /note="COG: COG0098; Pfam: PF00333,PF03719; InterPro:
FT                   IPR000851"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10321"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66640"
FT                   /db_xref="GOA:D6ZIU1"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIU1"
FT                   /protein_id="ADI66640.1"
FT                   /translation="MAEQEQQITGETADSADQTTNLGANDAQDRGGRRERRGNRRERDD
FT                   RRDNRRGGNADDKYIERVVTINRVSKVVKGGRNMSFCALVVVGDGEGTVGVGYGKAKEV
FT                   PAAIAKGVEEAKKSMFHVPMIRHTIVHEVLGEDAAGVVLLKPASPGTGVIAGGPVRAVM
FT                   ECAGIRDVLSKSLGSDNALNIVRGAVAALKQLEQPEAVAARRGLPLERVAPAGMLRARA
FT                   EGEAQVRAEAVKAEAELAAEGVSA"
FT   gene            complement(376723..376968)
FT                   /locus_tag="HMPREF0573_10322"
FT   CDS_pept        complement(376723..376968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10322"
FT                   /product="ribosomal L18p/L5e family protein"
FT                   /note="Pfam: PF00861; InterPro: IPR005484"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10322"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66641"
FT                   /db_xref="GOA:D6ZIU2"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIU2"
FT                   /protein_id="ADI66641.1"
FT                   /translation="MVAQLVNDYEHKTIVSASTMEDALRSAQDNKVAKATEVGKLIAQR
FT                   AKAAGITQCVFDRGGNMYHGRVAAVAEGAREGGLSL"
FT   gene            complement(377097..377630)
FT                   /gene="rplF"
FT                   /locus_tag="HMPREF0573_10323"
FT   CDS_pept        complement(377097..377630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="HMPREF0573_10323"
FT                   /product="ribosomal protein L6"
FT                   /note="COG: COG0097; Pfam: PF00347; InterPro: IPR000702"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10323"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66642"
FT                   /db_xref="GOA:D6ZIU3"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIU3"
FT                   /protein_id="ADI66642.1"
FT                   /translation="MSRIGKIPVEIPAGVEVNINGQDVSVKGPKGTLALSVANPISVQV
FT                   DGSTVVVTRPNDERESRSLHGLTRTLIANMVEGVTKGYAKVLEIQGTGYRVNQKGAGLE
FT                   FQLGFSHPVNVEPPEGITFKVEGNRVTVEGISKELVGEVASNLRKIRPPEPYKGKGVRY
FT                   LGENVRRKVGKAGK"
FT   gene            complement(377643..378041)
FT                   /gene="rpsH"
FT                   /locus_tag="HMPREF0573_10324"
FT   CDS_pept        complement(377643..378041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="HMPREF0573_10324"
FT                   /product="ribosomal protein S8"
FT                   /note="COG: COG0096; Pfam: PF00410; InterPro: IPR000630"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10324"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66643"
FT                   /db_xref="GOA:D6ZIU4"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIU4"
FT                   /protein_id="ADI66643.1"
FT                   /translation="MTMTDPIADMLTRLRNASSAYHESVSMPYSKMKAAIANILQTEGY
FT                   IKDYEVEEARVGKTLTLNLKYGAKRERAISGVKRVSKPGLRVYAKSTKLPKVLGGLGVA
FT                   IISSSSGMLTDREAADKGVGGEVIAYIW"
FT   gene            complement(378096..378281)
FT                   /gene="rpsN"
FT                   /locus_tag="HMPREF0573_10325"
FT   CDS_pept        complement(378096..378281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="HMPREF0573_10325"
FT                   /product="ribosomal protein S14p/S29e"
FT                   /note="COG: COG0199; Pfam: PF00253; InterPro: IPR001209"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10325"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66644"
FT                   /db_xref="GOA:D6ZIU5"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIU5"
FT                   /protein_id="ADI66644.1"
FT                   /translation="MAKTALKNKAARKPKFAVRAYTRCQRCGRPHSVYRKFGLCRICLR
FT                   EMAHNGELPGVKKSSW"
FT   gene            complement(378284..378844)
FT                   /gene="rplE"
FT                   /locus_tag="HMPREF0573_10326"
FT   CDS_pept        complement(378284..378844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="HMPREF0573_10326"
FT                   /product="ribosomal protein L5"
FT                   /note="COG: COG0094; Pfam: PF00281,PF00673; InterPro:
FT                   IPR002132"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10326"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66645"
FT                   /db_xref="GOA:D6ZIU6"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIU6"
FT                   /protein_id="ADI66645.1"
FT                   /translation="MAEENYTPRLKTKYREEIKGQLLKEFQHQNVNQVGGLEKIVVNMG
FT                   VGAAAHDHKLMEGAISDLSIITGQKPVVDKARKSIAQFKLREGSPIGAHVTLRGDRMWE
FT                   FLDRLLSTALPRIRDFRGLSSKQFDGHGNYTFGLTEQSVFHEIDQDSIDHVRGMDITVV
FT                   TTAATDDEGRALLKYLGFPFKED"
FT   gene            complement(378844..379218)
FT                   /gene="rplX"
FT                   /locus_tag="HMPREF0573_10327"
FT   CDS_pept        complement(378844..379218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="HMPREF0573_10327"
FT                   /product="ribosomal protein L24"
FT                   /note="Pfam: PF00467; InterPro: IPR003256"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10327"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66646"
FT                   /db_xref="GOA:D6ZIU7"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIU7"
FT                   /protein_id="ADI66646.1"
FT                   /translation="MAAKLKVGDEVVVITGRDKGKHGRILQIDRKRERVVVEGVMMMKH
FT                   HNKAGRTQQGPTGGIETKEASIHISNVMYYEPAAAKAKLGNTTKKIAGTRVGMREEVVE
FT                   RDGKEKTVRIRVSKATGKDL"
FT   gene            complement(379218..379586)
FT                   /gene="rplN"
FT                   /locus_tag="HMPREF0573_10328"
FT   CDS_pept        complement(379218..379586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="HMPREF0573_10328"
FT                   /product="ribosomal protein L14"
FT                   /note="COG: COG0093; Pfam: PF00238; InterPro: IPR005745"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10328"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66647"
FT                   /db_xref="GOA:D6ZIU8"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIU8"
FT                   /protein_id="ADI66647.1"
FT                   /translation="MIQQESRLKVADNTGAKEILCIRVMGGSKRRYAGIGDTIVATVKD
FT                   AIPGGNVKKGEVVKAVVVRTKKETRRKDGSYIRFDENAAVILKNDEEPRGTRIFGPVGR
FT                   ELREKKFMRIISLAPEVI"
FT   gene            379821..380309
FT                   /gene="cah"
FT                   /locus_tag="HMPREF0573_10329"
FT   CDS_pept        379821..380309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cah"
FT                   /locus_tag="HMPREF0573_10329"
FT                   /product="carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="COG: COG0288; Pfam: PF00484; InterPro: IPR001765"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10329"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66648"
FT                   /db_xref="GOA:D6ZIU9"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIU9"
FT                   /protein_id="ADI66648.1"
FT                   /translation="MFDDLLQANALFAKNFPYRGLPGAPAHGLLIVTCMDSRLDPLEIF
FT                   GLNVGQAKVLRTPGGFLSPNTLAGAIAAVHKLNVDRIMVLEHTRCTMASIDEAGFQRDV
FT                   VAHAGQPVGDLVFGADPNQAQHLRDDVETLRNHALIKGFAEVGGFMYDVETGQVTQAC"
FT   gene            complement(380448..381224)
FT                   /locus_tag="HMPREF0573_10330"
FT   CDS_pept        complement(380448..381224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10330"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="COG: COG1120; Pfam: PF00005; InterPro: IPR003593"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10330"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66649"
FT                   /db_xref="GOA:D6ZIV0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIV0"
FT                   /protein_id="ADI66649.1"
FT                   /translation="MNTYDCRNITFSYQGTVSGKPLLDDLSLTVPTGITLGIIGPNGSG
FT                   KSTLIKCLYKSIIPQKGTINFNGTDLNQISTRQLSKLLSVVVQSETAALPLTVREYVEL
FT                   GRATYHNAFEGYSSQDAEITNSSMEMLGLCELADVPITRVSGGEHQRAKLARALCQSTS
FT                   VMLLDEPTNHLDIYFQHQILKIVKKRNLSAIVVLHDLNLAAIYCELIAVLNKGKIVALG
FT                   KPEDVLIPEILEDVYRVKVQRIDTKHGVQLLLLPMN"
FT   gene            complement(381221..382045)
FT                   /locus_tag="HMPREF0573_10331"
FT   CDS_pept        complement(381221..382045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10331"
FT                   /product="periplasmic binding protein"
FT                   /note="Pfam: PF01497"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10331"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66650"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIV1"
FT                   /protein_id="ADI66650.1"
FT                   /translation="MSIGVASGIFAAKVAKKGQFVLRSGELGEKNPLADEYGAELWDEA
FT                   SPSTEGIIEKGVDLVIGDLYGKADPDKLAAAGIQMYIPSVLCQHAKEENPDLVKGDVSP
FT                   VKLTDVENDIQELGKILNNPDASGKAVHEFDSKYKEAKNTIKDSGKSAAFLFYFSEQYP
FT                   VMSVGEGGIEGAIMRELGLKNIFSDHKEAYLEEVSWEAVLQANPDVIIIKYGRTGSTFE
FT                   QDKARLLKEPGADTLTAVKNDNIIGIANRETWPSPEIATGMLELAKNINKIK"
FT   gene            complement(382260..383108)
FT                   /locus_tag="HMPREF0573_10332"
FT   CDS_pept        complement(382260..383108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10332"
FT                   /product="iron chelate uptake ABC transporter, FeCT family,
FT                   permease protein"
FT                   /note="COG: COG0609; Pfam: PF01032; InterPro: IPR000522"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10332"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66651"
FT                   /db_xref="GOA:D6ZIV2"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIV2"
FT                   /protein_id="ADI66651.1"
FT                   /translation="MVIVWDIRAPRVVLAGLVGMGLSISGAVIQSVVRNILADPYLLGI
FT                   ASGASTGAATVMVFGAVGIFGLTLGAFAGALISICAVFLLTTVGGVLTAERVVFAGIAV
FT                   GLFMSALTNLVVFFYGSQASAHAVMFWMLGSLALASWNQLPIPAVITLLTIAICVSQGP
FT                   RLDAISLSDDTARALGFNPQTLRYVTITVIAGCVASLVAISGAIGFVGLVVPHIARHLV
FT                   GATSRSVVPTAGTLGALLLIWADAVGRVVFAPRELPIGVITALAGTPLLMLLIRKQYKF
FT                   S"
FT   gene            complement(383473..385065)
FT                   /locus_tag="HMPREF0573_10333"
FT   CDS_pept        complement(383473..385065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10333"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="COG: COG1132; Pfam: PF00005; InterPro: IPR003593"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10333"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66652"
FT                   /db_xref="GOA:D6ZIV3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIV3"
FT                   /protein_id="ADI66652.1"
FT                   /translation="MSRILILREVDQLACWMLISLGLLVLSVGLSWWLDMWFAHVYSYK
FT                   IIADLRVDLFDAINRISPAGLRHRKTGDVAAAAMSDVEITEWFYAHTVIDFLATHVANL
FT                   IFTIAMIILVGPSGLILLVVTTLILLVPILTLTLQTKQGDNIRRSLANQKGRCLEMIQG
FT                   SREIMSLGLANLQLDAIRDSTLEVQRHKRSYLIRSGIEIAVSQLMISAATIGALAWLLG
FT                   LMHSGKVNLASIPPAMMLLSASCIAALSISSMLRKLGEVSGATSRYFELIDKPRQVHDH
FT                   GNTAEFTDGLLSLEFRDVCFQYDQAKVINDFSLLIPAGSSVALVGRTGAGKSTLAALVV
FT                   RLYEPQSGEIYIDGKRIDSIPLKQLRQLVTLVPQHPYIFRGTIRDNLLMAKPSASEDEL
FT                   WQSLKIAQIMDTIRNLPKQLDTVIGERGATLSGGQRQRLSLAQAFLRNSSIVIFDESVS
FT                   NLDPKLEQELIEASRFIYEGRTTITIAHRLSTIKSADCVAFLHEGKLAAFGPHSELIQH
FT                   CEPYREFVAPTSA"
FT   gene            complement(385215..386957)
FT                   /locus_tag="HMPREF0573_10334"
FT   CDS_pept        complement(385215..386957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10334"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="COG: COG1132; Pfam: PF00664,PF00005; InterPro:
FT                   IPR001140"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10334"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66653"
FT                   /db_xref="GOA:D6ZIV4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIV4"
FT                   /protein_id="ADI66653.1"
FT                   /translation="MPNGEILKLGRAGWIPMCAASLFGLLHSAVTLSLAWVMSRIFATL
FT                   YSGEYSHLVVLLGVLAVLLLVRPAIALGKELLVSLIGKTVKIDVRLKLLQHLNNIGPFG
FT                   LSSKRTGEAEALVTDGVELLEDYYGRYIPQIAVTVVTAITVLILLFQLDSLVAFIGAIV
FT                   VVLTPTLPKAWNKVLTRRGYRHWEQYSQMNAEVVDAMQGMTTLQLFNGVEERREKIVFT
FT                   SQKLLSTTLSQMRISLLESALSSWVVYGGPVMVLALGVHQAAQGNIAVDSLFWCMFLGV
FT                   ELFRPFQDLSVNWHAGYHGYSTAQKALSLLKAPTPDDSSLPQEHRPRTTEIQFNDVSYR
FT                   YSSALQDAVSDINLEIPEGETLGLVGQSGCGKSTMLGMLLRFGDPSRGNIRIGGVDLRA
FT                   LSRDDRCSLITLVPQEPVIFDGTIADNLRACAPNASDELLKSLCLSLGLEDIAPIDTLL
FT                   DFRVDERGSGVSGGQRQRVAIARALLRETPILLLDEATSALDAETERLTWRAIDNHRNK
FT                   LASKGRSLTIISSAHRLESVRAADRIVVLSAGKIVEIGNHDSLMHQGGTYAMLVATSEE
FT                   LVQS"
FT   gene            387381..387773
FT                   /locus_tag="HMPREF0573_10335"
FT   CDS_pept        387381..387773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10335"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66654"
FT                   /db_xref="GOA:D6ZIV5"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIV5"
FT                   /protein_id="ADI66654.1"
FT                   /translation="MGQQPMPGQPLGQPTGQPMPGQFARPYEHPQEQTVMVLAIIGIFF
FT                   WVTSPIAWYLGSKAKKEMLEQNMEPTSRLKVWTLVAMVLTIIGIVSFAISMSMIIVGGM
FT                   AFMQMANDTNDMSDMSAGLMPLFSAI"
FT   gene            complement(387920..388987)
FT                   /locus_tag="HMPREF0573_10336"
FT   CDS_pept        complement(387920..388987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10336"
FT                   /product="aminotransferase, class I/II"
FT                   /EC_number="2.6.1.-"
FT                   /note="COG: COG1168; Pfam: PF00155; InterPro: IPR015421"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10336"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66655"
FT                   /db_xref="GOA:D6ZIV6"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIV6"
FT                   /protein_id="ADI66655.1"
FT                   /translation="MWVAEMDFGIAPGVRATLQSALDDTVTGYTPVGLSQQVGQALREF
FT                   YADEFGWTIQPDAVGVAADVLSVLQAVVSILPPQAPVVVPTPAYMPFLTLPQDQGHEVI
FT                   QVASLYDAATGKYQLNLEGISQAFATAESGGLLVLCNPWNPVGKCVNADEMSGLCTILE
FT                   QNPHVLVFSDEIHSPLVLDGKLHPFANYSDLAASRTVTASAASKGWNIPGLHCAQWIIP
FT                   DESLRKRLRTPLQVFASGATPWGMLATISAFRDCRNWLGEVKAQIVENRELVRNWLTNH
FT                   GEHFRVFLPEATYLSWWETDGILGDCPARTLQERGLIVNDGADLGTGFEKAFRLNLATT
FT                   PEVLHAALNLIGARG"
FT   gene            complement(389248..389532)
FT                   /gene="rpsQ"
FT                   /locus_tag="HMPREF0573_10337"
FT   CDS_pept        complement(389248..389532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="HMPREF0573_10337"
FT                   /product="30S ribosomal protein S17"
FT                   /note="COG: COG0186; Pfam: PF00366; InterPro: IPR000266"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10337"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66656"
FT                   /db_xref="GOA:D6ZIV7"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIV7"
FT                   /protein_id="ADI66656.1"
FT                   /translation="MADETMTTETTERNHRKVRRGYVVSDRMEKTIVVQLEDRVKHPLY
FT                   GKVMRKTKKVTVHDEQNLAGIGDLVVIMETRPLSKTKHWRLVEIAEKAK"
FT   gene            complement(389536..389778)
FT                   /gene="rpmC"
FT                   /locus_tag="HMPREF0573_10338"
FT   CDS_pept        complement(389536..389778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="HMPREF0573_10338"
FT                   /product="ribosomal protein L29"
FT                   /note="COG: COG0255; Pfam: PF00831; InterPro: IPR001854"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10338"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66657"
FT                   /db_xref="GOA:D6ZIV8"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIV8"
FT                   /protein_id="ADI66657.1"
FT                   /translation="MNMIGSKGLAPNDLDAMDNEQLAMKLKDAKQELFNLRFAQATGQL
FT                   EDHGRIKAVRRDVARIYTIYRERELGIRTEPSVKE"
FT   gene            complement(389775..390191)
FT                   /gene="rplP"
FT                   /locus_tag="HMPREF0573_10339"
FT   CDS_pept        complement(389775..390191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="HMPREF0573_10339"
FT                   /product="ribosomal protein L16"
FT                   /note="COG: COG0197; Pfam: PF00252; InterPro: IPR000114"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10339"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66658"
FT                   /db_xref="GOA:D6ZIV9"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIV9"
FT                   /protein_id="ADI66658.1"
FT                   /translation="MLIPRRTKWRRQHRPGRRGYAKGGTEIAFGDFGIQALESAYLTNR
FT                   QIEAARIAVTRHVKRGGKIWINIFPDRPLTKKPAETRMGSGKGSPEWWVAPVKPGRVLF
FT                   EIAGVSEELAREALSRAQHKLPIKTRFVSREGGE"
FT   gene            complement(390195..391016)
FT                   /gene="rpsC"
FT                   /locus_tag="HMPREF0573_10340"
FT   CDS_pept        complement(390195..391016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="HMPREF0573_10340"
FT                   /product="ribosomal protein S3"
FT                   /note="COG: COG0092; Pfam: PF00417,PF07650,PF00189;
FT                   InterPro: IPR005704"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10340"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66659"
FT                   /db_xref="GOA:D6ZIW0"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIW0"
FT                   /protein_id="ADI66659.1"
FT                   /translation="MGQKVHPTGFRLGVTAEHRSRWFADSTKSGQRYRDFVKEDVEIRR
FT                   LMQDKLERAGISKVEIERTRDRVSVDLYTARPGIVIGRRGAEADRLRAQLEKLTGKQVQ
FT                   LNIREVKNPDLDAQLVAQSIAEQLSARVSFRRAMRKGMQSAQRGGAKGIRVQCSGRLGG
FT                   AEMSRSEFYREGRVPLHTLRANIDYGFYEARTTFGRIGVKVWIYKGDMTETEWNRMQAE
FT                   QAGRTGRRNDRHAGNRRPRADRPADNAPSENVNETPEAATVAAGATTETEA"
FT   gene            complement(391020..391727)
FT                   /gene="rplV"
FT                   /locus_tag="HMPREF0573_10341"
FT   CDS_pept        complement(391020..391727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="HMPREF0573_10341"
FT                   /product="ribosomal protein L22"
FT                   /note="COG: COG0091; Pfam: PF00237; InterPro: IPR001063"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10341"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66660"
FT                   /db_xref="GOA:D6ZIW1"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIW1"
FT                   /protein_id="ADI66660.1"
FT                   /translation="MKAIAHTRYVRVTPQKARRIMNEVRGMEANKALDLLKFAPQKPAL
FT                   PIRKTLVSALANAEQAARNAGTSFNSDEMYVVEAYVNDGPTMKRFRARAQGRGARILKR
FT                   TSHLTIVVGDAEDKKELAAPYLPSQRRPQADRISASAAKKAAAEAVTKKAAKPVETPEE
FT                   STPKTDSAAKKAPAKKSAATKSTTKSSTSKSATSKAATTKSAKAKSSSSKSTATKSATA
FT                   KKPAAKSTEKGAE"
FT   gene            complement(391747..392025)
FT                   /gene="rpsS"
FT                   /locus_tag="HMPREF0573_10342"
FT   CDS_pept        complement(391747..392025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="HMPREF0573_10342"
FT                   /product="ribosomal protein S19"
FT                   /note="COG: COG0185; Pfam: PF00203; InterPro: IPR002222"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10342"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66661"
FT                   /db_xref="GOA:D6ZIW2"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIW2"
FT                   /protein_id="ADI66661.1"
FT                   /translation="MPRSLKKGPFVDAHLQKKVDAQNEANTKNVIKTWSRRSMITPDFL
FT                   GHTIAVHDGRKHVPVFITESMVGHKLGEFAPTRTFRGHDKDDKKGRR"
FT   gene            complement(392041..392877)
FT                   /gene="rplB"
FT                   /locus_tag="HMPREF0573_10343"
FT   CDS_pept        complement(392041..392877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="HMPREF0573_10343"
FT                   /product="ribosomal protein L2"
FT                   /note="COG: COG0090; Pfam: PF00181,PF03947; InterPro:
FT                   IPR005880"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10343"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66662"
FT                   /db_xref="GOA:D6ZIW3"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIW3"
FT                   /protein_id="ADI66662.1"
FT                   /translation="MGIRKYKPTTPGRRGSSVSDFAEITRDHPEKSLVRPLHKTGGRNN
FT                   KGRVTSRRRGGGHKRQYRLIDFRRHDKDGIPAKVAHIEYDPNRSARIALLHYADGEKRY
FT                   ILAPSKLKQGDSIEQGPTADIKPGNNLPLKNIPLGTTIHAVEMRPGGGAKIARSAGVSV
FT                   QLVAKEGRFAQLRMPSGEIRNVDARCRATIGEVGNSDHSNIDLGKAGRSRWLGRRPKVR
FT                   GVVMNPVDHPHGGGEGRTSGGRHPVSPWGKPEGRTRSKKKASNQYIVRRRKTGKNR"
FT   gene            complement(392890..393192)
FT                   /gene="rplW"
FT                   /locus_tag="HMPREF0573_10344"
FT   CDS_pept        complement(392890..393192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="HMPREF0573_10344"
FT                   /product="ribosomal protein L23"
FT                   /note="COG: COG0089; Pfam: PF00276; InterPro: IPR012677"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10344"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66663"
FT                   /db_xref="GOA:D6ZIW4"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIW4"
FT                   /protein_id="ADI66663.1"
FT                   /translation="MSLEKTKNPHDVIIKPVVSEKAYNLIDHGQYTFVVAPNANKVEIK
FT                   LAIEEIFKVKVASVNTQNREGKRVRTRTGWGKRNDTKRAIVTLKEGSIDVFGMQA"
FT   gene            complement(393189..393833)
FT                   /gene="rplD"
FT                   /locus_tag="HMPREF0573_10345"
FT   CDS_pept        complement(393189..393833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="HMPREF0573_10345"
FT                   /product="50S ribosomal protein L4"
FT                   /note="COG: COG0088; Pfam: PF00573; InterPro: IPR002136"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10345"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66664"
FT                   /db_xref="GOA:D6ZIW5"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIW5"
FT                   /protein_id="ADI66664.1"
FT                   /translation="MTENRSVDIFDGVGKKTGTVELPGEVFDLDFNNPLVHQVVNAQLA
FT                   AARQGTHATKTRGDVSGGGKKPWRQKGTGRARQGSIRAPQFTGGGTVHGPQPRDYSQNT
FT                   PKKMKAAALRQALSDRARAGRIHVLSDFGVKETPSTKAAKAALQGVVDSRRALIVLTPE
FT                   VDDVVALSVNNLSEHHALFVGELNTYDVLANDDVVFSATALDSFLGKGENK"
FT   gene            complement(393836..394489)
FT                   /gene="rplC"
FT                   /locus_tag="HMPREF0573_10346"
FT   CDS_pept        complement(393836..394489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="HMPREF0573_10346"
FT                   /product="50S ribosomal protein L3"
FT                   /note="COG: COG0087; Pfam: PF00297; InterPro: IPR000597"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10346"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66665"
FT                   /db_xref="GOA:D6ZIW6"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIW6"
FT                   /protein_id="ADI66665.1"
FT                   /translation="MTDTMASVKALLGRKLGMTQVWDEDGKLIPVTVVQVEKNVVTQIR
FT                   TNETDGYDAVQLGFGKMDERKVTKPMAGHFAKAGVEPRRHLAEIRTGDASSYELGQELG
FT                   AEVFEAGTLVDVSGNTKGKGFAGVMKRHGFQGVSASHGAHRNHRKPGSIGACATPGRVF
FT                   KGLNMAGRMGGNRRTIMNLKVQAVDAEKGLVVLTGAIPGPKGGIVMIRSAVKGA"
FT   gene            complement(394501..394809)
FT                   /gene="rpsJ"
FT                   /locus_tag="HMPREF0573_10347"
FT   CDS_pept        complement(394501..394809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="HMPREF0573_10347"
FT                   /product="ribosomal protein S10"
FT                   /note="COG: COG0051; Pfam: PF00338; InterPro: IPR005731"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10347"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66666"
FT                   /db_xref="GOA:D6ZIW7"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIW7"
FT                   /protein_id="ADI66666.1"
FT                   /translation="MAGQKIRIRLKSYDHEVIDSSAKKIVETVTSAGATVVGPVPLPTE
FT                   KNVYVVIRSPHKYKDSREQFEVRTHKRLIDIIDPTPSAVDSLMRLELPADVNIEIKL"
FT   gene            complement(394980..395900)
FT                   /locus_tag="HMPREF0573_10348"
FT   CDS_pept        complement(394980..395900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10348"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10348"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66667"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIW8"
FT                   /protein_id="ADI66667.1"
FT                   /translation="MQLNRQSCETKSDATFLTLSLLGVLFSEIEMEGYLSDDDFYQRFA
FT                   EADSSLLEDISRSLTKVETISDDRGIIFLQNFLDLYPWGRWKKIYKLPLSPQPFSALNR
FT                   EIFSRLGKRVQRLLTGEHEQPEIAFYVEAVDDNGFDTADAYWWSFDAKPPYRVTLPGKY
FT                   DVNSQLWLPILTDEFQIISPGWHAVNTVRDKSNPIKLLEINSYNDWVSLCNRFPLVKSA
FT                   PYPLNDINGAPQKWVTADLDSARNTYDAIKLSIRGYFDAAYRLQDQIDGIPCLLMGWNP
FT                   GATIWLHPSVSGLREFATGEPISVS"
FT   gene            complement(395891..396502)
FT                   /locus_tag="HMPREF0573_10349"
FT   CDS_pept        complement(395891..396502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10349"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10349"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66668"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIW9"
FT                   /protein_id="ADI66668.1"
FT                   /translation="MFKKIVFVTVFSICMLQAGNVAVAYDGEGANKNTVDVEMLSNELR
FT                   LAIVENRPVSSMSKQEQLELAELLPADGSAISFQSDVYGQLRSAKGICTASTQNIHLRT
FT                   SMQKNYIGNKPETHCDNVAKYIQMDTVIFRKEWYGWGNPTAYSSYRLNVKDFTNKGIAR
FT                   KCVDQTKHDWRAINSHYIVDKFGCKHTLYSSTTAEGLKCS"
FT   gene            complement(396732..397523)
FT                   /locus_tag="HMPREF0573_10350"
FT   CDS_pept        complement(396732..397523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10350"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="COG: COG1101; Pfam: PF00005; InterPro: IPR003439"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10350"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66669"
FT                   /db_xref="GOA:D6ZIX0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIX0"
FT                   /protein_id="ADI66669.1"
FT                   /translation="MLELSHISKAFFRHTVNEKIALRDISLQLDEGDFVTIIGSNGAGK
FT                   STLLNIVSGRYRPDLGQIHIDGNDVTRKPDYKVARYVGRVFQDPMAGTCPHLTIEENLA
FT                   IAWARTHGHGLGLGVTPARKAQFREELKVLEQGLENRLTARVGLLSGGQRQALSLVMAV
FT                   FTQPKILLLDEHTAALDPARAELITRLTQELVARHGLTTLMVTHNMEQALHLGNRLIMM
FT                   HEGEIIMELSGKDKENATVDDLLSQFAKFKGAALSDRTMLS"
FT   gene            complement(397527..398516)
FT                   /locus_tag="HMPREF0573_10351"
FT   CDS_pept        complement(397527..398516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10351"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   permease protein"
FT                   /note="COG: COG4120; Pfam: PF02653; InterPro: IPR001851"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10351"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66670"
FT                   /db_xref="GOA:D6ZIX1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIX1"
FT                   /protein_id="ADI66670.1"
FT                   /translation="MIGAVELGLIYGLMALGVYLTFRILDFADLTIDSSFTTGAAACAV
FT                   VILGGGSPWLGTLAGFAVGLIAGFITGLLNTAGKIHPLLAGILTQIGLYSVNLRIMGKS
FT                   NLPFRREESLFTPLREANLVGTWVSVAILLAVLLVACGIVVWFLSTNLGLALRATGDNE
FT                   EMARAQGVNTDLAKLVGLALSNGLVALSGSLIAQYQGFADISMGIGLIIAGLASVIIGT
FT                   ALIPTGRIWMAVLAVVGGSVVYRVIIQAALMIPGFNPNDMKLLSAVIVVVFLIAPRWKG
FT                   FLSWQKNHPIAEFSGVQPWDTADAEELDSGDTRPADKHVTKRTRRKGL"
FT   gene            complement(398531..398659)
FT                   /locus_tag="HMPREF0573_10352"
FT   CDS_pept        complement(398531..398659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10352"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10352"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66671"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIX2"
FT                   /protein_id="ADI66671.1"
FT                   /translation="MGFCGVERRGILGRYFGWSVSLVFNEWISDPENVTGEPFEYM"
FT   gene            complement(398701..399684)
FT                   /locus_tag="HMPREF0573_10353"
FT   CDS_pept        complement(398701..399684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10353"
FT                   /product="ABC transporter substrate binding protein"
FT                   /note="COG: COG2984; Pfam: PF04392; InterPro: IPR007487"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10353"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66672"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIX3"
FT                   /protein_id="ADI66672.1"
FT                   /translation="MRRIIVSIFVGVAALALASCSSSDGAKGGAAGSDGGYKVAIAQYA
FT                   SFPPLDEAVAGFKDAVQQAGLDVSYDVSNAQGDQTNVNSIASKYASGDYDLVFAIATPM
FT                   AQSIAQNVVDVPVLFTAVTDPVTAELVKSNEAPGYNVTGTTDMNPVAQQIDLVKQVIPD
FT                   AHKIGVIYSSGEVNSQVQVKMAKAEAKKQGLEVVEKTITNTAEVQQAAQTLTGVDAIYI
FT                   PTDNTVIAALDSVLQVAEEKGILTVTGDTSSVENGAALTLGLDYRELGHQTGEMAVKIL
FT                   KGEVQPKTMPVESQKKPQLVVNPEAAKKQGHPLSDELLAKADKTIK"
FT   gene            complement(399809..401434)
FT                   /gene="gabD"
FT                   /locus_tag="HMPREF0573_10354"
FT   CDS_pept        complement(399809..401434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /locus_tag="HMPREF0573_10354"
FT                   /product="succinic semialdehyde dehydrogenase"
FT                   /note="Pfam: PF00171; InterPro: IPR015590"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10354"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66673"
FT                   /db_xref="GOA:D6ZIX4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIX4"
FT                   /protein_id="ADI66673.1"
FT                   /translation="MEYPKGINDKFVQALLDAGRSESGAETPVYNVQTWEPFGTIHCST
FT                   FSEGEQSVLRAHAVSDQWSQEGFYARSRILYRFLKQVVRHYGPIIGLNQLLSGKSWLDA
FT                   SAEYFYMITQVRGIKRNLKYLWKPRRGAGTVPRSTYRVWYRPVGVVGMFTSADNPTSMV
FT                   CDILNPLMAGNAVVNFVTPQAALGSLLMKAMLVDAGMPEDAWRVVVSDSSQFGMKFIPA
FT                   LDYVAAIGSNRMCQQISMECARHSVPVSCFGGIKNIALVMDDAKLWDAAKACARSAFLN
FT                   AGQSINSVEIIFVHESVREPFEQMMLQYTQEQIRVGRFTDRHATMGSLMYPSRVKKCEK
FT                   VVKLALDNGARVLMGSHPRPEISPTFFEPTILSNLPYDLDLLETEVYGPLVALLPFEGI
FT                   TSVVRLVTGSRVIDSASVFTRDIDFVRNLINNAEFATVSVNDTYFSMDMSWRAPIQGKG
FT                   ESGQGIRHGLEAILQYTQVFSATRLKSISWVPKDWRSGNWTERLTFWFMGFYSWLSRNV
FT                   TDTVVADGIRAILRWIRDRFVGPV"
FT   gene            complement(401526..403088)
FT                   /gene="gabD"
FT                   /locus_tag="HMPREF0573_10355"
FT   CDS_pept        complement(401526..403088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /locus_tag="HMPREF0573_10355"
FT                   /product="succinic semialdehyde dehydrogenase"
FT                   /note="Pfam: PF00171; InterPro: IPR015590"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10355"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66674"
FT                   /db_xref="GOA:D6ZIX5"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIX5"
FT                   /protein_id="ADI66674.1"
FT                   /translation="MHGPRKDVVDVESGRLLTRVATASPEDAQESLMTVQAAQVVWTEM
FT                   GSFGRAKVLARFSQLVWKFQNEMVALSQMLSGKSLIDSHEEFLDVLSTARNIKYSSRRL
FT                   GKRRAGRGVLPGSRWRVYQRPLGTVGIFTSPEWPLSSVNDVLQAIAAGNAVVNFVTPQA
FT                   ALGAVLMHAMLVDAGMPYGLWKIIPDTTSKAGRSVIPGLDMVSVLGSEKLGRRISRVCQ
FT                   EYKVPFKGFLQVHNVGVISEDCRFDHAVRAMARAGFQFAGQSVNGAEIIWVQESIFDYF
FT                   KLALKDFVSDQVTIGSLDSADTTMGPMLTPQRIQRMQELVDDAVQRGAELVLGGYAVPE
FT                   LGPSFFEPTILSRVPQDAALFESEVHGPIIYLQPFQDLAEVSRYLGTSRHSYCTYLFTE
FT                   SESTMRDFVHAVDGAAVVINDSYMSLYSTWNAPIQGIKNTGSGIRHGAESILQYSRVQS
FT                   VTRQEGHPWISNDLQPGNRMERWSFFSSRAAVIASILFTDTAIAYAWRNMWHHIKNRIH
FT                   GPV"
FT   gene            complement(403313..404509)
FT                   /gene="tuf"
FT                   /locus_tag="HMPREF0573_10356"
FT   CDS_pept        complement(403313..404509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tuf"
FT                   /locus_tag="HMPREF0573_10356"
FT                   /product="translation elongation factor Tu"
FT                   /note="COG: COG0050; Pfam: PF00009,PF03144,PF03143;
FT                   InterPro: IPR004541"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10356"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66675"
FT                   /db_xref="GOA:D6ZIX6"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIX6"
FT                   /protein_id="ADI66675.1"
FT                   /translation="MAQGTYTHDKPHVNVGTIGHVDHGKTTLTAAITKVLADKYPDLPA
FT                   NKFTPFDQVDNAPEERQRGITINVSHVEYETPNRHYAHVDAPGHADYIKNMITGAAQMD
FT                   GAILVVAATDGPMAQTKEHILLAKQVGVPSILVALNKCDSSDVDEDMLEIVEDEIRDDL
FT                   EKQGFDRDCPIIHVSALKALEGDPEWTKKIEELMEAVDTYIPEPVRDLDKPFLMPIEDV
FT                   FTITGRGTVVTGRVERGKLPLNAEVEIVGIRPTQKTTVTGIEMFHKSMDEAYAGENCGL
FT                   LLRGTKREDVERGQVVCIPGSVTPHTKFEGKVYILKKDEGGRHKSFYDGYRPQFFFRTT
FT                   DVTGVIHLPEGTEMVMPGDTTEISVELIQPIAMEEGLGFAIREGGRTVGSGKVTKIIA"
FT   gene            complement(404719..406857)
FT                   /gene="fusA"
FT                   /locus_tag="HMPREF0573_10357"
FT   CDS_pept        complement(404719..406857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="HMPREF0573_10357"
FT                   /product="translation elongation factor G"
FT                   /note="COG: COG0480; Pfam: PF00009,PF03144,PF03764,PF00679;
FT                   InterPro: IPR004540"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10357"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66676"
FT                   /db_xref="GOA:D6ZIX7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIX7"
FT                   /protein_id="ADI66676.1"
FT                   /translation="MPVALDVLTDLKKVRNIGIMAHIDAGKTTTTERILFYTGINYKIG
FT                   ETHDGASTMDWMEQEQERGITITSAATTCFWNKHQINIIDTPGHVDFTVEVERSLRVLD
FT                   GAVAVFDGKEGVEPQSETVWRQADKYNVPRICFINKMDKLGADFDFSVQTIIDRLGARP
FT                   VVMTFPMGAESDFVGVVDVLRQQAVYFPEKDADGNDTKGAIVEYKDIPAEYQEKAAKYL
FT                   ETATEEAAEASDELMETYLENGELSVDQIKQGIRARTIRSEIYPVYGGSAFKNKGVQPC
FT                   LDGVIDYLPCPLDVEEVRGFRPGHEEDGETESRKPDENEPFAALAFKVAVHPFYGKLTY
FT                   VRVYSGKAEQGTQIYNSTKGKKERVGKLFQMHSNHENPVEVAHAGHIYAFIGLKETTTG
FT                   DTLCAIDKPIVLESMTFPDPVIHVAVEPKSKADQEKMGTAIQKLAEEDPTFTVRLDEET
FT                   GQTVIGGMGELHLDIIVDRMKREFKVEANVGKPMVAYRETIKKKVEKVEYTHKKQTGGS
FT                   GQFAKVLVTFEPLSEEERAEGKTYAFEDKVTGGRVPREYIPSVDAGIQEAMESGVLAGY
FT                   PMVDVKATLEDGAYHEVDSSEMAFKIAGNMVFKEGAKKANPVILEPIMDVEVRTPEEYM
FT                   GDVIGDLNSRRGNIASMNDGQGVKVIRAKVPLSEMFGYIGDLRSKTQGRAVFTMQFDSY
FT                   AEVPRSVSEEIIANNRGA"
FT   gene            complement(406951..407421)
FT                   /gene="rpsG"
FT                   /locus_tag="HMPREF0573_10358"
FT   CDS_pept        complement(406951..407421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="HMPREF0573_10358"
FT                   /product="ribosomal protein S7"
FT                   /note="COG: COG0049; Pfam: PF00177; InterPro: IPR000235"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10358"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66677"
FT                   /db_xref="GOA:D6ZIX8"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIX8"
FT                   /protein_id="ADI66677.1"
FT                   /translation="MPRKGPAPKRPLIADPVYNSPLVTQLVNRVLLDGKKSVAQNIVYG
FT                   ALQGVAHKTEQDPIVVLKRAMENIRPHLEVRSRRVGGATYQVPVEVKASRATTLALRWL
FT                   VDFSRQRREKTMTERLMNEILDASNGLGAAVKRREDVHKMAEANRAFAHYRW"
FT   gene            complement(407424..407690)
FT                   /gene="rpsL"
FT                   /locus_tag="HMPREF0573_10359"
FT   CDS_pept        complement(407424..407690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="HMPREF0573_10359"
FT                   /product="ribosomal protein S12"
FT                   /note="COG: COG0048; Pfam: PF00164; InterPro: IPR005679"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10359"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66678"
FT                   /db_xref="GOA:D6ZIX9"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIX9"
FT                   /protein_id="ADI66678.1"
FT                   /translation="MYTTTPKKPNSALRKVARVRLSSGIEVSAYIPGVGHNLQEHSIVL
FT                   VRGGRVKDLPGVRYHIVRGALDTQGVRDRKQGRSKYGAKKEKK"
FT   gene            408089..409084
FT                   /locus_tag="HMPREF0573_10360"
FT   CDS_pept        408089..409084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10360"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /note="Pfam: PF02517; InterPro: IPR003675"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10360"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66679"
FT                   /db_xref="GOA:D6ZIY0"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIY0"
FT                   /protein_id="ADI66679.1"
FT                   /translation="MSDNQPKPELPEPLEPGAKSPLLAASAATERLTGEKGVWMQATLL
FT                   PLALIGVYLLVTGLTLHIYRAGTHAGSSPREVFDTPVALGICGLILCVAEIAVYRFLVG
FT                   QLAKRPVSELAAKFALPETLAGIAVGAGLVSLPMLLLWVSGHWQLVKVSVEPGVGLGIA
FT                   MGLVSCVWEELLFRGVMVRLFDRAWGPVWALVMSTVVFGGLHLMNPGMTGMGVVALALS
FT                   GGPLLGAAYLWKRRLWFPIGLHFGWNAVQGSFWGSVVSGTGEQRGLLQGTFVGPEWITG
FT                   GSVGMEGSFLTAIVCLVATTLIVLRMRRHPADSAGTPSHNQTTPSVQPEA"
FT   gene            complement(409118..410191)
FT                   /locus_tag="HMPREF0573_10361"
FT                   /note="disA"
FT   CDS_pept        complement(409118..410191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10361"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1623; Pfam: PF02457,PF00633; InterPro:
FT                   IPR003390"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10361"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66680"
FT                   /db_xref="GOA:D6ZIY1"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIY1"
FT                   /protein_id="ADI66680.1"
FT                   /translation="MNDAQRFREVITMLAPGTELRDGLDRVIRAHAGALVVLGYEDHIK
FT                   RICSDGFEFDIDFSATRLRELCKMDGAVIIDPNKWRIRRANVQLLPDPSIPTTESGMRH
FT                   RTAHRVAVQSGNPVIAVSHSLRAISLYLGNKRYVLEDPETLLTRASLAIDTLEKYRIRL
FT                   NEVSDSLTTMEIDDMVTARDVALVVQRQEMVRRVGHEVSDMLIQLGEHGRLLKMQQAEL
FT                   MRGFAVNRSLLIRDYMPDEYSEEKIVNRLGELDDAELLDLSLVARIIGVNGMGSEILEI
FT                   PLSARGLRMLARIPRLPAHIVEAITRRWGTLSELLEVSTEELMEIEGVGPGRAQIIHDS
FT                   LEQVVENSALERISSHS"
FT   gene            complement(410196..410819)
FT                   /locus_tag="HMPREF0573_10362"
FT   CDS_pept        complement(410196..410819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10362"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66681"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIY2"
FT                   /protein_id="ADI66681.1"
FT                   /translation="MIALAIVILAIVGMVVAIREVAAAFTRWQATQAAEAKAYQMRMEE
FT                   RTFPAPQPCADKSLGITLTHPSAVLTVGAGDQAEMVVHNTGKTACTVVIDPTKVGMQII
FT                   SGNQIVFNSTSCQPADAPRKQLLLDRGMTWKQTLKWDGKMQNADCSPASDAAAAGTYRL
FT                   NAVWNGAVTGTETVFAIQDPPPAPSSAPESAPETSHENTTKTVG"
FT   gene            411093..411602
FT                   /locus_tag="HMPREF0573_10363"
FT   CDS_pept        411093..411602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10363"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10363"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66682"
FT                   /db_xref="GOA:D6ZIY3"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIY3"
FT                   /protein_id="ADI66682.1"
FT                   /translation="MSASTRHESSVRGTRHKIVTPHQLAITGIGSLLTFAWYASPDFFT
FT                   EKKPRAWVRLGIIPALTALTALVARDTVTAVRDDIASESPDQEAWEMTSDNVKFDPKNL
FT                   DWRVLMLLGAFGTVLLGCSIWFEFWLFRRGERRRLSGVKLAHTRQAIPISLLFAAGYLI
FT                   DDAQTN"
FT   gene            complement(411641..412123)
FT                   /locus_tag="HMPREF0573_10364"
FT   CDS_pept        complement(411641..412123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10364"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10364"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66683"
FT                   /db_xref="GOA:D6ZIY4"
FT                   /db_xref="InterPro:IPR021517"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIY4"
FT                   /protein_id="ADI66683.1"
FT                   /translation="MSHTRPVVLVLLTVVVGALSATLLNFLYNQGASLPRDGVEFGLVV
FT                   LIISLLSAWLAAQVQRLKKRQSTWMSAVGAARVAALSLALSHTGAIFLGYFGAQTLFIL
FT                   VNLGNDALADMLWKKIVAVIGAVLMTITGLVVEKICTIDPKDPKSQSSPGATPEAA"
FT   gene            complement(412123..413421)
FT                   /gene="folK"
FT                   /locus_tag="HMPREF0573_10365"
FT   CDS_pept        complement(412123..413421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="HMPREF0573_10365"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   diphosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="COG: COG0801; Pfam: PF02152,PF01288; InterPro:
FT                   IPR000550"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10365"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66684"
FT                   /db_xref="GOA:D6ZIY5"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIY5"
FT                   /protein_id="ADI66684.1"
FT                   /translation="MTLHNASNSDFPQEIRGRQVDVLDSLDGLDSITLRGIFARGIHGV
FT                   LESEHHAPQDFSVDLTLWFDSRRAASSDDVADTVDYSVVAEKIVAVIEGKSAALIERLA
FT                   THIALSVLEDSRIAAVQVTLHKPHACLNVQFEDVAIRILRTRSDFEAHQADFPVNLTQR
FT                   PDQIRPAVLALGANLGNPLATLREVVAALQSAPEFERVEVSPLARTRPVLQPGAAPQPD
FT                   YYNAVVRVWSRLSAVELLKLAHHLEDSHGRERPYHWAARTLDVDVIDVEGVVSADSRLV
FT                   LPHPRAATRAFVLVPWSQLDPQATLEGRTVAKLAAWAQDVDGIVNLWADWLETNLDTES
FT                   AKPASNLSAAGSSGTPEVSPRSDSPVRDRDSFGLPSWQAALPQTEARPRVVDNDTEIDI
FT                   IRQQSVAPAASSLSSASPAVPVPEWKRVRRRRH"
FT   gene            complement(413437..414246)
FT                   /gene="folP"
FT                   /locus_tag="HMPREF0573_10366"
FT   CDS_pept        complement(413437..414246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folP"
FT                   /locus_tag="HMPREF0573_10366"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="COG: COG0294; Pfam: PF00809; InterPro: IPR000489"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10366"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66685"
FT                   /db_xref="GOA:D6ZIY6"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIY6"
FT                   /protein_id="ADI66685.1"
FT                   /translation="MGILNVTPNSFSDGGKWFDSSQAVAHGLEMVAQGADLIDVGGEST
FT                   APGRKPVEVEEEIARVLPVISKLSEAGVTVSVDTLHAETAQAAAAAGASIINDVSGGIV
FT                   DDTMFATIATLQSRYPQLSYICQHWRGSPEVANQLAVYDNVAAETWREVESRLELMRHS
FT                   DIDMRRVIIDPGLGFSKVGEQDWEVLANLEVFLHRGYPVLLGPSRKRYLADLETVASDR
FT                   HARDDATAAVSMFCALHKVWAVRVHNVAPVAVAVQAAARLDAHRHSC"
FT   gene            complement(414398..414973)
FT                   /gene="folE"
FT                   /locus_tag="HMPREF0573_10367"
FT   CDS_pept        complement(414398..414973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /locus_tag="HMPREF0573_10367"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="COG: COG0302; Pfam: PF01227; InterPro: IPR001474"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10367"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66686"
FT                   /db_xref="GOA:D6ZIY7"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIY7"
FT                   /protein_id="ADI66686.1"
FT                   /translation="MNASYNPDGVTQAVRDLLVAVGEDPDREGLRDTPERMARSFAEML
FT                   QGYREDPKKHLERMFPVEHNDLVLVKDIPFNSMCEHHLLPFVGLAHVGYIPQGKRVTGL
FT                   SKLARLVDGYAHRLQVQERLTQQIADALWDVLQPQGVIVVLQAEHMCMTIRGVKKPGAR
FT                   TTTSAVRGVMEQSSTTRAEAMSLILSAD"
FT   gene            complement(414970..417249)
FT                   /gene="hflB"
FT                   /locus_tag="HMPREF0573_10368"
FT   CDS_pept        complement(414970..417249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflB"
FT                   /locus_tag="HMPREF0573_10368"
FT                   /product="ATP-dependent metallopeptidase HflB"
FT                   /EC_number="3.4.24.-"
FT                   /note="COG: COG0465; Pfam: PF06480,PF00004,PF01434;
FT                   InterPro: IPR005936"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10368"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66687"
FT                   /db_xref="GOA:D6ZIY8"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIY8"
FT                   /protein_id="ADI66687.1"
FT                   /translation="MDKTNKTQKKKQISGGIAVFVVIAIIVAFMVFSAQGGPKRITTGE
FT                   GLTLLRGNTVEKVVINDGTQTVSMELTKSYQRPRVYLPKDGPFGLKPNADAGKKVSFSY
FT                   VRPQAETVANAVADAKPKKGFDSIYPVSSWWESMLTLMVPMIILFVVFFWFVSRMGGGM
FT                   GPLGMGRAKPRTFNKEDKTKVTFADVAGVNEAVEELQEIKEFLAEPEKFHKLGAKIPKG
FT                   VLLYGPPGTGKTLLARAVAGEAGVPFFSMSGSEFVEMFVGMGASRVRDLFEQARAAAPA
FT                   IIFVDEIDAVGRHRGTGLGGGHDEREQTLNQLLVEMDGFDERTNVIMIAATNRADVLDP
FT                   ALLRPGRFDRQVAVEAPDLKGREAILAVHAKNKPLDPETDMKSLAKRSPGFTGADLANV
FT                   LNEAALLAARHSRETITAQDLDEAVDRVIAGPQKHSRIMNDHDKLVTAYHEGGHALCAA
FT                   ASNYSDPVTKVTILPRGHALGYTMVMPTEDRYSETRNQLLDQLVYAMGGRVVEEIVFQD
FT                   PSTGASNDIENATAIARKMVTRWGLSAGLGAVRYGSSHDEPFVGMDYGKAQEYSDSTAH
FT                   AIDAEVQDLMEAATREAWSIITENRDILDTLARRLLEEETLDEKALDVIFKDVKKAPRR
FT                   KVWQSYEGLTANDRGPIEIPEAVRIRNAKANDESGEGFALDGADRPLADSGIGGTVPFE
FT                   QGEVNTADSPTASEPNTTTPADLGLPVPPVRNEQEVRILDDTDPLPSVEKSGEPLPTSP
FT                   SEEEKQ"
FT   gene            complement(417589..418143)
FT                   /gene="hpt"
FT                   /locus_tag="HMPREF0573_10369"
FT   CDS_pept        complement(417589..418143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="HMPREF0573_10369"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="COG: COG0634; Pfam: PF00156; InterPro: IPR005904"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10369"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66688"
FT                   /db_xref="GOA:D6ZIY9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIY9"
FT                   /protein_id="ADI66688.1"
FT                   /translation="MDAADMGADMERVLLTEEQIQNRLTQMAAVIDKDYEGHELLLVGV
FT                   LRGAVMVMADLARKLHSPIQMDWMAVSSYGSGTKSSGVVRILKDLDTDIKDRHVLIVED
FT                   IIDSGLTLSWLEANLRTRGCASLNIATLLRKPDAAKAVVNPRYVGFDIPNEFVVGYGLD
FT                   YAEHYRNLPFIGLLAPHVYEK"
FT   gene            complement(418247..419494)
FT                   /gene="tilS"
FT                   /locus_tag="HMPREF0573_10370"
FT   CDS_pept        complement(418247..419494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tilS"
FT                   /locus_tag="HMPREF0573_10370"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /EC_number="6.3.4.-"
FT                   /note="Pfam: PF01171; InterPro: IPR012795"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10370"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66689"
FT                   /db_xref="GOA:D6ZIZ0"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIZ0"
FT                   /protein_id="ADI66689.1"
FT                   /translation="MSSLPPFVSPEGAETRLWERDAGGALGEIQLAVRRVLQSLGSPDD
FT                   TLLCLALSGGPDSLSLAAALVRVALHHPHPWDVSCFTVDHGWRPESAAESQAAVQCARE
FT                   LGFSSAMVLRGESGGGANGPEGEARLLRWGLLARAAVAEAKAQGKDHAVILTGHTLDDQ
FT                   AETVLLRLARGSSLRSIAAMREFETLDCKTGLPLRFAWREADSGAVAAVDLSLARPLLG
FT                   IRRELTQAACEQAGLVAVNDPSNRMEGPVKTAAGQPLPRAAIREQVMPALAAALGQDPA
FT                   PALARLAGQAAADDTILGMLAGEVFWEVLSDEPGDWEPGDSVKLELTVIEGYKYRDLIR
FT                   YSAPVLRRVVRRASLLAGARADSLTAAHLRGVVDLIRDWHGQGPLTLPGITVTRRGNFL
FT                   EFSASQNRSDSKQQPE"
FT   gene            complement(419513..420832)
FT                   /locus_tag="HMPREF0573_10371"
FT   CDS_pept        complement(419513..420832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10371"
FT                   /product="NlpC/P60 family protein"
FT                   /note="COG: COG0791; Pfam: PF00877; InterPro: IPR000064"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10371"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66690"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIZ1"
FT                   /protein_id="ADI66690.1"
FT                   /translation="MTLGMGTIPLAVGAPSAKSDRIAQLESAIARNRVKVDAAQLHYAQ
FT                   TAEDFAEATDALNAATSEASESAKKAQAAKRDADAAKAKLGRLAVAMYRQNGNGLSDFA
FT                   AITESDAFRKAALKEAATDALGNQADSQTQGLMALQNVAEVLRDKADRAAKAKKDAAVS
FT                   LATTEKTARNQAQDALDDLKKLETQREKIIVELARERDVTIAEEKARQEKVEQERQAAL
FT                   AVAAQRKRQEQEALAAQQAAARAAQQAAEQKAREQAAKAEADRQARQRAAAPAAPATQP
FT                   SNPAPPPVAAPPQPAPPSPAAAPAPRVVSPPSRAASGGYGPALLEWAKTKTGLPYVWGG
FT                   TGPNGYDCSGLVYAGMRELGKGVQRSAAAQYNAYANVPFSQKQPGDLVFWSNNGTGSGV
FT                   YHVAIYSGGNTILMAPKPGSSVGTFNIYNQNRIMPFVARL"
FT   gene            complement(421132..422901)
FT                   /gene="rho"
FT                   /locus_tag="HMPREF0573_10372"
FT   CDS_pept        complement(421132..422901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="HMPREF0573_10372"
FT                   /product="transcription termination factor Rho"
FT                   /note="COG: COG1158; Pfam: PF07498,PF07497,PF00006;
FT                   InterPro: IPR004665"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10372"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66691"
FT                   /db_xref="GOA:D6ZIZ2"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIZ2"
FT                   /protein_id="ADI66691.1"
FT                   /translation="MREFLPITFEIRILVNDNQLAAMKLSELRELAKSLEIKGISQARK
FT                   PQLIEAIIEKQQSGGSAGTSALAETAAPEQTRVAEHDGEKDAAISASQARAARRHRRAS
FT                   APAGEPAVDETSEKAATLDVKAALERDLGATPTRQRRNHDDVDSVTENNPQLEAVAQGA
FT                   SVRREQTQEERSEHYDRRNRNDRRGRNRNRNRGRDRDDNDNTNSSDEISPEELLPIAGI
FT                   LEVKENHAFVRTSGYLPGPNDVYVTLGQVRRWGLRSGDAIVGAVRKPREGEERRVKHNA
FT                   LVHLESINGQSLEEASQRIEFSKLTPLYPDEQLRLETSSKVLAPRIIDLMAPIGKGQRG
FT                   LIVSPPKAGKTIILQQIANAISINNPEVHIMVVLVDERPEEVTDMQRTVKGEVIASTFD
FT                   RPASEHTTVAELAIERAKRLVELGGDVVVLLDSITRLGRAYNLAAPASGRILSGGVDAS
FT                   ALYPPKRFFGAARNVENGGSLTIIATALVETGSKMDEVIFEEFKGTGNMELRLSRELAE
FT                   KRLYPAVDVNASGTRHEEVLFTKEELSVLWRLRRVLASLELEQAAGVVLQKLKDTQNNA
FT                   EFLMAVAKTTPTE"
FT   gene            423177..424433
FT                   /locus_tag="HMPREF0573_10373"
FT   CDS_pept        423177..424433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10373"
FT                   /product="receptor family ligand-binding protein"
FT                   /note="COG: COG0683; Pfam: PF01094; InterPro: IPR001828"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10373"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66692"
FT                   /db_xref="GOA:D6ZIZ3"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIZ3"
FT                   /protein_id="ADI66692.1"
FT                   /translation="MLCGFGFSISPERFHFSKKGILMKRIIAAAAISALTLTGMTACTS
FT                   PSSGPVAGGNAATGDTIKIGVNYELSGAVATYGKQNVDGIELAFAEINAKGGVKGKKIE
FT                   IVKYDSKSEPAEATTLATKLMSQDKVLTMIGPATSGSFKAVIPAGNQNKVPVISGSATA
FT                   DDVTVTGGKLQEFAFRTCFSDSYQGGVMAKYAAEKLGAKTAVIMGDTSSDYAKGLAKNF
FT                   QENFTKSGGSVVAEEGYVAGDTDFKATLTNIKGKNFDVLYIPGYYQEVGLIIKQARELG
FT                   INAKILGGDGFDSPTLLELAGASALNNVFFTSHYSALDTSNTKLQNFIKTYQDKFGEEP
FT                   SSFNALGYDTAYFVAQAIGEAKELNGPAIAEAMAHAKGFAGVTGSFDMDPQTHDPIKTA
FT                   VVVSLKDGVQDSAEAYALK"
FT   gene            424528..425412
FT                   /locus_tag="HMPREF0573_10374"
FT   CDS_pept        424528..425412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10374"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   permease protein"
FT                   /note="COG: COG0559; Pfam: PF02653; InterPro: IPR001851"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10374"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66693"
FT                   /db_xref="GOA:D6ZIZ4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIZ4"
FT                   /protein_id="ADI66693.1"
FT                   /translation="MDLILQQLINGLSLGSIYALIALGYTMVYGIIQLINFAHGDVLMV
FT                   GAYAGFAGMVLLHLDPFTSLLAAMIICAILGMLIERLAYKPLRHSTRIAVLITAIGMSL
FT                   LIEYVTMYFVGAEARAYPAQTGWLGASYHFGGVNLSMIQIIIVVVSVILMVVLQFIIKK
FT                   TRIGKAMRAVSQDQDAAKLMGISVDNTISFTFALGSALAGAAGVLWGLYYTSITPLMGI
FT                   MPGLKAFVAAVLGGIGLIPGALVGGYLVGLLETIVNSLGLSTFRDATVFLVLIIVLIFK
FT                   PAGILGKNVQEKV"
FT   gene            425416..427266
FT                   /locus_tag="HMPREF0573_10375"
FT   CDS_pept        425416..427266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10375"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="COG: COG0411; Pfam: PF02653,PF00005; InterPro:
FT                   IPR001851"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10375"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66694"
FT                   /db_xref="GOA:D6ZIZ5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIZ5"
FT                   /protein_id="ADI66694.1"
FT                   /translation="MKPGIKSIIAQAIILAVLWGLGYALITVGVIDSYIFNTMVTICVN
FT                   IILAVSLNLVTGFTGQFSLGHAGFMAVGAYSTGLIVTAIPTYGGFFWGLFVGGIFAASI
FT                   GFLIGLPTLRLKGDYLAIATLGMAEIIRVLLLNLEFSGGAAGLFIQLQFTDWNILFILT
FT                   AGTIVLIRNFLDSRHGHSCIAIREDEIAAESIGVYSTRIKTLAFVVGSFFGAVGGGLYI
FT                   GNFFFVKPDLFNFMMSINILVIVVLGGLGSLTGSIIAAILLAVVSTLLQPFPEIRMILY
FT                   ALVLVILMVFRPQGLLGTKELNFKVFGRLLRKPTGKGEPKRSNALPAPSAAKKETPHLE
FT                   PNSEEKEESSQRAHAILDVHRLTRHFGGLAALTDVDMYLQPGELIGLIGPNGAGKTTVF
FT                   NLLTGVYPPSSGTVTFRPDPKGGEISIAGQKPFVISRCGIARTFQNIRLFKDLTVLDNV
FT                   VFAMEQREKYSLLASFLHLPSWSRSRQRVHKDSLQLLEMMNLAEKAGEHARNLSYGEQR
FT                   HLEIARALATNPQLLLLDEPAAGMNPAETAQLTALIAKLRQRYHLTILLIEHDMSLVMT
FT                   ICERLYVLDHGVVIASGTPQEVRNNPKVIEAYLGQEVENV"
FT   gene            427259..427963
FT                   /locus_tag="HMPREF0573_10376"
FT   CDS_pept        427259..427963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10376"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="COG: COG0410; Pfam: PF00005; InterPro: IPR003439"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10376"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66695"
FT                   /db_xref="GOA:D6ZIZ6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIZ6"
FT                   /protein_id="ADI66695.1"
FT                   /translation="MFEIKDLKVSFGGIQALKGISLRVEEGEIVTLIGANGAGKTTTLR
FT                   TASGLERPLEGSIWLDGEEITKSSPRSRVRHGLVHVPEGRRVFPTMTVMENLDLGAYMR
FT                   KDRSGTAADLKMVFDRFPVLADRKNQLAGTLSGGEQQMLAMGRGLMAKPRVLLLDEPSM
FT                   GLAPLFVQEIFDIIVKIKEMGTTILLVEQNANMALQIASRAYVMETGKIVLQGDAAELL
FT                   ASDEVKHAYLGG"
FT   gene            427984..428604
FT                   /locus_tag="HMPREF0573_10377"
FT   CDS_pept        427984..428604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10377"
FT                   /product="CBS domain protein"
FT                   /note="COG: COG0517; Pfam: PF00571,PF01842; InterPro:
FT                   IPR000644"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10377"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66696"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIZ7"
FT                   /protein_id="ADI66696.1"
FT                   /translation="MTANPFTIDSGATVPDAIELMQTHGITKLPVLRDGKLCGVVSQLD
FT                   LNRALPSDATSLSFGEVAYLLSKLKIYKIMRKNPPTIAPDAMLEEAAILMRDTKVEILP
FT                   VLDEGKVVGVITESDVLDAFIDINGAREPGTRLVIEADDQPGVMSRLAGVTEELETNIT
FT                   HIAVYRTGMESSFVLLGVNTVNTADLEDAFTKAGFQVRYVLRR"
FT   gene            complement(428731..429636)
FT                   /gene="thrB"
FT                   /locus_tag="HMPREF0573_10378"
FT   CDS_pept        complement(428731..429636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="HMPREF0573_10378"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /note="COG: COG0083; Pfam: PF00288,PF08544; InterPro:
FT                   IPR000870"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10378"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66697"
FT                   /db_xref="GOA:D6ZIZ8"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIZ8"
FT                   /protein_id="ADI66697.1"
FT                   /translation="MNFVRDEVTVSVPASSANLGPGFDALGIALELRDEIRVRATTGAT
FT                   HVTVEGEGAGKVPEDDTNMVVQALRAGLESVGASQIGIEMHCVNRVPHGRGLGSSSAAL
FT                   VSGLAAAGALLEPGALDTEAIFQLAVQMEGHPDNAAPAVYGGAVVGWMEPSAGQVTPRA
FT                   YAQQFEVSPQVRLTVLIPEFELATSQARGLLPESVPHRDAAFNAGRAALLPLALAQHPE
FT                   LLFFATEDRLHQEYRREGMPQSLEMVDRLRAAGTPAAISGAGPTVIVFDHLDPATRQDL
FT                   EHLGWKPRELPVAPQGIIVR"
FT   gene            complement(429708..430919)
FT                   /gene="thrC"
FT                   /locus_tag="HMPREF0573_10379"
FT   CDS_pept        complement(429708..430919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrC"
FT                   /locus_tag="HMPREF0573_10379"
FT                   /product="threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /note="COG: COG0498; Pfam: PF00291; InterPro: IPR004450"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10379"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66698"
FT                   /db_xref="GOA:D6ZIZ9"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR026260"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZIZ9"
FT                   /protein_id="ADI66698.1"
FT                   /translation="MPKPAPSRAKTVEVIETTIKEQPNMAQMWSGLLEEYRNRLPLEPS
FT                   DPVVTLFEGNTPLIRARRVEQRIGALSDKAGVDTTGTEVYVKFEGANPTGSFKDRGMTM
FT                   AMTKVKAAGTQMVACASTGNTSASAAAYSVAAGVGCAVILPAGKIALGKLAQAVMHGAK
FT                   LIAVDGNFDDCLRITRELTEKYPVDLVNSINPYRLQGQKTAAFEICDAFGDAPDIHCLP
FT                   VGNAGNISAYWMGYNEYFGRKVASSIEDSAQKLKPQTTKLPQMWGIQANGAAPFVAGHP
FT                   IENPETIATAIRIGNPASWDYATAARDDSGGLITAVSDAAIMQAQSIIAAEVGVFCEPA
FT                   SAAPVAGLLALAEQGKVPGGVRIVCTLTGNGLKDTATAMEAKGNMTPPVIAPSLQAAVR
FT                   ELGL"
FT   gene            complement(430946..432241)
FT                   /locus_tag="HMPREF0573_10380"
FT   CDS_pept        complement(430946..432241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10380"
FT                   /product="homoserine dehydrogenase"
FT                   /EC_number="1.1.1.3"
FT                   /note="COG: COG0460; Pfam: PF03447,PF00742; InterPro:
FT                   IPR001342"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10380"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66699"
FT                   /db_xref="GOA:D6ZJ00"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR016204"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ00"
FT                   /protein_id="ADI66699.1"
FT                   /translation="MAQKQDVKIGLLGAGTVGLQVARILHDQQQELAARAGANLVLSAV
FT                   AVRDTSKVREGLDQSLLTTDIDAVINSADLVIELMGGLEPARSAMLKALEAGKTVVTGN
FT                   KAVLAQYGPELYETAARTDANLYFEAAVAGAVPVVYGLRESLTGDRINKVLGIVNGTTN
FT                   YILDQMTTHGWSYEQALHQAQELGYAEADPSADVGGRDAAAKCAILASLAFHTRVNLED
FT                   VPVKGITEVSAQDIKQATESGYAVKLLARAERVIVEGEEQIALGVEPTLVPQSHPLASI
FT                   TGPYNAIVLETEFAGRLMFYGAGAGGAPTASAVLSDVVAGANHLVSGGHAPRESVYAAL
FT                   PICEPGRVETRRQVRLEVADRIEMMAEIAKIYAVGGVSIASLTQSPTETVPTEATLVIS
FT                   THRAQNSQHDGITAALAKSPIVHKIASEMSIE"
FT   gene            complement(432266..432421)
FT                   /locus_tag="HMPREF0573_10381"
FT   CDS_pept        complement(432266..432421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10381"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66700"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ01"
FT                   /protein_id="ADI66700.1"
FT                   /translation="MAPFFSTQLRHVRKELTVDLAAGNPARLHLAPLDLHYRKFLDDHP
FT                   ADTVKG"
FT   gene            complement(432422..434101)
FT                   /gene="argS"
FT                   /locus_tag="HMPREF0573_10382"
FT   CDS_pept        complement(432422..434101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="HMPREF0573_10382"
FT                   /product="arginine--tRNA ligase"
FT                   /EC_number="6.1.1.19"
FT                   /note="COG: COG0018; Pfam: PF03485,PF00750,PF05746;
FT                   InterPro: IPR001278"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10382"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66701"
FT                   /db_xref="GOA:D6ZJ02"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ02"
FT                   /protein_id="ADI66701.1"
FT                   /translation="MTPEELTQRIIAQLSTAAAENNIVLADGVLAEKMRVERPKNRDHG
FT                   DWATNIALQLGKSVGKNPRELAEIFASAIAQIDGVSSAEVAGPGFINIRLEAGAAGALV
FT                   ADILASGNDYGHGEGLKGVHINLEYVSANPTGPLHIGGARWAAVGDSLARLYKFSGAKV
FT                   TREYYFNDHGSQIDRFAISLLAAARGQETPEDGYGGQYIADIAAKVQAEAKAAGDPDPA
FT                   TLDDEAAQEYFRSHGVELMFDEIKESLRGFRTEFDVFFHENSLYETGAVTKALDYLRER
FT                   GEVIEKDGATWLLTTKHGDDKDRVVIKSDGNASYFASDVAYYQDKRRRGADRAVFLLGA
FT                   DHHGYVGRMMAMCAAYGDKPGVNMQIIIGQLVNLFKDGEPVRMSKRAGDIVTLEDFVEA
FT                   VGVDAARYALVRSSMDTQLAIDLDVLASHTNENPVYYVQYAHARTSNVAKNAAAHGVSC
FT                   ADGFAPEELRDPADAALIGVLAQFPSVVATAAAENATHLVPRYLENLSGAYHTWYGKRR
FT                   VTPAGDEPVTAEHAALLALNNAVGQVLRNGLDLLGVTAPERM"
FT   gene            complement(434208..434280)
FT                   /locus_tag="HMPREF0573_t10005"
FT   tRNA            complement(434208..434280)
FT                   /locus_tag="HMPREF0573_t10005"
FT                   /product="tRNA-Arg"
FT   gene            complement(434332..435588)
FT                   /locus_tag="HMPREF0573_10383"
FT   CDS_pept        complement(434332..435588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10383"
FT                   /product="metal ion transporter, metal ion (Mn2+/Fe2+)
FT                   transporter (Nramp) family"
FT                   /note="COG: COG1914; Pfam: PF01566; InterPro: IPR001046"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10383"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66702"
FT                   /db_xref="GOA:D6ZJ03"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ03"
FT                   /protein_id="ADI66702.1"
FT                   /translation="MTHFHDNPKTSQKSLVALMGPAFVAAVAYVDPGNVAANITAGARY
FT                   GYTLVWVLVLANLMAMLVQYESAKFGIVTGRSLPQVLGDRLRRPGRIAFWIQAEIVAGA
FT                   TDLAEVIGGAIALNLLFGTPLLVGGLIIGVVSLGMLFLQNTSGQIVFERVIIALLLVIT
FT                   LGFVGGLVVAPPSWQAAVAGLRPTFPNAESVLVAASMLGATVMPHAIYLHSSLTKDRHG
FT                   SEHPDDQKRRLIRATKLDVFWALLVAGSVNIALVLLAAAALRGPGTGQTDTDTIEGAYH
FT                   VIAIALGGGVATVFAVGLLASGLASTSVGAYAGAEIMSGLLHVRVPLLARRVVTLIPGL
FT                   AILALGFNPTWALVLSQALLSLGIPFALLPLVIYTSKKTIMGSFADPKWLLAINIVVAA
FT                   LIVALNLGLLVLLMLGMGG"
FT   gene            complement(435657..436046)
FT                   /locus_tag="HMPREF0573_10384"
FT   CDS_pept        complement(435657..436046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10384"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66703"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ04"
FT                   /protein_id="ADI66703.1"
FT                   /translation="MEQQRSAVRLAAVVAKQRQSSDALQGAQTVVDEHTQWVLSHLSSG
FT                   DRDLIKSVTGEVIEPGADSASLFALTLAESRINQASATTAHSQNQQLLMRRPQPLSQHD
FT                   RIATFTSMRAMLGNGSVGRALDTEA"
FT   gene            complement(436204..436989)
FT                   /locus_tag="HMPREF0573_10385"
FT   CDS_pept        complement(436204..436989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10385"
FT                   /product="glycerophosphodiester phosphodiesterase family
FT                   protein"
FT                   /note="Pfam: PF03009; InterPro: IPR004129"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10385"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66704"
FT                   /db_xref="GOA:D6ZJ05"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ05"
FT                   /protein_id="ADI66704.1"
FT                   /translation="METDIHATTDGVPVISHDPLWHAADGEIAIAEVSWAELCRHQLPN
FT                   GEQPFSLEEFLDRYPNIYLNIDAKTDAVVPGALRVLQGRQDLGRLALASFSARRVWKMA
FT                   RYLGPGCGYLPGARDIARLLGGAAAGLVRPVHPKIRGIEIPWETIFSSEGESGAARRLE
FT                   SDTRRVVSGLAEKRYLERLYRFGIVPRLCRDFHCALAVPESVPGMRIVTPRFVAAAHAL
FT                   GCPVYVWTVNDLASYRRLVSLGVDGIYTDIVSTLAQNGH"
FT   gene            complement(437163..437828)
FT                   /locus_tag="HMPREF0573_10386"
FT   CDS_pept        complement(437163..437828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10386"
FT                   /product="peptidase, M23 family"
FT                   /note="COG: COG0739; Pfam: PF01551; InterPro: IPR002886"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10386"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66705"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ06"
FT                   /protein_id="ADI66705.1"
FT                   /translation="MVSPNLSIASPNFEFSTNQTLLSVVAKASGATDYDSDLNAVPASS
FT                   RSRVVEASALGQCAAQGSANGDASAAPEEKLLLWPLSAGSYTFTSPWGMRVNPVTGTRL
FT                   LHEGVDLSAPTGTNIYAVADGIVMDAGMQGSTGVITIKHVQDGEVYYSRYLHMYSNGIY
FT                   VHQGDEVKAGDVIAGVGSTGRSTGPHLHFEIRNADKESVEPMGWMKRHGARFINQICS"
FT   gene            complement(438178..439212)
FT                   /locus_tag="HMPREF0573_10387"
FT   CDS_pept        complement(438178..439212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10387"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1253; Pfam: PF01595,PF00571; InterPro:
FT                   IPR002550"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10387"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66706"
FT                   /db_xref="GOA:D6ZJ07"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ07"
FT                   /protein_id="ADI66706.1"
FT                   /translation="MNDWVSLIFMVLLLAINAFFVGAEFAFTASRKAEIEPLVKQGKRG
FT                   AASAMIAVENVSEMLAVCQLGITLASTGLGVVAEPAIAHLLLPIALRLGLPPVSAHSFA
FT                   ILLALLIVLYLHVVAGEMIPKYTSVSAHTRLILLYSPPMVAMERALRPVIRAMNRFANS
FT                   VVRLFGLEPQHEVGVSFTVEEMSSIVEKSREEGVLEDDLGLLSGTLEFSAEVVSGVMVG
FT                   LEQLVMLPADITPVEAEKTMARSGFSRIPIIDETGNIIGYLHIKDVIAVDKGLRENPLE
FT                   PWRIRSLITVTPQMEVEDALRVMQKQGTHLAGVVNPENPETVIGVVFLEDILEELVGEV
FT                   RDLL"
FT   gene            complement(439205..440572)
FT                   /locus_tag="HMPREF0573_10388"
FT   CDS_pept        complement(439205..440572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10388"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1253; Pfam: PF01595,PF00571,PF03471;
FT                   InterPro: IPR002550"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10388"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66707"
FT                   /db_xref="GOA:D6ZJ08"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ08"
FT                   /protein_id="ADI66707.1"
FT                   /translation="MGQLSPVVADWLLVAVGLILTLVTAFFVATEFAFLAVDPARVAGR
FT                   AANGDKRAALVKNSISNLSTQLSGTQVGITLSTIMVGYTTQKAIANLVTRGLGHTGMAL
FT                   AAATALGAVVALILTNLYSMVFGELIPKNLALADPLKTAAFVVRPQRAFTSVFKPLIVV
FT                   LRSSANFVLNRMGVEVVEELSGAHSAQELVAMVRQSAEEGVLDLSTASLFTRSVHISGL
FT                   AAKDVMTDRGRVHYLSQNDSADDLIEKARETGHSRFPVVGPNGLDDILGFANLRRAVSV
FT                   PFERRSEVVVTSSSLMYEVPRVPETMGLADLMVLLRDAGSQTAVVVDEYGGTSGIVTLE
FT                   DAVEEIVGEVADEHDQHAAGINHPVEDEWLVPGLIRPDELLIQTKVELPDEGPYETLGG
FT                   LIMTELGHVPSQGETVLVNGYLLRVEQMDGRRIDRVRITRNPTPDEQVDSAEVAHE"
FT   gene            complement(440691..441188)
FT                   /locus_tag="HMPREF0573_10389"
FT   CDS_pept        complement(440691..441188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10389"
FT                   /product="DoxX family protein"
FT                   /note="Pfam: PF07681"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10389"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66708"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ09"
FT                   /protein_id="ADI66708.1"
FT                   /translation="MQTVLKNEDNSVMRTLLRFISRPLLAAVFIHDGLDALLNPDDHVE
FT                   RFRKMEPTLEKVGLPPILTSDAKLLSRLAGVATAVTALGLALGKSPRICALILAVVNLP
FT                   ISVVNNPVWAAKSTAERRDYTRGLVAGGSLAGGLGMVLADGNGQPSLKARREIARAAKA
FT                   GK"
FT   gene            441356..441946
FT                   /locus_tag="HMPREF0573_10390"
FT   CDS_pept        441356..441946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10390"
FT                   /product="putative RNA polymerase sigma-70 factor"
FT                   /note="COG: COG1595; Pfam: PF04542,PF08281; InterPro:
FT                   IPR014284"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10390"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66709"
FT                   /db_xref="GOA:D6ZJ10"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014293"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ10"
FT                   /protein_id="ADI66709.1"
FT                   /translation="MSEKINSAPPHETRSITEQRFETEVMPFLNQLYSGALRLTRNPHD
FT                   AEDLVQETFLKAFRSFDSFQEGTNLLAWLYRIMTNTFINSYRKDQRRPRTETMAEITDY
FT                   QLSQDDSNRESRSAESLALDRLGTQDILDALDALPDEYREAVYLADVEGLAYKEIAEIL
FT                   DIPSGTVMSRLHRGRAKLRKMLRERVEAEVQMS"
FT   gene            441943..442239
FT                   /locus_tag="HMPREF0573_10391"
FT   CDS_pept        441943..442239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10391"
FT                   /product="anti-sigma factor, RsrA family"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10391"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66710"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ11"
FT                   /protein_id="ADI66710.1"
FT                   /translation="MNFKENFPSRTPDSSGCGCDSECDCDCETVTQNMREIMNGEMDLP
FT                   LAQRFHDHLRHCPDCHEESLWVERYITLLRQSCRCEAPVELRERIMIEIRKIG"
FT   gene            442295..442417
FT                   /locus_tag="HMPREF0573_10392"
FT   CDS_pept        442295..442417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10392"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10392"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66711"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ12"
FT                   /protein_id="ADI66711.1"
FT                   /translation="MCENGQVDYKLQKEAVMSKRGRKRRARSKSAANHGKRPNA"
FT   gene            complement(442538..446287)
FT                   /gene="sucA"
FT                   /locus_tag="HMPREF0573_10393"
FT   CDS_pept        complement(442538..446287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucA"
FT                   /locus_tag="HMPREF0573_10393"
FT                   /product="oxoglutarate dehydrogenase
FT                   (succinyl-transferring), E1 component"
FT                   /EC_number="1.2.4.2"
FT                   /note="COG: COG0567; Pfam: PF00198,PF00676,PF02779;
FT                   InterPro: IPR011603"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10393"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66712"
FT                   /db_xref="GOA:D6ZJ13"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ13"
FT                   /protein_id="ADI66712.1"
FT                   /translation="MTLKGKNIVAQTQSSNNSPSEEVIAQLHAQYLADKNSVPLEWQSY
FT                   FQQMESLGLLPGAAASACSELTHSNEITKHSKESRPAGLDAQHSDRPPLPRSVVHPPTS
FT                   PYAAMVAKQHYDAAKSVVKGEDHSERLKGISAAIVKNMDASLSVPTATSYRQIPAKVLI
FT                   ENRAQINDHLKRTRGGKVSFTHLIGYAIVEALVETPDVNVRYRLEDGKPYVDHFAHVGF
FT                   GLAIDLPKDDGSRLLVTPVVHNADTLSFEEFVRAYEELVKKARDGKLGMEDYSGCTVTL
FT                   TNPGTLGTLMSSPRLVQGQGCIIGVGATNYPAEWAGASEEQLAQAGVGKIMHMSSTYDH
FT                   RVIQGALSGTFLGVIEKKLKGEDGFYERVFDSMKVPYEPFSWARNNEYTGEGELSKDTR
FT                   IARFIHAYRSRGHLIADVDPLDYRVRRHPDLKLDAYGLSIWDLDLYFPVGRLGGKHNVS
FT                   MKLRDILTQMRDTYTRTAGIEYMHIQDPEQRAWMQQEIEQPYEPPSKEVRHAIMNRLNA
FT                   AQAFEDFLQTKYVGQKRFSLEGGESLIPLMLRIMDDAAHDGLAGVTIGMAHRGRLNMLV
FT                   NVAGKTNNQIFAEFEGNMNPGSVQGSGDVKYHLGTESIYESYEGKTTSVYIAANPSHLE
FT                   AVDPVVQGIVRAQQDKVGIEGDYGYLPVLIHGDAAFIGQGVVYETLNMSQLKAYTTGGT
FT                   VHIIVNNQIGFTTSPTNARSTNYCTDLAKGLQVPIFHVNADDPEMVTRVAGLAYRFQQK
FT                   FHKDVIIDLICYRRRGHNEGDDPSMTQPVMYHLIDSHPTTRTVYINNLIGRGDLSDAEA
FT                   QAAVEDYHQKLEKIFEETKEKGYTPTRQGEQGGNDWDWNLPAAQTDQSDDMIAWTSAIP
FT                   QYVVEAIGDAHVDYPEGFNMHPKIKKLYEKRQRMSREGNIDWGFGELLAFGSILMEGAP
FT                   IRMSGEDARRATFVQRHAVAHDFSTGEEWTPLEFLSDKQGKFMIYDSSLSEYAPMGFEY
FT                   GYSVERPEALTIWEAQFGDFSFGGQTMIDEFICSAQQKWHQHSSLVLLLPHGFEGQGPD
FT                   HSSARIERWLSLAAQDNMWIVQPSTPANHFHMLREQAYRRPRTPLVVFTPKQLLRLKAA
FT                   VSSVQDFTTGRFQRVIVDQGNLDPNAVTRVLICTGRLYYDLAAERAKTGDKTTAIVRLE
FT                   QYYPLHEDLKPILAQYPNAELVWVQDEPENQGVWTFLKMHQDAFIGDRPIRVVSRPAMA
FT                   APSTGLASVHKKQAADLVSRAFAR"
FT   gene            complement(446416..447363)
FT                   /locus_tag="HMPREF0573_10394"
FT   CDS_pept        complement(446416..447363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10394"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1162; Pfam: PF03193; InterPro: IPR004881"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10394"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66713"
FT                   /db_xref="GOA:D6ZJ14"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ14"
FT                   /protein_id="ADI66713.1"
FT                   /translation="MVVAVDRGRFTVAISANCMVQAVKARALGRKGVIVGDWVGLEGDT
FT                   SGTPDTLARIVTLEERQTVLRRSFDESEVGAREKLIVANATQMLIVVAARDPEPKRGMI
FT                   DRAIVSALDAKVTPLLAVTKTDLDSVPALIADYEAVGIKVFTLNRNLYEATAPVPSPVE
FT                   THPSHLAPRPCAPRLQELHQQLQGEVTVLLGHSGVGKSTLVNALVPGANRATGEVNEVT
FT                   GKGRHTSTSAVALPIGSQGWLIDTPGVRSFGLAHVDAAGLLRGFTELYAIAQDCPRGCA
FT                   HAADAPDCLLDEHPELALRLASFRSLLSEVPSAY"
FT   gene            complement(447471..448862)
FT                   /gene="aroA"
FT                   /locus_tag="HMPREF0573_10395"
FT   CDS_pept        complement(447471..448862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroA"
FT                   /locus_tag="HMPREF0573_10395"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /note="COG: COG0128; Pfam: PF00275; InterPro: IPR001986"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10395"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66714"
FT                   /db_xref="GOA:D6ZJ15"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ15"
FT                   /protein_id="ADI66714.1"
FT                   /translation="MQATVWSAPRARGPVFGAVRLPGSKSLSARELLLSAIGDAEANLT
FT                   GVLFARDTDLMVQALRSLGAVIAPWPPVVDQPVQIKPLPQLWTGAPAQDASGGPSGGAP
FT                   ITVDCGLAGTVMRFIPALAVALGRAVRFVADSQANARPMRPLLDALVQLGARIEYESPD
FT                   GDVFPYTIYPPAERLGAEVTVDATASSQFISALLLAAPLLPDGCTIRSKTVALPSLPHI
FT                   EMTMQCLSQHGITVEQGLSDDGKPFWNVVSEPVFGQDVFIEPDLSNAGPFLALVGIAGG
FT                   RISVPAWPAKTMQAGAAWLQILPLMGLRVEWNCGVLTVSRPGPLQPLDADLSAVGELVP
FT                   AVAALAAFAEGTSHLRGLHHLRGHETDRLEALRAELTAIGISCEITPEDDLVITGKPVT
FT                   PSWRDTPTIDAEPLLLHSYQDHRLATFGALLGLYYPVQIDDIGATTKTLPDFTTMWERL
FT                   LGAAS"
FT   gene            448931..449725
FT                   /gene="hisN"
FT                   /locus_tag="HMPREF0573_10396"
FT   CDS_pept        448931..449725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisN"
FT                   /locus_tag="HMPREF0573_10396"
FT                   /product="histidinol-phosphate phosphatase HisN"
FT                   /note="COG: COG0483; Pfam: PF00459; InterPro: IPR000760"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10396"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66715"
FT                   /db_xref="GOA:D6ZJ16"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ16"
FT                   /protein_id="ADI66715.1"
FT                   /translation="MSSRWEDDLQLALIMADQVDALTTKRFLAPDLKVSDKPDLTPVTD
FT                   ADQAAEKLIRKHLSHSRSRDAVVGEEEGSTGLASRKWVIDPIDGTSNFLRGVPVWATLI
FT                   GLMEDGKMVMGVVSAPALGFRWWAAAGSGAWTGRSRTSARQLRVSRISNLNQASFSYSL
FT                   IGEWAEAHRLRGFMNLSQQVWRTRAYGDFWSYMLLAEGAVDVAAEPDLNLWDMGALYPI
FT                   VTEAGGKFTSLTGEDGVNGPGAVVTNGRLHSQVLQYIGSETD"
FT   gene            449786..451027
FT                   /gene="sbcD"
FT                   /locus_tag="HMPREF0573_10397"
FT   CDS_pept        449786..451027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbcD"
FT                   /locus_tag="HMPREF0573_10397"
FT                   /product="exonuclease SbcCD, D subunit"
FT                   /note="Pfam: PF00149; InterPro: IPR004593"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10397"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66716"
FT                   /db_xref="GOA:D6ZJ17"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ17"
FT                   /protein_id="ADI66716.1"
FT                   /translation="MKFIHTSDWHLGRDFMNYDLAPYQDDFLGQILAQIAAHRPDAVLI
FT                   SGDVLDKPNPGDADLDKLSDFLNQARRMTRVILIAGNHDGASRLGFAKGFTLPEVNIVT
FT                   KAAQVGTAIEIPRPDGELGALVYPIPYLYPYQDRTELSTWVDTDGVRHLDDALDPPPSE
FT                   DDPDPVFPGKPEALFAAALRRIARDLHRRDTDVPVLAMAHDFLSPVREMEPLGNLSPIP
FT                   VSLLDDLAGGLKGGRGIDYLALGHIHQAFQLSGTNVAAWYAGSPLPYRVSEHNVKGTLL
FT                   VQIDPNHQVEVQRLALELPYEVKQLEGSIEDLTNPADPRYQRWHHAFCSINLTETILPP
FT                   NAYNRLKAVFPRMLTLTHRQDSLPETLSSGTEFRELSELEIATEFLRTCGIDTEEDLAL
FT                   LRKLFENTFEGSAK"
FT   gene            451024..454200
FT                   /locus_tag="HMPREF0573_10398"
FT   CDS_pept        451024..454200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10398"
FT                   /product="RecF/RecN/SMC N-terminal domain protein"
FT                   /note="COG: COG0419; Pfam: PF02463"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10398"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66717"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ18"
FT                   /protein_id="ADI66717.1"
FT                   /translation="MKFHRLTLEGVGSFYERTTLDLDTLAESGLFLITGKTGSGKSTIL
FT                   DGIVYALYGDVAGERESTTDRILSYYWDKDYPPEVVLVFSAHDKFYELQRTVTFTKPGR
FT                   KTPVPSIAQLKVSDTSVFTKVTEPIATGKDVTKMVVEILGLEKSHFLQTVILPQGQIQQ
FT                   FLTAGAGQRHEVLSNLFGASNFIALEKAAKERASQGKETTAEYTRRLDELLTTAYADLS
FT                   NIEIAGENETAWHDTLEEFAAAKDAAAQSISALDRAGQPLFASATKILCSETAQSKDAA
FT                   EQAQEHYLAAQTELTKAETEQRVILEARQMADKLSQLTAKTTEIEQLDQRNQKALHANA
FT                   VIDADDAAQEPYQSARHQRANILDTLAQLVDNDTDLARFRDRVSALSDTDLQNWLEDAD
FT                   FSPHLADLRDEISAEVNASQKKLETIKANLSLQREKTTAAHSKESKLESLHNQMHQLAD
FT                   NAKTTKATLDQKRQSLREQKSLADGLVSRQTELANVQELHEWAKSAEKLTTELKAAQEN
FT                   VASLQAHYDQAQENAASVLRKWSSTAASRLAARLKDGESCPVCGSRNHPHPAAETTNQT
FT                   TFQDYEAAVRDAKKAQDRLTHGNETKTEINTKLQTATDQLQGRDVESLAADLAVATQAL
FT                   AAATAASEQVPQLEETIAALEESRERNQTEREILIQQEAGLSTEIKNLHADIQELADKI
FT                   QAELAAFNPDSDPKDLLETNQLSLDTVKQLSKFYDSWLAIRQEWIISHAALCKSLTDHG
FT                   FESVAEAQTYAKSRQQLETDQETVTSHHKAVADLRAKLDTDAYRDKAAATIPDLESLRA
FT                   AVATGEQEYRSLTQRTAAMDRSHENLCRLQEKYAQTKQEWDTKVSEIAGYERLSQVLNG
FT                   DNAKKTTLSAYYLSKRLGQVIFVANQLISDVSGGYYQIRHNDQYEADRNQKYHGLGIEM
FT                   YNGAEDQVVPPKSLSGGEKFYCSLAIAMALSEVVQRERGGITLENIFIDEGFGSLDNDT
FT                   REAVMSALHHLQQDGGRCVGIISHVSELQGEIPLQVQVRNYQSGNTTELKPGGTRKIGS
FT                   YLQINGLDTF"
FT   gene            complement(454197..454733)
FT                   /locus_tag="HMPREF0573_10399"
FT   CDS_pept        complement(454197..454733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10399"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66718"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ19"
FT                   /protein_id="ADI66718.1"
FT                   /translation="MSSVPQQLKNIRAYIALSPACLQGKTWEGSPVTVVDEAWCVAAGF
FT                   PAPGELRGEDREVAEDEALHAAALKSLDAQVDSPRPLRVVAVAEVAGTDLQSCPSKCGG
FT                   SYILTRPVQYSEVVSYHVDEPAAIAEVAKLVQLRAGQAEGATEAGEPSPELEFPELLWF
FT                   DGSELEILREFLGLS"
FT   gene            complement(454730..456055)
FT                   /locus_tag="HMPREF0573_10400"
FT   CDS_pept        complement(454730..456055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10400"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66719"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ20"
FT                   /protein_id="ADI66719.1"
FT                   /translation="MSFIGVATCLHPDLEADIIRTIESDSLPLQVIRRCRDATELLSIA
FT                   KAHLVQLVAVDTEMLELEGATVQELTAENVAVIAFAPLEDVDQLNSCGGISVLAKADPR
FT                   VEELEQSEAARLLSQMMSILMPPPPPNPREEFSNDNAEMAGSIGQIIAFWGPVGAPGKS
FT                   TLALNIASRLRNYGRVLLVDADTVESSLVQMLGIALDTSGVVTGCRLAEQGKLKPESFP
FT                   QLVNRVGFGVDLLTGLTKAERWREVGQHALSALLEMARINYRWILVDLASGTDDQSDLL
FT                   AAMGPTRYGATLGALDVADLVVEVGLADPVGIRRLLVNHNWAREQELWNCPTLAVVNRG
FT                   RASVGGANWRNSIVNVVAASVPNLPVAVVREAGEDFDRALIAACDVMTVNPRAGVLEDL
FT                   ERVQNEIFKQLGLLPRRGSRRNRPGENKLWKFKRGEQKEYKK"
FT   gene            complement(456052..456687)
FT                   /locus_tag="HMPREF0573_10401"
FT   CDS_pept        complement(456052..456687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10401"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66720"
FT                   /db_xref="GOA:D6ZJ21"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ21"
FT                   /protein_id="ADI66720.1"
FT                   /translation="MPIGSEISSKSQYLNRRTVLGVALMILAVILVIVTVRVTSHLEGY
FT                   LVAKTTLVAGHTVQSGDIEVISANPGRAAGQYLREGEMQEGSVVVQTIAGGQLIPKASL
FT                   SQTEPFRKRIVLNLAAPLPSSVKKGDYLEIWKLPDEKSASTFESDAPLENAQKLADKAV
FT                   FLAEKKSETALGSKNQMNVEISVPEEDLSPILAAVGTKTPLMAIPVAS"
FT   gene            456792..457010
FT                   /locus_tag="HMPREF0573_10402"
FT   CDS_pept        456792..457010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10402"
FT                   /product="DNA binding domain, excisionase family"
FT                   /note="Pfam: PF00376"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10402"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66721"
FT                   /db_xref="GOA:D6ZJ22"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ22"
FT                   /protein_id="ADI66721.1"
FT                   /translation="MGYNFFTIADVADMLKVSQGAVRNLINNGELKAIQIGGRGLWRIE
FT                   ESAMEEYIKGQYAQSEEKIASGAALVE"
FT   gene            complement(457093..457602)
FT                   /locus_tag="HMPREF0573_10403"
FT   CDS_pept        complement(457093..457602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10403"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66722"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ23"
FT                   /protein_id="ADI66722.1"
FT                   /translation="MEHDEFLDDLAADFAAKLRAQRQVEATELAAADATEVTLSGRLLA
FT                   SVDAAVEIQLINGESLRGKVAEAAASWLILRLLRMDIFIWQRAIEVVSGLGPAPQWPTL
FT                   VESRIPGTVKLREFAATRREIQFTTRNQTLKGYIERVGADFVDVVDHGRREAIALAALL
FT                   YVSCPR"
FT   gene            457789..458607
FT                   /locus_tag="HMPREF0573_10404"
FT   CDS_pept        457789..458607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10404"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10404"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66723"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ24"
FT                   /protein_id="ADI66723.1"
FT                   /translation="MKTALLEPNMTEANTTPPVTLPPDDATPQIGLSRTRPSDVPTPPT
FT                   TTRVTVNLLLETERGFQQEVKRQGPASDDLQRTATIATNPRPQPVLGPAWKRRQVAKSS
FT                   VRSLVRATYAQRGQTAQILTTYHQAEATEHPGTVPARELPTKSVRRSPVEDVQHSPRVW
FT                   AAQMARCGLEIIEGTRPLSQMTRWASPQAYRYLEQRRNAIVSKQKPQPGLTGKTRRVSP
FT                   VRVLSAHSRATSATTHEAVIVLNDGQRTRAAALTLENHGEQWMIAAIRLG"
FT   gene            complement(458618..461443)
FT                   /gene="secA"
FT                   /locus_tag="HMPREF0573_10405"
FT   CDS_pept        complement(458618..461443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="HMPREF0573_10405"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="COG: COG0653; Pfam: PF07517,PF01043,PF00271,PF07516;
FT                   InterPro: IPR000185"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10405"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66724"
FT                   /db_xref="GOA:D6ZJ25"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ25"
FT                   /protein_id="ADI66724.1"
FT                   /translation="MRIGEGKVLKKLVKVADAVDRLEDEYRELSESELKAKTDEFKQRL
FT                   EEGEKLDDIMIEAFATVREASDRVLGLRHFREQIMGGAALHWGNIAEMKTGEGKTLVAT
FT                   LPCYLRALSGKGVHVVTVNDYLASYQGELMGRVYRYLGLSTGIIMAQMDPEERRKQYNC
FT                   DITYGTNNEFGFDYLRDNMAQRVEDLVQREHNYIIVDEVDSILIDEARTPLIISGPAQG
FT                   DVNHWYTDFAKIVQDLHPGEDYEVDQKKRTVGVLEPGIDKVEDYLGIDNLYEVANTPLI
FT                   GFLNNAIKAKELFKLDKDYIVTPEGEVLIVDEHTGRVLPGRRYNEGMHQAIEAKEGVEI
FT                   KAENQTLATITLQNYVRLYPKGSRAGMTGTAETEAAEFNDVYKMGVVPIPTHKPMIRED
FT                   KDDLVYKTAEAKFNAVVEDIEENYHRGQPVLVGTTSVEKSEYLSHLLNQRKIPHQVLNA
FT                   KQHEREAAVVAMAGRKGQVTVATNMAGRGTDIMLGGNAEFLAVQTLKDRGLDPEENSEE
FT                   YEAAWPQALQEAKAKVAQEHDEVVELGGLYVLGTERHESRRIDNQLRGRAGRQGDPGRS
FT                   RFYLSMEDELMRFANQGWLGNMMRSGLPEDIPLEFKMVSGAIRSAQTQVEGRNAEIRKN
FT                   VLKYDDVMTEQRETIYGERGRVLRGEDLSATVDSFIEGTIADAVAQATDLPDVSDWDLK
FT                   TLWAGLKNLYPVSLSVEDLENAVGGKSALTTDFITEQLVDDAKLQYELAAKSLAENPIA
FT                   QAQLGDEPMKELERRVLLSVVDRLWREHLYEMDYLKEGIGLRAMGQRNPLVEYKTEGYL
FT                   MFSAMTGRIKEETVQNVFGYVKAFVDAMQRAETAAQETDENGESPAETTEEATPDNDAP
FT                   ISKSAAKKKARNFKKSGRRAGLKSVSANRTVMGDTGHQAMNTQISYSSDGSVEEAPQGN
FT                   RAQRRAAKRRG"
FT   gene            complement(461713..462372)
FT                   /gene="raiA"
FT                   /locus_tag="HMPREF0573_10406"
FT   CDS_pept        complement(461713..462372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="raiA"
FT                   /locus_tag="HMPREF0573_10406"
FT                   /product="ribosomal subunit interface protein"
FT                   /note="COG: COG1544; Pfam: PF02482; InterPro: IPR003489"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10406"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66725"
FT                   /db_xref="GOA:D6ZJ26"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ26"
FT                   /protein_id="ADI66725.1"
FT                   /translation="MELKIHSPKEAIMEITVKARNAEIHPDFREYIEEKIAKVEQLAPR
FT                   TQRVDVELTHEKNPRQADTAERIELTVLGKGPVVRAEASSSDRYAAVDIAAGKLFERLR
FT                   RARDRAKDHRKYEIPPDVELDVQIPEASEAPAAKPPLKLGESREEQLGDSPVIVREKLH
FT                   ESRAMSVEEALDEMELVGHPFYLFIDSETAQPAVVYHRKGWTYGVIRLNATCTQND"
FT   gene            complement(462503..463282)
FT                   /locus_tag="HMPREF0573_10407"
FT   CDS_pept        complement(462503..463282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10407"
FT                   /product="hypothetical protein"
FT                   /note="Pfam: PF00156"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10407"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66726"
FT                   /db_xref="GOA:D6ZJ27"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ27"
FT                   /protein_id="ADI66726.1"
FT                   /translation="MVDFSGIWDAAGELGKVLLPTECVGCGAWDEEICDTCLAQMLGCP
FT                   FPLQISEDDDNVTDVPVFAIAKYDGPMRRVVLTGKHDKRRDLRAYFKAAGQSAVQGLRS
FT                   ENLLDTGKFGTGGTIRGEMFVVPAPSTHLQDPSEVAAAFAQGAARGLVAAGLCRQASVL
FT                   EILELATGSTTQAGLGWEARNLNRHGKMQVRGSTVVAKRELAGKDLLIIDDVSATGATL
FT                   REMIRVLSGLDATVLAGLVFASSRRETPVSGTQNFEK"
FT   gene            complement(463301..464977)
FT                   /locus_tag="HMPREF0573_10408"
FT   CDS_pept        complement(463301..464977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10408"
FT                   /product="putative lipoprotein LpqB"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10408"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66727"
FT                   /db_xref="InterPro:IPR018910"
FT                   /db_xref="InterPro:IPR019606"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ28"
FT                   /protein_id="ADI66727.1"
FT                   /translation="MLSEYRTRWWRAVLVAICALSLVGCATLPTAGPVNDSKVRVGANQ
FT                   PLLGLSAPGPVPNATVEQIVTGFIRACSAGYSDDFTVARSFLAPKAAMDWRPDAQVEIF
FT                   DTDSALETRELGDGSVEVTARALGSVDENGNYTVAGAAEKVRTVFSLVKPADNQWRIAA
FT                   LEDGVMLSQSAFSSIYASAPVYFLTNDAGALVPDLRWYPRRRLPTYLVNALLAGPQDPF
FT                   KGAVRSAFPAGSTLAGGAVDVFDGVANVSLNVTDPLNDPTTINLAYWQMESTLRDVSGI
FT                   STVSLSVGKVPLENTNPITQSTTPQFPIMVKDGNVVRLNAGATEVLVPAGAVGSGVITN
FT                   PAISTAGNEIVFTDSSYRRLYMWGHGTVTQLYSGRELLAASIDRNGWIWTLDTADLHHL
FT                   IALRPDGARVNLEVPWESGDPVHTFTVSPDGTRVAFVRHVGQADIVSVAVVIRDASGAP
FT                   KSFSAPVALQTGNEVVPAIAWLQGDSLVLLTGSGDNTAVRIAPLFGPISSLPGVKNAVD
FT                   LAAGEEENQIYLITSGGDLYKRSGRNWQQVLDGVSDPSYPG"
FT   gene            complement(464971..466575)
FT                   /locus_tag="HMPREF0573_10409"
FT   CDS_pept        complement(464971..466575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10409"
FT                   /product="ATPase/histidine kinase/DNA gyrase B/HSP90 domain
FT                   protein"
FT                   /note="COG: COG0642; Pfam: PF00672,PF00512,PF02518;
FT                   InterPro: IPR003594"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10409"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66728"
FT                   /db_xref="GOA:D6ZJ29"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ29"
FT                   /protein_id="ADI66728.1"
FT                   /translation="MAIIMLVATLVILFAVGIYASTAIKNGIFQERLNQVLEEAATQAR
FT                   AAQNRFDQAPASTVEQVQSLAQDVVTSISTLTSGSSAPAVLILRNPSETSSFVINEIAT
FT                   QNMREVITSQLRQAVQQKTGQHWQSIEITDAQGKRHPGIAVGTAVSLPLAGAHELYLVY
FT                   SLADEQAAINLVMGVLGGGGLAVLVLVAGMTWVVVYSVLVPVRRTVRTAERLAAGDLNA
FT                   RVLSQGQDETAQLADSFNKMANSLQSKIDTLGQMSRLQQRFVSDVSHELRTPLTTMRIA
FT                   DDVIYDAREELDPAALRSAELLHDQIERFDAMLADLLEISRIDSGSARLDFEIVDLNKL
FT                   VAQVVEDNATLAEKVGCRVIFNPPKYPCAAELDTRRVTRIVRNLLVNAIEHSEGNPVII
FT                   TTDSSETAVALRVSDHGVGMSPEVTSRVFDRFYRADPARARTTGGTGLGLAISLEDARL
FT                   SGGTLQAWGKTGYGSSFLLTLPRRHDMELGPSPLDITDYVEPTLDSYVPPQSTPEKANA
FT                   PMNVTDDLGNNGEVQPC"
FT   gene            complement(466719..467402)
FT                   /locus_tag="HMPREF0573_10410"
FT   CDS_pept        complement(466719..467402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10410"
FT                   /product="response regulator receiver domain protein"
FT                   /note="COG: COG0745; Pfam: PF00072,PF00486; InterPro:
FT                   IPR001789"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10410"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66729"
FT                   /db_xref="GOA:D6ZJ30"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ30"
FT                   /protein_id="ADI66729.1"
FT                   /translation="MSAKILVVDDDQALSEMIGIILESSAYEPSFCADGAKAVDKFREV
FT                   EPDLLLLDLMLPGMDGIEICRRIREFSNVPIIMLTAKSDTTDVVAGLEAGADDYIPKPF
FT                   KPKELLARVAARLRNLDAAEHDVLKAAGVEINLASHEVSRGGKPLNLTPLEYDLLVALA
FT                   TKPGRVFSREELLEQVWGLRHASDTRLVNVHVQRLRAKVELDPDNPTVVLTVRGVGYRI
FT                   GTEPQ"
FT   gene            467541..468824
FT                   /locus_tag="HMPREF0573_10411"
FT   CDS_pept        467541..468824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10411"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66730"
FT                   /db_xref="GOA:D6ZJ31"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ31"
FT                   /protein_id="ADI66730.1"
FT                   /translation="MSNNTYSPQDTPPGSNSGETAPAPGQVSPISPESSFVPPTPPTPG
FT                   SFQTGSWTLTPEDSTSKPPSFPNPLPTPDPAAAAPQTSAPNFGTNSTNAMNSTNGAGFD
FT                   PYGLNYQQVQPGIIPLRPLKLGDIYNGAFSAIRQAPAVMFGLVLALWAVLGGLTGALLH
FT                   LLTPDLNTYMANDFNLDSTDAPMDGLLEFTESTMLIGVITSLLQMFIVFMTLGICVAGL
FT                   GPLVLGRRPSVADVWQTLKGHVWGIVGYSLLLILGSVVLLGLGLLPLGGFFLINIKDVG
FT                   ASLGLLGLTFLTLIAVAVFSAWLYIKLVFAIPTAVMEDIGIIPALKRSWKLTKGSFWKI
FT                   FGVILLTSLIVSFLANGLNVVISLIISASMMVSQNFSALMTLSAVLSTIITGLAMPFYG
FT                   AVLGLLYIDTRMRREGLAVSLLQAAQQG"
FT   gene            468859..469596
FT                   /locus_tag="HMPREF0573_10412"
FT   CDS_pept        468859..469596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10412"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66731"
FT                   /db_xref="GOA:D6ZJ32"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ32"
FT                   /protein_id="ADI66731.1"
FT                   /translation="MLNISTQLGSLWLHHVDLSSLVLADVSDREGRDTLEEELSKPVYQ
FT                   ERPSLLKKILEWFADTFSSTSVNPVLPSWLWLIAALVVALLVIIIMILFTGNWKFGEQI
FT                   KPTLADEAAVFEDNRSAVQYLAAAQNALARGDYSTAFLEQFRHLLRLCEANELLVITPG
FT                   LTAGEGSTALSQAVPAESEELAWAANVFNALRYGRRKSDTAQVQRLISLDSRLESFVSN
FT                   RSHVRGDATDTPQEALVTAGGTA"
FT   gene            469596..470753
FT                   /locus_tag="HMPREF0573_10413"
FT   CDS_pept        469596..470753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10413"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10413"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66732"
FT                   /db_xref="GOA:D6ZJ33"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ33"
FT                   /protein_id="ADI66732.1"
FT                   /translation="MSSATPPTATPRISEAIFRSRWVIGGLILLAVFSFLSAVLRAPTD
FT                   DVDLSIRNPKGSGAMALAEVLRHRGVMVKDVYSMRDLDNFTSKDTVVITNTNEIDDVAL
FT                   REILHTPTNLLIIGTLAQGKRFDPYVQSVPAGTPDGIEAQCDFPGAKAAQTISSTRGSL
FT                   RPLRQPEAACFPVQDNAFAYVSFKRPEGFHLALLSEDSLARNDTIASAGNAALLLNLLG
FT                   SSPQVGWVNGTTFQQGSDQNGKDQPLLPDFFLIALVYLFVAAFVFTLAQGRRLGRVVPE
FT                   ELPVVVHGAEAVYGRGHLYEKSGAVAAAAHKAREYTARRIGSALHIPTPTTPPVMVREV
FT                   SRYTGIAESQIHELLYGEVPTTARGLGNLMHDLYLLTKLNPRKES"
FT   gene            470754..471713
FT                   /locus_tag="HMPREF0573_10414"
FT   CDS_pept        470754..471713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10414"
FT                   /product="ATPase family associated with various cellular
FT                   activities (AAA)"
FT                   /note="COG: COG0714; Pfam: PF07726; InterPro: IPR011703"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10414"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66733"
FT                   /db_xref="GOA:D6ZJ34"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ34"
FT                   /protein_id="ADI66733.1"
FT                   /translation="MDMQDPTLRKLIALRTEINKVVKGQDAVVTGLVIALLAEGHVLLE
FT                   GVPGVAKTLLVRALAKSLDLSHKRVQFTPDLMPGDLTGSLIFNAKESSFTFREGPVFTN
FT                   LLLADEINRTPPKTQAALLEAMEEHQVTADGVSRPLPKPFTVIATQNPVEYEGTYPLPE
FT                   AQLDRFLLKLDVPLPTRETELEVLQLHLSGFNTRDLDAAGVNVAANAADIAAARHAVKD
FT                   VKASSEVLGYIVDLVRATRSLPQVELGVSPRGATALLSTSRAWAWLSGRDYVTPDDVKS
FT                   LVLPTFRHRLRLRPESEMEGVNAKTVLDSVLATTPVPR"
FT   gene            471766..473100
FT                   /locus_tag="HMPREF0573_10415"
FT   CDS_pept        471766..473100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10415"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1721; Pfam: PF01882; InterPro: IPR002881"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10415"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66734"
FT                   /db_xref="GOA:D6ZJ35"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ35"
FT                   /protein_id="ADI66734.1"
FT                   /translation="MAVSKRLAFLIALGIPLVLLTHWKTGAFFWLLVCLLVWLFDVIAA
FT                   PSPRHLAITRSLPHTLRQRAETPYTVSVKNPTKRKYHAQIRDAWPPSLQALPRRQRVTL
FT                   DAQSTTTLQASFTPQRKGTLRSDAVTVRSYGPLGLGARQFSAPIVQQVQVLPEFRSAKY
FT                   LPSRLKTLRRLEGNSLVMQRGQGSEFDSLREYVPGDDVRDIEWHSSARLRTPVVKTWRP
FT                   ERDRNVIICLDSSRSAAVRLDKYPRLDASMEAALLLGALAGSAGDRVHLIAFDNQIRFH
FT                   IQPDRGAGLITEMAQALADLQVSLTEANWSGLSHTLLSGLRQRSLVVILTGLEGGAERS
FT                   GLMPMIEALSSRHHVLVANSLDPELERLAQLPSQWNLNDAKQSLGRFNPRDAFLAAAAM
FT                   AELNEHEEAGNLIPLLGGHILNATPENLPPNLADAYISLKRRGQI"
FT   gene            complement(473109..473456)
FT                   /locus_tag="HMPREF0573_10416"
FT   CDS_pept        complement(473109..473456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10416"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10416"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66735"
FT                   /db_xref="InterPro:IPR010428"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ36"
FT                   /protein_id="ADI66735.1"
FT                   /translation="MLPRYRTRRETFDELVIQEVRSLVAACPELAAIQYGVEDVPPSDP
FT                   APWESESVVLGRGFGADPGKSLPAQVVVYRRPLEQRARSTDDLRYLIHGVVLEESSQLI
FT                   GKHPEDIDPHW"
FT   gene            473828..474208
FT                   /locus_tag="HMPREF0573_10417"
FT   CDS_pept        473828..474208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10417"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10417"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66736"
FT                   /db_xref="InterPro:IPR021888"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ37"
FT                   /protein_id="ADI66736.1"
FT                   /translation="MTFDYRERSAIIGPLSAHRNPGAYDFCREHAEKLTAPRGWEVVHL
FT                   TNSFTPPPPNDEELMALANAVKAAAQNPAPRQAVHPEGYRGPLGRDAHSSSGSDATASE
FT                   PPPATGKRHGHLTLVPPPKQVS"
FT   gene            complement(474257..474850)
FT                   /gene="ppa"
FT                   /locus_tag="HMPREF0573_10418"
FT   CDS_pept        complement(474257..474850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppa"
FT                   /locus_tag="HMPREF0573_10418"
FT                   /product="inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="COG: COG0221; Pfam: PF00719; InterPro: IPR008162"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10418"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66737"
FT                   /db_xref="GOA:D6ZJ38"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ38"
FT                   /protein_id="ADI66737.1"
FT                   /translation="MPSNANPETPVAQKVRMPKKIMAEDFLTFNVTIEIPKGNRNKYEV
FT                   DHETGRIVLDRMLFTSTRYPDDYGFIDDSLGLDGDPLDALVLLEEPTFPGCVIKCRALG
FT                   MFRMTDEHGGDDKVLCVPATDQRAAWRTELEDVSEFHRLEVQHFFEVYKDLEPGKSVEG
FT                   ANWVGREEAEKEIHASWQRFRDKEGPDAHTYIHL"
FT   gene            474974..476641
FT                   /locus_tag="HMPREF0573_10419"
FT   CDS_pept        474974..476641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10419"
FT                   /product="putative D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase"
FT                   /note="COG: COG2027; Pfam: PF02113; InterPro: IPR000667"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10419"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66738"
FT                   /db_xref="GOA:D6ZJ39"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ39"
FT                   /protein_id="ADI66738.1"
FT                   /translation="MHTKGRVSATLIAGALVLGGAYVGADGADLVPGFLTFKAPLPRVA
FT                   PFPDSPALSPEPAEIPLFAKSTNFDANTYKALVREFATDYRLANAKLSFWVGDRDGVEL
FT                   ASHEPQSALTAASTTKLLTAVAALHEFGPDARARTVVAWDNDKRKLFLIGGGDMLLGAG
FT                   ADTPRSVKGYAGLDTLAADTIVALSAQTPGNTKPAAGGPPPSSAKKSKSATSNSPASRD
FT                   KSPAGSLLNGKPYTLVLDTSWFGSQTASPSWRDGDDRWVGPIQGMAINTGLVDPNAYRG
FT                   YQSDPAGVAGQAFAQALSRLGGAGPAKVEVGKSGLASKELLDPLSPLPKVSTEVSASHG
FT                   PVPIAYAQGAPLAQVERQMLKISDNTLAESLGRLVALHRNAKPTFAGSGAAVMDSLREL
FT                   GVDLGKTELKGCSGLAYETRIPARVLADVVRLTTSRDHPELHSVTANVPVAGADGTLEH
FT                   TYQGTLAAGVVRGKTGTLAITNSLAGTFVRDNQEFIYALVISGYPESQGGPSIEAKQMF
FT                   INGLLGAKTSFSKVDPKSQPPDSPPGAPASSSPDASAE"
FT   gene            476872..478245
FT                   /locus_tag="HMPREF0573_10420"
FT   CDS_pept        476872..478245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10420"
FT                   /product="O-acetylhomoserine
FT                   aminocarboxypropyltransferase/cysteine synthase"
FT                   /note="COG: COG2873; Pfam: PF01053; InterPro: IPR006235"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10420"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66739"
FT                   /db_xref="GOA:D6ZJ40"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ40"
FT                   /protein_id="ADI66739.1"
FT                   /translation="MSKTTIGPNWVDHPEWGFDTLQIHAGYAGDPTTGTQTVPIYATNA
FT                   FHFPSAESAAARFALQELGPIYSRLGNPTNDALEARIAALEGGVGAIATGSGQAAITLT
FT                   ILTLASKGQNVVASNSIYGGTFNLLGHTLDRLGIEVRFVDDPRDISQWTARTDANTAAY
FT                   YGELVPNPQGDVLDLEPLAQAAHAVGIPLVVDNTVPTPYLCRPIEFGADIVVHSATKYL
FT                   GGHGSAMLGVVVDSGRFDYAAEKAAPRFPGFNSPDSSYHGVVYARDFGVQGSLGANLAF
FT                   ILKARVEGQRDLGFVASPFAVWTVGLGVDTLSLRMERHIANTRQVAEFLESQVGKGLVE
FT                   TVRWSSLPSSPFYALAQKYTPKGCGSLLNFDLAGGLEAGKAFINSLELLANVANIGDVR
FT                   SLAVHPASTTHAQLTTAELLAQGITPGTVRLSIGIEAPRDILADIERGLAAAQQVNVA"
FT   gene            478580..479296
FT                   /locus_tag="HMPREF0573_10421"
FT   CDS_pept        478580..479296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10421"
FT                   /product="methylenetetrahydrofolate reductase (NAD(P)H)"
FT                   /note="COG: COG0685; Pfam: PF02219; InterPro: IPR003171"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10421"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66740"
FT                   /db_xref="GOA:D6ZJ41"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ41"
FT                   /protein_id="ADI66740.1"
FT                   /translation="MGKTRTKLVGIIQDMMDLGVRDFLALRGDEAPDSASGAAEPNEFD
FT                   RAFQLVQLIREVSADYLGDAHAVSIAVAAYPAGSIQTRTDAVQALVQKQAAGADFAITQ
FT                   VFYQARDYAELVQSATYQGVTIPIVPGIIPFTDMHRLQRLEGLTGVPVPERIKSIANIS
FT                   DPAERILESLGATLNFVNDLIEANAPGIHFYTFNRPRPVLDLVEHLRSRGFTHVDQEDS
FT                   QDLLGLMNATMHRISP"
FT   gene            479381..481696
FT                   /locus_tag="HMPREF0573_10422"
FT   CDS_pept        479381..481696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10422"
FT                   /product="putative
FT                   5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   S-methyltransferase"
FT                   /note="COG: COG0620; Pfam: PF08267,PF01717; InterPro:
FT                   IPR002629"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10422"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66741"
FT                   /db_xref="GOA:D6ZJ42"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ42"
FT                   /protein_id="ADI66741.1"
FT                   /translation="MTEKQTFPAATVAGYPRIGANRELKRSLEHYWGQKIDRATFDTQI
FT                   NQQLTTRIDHLKDLGLTEPGSNPGDFVLYDQVLTLTCALGAVPQRFGNLVRPDGSLDVD
FT                   GEFTLARGVDDKAALEMTKWFDTNYHYLVPEIGPYTQISAVANPWLEQVKVGGSALRPV
FT                   LIGPVTYLLGAKASADAPTHFQPLQRLDAVLAGFEVFLSQFAAAGVTWVQLDEPALVCD
FT                   TWSTSREEVLEVARKTYEFLSKLTNRPQIFVNAPYGPLGLDGLNVLTATDVEAIGLDLV
FT                   AGPVPSPADLKTIGDKTLVAGIVSGRNVWRTDLRQALATLQAIHQVVPNLSVSTSTSLQ
FT                   HVPHDAAVETSLDPQVRSWLAFADQKIAEVQTLARGLADPNSITAELAENAEILASRAN
FT                   HPGVKRAEVRQATAAVTVADRTRDPYPQRLAAQAEILQLPLLPTTTIGSFPQTTEIRQA
FT                   RAAFRRHEIDEAQYDEEIRNEIARVVKLQEDLGLDVLVHGEAERNDMVQFFAENLEGFA
FT                   TTEHGWVQSYGSRCTRPSILWGDVTRSHPITVEWSTYAQSLTTKPMKGMLTGPVTIMAW
FT                   SFVRDDESRAEVADQLGLALRDEIADLNAAGIKIVQVDEPAIRELLPLRAAGREQYLQW
FT                   SVGAFRLATGGAPKELQIHTHLCYSEFNVVVDAIDHLDADVTSIEASRSKMDILPAVHE
FT                   HGFERGLGPGIWDIHSPRVPKLDEEVGLLEKAVAALDPQQVWVNPDCGLKTRAYAETVA
FT                   TLENLVGAAKAVRAKLEA"
FT   gene            481726..482880
FT                   /gene="metX"
FT                   /locus_tag="HMPREF0573_10423"
FT   CDS_pept        481726..482880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metX"
FT                   /locus_tag="HMPREF0573_10423"
FT                   /product="homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /note="COG: COG2021; Pfam: PF00561; InterPro: IPR006296"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10423"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66742"
FT                   /db_xref="GOA:D6ZJ43"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ43"
FT                   /protein_id="ADI66742.1"
FT                   /translation="MPETNELLPVSGAWKPTDPKGNRQFAALGMLKLESGSTLPGARLA
FT                   FETFGTLNADKSNAILIDHALTGDSHVYGAAGPGHVTPGWWNEVVGPGAAVDTDRWFVV
FT                   CPNVLGGCQGSTGPATLAPNGRAWGSRFPLLTTRDQVAAEKILMNQLGIPHWFAVIGCS
FT                   HGGHRALEWAVTYPEQVERLVAVATGCATTAEQAAWCHVQMHVLELDTNFHNGDYYDNP
FT                   PGQGPFRGLALAREVAHTTYRCPKELQERFGRDPGYQEDPLSGGRLAVQSYLDHHGVKL
FT                   AKRFDAGSYRVLTRSMLTHDVGRGRGGLEVALSQVQARVLALGVDSDRLFYPSQTQQLA
FT                   RLTRRSQAVIIHSDSGHDGFLIENDAVGQAIGEFLTTEDTTIGC"
FT   gene            483002..484471
FT                   /locus_tag="HMPREF0573_10424"
FT   CDS_pept        483002..484471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10424"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66743"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ44"
FT                   /protein_id="ADI66743.1"
FT                   /translation="MRYLPDVLGPGFEAAKLQLEPDQISPRTATLVRYIPSKDPKSQLP
FT                   DRVVPVNVKPGGGPNQGSFRILPPPASPQQHTEGYVSNSDISAQWDSSSTRNLDYLQDY
FT                   LSSELRGREIQVETELDAVSAPRFIAVYVHGWNDYFYQAHLARMMARLGAAFYGLDLHR
FT                   YGRNMPPWSGLVSFNCYEDDYASYDCEIDWAIATARQEHPDLPVVVMGHSNGGAVVSGW
FT                   ASRHHDAYDGLIFISPWVVHDISGIPAGNTVRSFIAKYLKKLHIPMLGPGSTVYQDSLV
FT                   GYRTIGSPLPRRLVPFRNDPAVCGWTTNSRWRMSSGTPLLFGWLSAILSTQQWLVDYAR
FT                   FSDQPVLCLTAAHDPDDFYQPEIARIDKLIAQRWKSLGLSPRRQNLLKHQLYLSTMSRL
FT                   TSGSSKALEMENPYKTALVGWTEAARHIDTVLNGNLIADRINTLYGRVGSGLTLRQMSG
FT                   LHDLTLSQPLERAEFFAEVAAWISHSGILNK"
FT   gene            complement(484676..487408)
FT                   /gene="ppdK"
FT                   /locus_tag="HMPREF0573_10425"
FT   CDS_pept        complement(484676..487408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppdK"
FT                   /locus_tag="HMPREF0573_10425"
FT                   /product="pyruvate, phosphate dikinase"
FT                   /EC_number="2.7.9.1"
FT                   /note="COG: COG0574; Pfam: PF01326,PF00391,PF02896;
FT                   InterPro: IPR010121"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10425"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66744"
FT                   /db_xref="GOA:D6ZJ45"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR010121"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ45"
FT                   /protein_id="ADI66744.1"
FT                   /translation="MPKFVYRFAEGNKDQKDLLGGKGANLAEMSNLGLPVPPGFTITTD
FT                   ACRAYLKEGKVPEETTVQVTKALREVEETVGRELGAAEDPLLVSVRSGAKFSMPGMMET
FT                   VLNVGLNDKSVEGLAKIAGNDRFAWDSYRRLIQMFGKTVQDIDGDLFSDALDNMKKNRG
FT                   AKADTDLNASDLKELTAQFKEIVKEQTGKPFPQDPRTQMDMAIEAVFRSWNSERARIYR
FT                   RRERIPHDLGTAVNIVTMVFGNMGADSGTGVCFTRDPSSGRPGVYGDILMNAQGEDVVA
FT                   GIRNTETLKDLEGHDKKSYDELLGIMRKLETHYEDMCDIEFTIERGKLWMLQVRVGKRT
FT                   PAAAFRIATQLVDEGLITTDEALLRVTGEQLQNLMFPMFDMSGKPEVFTKGMAASPGAA
FT                   VGKIVFDNDAAEASANAGVPCILVRRETNPDDLRGMVAAAGVLTSRGGKTSHAAVVARG
FT                   MGKTCVVGAETIVVDQAAKTATVGDTVLHEGDEISIDGGTGEVFLGAVPVQDSPVTTYL
FT                   SHGLQAGLDASDSEDEKDLIRAVDRLMTHADEVRRLVVRTNADTPADTQRALDFGAEGI
FT                   GLCRTEHMFLGDRRPLVEKLILSPEGSDERQRALDALEPLQKGDFKEMLKIMDGKHMTV
FT                   RLIDPPLHEFLPDLTTLEIKNAVAKAQGESLSEEDQHMLEAVRRMHEENPMLGLRGVRL
FT                   GIYLPGLFKMQMKALVSAACELKKDGLDPHPEIMVPLIGSIRELQLVRDEAEEIIAQVQ
FT                   KEYGVTFNVPVGCMIELPRAAMTAETIAKEAEFFSFGTNDLTQTTWGFSRDDVEGVFFP
FT                   QYVEAGIFGVSPFESIDTHGVGRVVAEGVKRGRSTKPNLPMGICGEHGGDPTSIHFFHK
FT                   VGLDYVSCSPFRVPVARLEAGRAAAEHLKWDESATQGVE"
FT   gene            complement(487693..489336)
FT                   /locus_tag="HMPREF0573_10426"
FT   CDS_pept        complement(487693..489336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10426"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10426"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66745"
FT                   /db_xref="GOA:D6ZJ46"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ46"
FT                   /protein_id="ADI66745.1"
FT                   /translation="MDNHKVEMSGLEALRSLDPAWNLPVDLDSLRAKVSAQMESEGLTF
FT                   AAQPPAHVVATETADTQTPVAEVVSLAVRRHTLAVRRNWLVGLSAAAAATVVGFTGWSA
FT                   LSPDERGAVPISDDGVVIADGPRITAAGSEIVVPGASERLENVGDVEFVAAGHFSTVPT
FT                   KAPILRVGKGASVSADQVQKVANSLGMRGSVKKNGAGFTVTDTKGATLTVTVGQLTSLT
FT                   FDNLSAVRMECVPVKPGDGNVELPNPDATKNPTENSGASSNSSPAPSTSTAPGSTPLEP
FT                   GEPTEPSVAPTPKWTPTPTETPTETVPPAVRPEIPEPSHPATKGATQNVDTADNVNVPG
FT                   AVVEVGQLQVLLVVNQTTDPSGNSPIETVEPQATQNPSPGPTPCVMKVAGNAPSPQNAI
FT                   AQVEKVAASLGATVMSRSAGASQKDGLTTVTVPVKMPGQSSTQSWKAVVSEAGVASIRA
FT                   NLGKETKIGEYKVISEAQAVERLNNPKYGPLDVHNQKGLPTKIDGRIDLVSARLVSQPV
FT                   RQKDGSILDMPVYLLTDSQGRVWTVLAVAE"
FT   gene            complement(489493..489993)
FT                   /locus_tag="HMPREF0573_10427"
FT   CDS_pept        complement(489493..489993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10427"
FT                   /product="Sigma-70 region 2"
FT                   /note="Pfam: PF04542,PF08281; InterPro: IPR014284"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10427"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66746"
FT                   /db_xref="GOA:D6ZJ47"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ47"
FT                   /protein_id="ADI66746.1"
FT                   /translation="MSTASHDEQWFERVFAEHGTAIVRFLYRRGAYSDAEDLAAEVFTV
FT                   MWRKKAEVPDGAELPWLYKTAGLTLANWYRKKKSLPMGDNQESLDSTDFSDPAQLVVED
FT                   QGMRAALLSLSERDREIILAVAWEGLSGNALAQYLGVSRSAADAALSRARKRLEEAIEN
FT                   NTS"
FT   gene            complement(490167..492821)
FT                   /locus_tag="HMPREF0573_10428"
FT   CDS_pept        complement(490167..492821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10428"
FT                   /product="ATPase family associated with various cellular
FT                   activities (AAA)"
FT                   /note="COG: COG0542; Pfam: PF02861,PF00004,PF02151,PF07724;
FT                   InterPro: IPR003593"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10428"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66747"
FT                   /db_xref="GOA:D6ZJ48"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ48"
FT                   /protein_id="ADI66747.1"
FT                   /translation="MFERFTDRARRVVVLAQDEARRLNQNYIGTEHLLLGLIHEGDGIA
FT                   ARALETMGISLEAVRAQVIEIIGEGEQPTTGHIPFTPRARKVLEFSMREALQLGHNYIG
FT                   TEHILLGLLREGDGVAAQVLIKLGADLNNVRQTVIELLSGYQGGQSQQSGRDTVGVGGG
FT                   RADNPNAGGNSAILDQFGRNLTQAARESKLDPVIGRTKEMERVMQILSRRTKNNPVLVG
FT                   EPGVGKTAVVEGLAQSIVRGDVPETLKDKQLYSLDMGSLVAGSRYRGDFEERLKKVLKE
FT                   IRTRGDIILFIDEIHTLVGAGAAEGAIDAASILKPMLARGELQTIGATTIEEYRKYIEK
FT                   DSALERRFQPVKVEEPSVEETVAILKGLRDRYESHHRVMITDAALAAAAQLADRYVSDR
FT                   FLPDKAIDLVDEAGARLRIKRMTAPPELKEVDEKIAKTRQAKEAAIDAQDFEKAAQLRD
FT                   EEKHLTEERAAKESQWRQGEDTSESVVDEEQIAEVLAMSTGIPVFKLTQAESSKLLRME
FT                   DELHKRIIGQDEAVKAVSQSIRRTRAGLKDPKRPGGSFVFAGPTGVGKTELAKALAEFL
FT                   FGDENALVQLDMSEFSEKHTASRLFGSPPGYVGYDEGGQLTEKVRRKPFSVVLFDEVEK
FT                   AHPDIFNSLLQVLEEGHLTDSQGRLVDFKNTIIIMTTNLGTREINKGVLTGFQASGELA
FT                   TDYQRMKGKVQEELKQHFRPEFLNRVDEIVVFPQLEKGEILQIVDLMIAKLDDRMLDQG
FT                   MALQITPAARALLAHKGFDKTLGARPLRRAVQREIEDVLSEKILFSELGEGQTVTVDVE
FT                   PRFIKHESADKVNGTDWEFTDDAEFTFTGSDGLPEGRAQQRRKLEDVTAATIREAELAA
FT                   READDSPDKEPAA"
FT   gene            complement(492899..493435)
FT                   /gene="dtd"
FT                   /locus_tag="HMPREF0573_10429"
FT   CDS_pept        complement(492899..493435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dtd"
FT                   /locus_tag="HMPREF0573_10429"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /EC_number="3.1.-.-"
FT                   /note="COG: COG1490; Pfam: PF02580; InterPro: IPR003732"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10429"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66748"
FT                   /db_xref="GOA:D6ZJ49"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ49"
FT                   /protein_id="ADI66748.1"
FT                   /translation="MNPEQTERDGDANRKGKSMRAVIQRVNGAKCVVNGEVTGEFTGPG
FT                   LVVLLGVTHTDGDAQVEKMARKIANLRIFDAPGAYDAAGGSEKLSQARGAEASAVQLGL
FT                   PVLLISQFTLYGDARKGNRPSWVAAAPGEVAQPLVDAVGAALQDQGMRVERGIFGADMK
FT                   VSFTNDGPFTILLEV"
FT   gene            complement(493432..493788)
FT                   /locus_tag="HMPREF0573_10430"
FT   CDS_pept        complement(493432..493788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10430"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66749"
FT                   /db_xref="GOA:D6ZJ50"
FT                   /db_xref="InterPro:IPR019662"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ50"
FT                   /protein_id="ADI66749.1"
FT                   /translation="MSDIFAAINSVQTFLVLGLVLIVVGMSLYALLHTLTTPAQAFPTE
FT                   GKRTRNFWALLNLLALVISFLGITPNGYVGLFGVMMALIIPAVYLADVRPAVASWRRRG
FT                   NNSRGMGQRPPTPW"
FT   gene            complement(493790..494854)
FT                   /gene="ygfZ"
FT                   /locus_tag="HMPREF0573_10431"
FT   CDS_pept        complement(493790..494854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ygfZ"
FT                   /locus_tag="HMPREF0573_10431"
FT                   /product="folate-binding protein YgfZ"
FT                   /note="COG: COG0354"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10431"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66750"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ51"
FT                   /protein_id="ADI66750.1"
FT                   /translation="MVTDTGWNHGLELLEGRGYVTIPLGVLKVSGTDRWTWLNSVSTQD
FT                   FSNWETASSREALILDPTGHIELSFFAVDDGTNVWILTEEPRGAVEFFQSMRFRSRVEI
FT                   ADVSADFTVIGYLKTGDKDSLAAQFWSEQARVTWTDPWPGPVGNTTTFTIPGASHPADD
FT                   PAAPHRELAVVSHPDLPALEAKAATNALMKADLGAWEAVRISLWHPRLGREGKPGTLPH
FT                   ELDWLRVAVSLQKGCYPGQETVAKLTNRGRPPRRLTFLDIDGSREELPAIGSPLTLESD
FT                   GSEVGVLTSVAYHPTDGQIGLGLLKRQVNPAEILLVEGTRAAQSVIVDPSGDNPRRLDD
FT                   SKLSGLLGLRARKK"
FT   gene            complement(494942..495892)
FT                   /locus_tag="HMPREF0573_10432"
FT   CDS_pept        complement(494942..495892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10432"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66751"
FT                   /db_xref="GOA:D6ZJ52"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ52"
FT                   /protein_id="ADI66751.1"
FT                   /translation="MTSQPHAEKPDPSLTNTVKITRRVRREEHQAEQIEKLPKVPESLI
FT                   GRVICAHPEIITALAALGMSLIFVLPADFLTVAGVIAVVCFAFGWAHLAHLPAPRASFI
FT                   LLTTFGVLAVLMGRIFGDFSIVAEVVGLGVMGAFIVEMLRRPRTDLLSSVAGNVTGILI
FT                   VSTAGAWVMLEAETLWYFLLVPGAVTLIGGCIGMAMSANWQLKWRVFTGILFSVIFGLA
FT                   AGAAILVMEGTSRDQMVLFAGGHLPSLTVALVSGLLLGVVFGIAFASLTVLFSGDLAPS
FT                   TVSAAVSQAFIPVLAAAVPLYILARLLVGEGPTLA"
FT   gene            496049..496204
FT                   /locus_tag="HMPREF0573_10433"
FT   CDS_pept        496049..496204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10433"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10433"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66752"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ53"
FT                   /protein_id="ADI66752.1"
FT                   /translation="MEPGASTDIDVLYLSYHTCDTLSPVLTKKTFNLPFNLTNLLVMTR
FT                   INLSLP"
FT   gene            496343..496963
FT                   /locus_tag="HMPREF0573_10434"
FT   CDS_pept        496343..496963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10434"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1392; Pfam: PF01865"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10434"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66753"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ54"
FT                   /protein_id="ADI66753.1"
FT                   /translation="MGLFNRAKDEGFFEQLTEIANNLIEGTDILAKLMSLPTAQRDGVR
FT                   NDLHAVENSSDDLTHEFMNKINQTFVTPLDRDDLSELAYRLDDCMDLVDEAGNLIVVYQ
FT                   LQEIPECLHKQAAILQKCAKVTASAMPRLKTLDELREYWVEVNRLENQADQIYMHCLSD
FT                   IVNHNPDPIAVIKLKDVTERLEDACDAFEHLAALVEGIAIKES"
FT   gene            496976..498010
FT                   /locus_tag="HMPREF0573_10435"
FT   CDS_pept        496976..498010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10435"
FT                   /product="phosphate transporter family protein"
FT                   /note="COG: COG0306; Pfam: PF01384; InterPro: IPR001204"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10435"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66754"
FT                   /db_xref="GOA:D6ZJ55"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ55"
FT                   /protein_id="ADI66754.1"
FT                   /translation="MDISLLLVVLVVVIAVVFDFTNGFHDAANAIATAISTRAWAPRTA
FT                   LAMAAVMNLVGSLLGTEVAKTIGSGIIDMSGYATAVSHAERAHGLLIILGGLIGAICWN
FT                   IITWYFGLPSSSSHALIGGLAGAGLAAGVTVNWSTITSHVLIPMVVSPLIGFTFAYVLM
FT                   SLVMMFMKNLAYRRTMRKFRVGQKFSSAALALGHGLQDAQKTMGVIFIALVASGHVDLD
FT                   DPIPLWVKFAAAIAIAAGTFVGGFRIMKTLGSRVIHVNPANGFVSETVAAGVLYFTAFI
FT                   WHAPISTTHTVTTAIMGVGATRRLSAVRWGTAGNIVVAWVLTLPAAAVVAAAVYSLLEF
FT                   LLRI"
FT   gene            complement(498083..499129)
FT                   /locus_tag="HMPREF0573_10436"
FT   CDS_pept        complement(498083..499129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10436"
FT                   /product="hydrolase, NUDIX family"
FT                   /note="COG: COG0494; Pfam: PF00293,PF00300; InterPro:
FT                   IPR000086"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10436"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66755"
FT                   /db_xref="GOA:D6ZJ56"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ56"
FT                   /protein_id="ADI66755.1"
FT                   /translation="MASHGIETGAEDDTGKGNLMSKVLAAGGVVWRGGELRPALEGVPT
FT                   QTPYEFLIVHRPKYNDWSLPKGKMEPGELLPACAVREIAEETGVQVCLGPQLGVTAYPV
FT                   EGRQKQVTYWLAQVRHSAAILARPYVEPASTREINETRWVDQTRAQELLTQEYDRHLIA
FT                   HAEECLRQGWGDSTPVMLVRHGKAKNRLKWNTDDSLRPLKKRGRHQAENLVSVLSAFGI
FT                   SRMFCSPWKRCEQTIRPYLKASGIRCEFPDVLSEDGYAANPYAGRELLRALLQAAPAEG
FT                   PTALCSHAPVLIPLMRSLGNDFLRETLIPLETGESLIVHVIPGVEADPKLIAVERAEAE
FT                   PPAGYARD"
FT   gene            complement(499110..501584)
FT                   /gene="ppk1"
FT                   /locus_tag="HMPREF0573_10437"
FT   CDS_pept        complement(499110..501584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppk1"
FT                   /locus_tag="HMPREF0573_10437"
FT                   /product="polyphosphate kinase 1"
FT                   /EC_number="2.7.4.1"
FT                   /note="COG: COG0855; Pfam: PF02503; InterPro: IPR003414"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10437"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66756"
FT                   /db_xref="GOA:D6ZJ57"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ57"
FT                   /protein_id="ADI66756.1"
FT                   /translation="MSDNQKNNAKPETNGTEIPVPPPLPGTEKKSLFAGATAEEMFPKN
FT                   DLNPGGSQEYDDADFTEPQAPREETLPDPVAIARADALGSKLKKNKSSNKIDHKPLTLK
FT                   KEDGLTPDGLPKLPKGRFADRELSWLAFNQRVFEQAQDPRLQLLERAWFLTIYCSNLDE
FT                   FYMVRVAGLKRRIAAGFATVSASGLTPRQLEGEISRRSHEMTGNVYHYFQDEIRPALDK
FT                   AGLVITDWDRLNETHHEILHRYFRNQVFPILSPLAVDPSHPFPYITGLSLNLAIIVRNP
FT                   NTGKEHFARIKVPPILPRFVAVTENGVENDPSSVILAGEKVNFVPIEQIISAHLDHLFP
FT                   GMEIKEAHEFRVTRNEDLEVEEDDAENILTAMESELAKRRFGPAVRLEVAESMPAFLLD
FT                   FLKENLEIGTSDVFRLPAPLDLRGLNDLHDLDIPQLKYPPYVPVTPAGLAEKESSKPAD
FT                   IFSSIRDHDVLIHLPYDSFATSVQQFIVQAAQDPNVLAIKQTLYRTSGDSPIVQALIDA
FT                   ARAGKQVVAIVEIKARFDEEANIGWARKMEHAGVHVVYGLVGLKTHCKLCLVVRQEPDG
FT                   LHRYCHVGTGNYHPKTARGYEDLGLLTDDREVAQDLTRLFNQLSGYAPRSTFHRLLVAP
FT                   RSIRDGLIERINREIANKKAGKKAGILFKINSIVDERMTDALYRASQAGVPVMVQVRGI
FT                   CSIKPGIPGLSENIRVVSILGRFLEHSRVYAFKNDGDPEVWIGSADLMHRNLDRRVEAL
FT                   VKIVDPEQIQYLIDLVKHGMAETTASWRLMPDQQWVRVNRNDAGLRLEDIQETLMSHTS
FT                   SRVAGRGGVSRH"
FT   gene            complement(501677..502312)
FT                   /locus_tag="HMPREF0573_10438"
FT   CDS_pept        complement(501677..502312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10438"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66757"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ58"
FT                   /protein_id="ADI66757.1"
FT                   /translation="METRKPRRPAIIEPETLEYLEGEEDPALSSESAHTSARILVKSPN
FT                   GEWSDPEPETKERLLAFMQGNGVDELAELWSRSPVNTLPGVLWRLLLIDQWVKRYPEGV
FT                   NTRFKQGLNSPQLSEYLDIDGAHSLDFPAWKKQLEQILSGSFDDNFADFLDRSQAVLRV
FT                   LAASESVWMKKDSANPLANEVTLRDNALLVTADELLDAAAMYREGRLD"
FT   gene            502560..502632
FT                   /locus_tag="HMPREF0573_t10006"
FT   tRNA            502560..502632
FT                   /locus_tag="HMPREF0573_t10006"
FT                   /product="tRNA-Lys"
FT   gene            complement(502829..503041)
FT                   /locus_tag="HMPREF0573_10439"
FT   CDS_pept        complement(502829..503041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10439"
FT                   /product="TOBE domain protein"
FT                   /note="COG: COG3585; Pfam: PF03459; InterPro: IPR004606"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10439"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66758"
FT                   /db_xref="GOA:D6ZJ59"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ59"
FT                   /protein_id="ADI66758.1"
FT                   /translation="MKISARNQFKGTVKNIERGAVNSIVEIEVAPGVCFAASITNTSVD
FT                   NLGLSEGSDAYAIVKASSVMVGVDA"
FT   gene            complement(503285..504049)
FT                   /locus_tag="HMPREF0573_10440"
FT                   /note="rumG"
FT   CDS_pept        complement(503285..504049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10440"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66759"
FT                   /db_xref="GOA:D6ZJ60"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ60"
FT                   /protein_id="ADI66759.1"
FT                   /translation="MNFSELLKIEFLKTKRSHITLLLFIAPLLVVSSGVASLRSYLSPE
FT                   YPNAWAAMFIQSALIYSYYLLPLSMIVVCVMIAGRETDHNGILKMLALPISRYALSSAK
FT                   FCVLLAYLLLEMVVFMACFVIAGWMATFSMGIQESLPLVFLLKWCGALFLTMIPSLTIM
FT                   WAITVVFDKLFLSIGINILLVIPGILMANTPLWLLYPYCYSGYLVSLSLHSDRILTIGT
FT                   GFTLWPFVPIAVLITAIMWFIALTQFGKKEMS"
FT   gene            complement(504061..504786)
FT                   /locus_tag="HMPREF0573_10441"
FT                   /note="rumE"
FT   CDS_pept        complement(504061..504786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10441"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66760"
FT                   /db_xref="GOA:D6ZJ61"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ61"
FT                   /protein_id="ADI66760.1"
FT                   /translation="MTALAIELKKCKRTGFLPLMLAVGILGAAYAFLNFTLRKETLLSL
FT                   PLAPMDILLTQLYGMIMVLNMFGLIAAACIIYNVEFKGNAVKKLYMLPVNVTAVYVSKF
FT                   TIMSVLFAIAVCLQNWALAAIGAVDLPSGAFDIRILISFAGYSFLTSLPVLSFMLFVSS
FT                   RIKNVWITLGIGVVGFLSGMALATSDIVLSLVSPFVVMLKPAVAMSAQPDTAVVLVSLI
FT                   ETILFFAAGLWCVRHLRYE"
FT   gene            complement(504783..505565)
FT                   /locus_tag="HMPREF0573_10442"
FT   CDS_pept        complement(504783..505565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10442"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="COG: COG1131; Pfam: PF00005; InterPro: IPR003593"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10442"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66761"
FT                   /db_xref="GOA:D6ZJ62"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ62"
FT                   /protein_id="ADI66761.1"
FT                   /translation="MDEKIAHDYIVTTEQLTKKYKSFVAVDAVSLHIRKGSIYGFLGPN
FT                   GAGKSTTMKMLLGLTSPSRGTFTIDGKQFPGDRISILKEIGSFIESPSFYANLTGKENL
FT                   EIIRRILGLPKSAVDDALDLVGLSEFGDRLAKKYSLGMKQRLGLAGALLGRPPILILDE
FT                   PTNGLDPSGIHEIRNLIKSLPGLYACTVLISSHMLSEIELMADDIGILNHGRLLFEGSL
FT                   AELRKYALKSGYATDNLEEMFLSMIETDNEHRKQRAKL"
FT   gene            505694..506479
FT                   /locus_tag="HMPREF0573_10443"
FT   CDS_pept        505694..506479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10443"
FT                   /product="response regulator receiver domain protein"
FT                   /note="COG: COG0745; Pfam: PF00072,PF00486; InterPro:
FT                   IPR001789"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10443"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66762"
FT                   /db_xref="GOA:D6ZJ63"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ63"
FT                   /protein_id="ADI66762.1"
FT                   /translation="MPPDSGIPHKWQGYDDMQNRYPGGVTMNQDAYLLNKRILLVDDEQ
FT                   DLLDMVLSILKESGFRQIMTARSVKEALEVAQKATPELAIIDVMLPDGTGFELMNKLKQ
FT                   YVDCPILLLTACGEDEDRFKGFSLGADDYIVKPFHPKELTYRIMAILRRSYRGENPIVA
FT                   LRNSQIDFSSAEVIKANERIPLTAKEHDILSALYRNAGRIVTIEALCEAAWGTNPFGYE
FT                   NSLMAHIRRIREKIERYPSQPVSLVTVRGLGYKLILEEK"
FT   gene            506481..507884
FT                   /locus_tag="HMPREF0573_10444"
FT   CDS_pept        506481..507884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10444"
FT                   /product="ATPase/histidine kinase/DNA gyrase B/HSP90 domain
FT                   protein"
FT                   /note="COG: COG0642; Pfam: PF00512,PF02518; InterPro:
FT                   IPR003594"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10444"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66763"
FT                   /db_xref="GOA:D6ZJ64"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ64"
FT                   /protein_id="ADI66763.1"
FT                   /translation="MKSVPKLIHRFISIFLLSSVLIILLNIIAFVVLVANYAPSVDASP
FT                   YTIARATGKALQVSPRGEYALSDSMSTKLTEARAWAILIDNETLKVIWRTPNTPQTIPN
FT                   SYTLPDIADLSTGYLDGYPTYTGRNNHGVVVVGFPHHSFWKHAQPSWNYSLISNFPQIL
FT                   LSILSINVLLILGIYLTANTKFLKSVNPITKGIQQLSRGESVSVPETGVLSELAANINS
FT                   ASDILQQQKEQLRRKETARANWIAGVSHDIRTPLSMVMGFAGQLENSPQLSVPDRKKVT
FT                   MIIKQSERMKNLIRDLNLASKLDYNMQPLMIQPHNVVAIVRQTVVDFINMDLPDGFSIK
FT                   WLTDENLASCNVNVDQDLLQRALSNLLYNSISHNENGCTIYVSVSVQHNNCIICVEDDG
FT                   IGVSAPELEKLNHTLHYMICDTSTTEQRHGLGLLIVRQIIDAHKGTVTISPSKHGGLKV
FT                   TLSIPQQTI"
FT   gene            complement(507983..510832)
FT                   /locus_tag="HMPREF0573_10445"
FT   CDS_pept        complement(507983..510832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10445"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1002"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10445"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66764"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ65"
FT                   /protein_id="ADI66764.1"
FT                   /translation="MVSDLAAAREFAAQWAGKGYEKGECQKFWTLLLHDVLGYERMESV
FT                   RFEHRVAGGGFIDVWIRDASVMVEQKSLGVDLDAPEMRQGVLKTPLAQVWDYAEDLPRT
FT                   EQPRFLVTCNFGEFRVYDRDRGGRRDLEGAPTFAFTLAELGEHPEYLGFIIDPINSRLE
FT                   KEKQVSIQAGELVGRLHDGLLAQYLEPDAPETRHALNVLCVRLVFCLYCEDAGLFQKDA
FT                   FYRYLKGVAPADVRPRLKLLFRALDTPVERRDPYDTTLREFPYVNGGLFAGDFEIPNFS
FT                   PELLGLLLDEVSRAVDWSQISPTIFGGIFESTLNPETRRAGGMHYTSPENIHKVIDPLF
FT                   LDDLKAELQAIGDAEGLTPRQRTNRYRAFHERLCKMRFLDPASGSGNFLTETYLQLRHL
FT                   EDEVLSRLNAGQTAFSLAEVGASVTRVSLDQFYGIEINDFAVKVSEAALWISRLKANGE
FT                   TEMLLALGDDDFPLRESAHIVQANALTLDWNTVLPADQCSYVLGNPPFIGYSRLDGAQK
FT                   ADRLAIFGKVGGVLDYVACWYRKAADYMRGNREIQAAFVSTNSIVQGQQVAPLWRGLFE
FT                   SGIVLNFAHRTFIWANEASDQAHVYCVIIGFSYTERKTKYVWDYAVKTDEDTARDATLG
FT                   RARRGGVGVRHEVNHLNGYLADAPDVFIDKRTKPLSAMPSMTYGFKPADGGFLLLSPED
FT                   RDEFLASEPDAEKWICPFVTAKEFISGKQRYCLWLPEITPDQLAALPKVRARVQACRQW
FT                   RLEQVQTGDAYKLADRPHLLRPTSKFKEGIYIVIPRHSSERRKYVPLGFLDSQTIPGDS
FT                   VSIVPNADIYLFGVLMSQTHNAWMRAVAGRLKSDYRYSSDIVYNNFVWPDAAPAERERI
FT                   EQSAQGILEARAHYPDASLATLYDPDLMPVELRAAHRENDRAVEAAYGLSADSDEAGIV
FT                   SHLFALYATKTCSTPGKCG"
FT   gene            complement(511007..512371)
FT                   /locus_tag="HMPREF0573_10446"
FT   CDS_pept        complement(511007..512371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10446"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10446"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66765"
FT                   /db_xref="GOA:D6ZJ66"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ66"
FT                   /protein_id="ADI66765.1"
FT                   /translation="MVNTFLGLWEIGTPRVYLFWIVVLLAQIAIAEINRRWNWTIFVLW
FT                   TVGGIAVMPYVITHGIPMVGWFPFGKFTIMILTATMTGFLLFYGKRHPLKAHRYAFWFG
FT                   LALWIGLAVNIMEANIRDVTIFLQASEYYSCAADWQCLQAIDQAHSIPMIPGLPETRGV
FT                   AAAVGTEAWYQAVAANFAQAHVGIDPATGFRTIGGYWNLLSALAGVLNIITITGLGKIA
FT                   ITSQPNQKVKGLIWVDMVWPWIIAYDLWNHAFLYNSLADYTWYCTFALLLACTIPAFTW
FT                   AKGQWIWFRCFTLMFWIAANNILPELLVQPSGMFNYATMNPVANIVCAWLALISNVALF
FT                   GYWLYKIIGQKRNPITGVLFCELGAFRKVVLAHFDNKDKYFIVDQIPQTPMELGFEPDT
FT                   LVPPEDGWVGIMPWWRRDKRYLGKPHTPLSADPVAQARLERKSGDEPSESAKADS"
FT   gene            512619..513671
FT                   /locus_tag="HMPREF0573_10447"
FT   CDS_pept        512619..513671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10447"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66766"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ67"
FT                   /protein_id="ADI66766.1"
FT                   /translation="MATSPKGKCFWKLAGLAAVPIFGGVFAFSQLSGKATRAEQDWVYP
FT                   ADDIIDLNYQNGKSSTYAIDIDAPAYAVYRILKQIGVQKSGSFSSEFLERTFARLPFYN
FT                   HYEIQEEFQTPDAIQPGDIAGFDYQGMSMEWADVVPGKYLVQWVDTKNPPAAPGSYAFR
FT                   FPFMKHYAAAWCFYVIPLKGERCRLLNHWRVGFEPDNLYTRAINWINIELVGGVMAHMQ
FT                   NIYVKRVAEFRKKQQWHGKFMRGALGGRFFRSGTPAGRWDGTPLFEDTYTQWFRYGRRS
FT                   PAVAEIRPPVTDNPNWPPTEPGNPWEDTVDPDYYVDWSEPEFSWDEQIRQKRERTYLPG
FT                   WGKHQSKAGD"
FT   gene            513674..514687
FT                   /locus_tag="HMPREF0573_10448"
FT   CDS_pept        513674..514687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10448"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66767"
FT                   /db_xref="GOA:D6ZJ68"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ68"
FT                   /protein_id="ADI66767.1"
FT                   /translation="MVMPAEAPNLFFFEVGQWWDFAMLFLVIAVLAALAWLAIRFKWAA
FT                   IALFIVVPVLLTIFWWPHSIPGTQSEGWFAIAKQYSALAGSLCLVALQYFPKLRRNRFY
FT                   LLIPPIILSINILEAVIRDFQCYSLHGNVNNGMWVWGGPWNIMNGIAGILNLLMIAGWT
FT                   GIYVSKTNRHIIWTDLTIGWIIAYDLWNVAYCYNCLSDRAWYSGVALLLSCTIPAFMTM
FT                   GRGAWIQYRAYTLTFWSAFVLSFPHFTQDSMFTHVASQNHAALFLLSFLALAANAGLAV
FT                   YHVWKIVKTKRNPFKTELYTDLPQNVKIIRRTATDEVKSRIAARLGKTPQELGYLD"
FT   gene            complement(514764..515360)
FT                   /locus_tag="HMPREF0573_10449"
FT   CDS_pept        complement(514764..515360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10449"
FT                   /product="isochorismatase family protein"
FT                   /EC_number="3.-.-.-"
FT                   /note="COG: COG1335; Pfam: PF00857; InterPro: IPR000868"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10449"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66768"
FT                   /db_xref="GOA:D6ZJ69"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ69"
FT                   /protein_id="ADI66768.1"
FT                   /translation="MAEMKRALLIVDVQPTFCEGGALGVVGGNEVAERIADFVTEHEDE
FT                   YEIIVTTQDWHINPGAHFSDHPDFIDTWPPHGIAGTAEAELHDAIASLPFDDSVKKGQY
FT                   AAAYSGFEGVNKSGDTLEEILRRADITDVDVVGIAESHCVKDTALDALDLGWPTRVFED
FT                   LTVPVSAELGEAAREEMAQAGIDEIPSTDAFKAVD"
FT   gene            complement(515462..515537)
FT                   /locus_tag="HMPREF0573_t10007"
FT   tRNA            complement(515462..515537)
FT                   /locus_tag="HMPREF0573_t10007"
FT                   /product="tRNA-Phe"
FT   gene            complement(515573..515646)
FT                   /locus_tag="HMPREF0573_t10008"
FT   tRNA            complement(515573..515646)
FT                   /locus_tag="HMPREF0573_t10008"
FT                   /product="tRNA-Asp"
FT   gene            complement(515677..515749)
FT                   /locus_tag="HMPREF0573_t10009"
FT   tRNA            complement(515677..515749)
FT                   /locus_tag="HMPREF0573_t10009"
FT                   /product="tRNA-Glu"
FT   gene            515863..517422
FT                   /locus_tag="HMPREF0573_10450"
FT   CDS_pept        515863..517422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10450"
FT                   /product="transporter, small conductance mechanosensitive
FT                   ion channel MscS family protein"
FT                   /note="Pfam: PF00924; InterPro: IPR006685"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10450"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66769"
FT                   /db_xref="GOA:D6ZJ70"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ70"
FT                   /protein_id="ADI66769.1"
FT                   /translation="MSFVFSPTPEPNPTPDKAVKEVLETSLDIMAVLAASLVCIVALLA
FT                   AAQVIGFLLRRWGRKHRLIKYMERRSRVGGSLTCIALGATIGWYWTVRDHNVPGYGTIS
FT                   HGLLILMIIAVTVWLIELCAVLEDMTRTQLEGGSKPNRLVTQAQVMHRVSQVFFGVFGA
FT                   ISIALTFPEARAAMGSVLASAGIISLIAGIAAQGVLANMFAGLQIAFSDPIRVGDVVVV
FT                   QGQQGTIEEITLTYIVIHLWDERRLILPSKKFTEEPFENWTKRDTHLLGVVELRVDWRL
FT                   PLAAFRNEVDRLLSETDLWDGRTSSVQVTDSSVETMLVRLVASAANSGDLWDLKCYLRE
FT                   RLIEWIEKEAPYALPRRRVETDKVTEVHLPVDEIEIEKQARELAIATIRKTNSSRHAAA
FT                   TKKQATEAAPTSPYGEPLLDQYARKIQEKRRSWRFKARRLDETHNEKSEQLPPSRDALQ
FT                   DTRVLSTTATITGDRLYSGTPDAEERRKLVTGPKQSEEKTTADSDTTTADTTTPSSEET
FT                   QK"
FT   gene            517419..518465
FT                   /locus_tag="HMPREF0573_10451"
FT   CDS_pept        517419..518465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10451"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /note="Pfam: PF03372"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10451"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66770"
FT                   /db_xref="GOA:D6ZJ71"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ71"
FT                   /protein_id="ADI66770.1"
FT                   /translation="MSRNKRFRKSAPPRRYATPQTLPNPDFLRVITCNLQWGTPAEGWT
FT                   DVQKANSRAEAFIRGLGERCRSLFKSGSVNTRTQLTEENLKQTAQVLQQLKPDILALQE
FT                   VDKGQRRSGYVRQARVLAEALRLPYWRIGASYAGQSQVLHRRPLDSELKAESGYGIALL
FT                   SRWPAKSWHFKRLGRVRARIVWGSDPWKGFSHGFLEGLRDLPAAAKGTGVRFGQMRVLL
FT                   AARLATPLGTVALGTTHLEIHRPTAASQLRRAWRSLYHLRSESCLLVGDFNLRDYQINK
FT                   VLQPLPTEQHPELHAAIPSYPADKPWIALDQLLGNGWELVGEPQALRLPISDHRAVIYD
FT                   IRPVKTAQ"
FT   gene            complement(518574..519920)
FT                   /gene="eno"
FT                   /locus_tag="HMPREF0573_10452"
FT   CDS_pept        complement(518574..519920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eno"
FT                   /locus_tag="HMPREF0573_10452"
FT                   /product="phosphopyruvate hydratase"
FT                   /EC_number="4.2.1.11"
FT                   /note="COG: COG0148; Pfam: PF03952,PF00113; InterPro:
FT                   IPR000941"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10452"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66771"
FT                   /db_xref="GOA:D6ZJ72"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ72"
FT                   /protein_id="ADI66771.1"
FT                   /translation="MAACTLFRAERRKNNNLSHKETQLAIIESIYGREILDSRGNPTVE
FT                   VELEYEGGMVRAAVPSGASTGQFEAVELRDGDKGRYQGKGVLKAVKAVNDIIAPELVGF
FT                   DTVEQRSIDAAMMDLDGTPNKGKLGANAILGVSLAVAKASAEDAGLELFEYLGGPNAHV
FT                   LPVPMMNILNGGSHADSNVDIQEFMIAPIGAETFAEALRMGAEVYHCLKSVLKDKGLAT
FT                   GLGDEGGFAPNLESNAEALDLILVAIEKAGYKPGKDVALALDVASSEFYDNGKYNFEGE
FT                   ARDAAYMEKYYEELIEKYPIVSIEDPLNEEAWEDWQKLTAAIGDKVQLVGDDLFVTNPE
FT                   RLERGIKEGVANALLVKVNQIGSLTETLEAIEMAHRAGFHTMTSHRSGETEDTTIAHLA
FT                   VASNAGQIKTGAPARTERVAKYNELLRIEDMLGDAAVYAGKSAFPRFRG"
FT   gene            complement(520023..520613)
FT                   /locus_tag="HMPREF0573_10453"
FT   CDS_pept        complement(520023..520613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10453"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66772"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ73"
FT                   /protein_id="ADI66772.1"
FT                   /translation="MAEKSLVTKTTKTATKLMTGVVALALAGGLLSGCEAKPGVAAYGD
FT                   GWVVTESQLGTVTKELAEAGINLNDTAEMQTARIYALRYLRTLHEGGQDLLSQCPQLDE
FT                   IKTDLFKVNPAKMSPETHDVMQLLLCATATDPAVAHELGVQTVNPQLAAQIEKAYKSGF
FT                   DLKNAKLSNRMNQTIQIIQQRATQMQMMGQGQQ"
FT   gene            complement(520681..524178)
FT                   /gene="mfd"
FT                   /locus_tag="HMPREF0573_10454"
FT   CDS_pept        complement(520681..524178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="HMPREF0573_10454"
FT                   /product="transcription-repair coupling factor"
FT                   /EC_number="3.6.1.-"
FT                   /note="COG: COG1197; Pfam: PF02559,PF00270,PF00271,PF03461;
FT                   InterPro: IPR004576"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10454"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66773"
FT                   /db_xref="GOA:D6ZJ74"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ74"
FT                   /protein_id="ADI66773.1"
FT                   /translation="MSLHGLLEVTGDALAGLEPDRADTASEYVAPPGFYAPLIAGLPGS
FT                   DERLTVVLAPSTRAATQLARELGAYTAGVELFPDWETLPHERLSPRTDTMARRIWALHR
FT                   VTHPHPQDAVQFLVMPVRAALAPVNAHIADYPLFTVQVGDTYDRDTMAANLLRLGYERV
FT                   DMVGARGQFAVRGGLLDVFSPTSAHPVRIELFGDEVDTIRAFTASDQRTFGGDIRTLVA
FT                   PACRELLLDDTARKLAASLAGQMPQAAEILNLAAEGKYGEGLESLSPLLGAEMVPLFSL
FT                   LPPGARLVATDRPRLEARATELVETTQEFLAASWSAAAGGGEVPLEIEQASFLTLEQLH
FT                   AAAQEAHMDTVFVSPFAVGENAQNVGAQIVMEPLAGETGLIGTIGDLASKNWNVVITTT
FT                   GKGMASRLRDVLSEADVPAKVVKDATSQNDGTVQITVAPLDEGYQVPTAQLLVVSEAQV
FT                   LGKKKSRHTADKANLPARRRKAIDPLTLTQGDYVVHLHHGIGRFVKLAKRTMGRGRETT
FT                   SKEYVVLEYAPSKRNGPADQLWVPTDSLDLLSKYVGGESPTLSKMGGADWAKTKSKARK
FT                   AVKEIARELVRLYAIRQASKGHAFSPDTPWQRELEDSFEFVETPDQLTVIDEVKHDMEQ
FT                   TVPMDRLVCGDVGYGKTEIAVRAAFKAVQDGKQVAILAPTTLLVSQHTETFTSRFAGFP
FT                   VTVAALSRFTTAKEAAQIKAGLKDGSIEVVIGTHALLSGNVRFKDLGLVVIDEEQRFGV
FT                   EHKEALKALRADVDVLTMSATPIPRTLEMAITGIRGMSTLTTPPEDRHPVLTYVGAYSD
FT                   KQVAAAIRRELLRDGQVFFVHNRVQSINRIAAHLAELVPEARVRVGHGQMSEKQLESVM
FT                   VDFWNQEFDVLVSTTIVENGLDVTNANTIIVDRADRFGLSQLHQLRGRVGRGRERGYAY
FT                   FLYPPGTTMNETAFERLKTIGTNTGLGSGMAIATKDLEIRGAGNLLGGEQSGHIAGVGF
FT                   DLYVRMVGEAVATYKGEEAPEDTSVSIELPIDAFIPEDYLDVQSLRLDAYTRLSAATTD
FT                   EEIDQLLEEMTDRYGRPPEPLERLGAVAKLRNLARAQKVQEIKVMGKFIRFAPVELADS
FT                   QMARLQRMYPGARVKLATRELFIPAPTRKNGLSETPIVDLELLEWVQKIIRGIIKPLA"
FT   gene            complement(524231..524899)
FT                   /gene="pth"
FT                   /locus_tag="HMPREF0573_10455"
FT   CDS_pept        complement(524231..524899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="HMPREF0573_10455"
FT                   /product="aminoacyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="COG: COG0193; Pfam: PF01195; InterPro: IPR001328"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10455"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66774"
FT                   /db_xref="GOA:D6ZJ75"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ75"
FT                   /protein_id="ADI66774.1"
FT                   /translation="MSPTHEPRLDPSRLLDKEGTWLVVGLGNPGDKYAGTRHNCGYMVT
FT                   DCFVKQSGQAYRNQSLARAGVVARVATVSLGYGVDAPKIIVAHTGSYMNESGPGVKELL
FT                   DYYRLGSDRLLVVHDELDLEMGYAKLKVGGSDGGHNGLKSIQKALGTKDFARLRIGIGR
FT                   PVKMPGGGFDVINWVLGRIPKSQQSILDEVLDRAVQCVTDIAENGLAKAQARLHLGNPK
FT                   "
FT   gene            complement(524932..525558)
FT                   /locus_tag="HMPREF0573_10456"
FT   CDS_pept        complement(524932..525558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10456"
FT                   /product="ribosomal protein L25, Ctc-form"
FT                   /note="COG: COG1825; Pfam: PF01386; InterPro: IPR001021"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10456"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66775"
FT                   /db_xref="GOA:D6ZJ76"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ76"
FT                   /protein_id="ADI66775.1"
FT                   /translation="MADNPTLQVEPRTDFGKGFARRARVADKIPAVLYGHGTDPVHLLL
FT                   PYHDTFLLVKDNPNAVISLKGLKDPAMVLVKDIQRHPVKRQIMHMDLLLVKADEKVDVE
FT                   VPIEIIGEPMSGLVANQDLLNMEIFAPVIDIPEKIEVNVDGLEDGVVLSVADIKLPAGV
FT                   EAKTDPEAIVLSVAAPQEADIPEAPAAEDETAEAPVADASAEAAE"
FT   gene            525591..525821
FT                   /locus_tag="HMPREF0573_10457"
FT   CDS_pept        525591..525821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10457"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66776"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ77"
FT                   /protein_id="ADI66776.1"
FT                   /translation="MFSPEDHGFLLRALFSEVSSLPLQVDRRIRFLSPDRKTRLARKQK
FT                   RAKGIQQKLPGRVDNGSRHGMTAALPLAEAT"
FT   gene            525958..526707
FT                   /locus_tag="HMPREF0573_10458"
FT   CDS_pept        525958..526707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10458"
FT                   /product="nitroreductase family protein"
FT                   /note="COG: COG0778; Pfam: PF00881; InterPro: IPR000415"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10458"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66777"
FT                   /db_xref="GOA:D6ZJ78"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR016446"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ78"
FT                   /protein_id="ADI66777.1"
FT                   /translation="MNETIDVQLEHRTIREFKSDPIPEDIFQTLMDVAMHTPTSRGIQS
FT                   ASIIRVKDQAKREKLAEIGGQEYVARAPEYLLFIVDLARAAAILQEMGLYPQSAATIDT
FT                   FQEGFTDAVLMVQNVVVAAESLGLGANILGNILNEPKGVIEAIGLPLYTFPVLGLTLGY
FT                   PGENPQRKPRMPKEFRVMTDTYVRPDSYLEALKDYDAQMREYYDLRNKGKREDKFTNQI
FT                   FQNLGKVRNRRASILDDIESQGFLMHP"
FT   gene            complement(526737..527708)
FT                   /gene="prs"
FT                   /locus_tag="HMPREF0573_10459"
FT   CDS_pept        complement(526737..527708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prs"
FT                   /locus_tag="HMPREF0573_10459"
FT                   /product="ribose-phosphate diphosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="COG: COG0462; Pfam: PF00156; InterPro: IPR005946"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10459"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66778"
FT                   /db_xref="GOA:D6ZJ79"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ79"
FT                   /protein_id="ADI66778.1"
FT                   /translation="MAELFDTPRKRLVIVTGRSHPELAEQVAKELDVEVLPTTIYDFAS
FT                   GEIYVRYNESVRGCDVFCIQSISGNVSKWLMEHFIMIDALKRASAKRITVVAPLYPYAR
FT                   QDKKHQGREPISARLISDLYKTAGASRLMSIDMHASQEQGFFTGPVDHLQAMPVLIDYV
FT                   RTRVDLNNVTVVSPDAGRIRVAEKWANRLGGYPLAFVHKTRDTSRPNVAVANRVVGDVA
FT                   GRTCVLVDDLIDTGGTIAEAVGVLKHAGAKDVLVAATHAVFSDPAAKRLSECGAREVIV
FT                   TDTVPIPPDKCFPQLKVLPIAPLLARAIRQVFEEGSVTALFE"
FT   gene            complement(527793..529256)
FT                   /gene="glmU"
FT                   /locus_tag="HMPREF0573_10460"
FT   CDS_pept        complement(527793..529256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="HMPREF0573_10460"
FT                   /product="UDP-N-acetylglucosamine
FT                   diphosphorylase/glucosamine-1-phosphate
FT                   N-acetyltransferase"
FT                   /EC_number="2.7.7.23"
FT                   /EC_number="2.3.1.157"
FT                   /note="COG: COG1207; Pfam: PF01128,PF00132"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10460"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66779"
FT                   /db_xref="GOA:D6ZJ80"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ80"
FT                   /protein_id="ADI66779.1"
FT                   /translation="MTNVTTIVILAAGQGTRMKSKKAKVLHSFAGRTLLSHAIHTAMEI
FT                   EPERIVVVVRHQADAVAAEALAVNPDIVIAHQDDVPGTGRAVWCALQKLEELGVATGTL
FT                   VVTSADVPLLDSSTILSLAETREEEGAALCLLTTEIANPFGYGRIQRVAGHVAGIVEER
FT                   DATYAQKQIKEVNAGIYAFGAEFLNRCLPTLSTNNDQGEIYLTDTIKAARQEGLKVSSV
FT                   LLADTAQAEGCNDRAQLAELRAEYNRRRTRYWMLQGVTIIDPTTTWIDADVTIGQDTTI
FT                   YPNTQLRRHTTIGEDCRIGPDSTLIDMKVGDDAEVFRVHGLSSEIGAHSYIGPFTYLRP
FT                   GTILSESTKVGGFCETKNIQVGRGTKIPHLSYVGDATIGEGTNIGAATIFANYDGVHKH
FT                   HSNVGSHCRTGANNVFIAPVNIGDGVYTGGGTIVRQDIPEGNLAVNDFHMRQIPGWVAE
FT                   HRPETIAAIEAMRAEQAKENSPDKTAGDN"
FT   gene            complement(529299..529369)
FT                   /locus_tag="HMPREF0573_t10010"
FT   tRNA            complement(529299..529369)
FT                   /locus_tag="HMPREF0573_t10010"
FT                   /product="tRNA-Gln"
FT   gene            529646..530167
FT                   /locus_tag="HMPREF0573_10461"
FT   CDS_pept        529646..530167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10461"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="COG: COG1846; Pfam: PF01047; InterPro: IPR000835"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10461"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66780"
FT                   /db_xref="GOA:D6ZJ81"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ81"
FT                   /protein_id="ADI66780.1"
FT                   /translation="MVPPSALPDGDEVDGILKAWRALLPHADLTPLSVFSRVSRLARHL
FT                   DQARREAFSSVDLEPWAFDVLSALRRAGEPFSLTPGVLMQQSLVSSGTMTNRIDRLEER
FT                   GLVRRCAHPEDRRAILVELTEEGKKHADAAITKLMATERDWLGDLSEADVNELARLLRA
FT                   VLLPFDAQSR"
FT   gene            complement(530324..531259)
FT                   /gene="ispE"
FT                   /locus_tag="HMPREF0573_10462"
FT   CDS_pept        complement(530324..531259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="HMPREF0573_10462"
FT                   /product="4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="COG: COG1947; Pfam: PF00288,PF08544; InterPro:
FT                   IPR004424"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10462"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66781"
FT                   /db_xref="GOA:D6ZJ82"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ82"
FT                   /protein_id="ADI66781.1"
FT                   /translation="MSGVRILENEPGRRLKVFAPGKVNLLLQVGQRPAGQPRHELLTVF
FT                   QCLDLGEYLTVEPRDAGETDMVHTVLAPGLTGPKNLDGPENLALKAVRTLRETGATVPF
FT                   TSIKIEKNIPVAGGMAGGSADAAGVLYAVNQLYELGFTSSDLQSLGAKLGADVPYGLTG
FT                   GNALGLGFGDRMQSLPVGTKCYWVLAVSPRGLSTPEVFKAFDRMVSHPQPLPSALSPDF
FT                   LAALDGNPAELAGYLHNDLQTAALSIFPELSQIIVAAEQAGALKALVSGSGPTVAALCP
FT                   DASSQKIVAARLEAHPLVACVFSATGPVCS"
FT   gene            complement(531256..532185)
FT                   /gene="ksgA"
FT                   /locus_tag="HMPREF0573_10463"
FT   CDS_pept        complement(531256..532185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="HMPREF0573_10463"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="COG: COG0030; Pfam: PF00398; InterPro: IPR001737"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10463"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66782"
FT                   /db_xref="GOA:D6ZJ83"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ83"
FT                   /protein_id="ADI66782.1"
FT                   /translation="MFLLGARDVSELCALLEVSPSKKKGQNFVTDPGTVRRIAAAAGIS
FT                   PGDTVVEIGPGLGSLTLALLELGCKVIAIEIDQRLAAALPVTVAQHGANSADLCVMTQD
FT                   ALEIAGESDLELPAGWAAPHRLVANLPYNVATPLLLHFLEVLPGLESALVMVQAEVADR
FT                   WVAGVADGDYGAPSVKLAWWGRAKRAFKVGRNVFYPVPNVDSTVVEFRRLEVRQRLKDD
FT                   LKPSAEGLTDEAIETLRQEVFAAVNAAFSQRRKTLRQSLAGYAGSPNAAANLLEAAGIT
FT                   PGLRAERLSVIDFTKIAAAKLYGTNDTK"
FT   gene            complement(532195..533367)
FT                   /locus_tag="HMPREF0573_10464"
FT   CDS_pept        complement(532195..533367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10464"
FT                   /product="Transglycosylase-like domain protein"
FT                   /note="Pfam: PF03990,PF07501,PF06737; InterPro: IPR011098"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10464"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66783"
FT                   /db_xref="GOA:D6ZJ84"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010618"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ84"
FT                   /protein_id="ADI66783.1"
FT                   /translation="MEENTANMSVSPKRAPRHLEIKPARGPRKIFIPLVGALAATLVLG
FT                   TGIGTAFAMAHKTATVVADGKVQEFGGWGTTVSDLLAENGVSFSAKDSVIPAPETPVKN
FT                   GMKITIESSRGLTVMVNGTRKDVDTTEDSASAAIKSLWDGQAVQFVGTSGKDLHGLPLA
FT                   LFAPGENYQLVHDGVTAQMKAAKSDFAPEDILDRNKVKLTGLDTVQVLFNPGVAPIVQV
FT                   QRITEENVTVSEPIQFETETIKDDSKFADEKVVTQKGTTGEKEITKKVRSIDGVVSSEE
FT                   VLSENVVTQPVNEKVTVGTKKRPASQPIAATGDVWSKLAFCEAGGRPDTNTGNGFYGMY
FT                   QFTLPTWRAVGGSGLPSEASAEEQTHRAQILQARSGWGQWPACSRKLGLR"
FT   gene            complement(533497..534423)
FT                   /locus_tag="HMPREF0573_10465"
FT   CDS_pept        complement(533497..534423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10465"
FT                   /product="hydrolase, TatD family"
FT                   /note="COG: COG0084; Pfam: PF01026; InterPro: IPR001130"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10465"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66784"
FT                   /db_xref="GOA:D6ZJ85"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ85"
FT                   /protein_id="ADI66784.1"
FT                   /translation="MSGEPFEGGAQVFGTGRLFDNHTHLPLLPGDYVSDSTGVRLSAEE
FT                   QMERAGQAGVQRVVVSLCSLPEVQVLSTDRERLAGSAFEMVRFAVAIHPNDAPRHLGIL
FT                   DTAPDNMVQTREVWQETPLDDALATVEQTAREFPETVVAIGETGLDYFRTAEAGKDAQK
FT                   QAFAAHIELAKALDLPLQIHDRNAHQDCVEMLQRCGAPQKTVFHCFSGDEELAEILAEN
FT                   GWYASFAGNVTYPANRDIQAGALAMPAHLRLIETDAPYLTPQPYRGRPNASYLIGHTAD
FT                   FLAELTQVTSEELREQTFRNATEVYGF"
FT   gene            complement(534490..536202)
FT                   /gene="metG"
FT                   /locus_tag="HMPREF0573_10466"
FT   CDS_pept        complement(534490..536202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metG"
FT                   /locus_tag="HMPREF0573_10466"
FT                   /product="methionine--tRNA ligase"
FT                   /EC_number="6.1.1.10"
FT                   /note="COG: COG0143; Pfam: PF09334; InterPro: IPR002304"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10466"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66785"
FT                   /db_xref="GOA:D6ZJ86"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ86"
FT                   /protein_id="ADI66785.1"
FT                   /translation="MRMRGHDVLMVSGTDEHGTPILVAAEAAGLTPRELANRNNRAIVE
FT                   DLCQLGLSYDLFTRTTTGNHYDTVRAMFKVVRDNGYMKVQTTRGAISPSTGRTLPDRYI
FT                   EGTCPICGAEGARGDQCDACGNQLDPTDLIRPRSKINGETPEFVETDHYFLDLPALARA
FT                   LNEWLDDREKNGNWRPNVIKFSKNFLKDIKPRAMTRDIDWGIPIPGWEDQPKRLYVWFD
FT                   AVIGYLSASIEWARRFGQSPEGWRQWWNNPESLSYYFMGKDNIVFHSQIWPAEMLGYNG
FT                   RGDFGGKPGDLGVLNLPTEVVSSEFLTMEGKKFASSRGIVIYVRDMLSRYQVDALRYFI
FT                   SAAGPENQDSDFTWSEFVRRTNSELVAAWGNLVNRTASMIAKKFGEIPPAGDFTAEDQA
FT                   LLDAVNAGFETVGDLIESHHQKAALAEIMRLVGEANRYVTTTEPFKLKDESQRDRLGTI
FT                   LHVLAQVVTDLNLMMSPFLPTSANAIDKVLGGAGDVAPLPRIEEVVDLDVKNEDGSDRT
FT                   YPIITGDYRNAPTWERHPVRVGQAVAKPAPVFQKLDESVVAEEHERYANLLQK"
FT   gene            complement(536338..538002)
FT                   /locus_tag="HMPREF0573_10467"
FT   CDS_pept        complement(536338..538002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10467"
FT                   /product="dolichyl-phosphate-mannose-protein
FT                   mannosyltransferase"
FT                   /EC_number="2.4.1.109"
FT                   /note="COG: COG1928; Pfam: PF02366"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10467"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66786"
FT                   /db_xref="GOA:D6ZJ87"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR027005"
FT                   /db_xref="InterPro:IPR032421"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ87"
FT                   /protein_id="ADI66786.1"
FT                   /translation="MGNAFQTRPERGDREYLWGWLGPLVVSILVFLTRVVRLDAIKTLV
FT                   FDETYYVKDAYGLIKRGYEVQWPKDYDSTFLTGSFKTPLEGAFVVHPTVGKWLIGLGIK
FT                   LFGNQPFGWRIAVCIAGAVAVYLVGRIVWELFGNARMATLASVLMGLDGVQITLSRTAI
FT                   LDIILEMFILLGVLCVVRDQLSYRPRLIAALASVDATRRTEQLRQRFRRAKNATAANSR
FT                   GSSRPSTGSGSTSVFSNFSLAWGPSCWWRPWLFAAGIAFGLAMSVKWSGLYVLAVFGIF
FT                   VFLRELSARWSTEPRWIGSSVLTGGIPAFVNLVPIAFLTYVASWIGWFTHSQAWGHTNR
FT                   GLVADWLDYHRQIFVFHTNLDATHPYMANPWGWLLQLRPTSFYYQEVPGDCGSSRCIAA
FT                   VNSLGNPILWWVGFVAFFLIIIAAFGFLDWRAGLIFTGYMATWLPWLVYSNRTIFTFYT
FT                   VVISPFMIMAVIYLLGLLMGAWRITKDKNWTGRYNLVPALSQVSRGEFITALMILVFIF
FT                   SAAVFFFPIWTGMPMPEDHYGWRMWLNNPNTKWAYWI"
FT   gene            538136..539002
FT                   /locus_tag="HMPREF0573_10468"
FT   CDS_pept        538136..539002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10468"
FT                   /product="S-adenosylmethionine-dependent methyltransferase,
FT                   YraL family"
FT                   /note="COG: COG0313; Pfam: PF00590; InterPro: IPR008189"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10468"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66787"
FT                   /db_xref="GOA:D6ZJ88"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ88"
FT                   /protein_id="ADI66787.1"
FT                   /translation="MDYPPVFEEVNLVLAGTPIGNVGDSSPRLREALRDAEVVACEDTR
FT                   RTRDLAHRLRVEMSARLLAYHEHNEATMTSELLNLARDGKQVLQVSDAGMPGISDPGFR
FT                   LGHAAGNAGIPFTVLPGPSAPLLALVGSGLPTDSFTFVGFLPRKFAALYHTLQSLSARN
FT                   ESLIFLESPRRTVETLDAMVQVFGANRPAVVARELTKTHEEFIRGTLESVHSELCSRLE
FT                   VLGEIVIVVQGATAGNESADSTLHLDKLEQLVQNGVKAKTAAKLIATWFGGSANELFSS
FT                   YLEGKNG"
FT   gene            complement(538999..539883)
FT                   /locus_tag="HMPREF0573_10469"
FT   CDS_pept        complement(538999..539883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10469"
FT                   /product="radical SAM domain protein"
FT                   /note="COG: COG1180; Pfam: PF04055; InterPro: IPR007197"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10469"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66788"
FT                   /db_xref="GOA:D6ZJ89"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR027596"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ89"
FT                   /protein_id="ADI66788.1"
FT                   /translation="MVLDTYGRCSGFGLDPVEKKPLYHFLPGTQVLSFGTAGCNLNCRF
FT                   CQNWDISKARENDRLTTSVSPGEIADLALRYRAKSVAFTYNDPTIFAEYAIDTARACHA
FT                   EKLRTIAVSAGYICAEPRREMYAVMDGANLDLKGFTEDFYWRLTGAHLRDVLETIAYVC
FT                   NETKCWVELTTLLIPGHNDSDGEIRNLSKWIVENVGPDVPLHFSAFHPDWKMRNVPRTP
FT                   ATTLQRAREIACGEGVRFVYTGNVRDREGGSTFCPGCGDLLIARDWFDVSQNTVGESGQ
FT                   CPRCATVIPGVWA"
FT   gene            540074..540811
FT                   /locus_tag="HMPREF0573_10470"
FT   CDS_pept        540074..540811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10470"
FT                   /product="glycerophosphodiester phosphodiesterase family
FT                   protein"
FT                   /note="COG: COG0584; Pfam: PF03009; InterPro: IPR004129"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10470"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66789"
FT                   /db_xref="GOA:D6ZJ90"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ90"
FT                   /protein_id="ADI66789.1"
FT                   /translation="MKIFAHRGLNRKAPENTLSAFRLAHEAGVEWIETDVDILGDGTAV
FT                   ILHDSTLDRTTDRCGSIYDLTVADLDQISAGAKFGDSTSYRHERIPLLTDLLTFLKESH
FT                   MKCNLEVKSNEAGGAMSRRLVDTVLREIQDVSPTELLISSFNHVFLYQIHQQRPDLQLA
FT                   CLFTKECLWEDAVSRCEQVGATAIHPEDSGLTIEITKRLQDAGLQINVWTVNDPTRARE
FT                   LASWGVDGIFTDIADEMRASLGD"
FT   gene            complement(540837..541682)
FT                   /locus_tag="HMPREF0573_10471"
FT   CDS_pept        complement(540837..541682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10471"
FT                   /product="transcriptional regulator, Sir2 family"
FT                   /note="COG: COG0846; Pfam: PF02146; InterPro: IPR003000"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10471"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66790"
FT                   /db_xref="GOA:D6ZJ91"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ91"
FT                   /protein_id="ADI66790.1"
FT                   /translation="METLDDATMQQLETLAGWMRGKKTVLVTGAGMSTDTGIPDYRGKG
FT                   NTEIPSVEYDQFVSDPVWQRWVWARNHQTWQTMLSLDPAPAHLAQARLERAGLLTGIAT
FT                   QNVDGLDLKAGCQEVYEMHGSFVRVECVDCGEVTARQPLHERLTEANPDYPLDLDPAHV
FT                   AILAVADRKAAESCTFQTVPCERCGGLLKPAVVFFGQLLPAEVMSRAYAAAAAADVVLV
FT                   VGSSLVVGTASYVMQAGLAKGAPLAIINRGRTMYDRAADLRIEGGASPCLTALADLLGA
FT                   "
FT   gene            complement(541837..542889)
FT                   /locus_tag="HMPREF0573_10472"
FT   CDS_pept        complement(541837..542889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10472"
FT                   /product="putative protein B"
FT                   /note="Pfam: PF07373; InterPro: IPR010860"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10472"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66791"
FT                   /db_xref="InterPro:IPR010860"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ92"
FT                   /protein_id="ADI66791.1"
FT                   /translation="MCQRLKQLMHARSLSRLQKPLCNLILKGIIFMNKKFVTLAVAAAI
FT                   AIPGMTILPALADDEVPANEVSTVDVTEPAADAVAAAAPQSDEVEAADQAEDAETTEPA
FT                   EEEAAESAATEETPAPVTAERSTELTPSEAQSAIDDINAAVETLKEIQSEEPKADWSKE
FT                   FDKLFATATELTQSLAVVAGGYQTLANPDLIMARTHLIVEIGLTVDKSANNLRYKIQKA
FT                   HVELGFSVTRAIMRVANIGATVYQLNDSISDLRATYERVSTYRDLKSTDTATIYVKDLL
FT                   NKAIWNTRVARDKEILTHKNFRTYQTLNKEITKAVRVWFKAKATVAECDAAIAKLNTAY
FT                   ATAYSAPSVR"
FT   gene            complement(543187..543302)
FT                   /locus_tag="HMPREF0573_r10004"
FT   rRNA            complement(543187..543302)
FT                   /locus_tag="HMPREF0573_r10004"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(543491..546585)
FT                   /locus_tag="HMPREF0573_r10005"
FT   rRNA            complement(543491..546585)
FT                   /locus_tag="HMPREF0573_r10005"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(546419..546575)
FT                   /locus_tag="HMPREF0573_nc10003"
FT   ncRNA           complement(546419..546575)
FT                   /locus_tag="HMPREF0573_nc10003"
FT                   /note="similar to 5.8S ribosomal RNA"
FT                   /ncRNA_class="other"
FT   gene            complement(546867..548394)
FT                   /locus_tag="HMPREF0573_r10006"
FT   rRNA            complement(546867..548394)
FT                   /locus_tag="HMPREF0573_r10006"
FT                   /product="16S ribosomal RNA"
FT   gene            complement(548783..550006)
FT                   /locus_tag="HMPREF0573_10473"
FT   CDS_pept        complement(548783..550006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10473"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66792"
FT                   /db_xref="GOA:D6ZJ93"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ93"
FT                   /protein_id="ADI66792.1"
FT                   /translation="MKQIMIIAGREFSVRMKSKSTIISTIVVVLVVLIAGGLANFFHLS
FT                   EADTEKIGVTTQTQSYAPAFEPEANPFLNTASPMGPAYEVKGYADDQELEQAVQKKEIS
FT                   LGIGGTADKPVVFSDGPASPTAMLMINATAQSVMLSSYIGNLGGSFQEIAQKMQQVQVE
FT                   VKDVSESEASGDDFNFAAYLVVMVLITLLFGLVMASGQLVANGVVEEKSSRIVEILVST
FT                   VTPMQLLIGKILGITLLGALQIVIMGSAGLVALLISGLASGIRIDLASFSGWYIVWFIL
FT                   GLATYMVLFAGAGALASRQEDVGQSTLPLILLQMGGFYAAIFSLLTPGSVFIKVVSLIP
FT                   FLNCYAMPARQLASSTVEWWEPWLSVLINLAILPFLLWLGARLYRGGILATGARMKLTD
FT                   ALRQKAAL"
FT   gene            complement(550003..550908)
FT                   /locus_tag="HMPREF0573_10474"
FT   CDS_pept        complement(550003..550908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10474"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="COG: COG4152; Pfam: PF00005; InterPro: IPR003593"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10474"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66793"
FT                   /db_xref="GOA:D6ZJ94"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ94"
FT                   /protein_id="ADI66793.1"
FT                   /translation="MNVQPGQILGFVGANGAGKTTTMRIVMGITDPNQGRVTFGGEPID
FT                   ATVRASIGYMPEERGLYPKMKVGEQLEYFARLHGQNRSIARESTQRWVQRLGVSERLKD
FT                   NVEKLSLGNQQRVQLAAALVHNPVLLILDEPFSGLDPLAVDVMSGVLQEYAAQGVPVIF
FT                   SSHQLSLVESLCTHVSILSGGSIVASGEVEKLRREVGTPMVRLCGDAAAVAAGADAARK
FT                   LNQSVQFISGGLLVPVLSDSPTAHAILQAAVETGSVTEFVPVIPSLAEIFRSAVEESEP
FT                   KSGVTETVSTEIEDVKGGQQ"
FT   gene            551155..552027
FT                   /gene="uppP"
FT                   /locus_tag="HMPREF0573_10475"
FT   CDS_pept        551155..552027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppP"
FT                   /locus_tag="HMPREF0573_10475"
FT                   /product="undecaprenyl-diphosphatase UppP"
FT                   /EC_number="3.6.1.27"
FT                   /note="COG: COG1968; Pfam: PF02673; InterPro: IPR003824"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10475"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66794"
FT                   /db_xref="GOA:D6ZJ95"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ95"
FT                   /protein_id="ADI66794.1"
FT                   /translation="MSWWEALILGIVEGITEYLPVSSTGHLTIAEYLMGKQIDDVGMVA
FT                   FTAVIQIGAIAAAVLYFWSDIWRIIKAWVTGVFHKSARRHPDYRFGWAIIIGSVPIAVV
FT                   GLLFKDFIETGLRSMWFVAAGLVVWSAVLFAADHYAARRMARKPAHSWQNTNSDNQTTI
FT                   IQALLIGLMQCVSLIPGVSRSGATISAGLFLGFDRVLATRLSFFLGIPALVAAGTLEGI
FT                   SNFDTIGETVGWAPTLLGLVMSFVIGYVSIAWLLKFVSKHSFNSFIIYRLCIGGLIAVL
FT                   LIAGVIPAN"
FT   gene            552024..552674
FT                   /locus_tag="HMPREF0573_10476"
FT   CDS_pept        552024..552674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10476"
FT                   /product="membrane protein, MarC family"
FT                   /note="COG: COG2095; Pfam: PF01914; InterPro: IPR002771"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10476"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66795"
FT                   /db_xref="GOA:D6ZJ96"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ96"
FT                   /protein_id="ADI66795.1"
FT                   /translation="MKAGTVESLNAELGLFISTFTTLFVIIDPFGNLPVFMSLTKDLPK
FT                   KQRQTVALQANLLAIVILFVFGFFGFQLFGLLGISPAALQISGGLLLLIVALQLLTGAE
FT                   GTVGEEGGSLNIAAVPLGTPLLAGPGSIVALMVAMGNAGHHPLSVIAVASGAFAVMFAS
FT                   WLAMHFATPIIHFLGNSGVAVMTRLAGMLLAAIAVELMISGVISVVQDVAKTL"
FT   gene            552856..553902
FT                   /locus_tag="HMPREF0573_10477"
FT   CDS_pept        552856..553902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10477"
FT                   /product="GroES-like protein"
FT                   /note="COG: COG1064; Pfam: PF08240,PF00107; InterPro:
FT                   IPR002085"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10477"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66796"
FT                   /db_xref="GOA:D6ZJ97"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ97"
FT                   /protein_id="ADI66796.1"
FT                   /translation="MTQVKAYAMDGPDQPFHPTVLERREPGPTEVYFEVKYAGVCHSDI
FT                   HTGRGEWGSVTYPLTPGHEIAGIVTKVGTDVTKFKVGDRVGVGCFVDSCGHCETCRAGS
FT                   EQFCRSDGGTIWTYNCVGRDGLPTAGGYSQGITVEQDYICHIPDSIPLDKAAPILCAGI
FT                   TLYSPLTRWGAGPGKKVAIVGMGGLGHMGVQISAALGAETHVISRTRAKEADAMRFGAV
FT                   QLHPTSEVGTWESMAGQFDLVVSTLSDGVELDDLVGCVKPEGVVAVVGLPEHRQQFLMR
FT                   SVVNDQKIIAGSSIGGIAKTQEVLNFCAEHDIAPQIEIISGNKINEAWNNVVNSKVRYR
FT                   YVIDTSTF"
FT   gene            complement(553891..554334)
FT                   /locus_tag="HMPREF0573_10478"
FT   CDS_pept        complement(553891..554334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10478"
FT                   /product="GtrA-like protein"
FT                   /note="Pfam: PF04138; InterPro: IPR007267"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10478"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66797"
FT                   /db_xref="GOA:D6ZJ98"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ98"
FT                   /protein_id="ADI66797.1"
FT                   /translation="MEMTPSPQSHCLRKKLWHLCRQIIGFGIVGLLAFFIDYALFALLY
FT                   KIVGIHYLIAAVISFCVSLAFNYAASMRYVFRHKSDMTRRREVVLFFVGAVIGLGINEI
FT                   MLYVGDVVFCIEPLITKILATVVVAAWNFVTRKIFLDSRESES"
FT   gene            complement(554548..554623)
FT                   /locus_tag="HMPREF0573_t10011"
FT   tRNA            complement(554548..554623)
FT                   /locus_tag="HMPREF0573_t10011"
FT                   /product="tRNA-Ala"
FT   gene            complement(554726..555748)
FT                   /locus_tag="HMPREF0573_10479"
FT   CDS_pept        complement(554726..555748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10479"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66798"
FT                   /db_xref="GOA:D6ZJ99"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJ99"
FT                   /protein_id="ADI66798.1"
FT                   /translation="MGQARNDDRFSDGVRLLDLDQQTQRPHSVEVALHKNQGKLGLAAT
FT                   RPIKMAQDLRTYTEIKANRAAAASNRVTSARRRAGLLGAMVLALVIVGAFAATGFLAWW
FT                   VMVAPVMGIGATISWGVIAAKRGREQDRQFQQSIWALEKRLAQSPAGRAALQSVGMRGA
FT                   KQWAKVAATSLAGGKQMPGTLAQAVRIANEAAPTAAVSITAETDRPADMKRSVQKSADV
FT                   EVPEKVAKVNSRGDKQITSEKAPNSELVEKPTKTASEPAVKKWNPADLPTPSYTLKTGA
FT                   IRQVVVEQDFRADWQYAPVPMRPQTAQIPPAGEALSAEDISVAPVDLESILERRRASGD
FT                   "
FT   gene            complement(555977..556672)
FT                   /locus_tag="HMPREF0573_10480"
FT   CDS_pept        complement(555977..556672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10480"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="COG: COG1670; Pfam: PF00583; InterPro: IPR016181"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10480"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66799"
FT                   /db_xref="GOA:D6ZJA0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJA0"
FT                   /protein_id="ADI66799.1"
FT                   /translation="MRNLRGETVYPGSFRRVIIREEDLKQRGLQTDFDWLEVRQLKGRD
FT                   FLAIEKLRMADRSWLAPWEAGAPPGLGHPVSIDEFVKDAARTARLGQGLYFGIVAEGRL
FT                   AGQISLSSVHRGAEMSAALGYWINSRFAGRGLTPLALAMVIDWIFASYGLHRLEVNIRP
FT                   ENRPSLRVVEKLGLRYEGLRQRFLYIDGAWRDHSSFAITTEEWHPGDMVARLETTLETT
FT                   LQHDNSPSK"
FT   gene            complement(556683..557879)
FT                   /locus_tag="HMPREF0573_10481"
FT   CDS_pept        complement(556683..557879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10481"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="COG: COG0303; Pfam: PF03453,PF00994,PF03454;
FT                   InterPro: IPR001453"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10481"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66800"
FT                   /db_xref="GOA:D6ZJA1"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJA1"
FT                   /protein_id="ADI66800.1"
FT                   /translation="MRSVGEHLNLCLLAAEPLPELAVPLEDAVGCVLAADIIADSSLPA
FT                   TDLAGGDGYAVRAQDVVHSPAILPVTADIQAGDTVWTRLVPGSAIRIASGAPLPPGADA
FT                   VVPVESTDMGISQVTVNQPASPGSDAMVIPSGIDVPSGATVLRAGQRLDAQKIALLAAL
FT                   GKGRVRVHPRVRVVILSIGDELVEPGAHREPGQVNDANGHSLAAAAEEVDAKTFRVMVT
FT                   DERARLRETIEDQLVRADVIVTTGGLSYGPADTVKDVLTPLGAVRFDNVAIAPGRQLGV
FT                   GKLGEVPIYCLPGNPVAAQVAFETFVRPALRKMAGWSNLYRTSVSAKMSRGWVSPAERR
FT                   EFVPVILTGKPGEYRGEVLGSHPQARLAALALANAFAVVPEDVTEVKPQQTLHCMVLE"
FT   gene            complement(557883..558815)
FT                   /locus_tag="HMPREF0573_10482"
FT   CDS_pept        complement(557883..558815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10482"
FT                   /product="nucleotidyl transferase"
FT                   /note="COG: COG1210; Pfam: PF00483; InterPro: IPR005835"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10482"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66801"
FT                   /db_xref="GOA:D6ZJA2"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJA2"
FT                   /protein_id="ADI66801.1"
FT                   /translation="MSLEVRCSVIPAAGKGTRMYPLTKSVPKELFPLVDRPVIMTVIDE
FT                   ALQCGIEQFHVVTSPRKATLGDFFTDTGDESDSQDLPLPQVDLVMQEQAKGLGHAVLQA
FT                   RDSVGEQPFVVQLPDDLYHPEDPLLQTMLDVHAITGGCVVALMKVSVAEAKLYSSARVE
FT                   SVDLGAAAAGHEVFKLADIIEKPDANQVRSPYALMGRYVLSPRIFEILERTAPGRNNEI
FT                   QLTDALATFAEIPAHEGGGVWGVVSQGRHFDTGNLTGYLQAQMELSLENPDFGAELRKF
FT                   MRGLVGTDESTVVKTPPGKCRESGQKGRR"
FT   gene            558892..559539
FT                   /locus_tag="HMPREF0573_10483"
FT   CDS_pept        558892..559539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10483"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /EC_number="6.3.3.2"
FT                   /note="COG: COG0212; Pfam: PF01812; InterPro: IPR002698"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10483"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66802"
FT                   /db_xref="GOA:D6ZJA3"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJA3"
FT                   /protein_id="ADI66802.1"
FT                   /translation="MELNLPDLRGQEPEDAKQQLRQLIRGARDRLSDSQVSKAGQDIRD
FT                   RVLEFAADFHTIACYVSVKKEPPTLDLIEALYQQGKRLLVPKLGSKLNRDWAFYAGRDD
FT                   LANRSPNRPMEPSGDALDSSALAAVDLVITPALAVDRQGNRLGQGGGWYDRALPYVKKQ
FT                   TPIYAMCYTHELQQELILPTDQYDIPVTGVLTPSCCFKLKDSEFQKSGILPA"
FT   gene            559678..560274
FT                   /locus_tag="HMPREF0573_10484"
FT   CDS_pept        559678..560274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10484"
FT                   /product="SAF domain protein"
FT                   /note="Pfam: PF08666"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10484"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66803"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJA4"
FT                   /protein_id="ADI66803.1"
FT                   /translation="MTINRFWNWRYPLAAGLAILAVFVAVTLFLPEKAAATVVVVKHEV
FT                   CAGCEITAQDVRLSALAPSAVPQDHFQKADRVIGKTAAVSLTSGTVLQPALLVENAVED
FT                   LRTGEVAFAIEVSDPAVAGFSKTGQSVEIWCSGGNVDGQLLASNARVVGVKAVSENFLG
FT                   TGNSASIAYLAAPEDEARRVIAAKTDHDLSFVVRR"
FT   gene            complement(560287..560547)
FT                   /locus_tag="HMPREF0573_10485"
FT   CDS_pept        complement(560287..560547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10485"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66804"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJA5"
FT                   /protein_id="ADI66804.1"
FT                   /translation="MMEQNKPTPRDIFAAQKVEPEPKKERQRIRRHRRATYISRQDEGK
FT                   DNPFAIPGGGSVEMPPETQDEIDESNDKRLQNDIPPHFGKL"
FT   gene            complement(560553..564779)
FT                   /locus_tag="HMPREF0573_10486"
FT   CDS_pept        complement(560553..564779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10486"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66805"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJA6"
FT                   /protein_id="ADI66805.1"
FT                   /translation="MEEDLEQPVQNPGESAANSEPASSVCNDAATEVLQSVAVDSVQER
FT                   LTRWAEEASASPGAQGLRDLDTLQNLLDLTGAHPAGIAQLYGGRLTKLSSLLRDNAVLG
FT                   AARAVMRKLDAEKKSSVARSGLYPTNLVIGVANWTQLPPFKESERGTRPELSHFKLEKF
FT                   NLPVLMRPLELEAIDGDYTLKMGGSVVINPVLVKAFRDRHIDCNPEAIIAASLEDGRLN
FT                   VTPALEAIRRAGQDFIPGFDLKENLLVANLGVSSAVLSSDWDAILPMAGKNPLVRAFAG
FT                   DKSAAAELLEPLPETSPADRDPDLERGIGDLDVSQARVVELIASGRSIFVDVPPGAPGA
FT                   STVQAILADCGASGKHVCYVPGGRRIGRVTVDGMQKVGLGSFVLDLTGASEWLSGLRDQ
FT                   LLNEDTAYPQPPVPVTELGDAHERLRQTRDKLSAYTQRLHVVREPWGVSAYAALQALAD
FT                   LTSAQPGPRTKVKLELADDEHSSKEGRERARDLLTRAQDAGLLEPELQESPWKGVVLST
FT                   ESDAQDAIEKIHALADGRLETLHQELERVSEETGLVLPSTLNAWKEQLGMLEGVARSLD
FT                   IFQPEIFAHSAADMVIATASRKWRQERSLPMKGKDKRTLIKQAKDALRPGVAPQDLHTE
FT                   LVRVQSFRDLWRRHALPGAWPRIPQEFEAVRELSAQVFAEVAALAPILSQVTTPEGTKP
FT                   EEVPLSDLLNLVKSLDKTTDQALRLPRQVQLLKELKESGLGPLLDDLRARRVPADLALA
FT                   ELDLAWWSAILLKILQSDSILAGIDGAAMHELADTLRSLDLAQIESLPYPVSRAMHELA
FT                   NQARQAQASTAEVLQSVLECGDTAALSDFQSFAPLIRQLRPVWALSPYLLAQIYGSSTI
FT                   EVLVLDHLDFMSLSQVIPLIARAKQLVVLGDSRRGWTGFTQLAAKVLPVVSLRCDLGEL
FT                   SEQVALFLASHGYGASVSPVPSPRPASLVKLHVISDSESHLARDGSPVISRGEISRVVE
FT                   LILDHALNRASQSLAVVCLNPRGVTRIRSALNDALVKVPQAQDFFHKGSGREPFVIVDS
FT                   AAATGLRRDVVIMSLGMSKTPHGRVQLNFGPVSGPSGVAHVVGCLEVVRQRLEIVSAFR
FT                   ANEVDVSKISEPGARMLVDLLDSADNPEGMERALTTPESFESEPDRLLVDLAERLWRAG
FT                   LTVVPRFGFKDGIQIPLAIGSAELPSELLVAVLTDDDTYVREPSLRRRERLWPARLEAA
FT                   GWKVITCYTMEVFANPAAQAAKVRHAVETALASRKDALSVPLIAAPQIEVPEESSRPKT
FT                   VLNSTESPAAESVAPRNSEETPAEDNANTNPEDRESEEKNPAAPNLRVVGAARGPRPPV
FT                   AKGLPLAAYGDDQLDELLEWIQSDGVERSEDQQVNELRETLELSRRGAQVDAVLRHVVR
FT                   RRNAAL"
FT   gene            complement(564872..565249)
FT                   /locus_tag="HMPREF0573_10487"
FT   CDS_pept        complement(564872..565249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10487"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66806"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041678"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJA7"
FT                   /protein_id="ADI66806.1"
FT                   /translation="MMTAALVEGPPEETGHRLAATILNTWEQAATAGTPETLFNLLLQD
FT                   SATQQTFANYVENQIMASIKEQVGTDLDLAIELMLSAILGVLLSRYVVKLEPLASMSRE
FT                   DLIAVLGTVIQRLLGQLETVG"
FT   gene            565677..570311
FT                   /locus_tag="HMPREF0573_10488"
FT   CDS_pept        565677..570311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10488"
FT                   /product="putative CoA-substrate-specific enzyme activase"
FT                   /note="COG: COG1924; Pfam: PF01869; InterPro: IPR008275"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10488"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66807"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="InterPro:IPR018709"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJA8"
FT                   /protein_id="ADI66807.1"
FT                   /translation="MSVSAANIIRLGVDVGSTTVKAVALNTQGQKVFADYRRHKADVRR
FT                   ELTQLLEDVLIDLGDVIVQTTVTGSGGLQIANSMRVPFVQEVIAETEAVRQHSPQTDVI
FT                   IELGGEDAKLTYLHPTPEQRMNGSCAGGTGAFIDQMATLLDTDAEGMNRLATQSQNIYP
FT                   IASRCGVFAKSDIQPLLNQGAAHADIAASVFMAVATQTIAGLANGRPLRGQVMFLGGPL
FT                   HFLPELRQAYQKLLPKVDNFYTPPDAQLFVALGSALLADGGGAGGPAAAPENLKVLIDR
FT                   LKQAKVIHESTRMRPLFKNDAELAEFRQRHRRDCIQSLDPNEAQGRCWLGIDAGSTTIK
FT                   AVVIDETDRIVFSHYASNEGNPLRAAIEIIRQIHQELPADTTIGRACATGYGEGLIKTG
FT                   MSLDEGVVETMAHYRAANRIAPGVTSVVDIGGQDMKFIKIKDGSVDSISVNEACSSGCG
FT                   SFLQTFAATMSTTVQEFAAAAVQSPNPIDLGTRCTVFMNSSVKQAQKEGADTGAIAAGL
FT                   SYSVVRNALYKVIKLKDPSDLGDKVVVQGGTFLNDAVLRAFELLTKREVIRPNIAGLMG
FT                   AYGAALSAKMHDDPTAQSTLASLADLDAFDVETTHKTCNFCQNHCQVTISTFANGSRHV
FT                   TGNRCERGASLEKRPQKSEVPNLYDWKYRRLFAYRRLTEDKATRGDIGIPRVLGMYEDY
FT                   PLWFTILSQLGFRVMISGRSSHDLFEQGMESIPSENTCYPAKLAHGHIEQLLEKEIQTI
FT                   FYPCVSYNIPRNLQADNHFNCPVVATYPEALRHNVEGLDAPGVRFISPFLNLANPEFVA
FT                   KRLTEVFADWNVTIEEVTAAVHAGYAEDARVKDEIRQQGRLALEWMRAHGKRGVVLAGR
FT                   PYHLDPEINHGIPEAIVSLGMAVLTEDSIADGRLERPLRVRDQWTYHSRLYEAAARVAS
FT                   EPDLELVQLTSFGCGLDAVTAEQVQEILESQNDIYTQLKIDEVSNLGAATIRLRSLAAA
FT                   AIERTGRSKRSDGNISVAGLTGSANVDSTGSVNVSFLPNPSPETAENHHQVAGEALASA
FT                   TVATFPASSTRPGGVPSPLSVLHSAGKNPAGHVYEAHPFTKEMRDAGYTILVPQMATIQ
FT                   FRLAEPILKRKGYNIRLLETVDAQTMETGLKYINNDACYPSLVVLGQLIDEFVSGRANP
FT                   DKTAVAMSQTGGMCRATNYASLLRKGLRDAGYPQVPVIAMSLQGLEENPGFKFTIPIYH
FT                   RIIQALVIGDAIQKMLLRVRPYEADPGSALALYERWNALWRDWFASSGKRVDGFGRVSY
FT                   AKLTKICVREFDALPLRNIARKPRVGIVGEILVKFHPYANNHAVQTIEDEGCEAVLPGL
FT                   LQFFEYTLADGKWDWEHLGINPLARFTKPLALWLLRRYTATVNKAMSATNGKFLPSHNI
FT                   MDMYERSQDIASMGNQAGEGWYLVSEMADMIESGCPNIICVQPFACLPNHIVGKGMFRP
FT                   LRNRYPQANIVGIDYDPGASAVNQLNRIKLMISTAKINAGRDLDFSKLGADLPEISVAD
FT                   SPTSCCSNPNQPLLLGMPTLPDQD"
FT   gene            complement(570318..570390)
FT                   /locus_tag="HMPREF0573_t10012"
FT   tRNA            complement(570318..570390)
FT                   /locus_tag="HMPREF0573_t10012"
FT                   /product="tRNA-Arg"
FT   gene            complement(570509..571207)
FT                   /locus_tag="HMPREF0573_10489"
FT   CDS_pept        complement(570509..571207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10489"
FT                   /product="NlpC/P60 family protein"
FT                   /note="Pfam: PF00877; InterPro: IPR000064"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10489"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66808"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJA9"
FT                   /protein_id="ADI66808.1"
FT                   /translation="MDSLKTIDAKKGFVAAASAGLALGTVWAGSAIAAPEGTDAPSQAK
FT                   VPVSAQVGDAVAQAHLAVAANPVVTAPENVAWTEGQVEVPAQQQQEQAQSTNNQGTAAR
FT                   STHRAAVSAAPISIPANIAGGSIADIALRYQGVPYVYGGTTPNGFDCSGFVGYVYNQAG
FT                   IALPRTSWAQGASGKHVSAGEAQAGDIVYYGGHVGVYLGEGKMVHSPRPGESVRVQQVY
FT                   GNPEYVRIGQ"
FT   gene            complement(571421..572134)
FT                   /gene="ideR"
FT                   /locus_tag="HMPREF0573_10490"
FT   CDS_pept        complement(571421..572134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ideR"
FT                   /locus_tag="HMPREF0573_10490"
FT                   /product="iron-dependent repressor IdeR"
FT                   /note="COG: COG1321; Pfam: PF01325,PF02742; InterPro:
FT                   IPR001367"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10490"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66809"
FT                   /db_xref="GOA:D6ZJB0"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJB0"
FT                   /protein_id="ADI66809.1"
FT                   /translation="MSEMVDTTEMYLKVIYEMMEDGVAPLRARIVERLGHSGPTVSQTI
FT                   SRMERDELLSLEDDRKISLTEQGMRAATEVIRKHRLAERLLTDIIGLPWYEVHDEACRW
FT                   EHVMSEKVESLLLTLLKMPECDPYGNPIPRRVKNYKNFDPTVEGSTLDSFWRRHPDGGT
FT                   VQIGRIGEPVQACEGVLKKLSEAKLLPGSKATLRFDDNAEVAALFPENAGKSGEKDVPV
FT                   VAIPRDLFKHFFIKL"
FT   gene            572535..573479
FT                   /locus_tag="HMPREF0573_10491"
FT   CDS_pept        572535..573479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10491"
FT                   /product="putative phosphoserine transaminase"
FT                   /note="COG: COG1932; Pfam: PF00266; InterPro: IPR015421"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10491"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66810"
FT                   /db_xref="GOA:D6ZJB1"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJB1"
FT                   /protein_id="ADI66810.1"
FT                   /translation="MRELFEVPTDYTVTLGNGGATTFWAVATASLVRHRASHAVFGSFG
FT                   EKFAKETSGAPFLQESLITKAELGDSTLPQLSEQADVYAWPQQETSTGAIAPVKRVGHA
FT                   DQLVLIDATSISGAVPVDLTQTDAYYFSLQKALGSDGGLWFAFLSPQAVERASEIADAP
FT                   SADRWIPAILNLKTAVANSVKNQTLNTPAIATLELLHSQLQWLASLGGLRDAHQRVCAS
FT                   SEAIYAWAQAKPFAAPFVADPVKRSPVVSTIEFDASVDTAVLLQVLRANGIVDLSPYRA
FT                   VGRNQLRIGTFPSTDPADTAALLACLDYVIERL"
FT   gene            complement(573543..575039)
FT                   /locus_tag="HMPREF0573_10492"
FT   CDS_pept        complement(573543..575039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10492"
FT                   /product="putative permease"
FT                   /note="COG: COG2252; Pfam: PF00860; InterPro: IPR006043"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10492"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66811"
FT                   /db_xref="GOA:D6ZJB2"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJB2"
FT                   /protein_id="ADI66811.1"
FT                   /translation="MSNNTTKTANKSAKKTAKSSARTSDGIAGFFELSERKSSVRQEIR
FT                   GGLVTFFAMAYILVVNPSILIAAAGAGGAENVTPASIAAGTALVGGLMTILMGLVANFP
FT                   LALAAGMGLNAMVSFTLVLGPFGLSFGEAMGLIFWEGVVITLLVVTGFREAVFNAVPSQ
FT                   LKVAISVGIGLFIALVGLINAGVVRPGGTPVQLGIGGSFAGWPMVVFLVGFVVILVLYI
FT                   RKVQAAILIGIVVSSVLAVILQAILKIPLMTDQTGKVVNETGWTKNVPALQGSPVQLPD
FT                   FATFGQIDFFGAFTKLPVISVLLLIFSLMLADFFDTMGTMVGVGAAGGLLDEKGNPPRT
FT                   FQILLIDSLAAMAGGLGGVSSNTSYVESTSGVGAGARTGLSSVVVGLCFLLSMFFAPLV
FT                   ELVPAEASSTALVFVGFLMMTQVADIDWKNAENAIPAFLTIAMMPFSYSITAGIGFGCV
FT                   AFIIMKLARGKLKEIHPLMWVVGLLFVVYFALGPIQALIS"
FT   gene            complement(575093..575911)
FT                   /locus_tag="HMPREF0573_10493"
FT   CDS_pept        complement(575093..575911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10493"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10493"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66812"
FT                   /db_xref="InterPro:IPR021391"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJB3"
FT                   /protein_id="ADI66812.1"
FT                   /translation="MAQKQTQATKPAETLELDSVLAKQSDLARNALKSITKDTEVGEHL
FT                   RVEATGQRLVTHFFQCLKPGYKGWVWAVSLTRVPHGRIGTVCETDLLPAEGALLAPPWI
FT                   PWSERLEPGDLGRKDRTPYNPDDPNLDQGYEATGQDADQLALWELGLGRKRVLNREGRN
FT                   AAVKRWLRDVHSRTELDRHGNPPEDPCSTCGYLWKISGSLRLEFGLCTNAWSPDDGHVV
FT                   AMDHTCGAHSETDADLTPSTLPVGRTFLDDKSLQELNPDEITLSGQTADA"
FT   gene            complement(575964..576341)
FT                   /locus_tag="HMPREF0573_10494"
FT   CDS_pept        complement(575964..576341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10494"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="COG: COG1278; Pfam: PF00313; InterPro: IPR012340"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10494"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66813"
FT                   /db_xref="GOA:D6ZJB4"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJB4"
FT                   /protein_id="ADI66813.1"
FT                   /translation="MPSGKVKWYDAVKGFGFVAGADGEEVFLHASALPENVVDLHPGTK
FT                   VEYSVVDGKRGRQAMNVTVVEKLPSVAKAQRKKAADMVPIVEDLIRILDDASGNLRRGK
FT                   YPENGKQIAKMLKIVAQSFEA"
FT   gene            576537..578564
FT                   /locus_tag="HMPREF0573_10495"
FT   CDS_pept        576537..578564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10495"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66814"
FT                   /db_xref="GOA:D6ZJB5"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJB5"
FT                   /protein_id="ADI66814.1"
FT                   /translation="MAGFVPADFAQASPAVQPAADPLDVSSSQIYDPDNKLGDDGIYQV
FT                   KSSLEAAKNFNMSVYIAIVPDFGELSPREWNEKTMQLSHLQANSYLLSIAYNPNADGAG
FT                   EIAASSTAGSAINSAQAGDRAMQVLPYQLSNGDYASGVSSFVQQLMDLAMSAKSGPAAP
FT                   ADNADVSGSSTNNWFILMLILAMLVAVALAIAIYRRNSYSTAAKPQDSAKFDRVEKVNQ
FT                   DSAVEGNATFAPATATETEPPENATQSFATFETPALVGDTPETVPTDTFVAAAPTAAPP
FT                   EQIQPEAPTYPEPEMLFDEAAAAASEVSYERGLNAVHDLNKAIFAAAEDLHASVEAFGP
FT                   AETTNFAATLDFSREQANALMNWLAGADLVSSEEVGQVEDSVQQVKQTLSAEVLEFTKR
FT                   RYNPDQVEVSLNRLAAAWNRARKSLAQVEIVEKQLEADYPQANLGHASANLSQSKRLLK
FT                   AAYKGILSGQKCLQEGDAKTAIRYARGSERAITQTEFALEHITKLGAFLSETKEHLSNM
FT                   LETLNANVQTVRTYDPEASGQEIAITLRTMEKAQKALVGEGDPIEALSKLCGLQANLFN
FT                   IYGTSVLAQDLTQLQGQFPLRLEWEQQHLELLRTDIMLRRNSIDPQIELELARCEQLIA
FT                   QAREKLPQGPLIGMTMLSTSAEMLIQLGSGIPEAFPTPAK"
FT   gene            578753..579328
FT                   /locus_tag="HMPREF0573_10496"
FT   CDS_pept        578753..579328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10496"
FT                   /product="hypothetical protein"
FT                   /note="Pfam: PF01936"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10496"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66815"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJB6"
FT                   /protein_id="ADI66815.1"
FT                   /translation="MKLQIPEEETTYLLVDGENIDATLGLSVLGRRPDPDERPRWDRVR
FT                   DYVSETFPGQTKGLFFLNASAHMPMTFVQALLAMNYQPIPLASERDEKVVDVGIQRTLE
FT                   AIDKQEYGNVVLVSHDGDFEPQLRSLLRNDHDVTVVGFEEFLSGELRTLEESGLKIVDL
FT                   EREIHAFNAPLPRIGAIQLSEFVPEDFI"
FT   gene            complement(579321..580160)
FT                   /locus_tag="HMPREF0573_10497"
FT   CDS_pept        complement(579321..580160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10497"
FT                   /product="CobB/CobQ-like protein"
FT                   /note="COG: COG3442; Pfam: PF07685; InterPro: IPR011698"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10497"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66816"
FT                   /db_xref="GOA:D6ZJB7"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJB7"
FT                   /protein_id="ADI66816.1"
FT                   /translation="MNESTLRIGILMPEVLGTYGDGGNAVVLAHRAKLLGYQSEIVHVS
FT                   CTEAIPESLDIYTLGGGEDVAQTIASRRLLTDRGLERAVQKQKPVLAICAAFQVLGTWY
FT                   TDAEGRRTEGAGLLDVVTLPQGARAIGELINSPSGLPLERELSEPLTGFENHGGATLLG
FT                   RDASPLGFVTSGIGNGQPGVAPGLADGASAAAGVQQGHEVSREIPEGYRATEDGKAMEG
FT                   CVQGSIIATYLHGPCLARNPQLADLLLARALRIPLPLAVPEIPGLQRLRQERLAAIK"
FT   gene            complement(580157..581446)
FT                   /locus_tag="HMPREF0573_10498"
FT   CDS_pept        complement(580157..581446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10498"
FT                   /product="Mur ligase middle domain protein"
FT                   /note="COG: COG0769; Pfam: PF08245,PF08353; InterPro:
FT                   IPR013221"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10498"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66817"
FT                   /db_xref="GOA:D6ZJB8"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR013564"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJB8"
FT                   /protein_id="ADI66817.1"
FT                   /translation="MIGGRVALRLQPKILEHLAADRLVALVTGTNGKTTTTRMLSEAVR
FT                   AGGVAVASNRGGDNMTPGVVAALMSNPRAGVAILEIDEMHLELIAKATRPRVIVLLNLS
FT                   RDQLDRVGEIAVIEKRIRRAVDENPQAYVVANVDDPLMTSAAWDSAHPVWVAAGKGWNG
FT                   DSLTAPRTGGAIIYSPDESDATTGKPPELASGLDRDVSWRSVPVEELLAHEVPWDKPPT
FT                   QSEFARPHPKWIWKAESYQPGVPVQLIDTGSGQETTATIQLPGRANRGNALQAFVAARL
FT                   LGVEVSAAATGIAQVKDVAGRYASFSVDGRHVRMLLAKNPAGWMESLTMLNPQAEIIVG
FT                   VNGQIPDGTDLSWLWDVNFESLSGKTVVATGERGADLQVRLNYANIETRWASTVLDAIE
FT                   MVAPGEVDLLLNYTSFRDARAEFVARGWLQ"
FT   gene            581748..583469
FT                   /gene="tusE"
FT                   /locus_tag="HMPREF0573_10499"
FT   CDS_pept        581748..583469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tusE"
FT                   /locus_tag="HMPREF0573_10499"
FT                   /product="sulfur relay protein, TusE/DsrC/DsvC family"
FT                   /note="COG: COG0446; Pfam: PF07992,PF04358; InterPro:
FT                   IPR015904"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10499"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66818"
FT                   /db_xref="GOA:D6ZJB9"
FT                   /db_xref="InterPro:IPR007453"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR025526"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR042072"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJB9"
FT                   /protein_id="ADI66818.1"
FT                   /translation="MQEIVILGGGTAGSTVANRLYRKLPAHEYRITVVDRDNNHHYQPG
FT                   YLFIPFGLYKPRRVVKPRSHFLPRGVRFLMDTIKRVDPVAKTIELGSQIIPYHYLIIAT
FT                   GCTIRPDQVPGMSDPRVWRKSVYDFYSLGGAVRLHRAMQQFKRGHLVVHISEMPIKCPV
FT                   APLEFALLADWFFFMRRRRLDIDITFVTPLDGAFTRPVAKAQLGELLRHRDIELETDFN
FT                   VEYLDPKRKVLIGYDGREIPFDLLVTTPPTMGQQYIADSGLGNDSNYVSVNKHTLQSTA
FT                   YPDIFVLGDAGDFPTSKAGAVTHFQAKTFVPNFLNYLRGKPLTESFDGHVTCFIESGFH
FT                   KALLLDFNYDVQPVTGKFPLPLVGPLSLLKETHFNHLAKIGFYFAYWGLLVRGLPLLLP
FT                   RNMPRFGKDFARWGLRDDGVTALPPKPRQAVSPSPQVRVPVVKVAPPTPQVAPYPTPSC
FT                   EPPTPAASNQIPVLHQVNGIPIDVTDEGFMIHPEQWNDEVAKGLAAALHIELDDAAWEV
FT                   VRFVRREFEEYGVSPTLGRIAKVGGFKVKTVFEMFGTKPAKKLAFLAGAPKPVGCV"
FT   gene            583460..584110
FT                   /locus_tag="HMPREF0573_10500"
FT   CDS_pept        583460..584110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10500"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2210"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10500"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66819"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR032836"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJC0"
FT                   /protein_id="ADI66819.1"
FT                   /translation="MRVKMASLTDQIPEPSERRNIPSKIRIMTPPPDAPANADSIREAD
FT                   EITYVDRKMAFICSKGNLDMAYPALIMAHSALNAGVHVDVFFTFWGLDIINKRTMDRLK
FT                   FTMQGNAAIHFPTLEKYYPGLGDMHFSPLFGALPGMTKLSTWYMKNELQKMEIPPVRDM
FT                   LEQIAQLGANLWACKLSADMMKLTPRHLHKCVRGIVDADTFIEMSEGAQIIFI"
FT   gene            584216..585334
FT                   /gene="gpsA"
FT                   /locus_tag="HMPREF0573_10501"
FT   CDS_pept        584216..585334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="HMPREF0573_10501"
FT                   /product="glycerol-3-phosphate dehydrogenase [NAD(P)+]"
FT                   /EC_number="1.1.1.94"
FT                   /note="COG: COG0240; Pfam: PF01210,PF07479; InterPro:
FT                   IPR006168"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10501"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66820"
FT                   /db_xref="GOA:D6ZJC1"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJC1"
FT                   /protein_id="ADI66820.1"
FT                   /translation="MGTALCRPLVDTGWDVAMWGTEYDDAVLDAYAQGQPHPAIHVPLA
FT                   PQVKTYRAKHLDAAVRGAEVLAICVAAVGLPDITRRLAPYFDLVRAVWVLTKGFVKDEA
FT                   GQVHLLAEAMEQIAVANGAELPTLVSIGGPVIARQCALSEPTATVYACQDFGAAIHYAR
FT                   TVRTDYYRAFPAEDTTGVEVLAPLKNSYAIALGVTEGIQESTGSPQSNLRAAVFAQAIR
FT                   EMSLVCEALGGRPESAIGLAGVGDLEVTGISGRNKFFGMRLGRGEHPDEAETEMKAAGH
FT                   TVEGVHSTPLAMTLIEQRCPQLLDELPLLRAVDEAISGEVDIRKTLVSAALPAYPADNF
FT                   AASQQGKWNSDWSPAASGLSWRLKKLVRRFKK"
FT   gene            585427..587127
FT                   /gene="tusE"
FT                   /locus_tag="HMPREF0573_10502"
FT   CDS_pept        585427..587127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tusE"
FT                   /locus_tag="HMPREF0573_10502"
FT                   /product="sulfur relay protein, TusE/DsrC/DsvC family"
FT                   /note="COG: COG0446; Pfam: PF07992,PF04358; InterPro:
FT                   IPR015904"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10502"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66821"
FT                   /db_xref="GOA:D6ZJC2"
FT                   /db_xref="InterPro:IPR007453"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR025526"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR042072"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJC2"
FT                   /protein_id="ADI66821.1"
FT                   /translation="MRLGMKNVVIIGGGTGGTVTANSLARRLDCKEFQITVIDYSTRHY
FT                   YQPGFVALPFGKIPNPLLWRRRRQTLHPGIRFLQDKVTAVDPVAKMVITQAKQISYDYL
FT                   VLATGCECRPELVEGMAKGTLLNTGIYSFYTQAWARRLRRALQTFTHGHLVVHISEFPI
FT                   RCPVAPIEFALKADHYFFTHRVRDDIEITIVTPQSQVFEQSIAARNLSNLLRLRDIEVQ
FT                   PDFVVRHIDATEKRMYAYDGKAIDYDMLVTVPPMRGQQFIVDSKLGDEMGFVHPDLETL
FT                   QHREYPDIFVIGDTADLPTSKSGSACVYQSRVLVSNLLDYIAGRPMMRRYDGHAMCIID
FT                   TGYNQATVIDRSYTVPAVTGNWFFPRLGPLSLLKQTRRNHLAKRLLFVFYSAFMAGLRV
FT                   FDRFSHIQLFGKDFRRWGLRPDGTTPLSAPDTTPDADSLIAPTWKRRPNACLAAAFSTK
FT                   VLKIPVLHEAGGRSIDVDAEGFMTNPCQWTRAVGTDLARAINLEMTPRHWEVIEFARQS
FT                   FVKYHVSPSLRRMEMAGHFPIAELFELFPSKPNKLICYVAGIPKPLGCI"
FT   gene            587149..587721
FT                   /locus_tag="HMPREF0573_10503"
FT   CDS_pept        587149..587721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10503"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2210"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10503"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66822"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR032836"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJC3"
FT                   /protein_id="ADI66822.1"
FT                   /translation="MEKSAPDFFDQDFWRVSEPLLHMEKRKMAFICSKGNLDMAYPALI
FT                   MSIAALTEKVDVNIFFTFWGLDIITKRTMDSLKFTMQGNTALHLPLLEKFRPGWGKRYL
FT                   PPSFGNLPGATHLATWYMNKMLEKNGIPPVRDLLEQIVEMGGHLWGCKMTVDLMELRQN
FT                   MMFKGVSGIITAPDFIKKSEDAQIIFI"
FT   gene            complement(587794..588696)
FT                   /locus_tag="HMPREF0573_10504"
FT   CDS_pept        complement(587794..588696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10504"
FT                   /product="glutamyl-Q tRNA(Asp) synthetase"
FT                   /note="COG: COG0008; Pfam: PF00749; InterPro: IPR000924"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10504"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66823"
FT                   /db_xref="GOA:D6ZJC4"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJC4"
FT                   /protein_id="ADI66823.1"
FT                   /translation="MHFGNLRTAVAAYLFAKSSGREFLVRIEDIDTGRSRPSFAAQSLA
FT                   DLAALGIVSDRRVVYQSQRHQLYQVALEQLVQKGLVYECYCSRADIAAAASAPHGKPGI
FT                   YPGICRDLSDSEREAKRTALAAQGRQPALRLRAPQGVEYTVKDSLLGPLTGLLHDFVLR
FT                   RTDGDWAYQLVVVVDDINQGVDQIVRGADLASSAPVQAWLTEILGGYPAAYAHVPLVMN
FT                   AQGQRLAKRDKSVTRPELNALGWSDQKILLKVLETLGWSAAKTDATALLTLPTEEILNH
FT                   ALASWSPENLPAEPVIFHP"
FT   gene            complement(588746..590311)
FT                   /gene="lysS"
FT                   /locus_tag="HMPREF0573_10505"
FT   CDS_pept        complement(588746..590311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="HMPREF0573_10505"
FT                   /product="lysine--tRNA ligase"
FT                   /EC_number="6.1.1.6"
FT                   /note="COG: COG1190; Pfam: PF01336,PF00152; InterPro:
FT                   IPR002313"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10505"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66824"
FT                   /db_xref="GOA:D6ZJC5"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJC5"
FT                   /protein_id="ADI66824.1"
FT                   /translation="MAEKENKTENVNPAPVASDEETYAAEAPEQIRIRAEKRAKMLAEG
FT                   KNPYPVHVDITTTISEVREKYSDLQAGEETAEFVGLAGRVRLMRSSGKLAFATLQEGNG
FT                   STIQIMISEREVGPESMSAYKAEVDLGDHLFVHGRVISSKRGELSIFVDSWQLTCKALR
FT                   PLPKSYINEAGEEVSLSEDMRVRRRDLDMIMRPAARDMVRNRSRVVQTLRRYLDEHDYI
FT                   EVETPMLQTLHGGAAARPFVTHMNAYDTELYLRIAPELFLKRCLIGGIDKVFEINRNFR
FT                   NEGADSSHSPEFTMLEVYCAYGDYHQIARLTQEMIQRCARDVFGTEVVTLSDGTEFDLS
FT                   GEWKWIDLYGSLSEALGQEVTVRTPKDALVALADRLGIELEPYYPSGKIVEVLWEELVG
FT                   DKLWEPTFVCDFPEDTSPLVKTHPDKPGQVQKWDLIIRGFEVATGYSELNDPVVQRARF
FT                   EQQALDAANGDPEAMEVDEDFLISMEQGMPPAGGMGMGLDRLLMTLTGSGIRETITFPL
FT                   VKRV"
FT   gene            590442..590705
FT                   /locus_tag="HMPREF0573_10506"
FT   CDS_pept        590442..590705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10506"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66825"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJC6"
FT                   /protein_id="ADI66825.1"
FT                   /translation="MQLSAADKMTVSTRLNEAKQSLDEVISLLDTDADASVLISKLNES
FT                   SRRLDRASFALMVSSLQGTAEASEPERVENIKHLEQLFLHIE"
FT   gene            complement(590866..591702)
FT                   /gene="panC"
FT                   /locus_tag="HMPREF0573_10507"
FT   CDS_pept        complement(590866..591702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="HMPREF0573_10507"
FT                   /product="pantoate--beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /note="COG: COG0414; Pfam: PF02569; InterPro: IPR003721"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10507"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66826"
FT                   /db_xref="GOA:D6ZJC7"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJC7"
FT                   /protein_id="ADI66826.1"
FT                   /translation="MELLKTREELATWRKGIQGKLGLVMTMGALHEGHLDLVRAAKAQA
FT                   DTVLVTVFVNPTQFAPGEDYDTYPRDLAGDAAKLQEVGADALFAPTPEVMYPSGEALVR
FT                   FDPGHAATILEGKTRPTHFAGVLLVVGKMFHLTRPDVAAFGKKDAQQLAIISQMVTDLD
FT                   FPLTILPVEIRREPDGLALSSRNRYLSPQERDTALNLSQALQWGRENASRLGASDLAAK
FT                   VRERLTAVPGIDVDYVALVNPTGFVPITGEFHGAAILALAAKVGSTRLIDNMDVQL"
FT   gene            complement(591707..593308)
FT                   /locus_tag="HMPREF0573_10508"
FT   CDS_pept        complement(591707..593308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10508"
FT                   /product="hypothetical protein"
FT                   /note="Pfam: PF03703; InterPro: IPR005182"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10508"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66827"
FT                   /db_xref="GOA:D6ZJC8"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="InterPro:IPR014529"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJC8"
FT                   /protein_id="ADI66827.1"
FT                   /translation="MWGVLVALVAIIYSQLDLIRDISKAMAAIRSTGKVLPVLLFSLLG
FT                   IVVLLLLLVLFAYLSWRFTAYALTDEAVLFRHGIIFKKERHMRLNRIQAVDVIAPLVPR
FT                   LLGLAKLHVDSAGASGSQIDIMYLKASQAQELRAEVLTKASGQKTVANRAVDTTNSLTN
FT                   STKIIGIGEAGLVGDLPAASGEAPETKLYEIPTEMLVGSILRSVSTWFAVLLIPLLLVL
FT                   GLIPAIAIFMSGDADSFWAALLVAPQALLGVLAGIFATITAIGQKVNEGWNFTAAASAD
FT                   GIRLRHGLTTHDSQTIPPGRVHAVVLKQPFLWRSKDWWRVELTMAGYQGTSEGNGGNKS
FT                   KTSSHVMLPVGTRAQALQALWMMEHDLGAVTDLNGAEIGTAGTNLLEVMMYGSGPAPGI
FT                   FTASPKARWFDWITWNRKAAVLTTTMVMIRDGRITRRVSFVPHCRMQSVALRQGPAQRA
FT                   LGMANVKLHLVPGVVPTTVYHLPTSSAQSLWELQVSHADMARDKEPPAAWLERVISNTQ
FT                   PCADSNEEQTDIFREE"
FT   gene            complement(593505..594005)
FT                   /locus_tag="HMPREF0573_10509"
FT   CDS_pept        complement(593505..594005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10509"
FT                   /product="hypothetical protein"
FT                   /note="Pfam: PF03703; InterPro: IPR005182"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10509"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66828"
FT                   /db_xref="GOA:D6ZJC9"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJC9"
FT                   /protein_id="ADI66828.1"
FT                   /translation="MTDELFNPAGVTFKPISMKLITVRILGLLAGIAVFALALGGFAGA
FT                   MMCTQGIPWFWFLEIVPIGLLVWQLWLIPRQVKAWGYAESERDLFLRRGIMFKKMWAIP
FT                   YGRMQFVDVQQGPIDRIFGIAQVSMKTASTESAASIPGLDHAEADRLRQILTARGESLR
FT                   AGL"
FT   gene            complement(594056..594988)
FT                   /locus_tag="HMPREF0573_10510"
FT   CDS_pept        complement(594056..594988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10510"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG5495; Pfam: PF03807"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10510"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66829"
FT                   /db_xref="GOA:D6ZJD0"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018931"
FT                   /db_xref="InterPro:IPR019665"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037108"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJD0"
FT                   /protein_id="ADI66829.1"
FT                   /translation="MSEIGGNPSPSLRVGVIGMGAVGPILAAAFRQAGHTLAGVSARSE
FT                   TSRERVDAILPGVAVVPPAQLVPDCDLVVLSVRDQEIAPLVAELAQTQAFQPGQLVAHV
FT                   SGAHGLDVLQPAVCTGAIPLALHPAQTFSGTSLDLQRLPGTHWAVNAPQSLLAVAQALV
FT                   LDLGGVPHVLPDSARPLYHAALAHGANHLVIVLTQAIRALQMAGLDDPAVFAEPLFKAA
FT                   FDRALREGETGLSGPVARADFPTVAMHLEALRSGPVLHKDDLDPALPFDDLADVPDSYR
FT                   ALARAATQRLWQRGGLSSHQREQLRKILG"
FT   gene            595229..595954
FT                   /locus_tag="HMPREF0573_10511"
FT   CDS_pept        595229..595954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10511"
FT                   /product="response regulator receiver domain protein"
FT                   /note="COG: COG0745; Pfam: PF00072,PF00486; InterPro:
FT                   IPR001789"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10511"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66830"
FT                   /db_xref="GOA:D6ZJD1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJD1"
FT                   /protein_id="ADI66830.1"
FT                   /translation="MVMEPAVSEARLLVVDDEPNIRDLLASSLRFAGYDVLSAGDGTEA
FT                   LRLATTEKPDLVILDVMLPDMDGFTVTRKLRASGIDMPILFLTAKDDMRDKVEGLQAGG
FT                   DDYVTKPFGLEEVVARINAILRRTKRSAVEQPLLRVADLELDDNLYEVHRGGRLIDLSP
FT                   TEFKLLRYLMVNEGRVVSKTQILDHVWEYDWEGDAAIVESYISYLRRKLDAPDETGSIP
FT                   PSLIQTRRGVGYLLRDPNE"
FT   gene            596031..597953
FT                   /locus_tag="HMPREF0573_10512"
FT   CDS_pept        596031..597953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10512"
FT                   /product="ATPase/histidine kinase/DNA gyrase B/HSP90 domain
FT                   protein"
FT                   /note="COG: COG0642; Pfam: PF00672,PF00512,PF02518;
FT                   InterPro: IPR003594"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10512"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66831"
FT                   /db_xref="GOA:D6ZJD2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJD2"
FT                   /protein_id="ADI66831.1"
FT                   /translation="MSRVFKEAPKSDEEWQVRGIGKLWISLALATRLTIIFAVALVAAL
FT                   SLAGTVTVLSLSSYLTSQQDAQLSAAARVMGPNAANLSDTTVFSNNMPSDYYIYVQFVG
FT                   SMHRPDREFITPSTKSKSGIPQRQYLPKKADIPTISNSSSLVMPGTTVPSTKSGQKWRV
FT                   LSILLTSQGKVAGAATVGLSMTPQSNMLQAIMFTITISTLIIAIVGTLMTNYLVGRAFR
FT                   PLHEIEGVANKIAAGDLTQRVKKAPNTTEVGSLANSLNVMLSNLEQAFSAVELSERKMR
FT                   RFVSDASHELRTPTAAIRGYAELSRMGGVGPERQAEVMARIESEATRMGNMVQDLLTLA
FT                   RLDEHRPMTFERTDITALARNSLSDMAVLDPERDLQLLNMEDETLEEVYSVYATVDAEK
FT                   ISQVITNLLTNVRQHTPANTPVEVVVGYHMWPDETGAPIKNAVASKIPAFQRCAVLEIR
FT                   DHGPGVAPEDAKKVFERFYRSDTSRVRTTGGTGLGLAIVSGIVSAHNGTVAMLQTPGGG
FT                   ATVRIKLPCQASHVDAEGENKNNPAAKFAAAAAAINKVSSSKENSRQLSAAQSTASASR
FT                   SRGVPGVNTKAVPAARPTPPVARPTLPSPVVPPTPPVAPPSRPVAKPVPKPTVAPPPPP
FT                   PPRSA"
FT   gene            598094..599119
FT                   /locus_tag="HMPREF0573_10513"
FT   CDS_pept        598094..599119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10513"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10513"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66832"
FT                   /db_xref="InterPro:IPR009218"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJD3"
FT                   /protein_id="ADI66832.1"
FT                   /translation="MMCMAEKIPAWLLTGFARSVAAEGGTAPRDVAESVGTELAQRWMA
FT                   PERHFHNLEYLKTTLENVDILSEQARDVEAIRLAVWYHGAIFDVSEAAVERGEAGLDVL
FT                   GSADYAADSLAELGVGEARIEKITDLIRGLYRHQAVEDIDAQVLSDADLCVLAADPQEY
FT                   LEYLRDIRREYAAYDEARFISARSTIIGNLLSRPQLFWTHGAAGWEEQARENLRAELER
FT                   LEKTGTTGLDIAGAGAEPAAQTGATPETAPTSDMLPTPREGTPVETATKPETGELPEAA
FT                   SRDQDPEDTDEPNEVNPYAPPDEADLGSTLENVAEAMDTMVMKALKPAEVGLKPLSDVE
FT                   E"
FT   gene            599268..599558
FT                   /locus_tag="HMPREF0573_10514"
FT   CDS_pept        599268..599558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10514"
FT                   /product="WXG100 family type VII secretion target"
FT                   /note="Pfam: PF06013"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10514"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66833"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJD4"
FT                   /protein_id="ADI66833.1"
FT                   /translation="MQFQVDSDAVAAAGAQTRACAEEVSAQVSAMMANLTTLQESWTGA
FT                   ASGAFAALAAQWRATQATVEDNLRQIGIQLDTASANYAEAESNATALFAGA"
FT   gene            complement(599667..600209)
FT                   /locus_tag="HMPREF0573_10515"
FT   CDS_pept        complement(599667..600209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10515"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66834"
FT                   /db_xref="GOA:D6ZJD5"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJD5"
FT                   /protein_id="ADI66834.1"
FT                   /translation="MKKFLVTATALMLGLAFAPAAYAENLSTPSASGDSAGTVMQHVNL
FT                   DSMPSGASNVVVNPSSPAPTAPSTAELNTGGSDVDVPAGPEVMYPQAPASVANAEPQIH
FT                   ANVAPQAPANANGQAKTSISAINANAPQAFVSSPIKSVPGVVSFVFIMLLCVGAGVAAA
FT                   VVISFVTGKKINLGLNR"
FT   gene            complement(600589..602217)
FT                   /gene="groL"
FT                   /locus_tag="HMPREF0573_10516"
FT   CDS_pept        complement(600589..602217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groL"
FT                   /locus_tag="HMPREF0573_10516"
FT                   /product="chaperonin GroL"
FT                   /note="COG: COG0459; Pfam: PF00118; InterPro: IPR002423"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10516"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66835"
FT                   /db_xref="GOA:D6ZJD6"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJD6"
FT                   /protein_id="ADI66835.1"
FT                   /translation="MAKMIAFAEEARRGMERGLDLLADTVKVTLGPKGRNVVLEKKWGA
FT                   PTITNDGVSIAKEIDLADPYEKIGAELVKEVAKKTDDVAGDGTTTATVLAQAIVKEGLR
FT                   NVAAGANPIALRHGIEKAVDAVVSRLLADAVEVKTKEQIAATASISAADETIGGMIAEA
FT                   MEKVGQEGVITVEESNTFGLSLEVTEGMRFSRGYISPYFVTDADRQEAALEDTYVLLVD
FT                   TKISSIKDLVPLLEKVMQAGKPIAIVAEDIEGEALATLVLNRIRGALKVVAVKAPGFGD
FT                   RRKAMLQDMAILTGAQVVSEDLGLKLENVGLEVLGTARKVVVTKDDTTIVDGAGDKDAL
FT                   EARIRQIRQEIEKSDSDYDREKLQERLAKLAGGVAVIKSGAATEVELKERKHRIEDAVR
FT                   NAKAAKEEGLVPGGGVALIQAAAEAFKDLQLKGDEATGAAIVQVAVESPLKQIADNAGL
FT                   EGGVVAEKVRHLPKGEGLNAATGEYENLLEAKVADPVKVTRSALQNAASIAGLFLTTEA
FT                   VVADKPEPPAPAAAPAGDDNMGGMY"
FT   gene            complement(602440..603066)
FT                   /locus_tag="HMPREF0573_10517"
FT   CDS_pept        complement(602440..603066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10517"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10517"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66836"
FT                   /db_xref="GOA:D6ZJD7"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJD7"
FT                   /protein_id="ADI66836.1"
FT                   /translation="MDEARYPEDEFDRIGKNLPQGAHRPGQPWWHGFLPFVIVIIAAPL
FT                   LAWAMLLLIGSHPSTANDAAGKPPTSQTPNAVATPSPSETEKPSKKPAESAAPSEEPTQ
FT                   TTPPTAETKTEPRAADKTITVSVLNASGINGLAAKVKDKVAADGFTKVSAENFQGTKPS
FT                   ANTIYYPAGHEAEAREMQRILNIDMIVPKDGAQTVQIVLVSRLKG"
FT   gene            complement(603160..603858)
FT                   /gene="ung"
FT                   /locus_tag="HMPREF0573_10518"
FT   CDS_pept        complement(603160..603858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ung"
FT                   /locus_tag="HMPREF0573_10518"
FT                   /product="uracil-DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /note="COG: COG0692; Pfam: PF03167; InterPro: IPR005122"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10518"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66837"
FT                   /db_xref="GOA:D6ZJD8"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJD8"
FT                   /protein_id="ADI66837.1"
FT                   /translation="MQTGEERGGLERIMSPDWAQVMAPVEGQIHAMGDFLRAELAAGRG
FT                   YFPAGENVFHAFQYPLERVKVLIVGQDPYPTPGHAMGLSFSVMSGTEIPRSLVNIFKEL
FT                   HQDLGLPLPTSGDLRPWAEQGVMLLNRALTVQPGKPASHRGRGWEAITEFAIRELANHH
FT                   AAQGLPLVAILWGADARRTKEFMPHVPCLESVHPSPLSASRGFFGSRPFSRANELLVAQ
FT                   SGQPVDWRLP"
FT   gene            complement(603869..604783)
FT                   /gene="nadC"
FT                   /locus_tag="HMPREF0573_10519"
FT   CDS_pept        complement(603869..604783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /locus_tag="HMPREF0573_10519"
FT                   /product="nicotinate-nucleotide diphosphorylase
FT                   (carboxylating)"
FT                   /EC_number="2.4.2.19"
FT                   /note="COG: COG0157; Pfam: PF02749,PF01729; InterPro:
FT                   IPR004393"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10519"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66838"
FT                   /db_xref="GOA:D6ZJD9"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJD9"
FT                   /protein_id="ADI66838.1"
FT                   /translation="MLPPEIASALAAAKLDSRQVADFIEATLDEDLAYGPDVTTDAIFD
FT                   DTLTLQARMVARASGCLAGVPVAAAVPFVLAQKTGASTPQVAMRRQDGERVEPGDVILE
FT                   ITAGARTMLTAERTLLNLASQLSGVATAVAAYVDAIAAASGESGTTGTKARVRDTRKTI
FT                   PGMRVLQKYAVRCGGGENHRMGLGDAALIKDNHIAAAGSLTAAVLAVRAYAPQIPLEVE
FT                   CDTLEQVREATNLGVGLILLDNMNPETMTKAVAIAAPHGVKTEASGGLTLRDAAATTAS
FT                   GVDYISVGALTHSAPILDLALDM"
FT   gene            complement(604824..606416)
FT                   /gene="nadB"
FT                   /locus_tag="HMPREF0573_10520"
FT   CDS_pept        complement(604824..606416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadB"
FT                   /locus_tag="HMPREF0573_10520"
FT                   /product="L-aspartate oxidase"
FT                   /EC_number="1.4.3.16"
FT                   /note="COG: COG0029; Pfam: PF00890,PF02910; InterPro:
FT                   IPR005288"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10520"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66839"
FT                   /db_xref="GOA:D6ZJE0"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJE0"
FT                   /protein_id="ADI66839.1"
FT                   /translation="MDVNWTMTTPVLVVGSGAAGLSAVINLVFAGVDCVLVTKSDLTAS
FT                   STDWAQGGLAAVWDRRDTPAAHYEDTIVAGAGLCSQTAVRTLVQEAPRALQWMMRIGAR
FT                   FDRNAAGEIDLHLEGGHSARRILHSNGDASGHEIEITLAKNVAAMDGATWDTGGQGELK
FT                   VLEDCELCDVLVDEKGRACGATVRDSRRGFGVVSAFAVILATGGIGQLWNATTNPEVVN
FT                   GAGLAAALRAGAIGRDLEFMQFHPTIFVPPVKVKGDRGVLVSEAVRGEGAVLVDGQGNR
FT                   IMRGVHPQEDLAPRDIVSAAEQEYMVAHGLDHLYLDATSFGTQKWKEMFPTIYELVSSR
FT                   GVDPITEPIPVRPGAHYYCGGIAATMSGQTNVAGLYAIGEVACTGVQGANRLASNSLTE
FT                   ALVMGSLVAQQLAEVDLPQLRRCPVAKPAAIPQPVEIAPPILEQIQEIMSRDVYVLRDR
FT                   AGLQRAQRELEKLSPHATLVARALVASAWAREESRGTHRRTDFPHRREEWRRHLDVQLG
FT                   PDGTSLEVSVTPV"
FT   gene            complement(606435..607424)
FT                   /gene="nadA"
FT                   /locus_tag="HMPREF0573_10521"
FT   CDS_pept        complement(606435..607424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadA"
FT                   /locus_tag="HMPREF0573_10521"
FT                   /product="quinolinate synthetase complex, A subunit"
FT                   /note="COG: COG0379; Pfam: PF02445; InterPro: IPR003473"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10521"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66840"
FT                   /db_xref="GOA:D6ZJE1"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJE1"
FT                   /protein_id="ADI66840.1"
FT                   /translation="MTRSATETQALQKRIRQLAQEKDAVILAHNYQSSEVQDVADFTGD
FT                   SLALSRLAADAPQHTIVFAGVHFMAETAKILSPQKRVLIPDATAGCSLADCITAEQLRD
FT                   WKAAHPGAIVVSYVNTTAAVKAETDICCTSANAIDVVKSIPTQTEILFCPDRNLGAHVR
FT                   RVTGRKNLVTWDGACHVHAAMTPDILLQGILAAGDADVYIHPECGGTQAAVDLIGAGKL
FT                   SEERVKVLSTGGMLSEAKKAPKGSRVLVATEVGMLHPLRKANPEVTFEPLMPQAACPYM
FT                   NQTTLENLVSCLENGRDEVFVDEDIAVRARASVQRMIAIGHTVSPQQH"
FT   gene            607613..607688
FT                   /locus_tag="HMPREF0573_t10013"
FT   tRNA            607613..607688
FT                   /locus_tag="HMPREF0573_t10013"
FT                   /product="tRNA-Thr"
FT   gene            complement(607741..609336)
FT                   /locus_tag="HMPREF0573_10522"
FT   CDS_pept        complement(607741..609336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10522"
FT                   /product="kinase domain protein"
FT                   /note="COG: COG0515; Pfam: PF00069; InterPro: IPR002290"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10522"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66841"
FT                   /db_xref="GOA:D6ZJE2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJE2"
FT                   /protein_id="ADI66841.1"
FT                   /translation="MSANAELLGAEIGGYVLERRLGTGASATVYLARDGAGNPVAFKLL
FT                   APDADLGQRDGDARERLRSEALSLKRVKVPGVAAVMDLEVDGVDAFIVTEYVPGPTLAE
FT                   DVRVSGAWQREDALELGNLLADTLRAVHESGICHRDIKPANVILGPNGPVLIDFGISSV
FT                   LENTSGLTRTGLVVGTPGFISPEIIEGQKAGFADDWWALAALLLFTLTGRPPFGTGSPT
FT                   VIISRVLAGNPDVEGLEVPVAEGFRRALAPQARRSVDFAELLRVVEFGANSAETATTAL
FT                   LTPAVPSEPGYTVVIPQELNGRYNLAGVESLSARMESAPEWSADETGEVAVTWGNVDLP
FT                   NPSTSVDSESFASVATGEPGVKQTPGMLPFLGLVGALAWTVWVPWQPAVSGIIAVLGFW
FT                   VAAVAGWHWRSTRKILSLPGACIKGLVSTIPAAVILAVALLTVEEILYGHRIMLPSALP
FT                   DTVTLFRTSVPKSVYVAQGLSGVALLTAWWIPLSVPLRIGARRVLRAVLPTPMRRLILG
FT                   LALAGLVAVVFVLA"
FT   gene            609426..609545
FT                   /locus_tag="HMPREF0573_10523"
FT   CDS_pept        609426..609545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10523"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66842"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJE3"
FT                   /protein_id="ADI66842.1"
FT                   /translation="MHKNLKKNARIWNNGQVGAVADKFSYPAFTTDRPARTRR"
FT   gene            609561..610679
FT                   /locus_tag="HMPREF0573_10524"
FT   CDS_pept        609561..610679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10524"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="COG: COG3839; Pfam: PF00005,PF08402; InterPro:
FT                   IPR003593"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10524"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66843"
FT                   /db_xref="GOA:D6ZJE4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJE4"
FT                   /protein_id="ADI66843.1"
FT                   /translation="MATVTFDKATRIYPGNTTPSVDELNLEIADGEFLVLVGPSGCGKS
FT                   TSLRMLAGLEEVNSGRILIGDKDVTDVQPKDRDIAMVFQNYALYPHMTVRDNMGFALKI
FT                   AGTPKDEITKRVEEAAKVLDLTEYLDRKPKALSGGQRQRVAMGRAIVRKPQVFLMDEPL
FT                   SNLDAKLRVQTRTQIASLQRKLGVTTLYVTHDQTEALTMGDRIAVLKDGILQQVGSPDE
FT                   LYQHPENDFVAGFIGSPSMNLRKFKVEGEEAVLYGASLPISAAQRSALTDADGGEVTIG
FT                   FRPEDLEITTDTGDGVMPIVVDIIEELGSDGYVYGHLDGAEQGTSGSVTEDHLVVRVPP
FT                   RTAPKPGSVMNVRITPGHQHVFSAATGKRLPD"
FT   gene            complement(611275..623421)
FT                   /locus_tag="HMPREF0573_10525"
FT   CDS_pept        complement(611275..623421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10525"
FT                   /product="putative Ig domain protein"
FT                   /note="Pfam: PF05345,PF04122"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10525"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66844"
FT                   /db_xref="GOA:D6ZJE5"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="InterPro:IPR008009"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJE5"
FT                   /protein_id="ADI66844.1"
FT                   /translation="MTVAGTALALTLMGLALPTRAIAEDRAAYPGAIDLPAWITDGKRE
FT                   PIKSDASPQDNWVVTGKVVTYRSGERAGANDDPGEKLVAGINVYARYQANNGAWSPVFK
FT                   ATTKDASTDSKTGRPSNYAIKMRDFVDYNGELGQFRPGEGKAQRLQVWINPEQVPGYRL
FT                   TFSERTGGVVQGYSTPKDFNYQFNQMMQWGYTPFGKSTQVSQMNIGLIRVANSADELDL
FT                   GNGVNIEPSLPSASAKKTLKGYVRWENQTLNRGGGNAYVGRPNIEDYPVNTPVVDYVVV
FT                   AAVKDKNGAVEARCTTTTEVPNDDGKSPNWQINFRQDVDVKNMKFQVFKGDCRPGNVRL
FT                   ERLPMRMGYWSPFPTTVDSWGTPLESTLGSANRGWTGLPGTWANNVRVLLRPLQMELTP
FT                   HGTNSGPDAGTQSFYGDTVTVDYSRLPLNTPLVARLYTGKLNDDGSGRPIDSINFKATG
FT                   EKGTGSLTFNTPLKGDTFQEYWVDVVPQKIDKNPELQVLASQSFLYKPIRLGINSGKVN
FT                   ETGAYTIYQKAPDATSSGVKLTECQVISKEPIDATTRQDSLPSNLKRDTSAGSNGCTLQ
FT                   GVPEKSGTYSLWVRFNFTDGSGKNHTIVQYLPWKVAPRLKPQIESGTPDSEMNKFSPLE
FT                   KFPAIGVPYSGLVSPYADWQGRHFTYQVFDSEPGASSVALEPAADGMVSLRDGSVDSGL
FT                   RFDPATGQVTGTTQAGKSAVFWVKATDEDGGVTPAEKFEIHPGSPLILQRAQLPTGSSG
FT                   SEYQNANGTPIVIWVSGGQPTTDKLTVSGGPELSRNTYSNVEILGIYDGENHKVNTTDI
FT                   GGINCSTQTSGNGKYILCSGQPKVSQVTTYYLQVKYTDSAGRTLDGSKYNLPQIKGLST
FT                   LSGAEGWLKMTLLPKITVDTSSDPNVTSMELPDGTKGLSYGPQDVKKYLSGGTGNFANY
FT                   TFSAAGLPAGLTMDANGVITGKPVETTTLNGAAVTVYLRGKDGTAAERSSTSVNFTLRI
FT                   KTDFKAVKDVLSATARGGNTYTSREPLLDMSSAGITGGVSPYSYKLQYKYSENDDWQNA
FT                   ALSGGRYQVPNADGNPSGLLLDSNGKLVGATMGKDSFPQLRVVVTDADTVSCQQGCPVN
FT                   VGLNLKRVDDRRPSVVEGASLTVNVGETATGALPVNDPSGTPQKYTVTDAVLPRGVALT
FT                   VDEDTGAYTLTATHETKADNSGSVTLSVTGANGAKAEVILRVHVMDQRIPQTNNNVAIS
FT                   LEQGIPVPATAKVSGAVDAAHSPEIKCFVPANYASGDCPTTAQKLPGLVGVTLKPNGTL
FT                   TGTPVKGDVGEHQVPLKALGVNGKWSAEFSTTMTVSPSTLVFEPGLAPGGTTGQPYEWT
FT                   FSPATGAEGLTKQYLVLDPNGHPVDGCTVNNHGSKPKLQCDANALQNKVTYTLRVSAGT
FT                   GDVAVNIDRAFTPAIYPPLKFGSYTLPSAAVKAVYRRNDGSTFSFTAAGGSGSYGFSFQ
FT                   AGSKHRKATPPSSCTGWALYTTNDEYSGLCLESDGRITGTPTVAGVIDFSKLEVLDSAQ
FT                   HRAGLPTDVEKMLVINPPLEFTTPCVKPTSGTDYPCQGERNQPVAANGKLKIATVSGGA
FT                   TPYRNLRVEGLEAYNAGAASSTPKLRAEWCDGNQTSNTVGDICLTGTWSKTMSPGSSLN
FT                   ISVTGAAGRTVTVEVFIPVSTDLKFTDKPSGALPRGVTLEQATNGGKPGNISDTAWDSV
FT                   KDNVKSGLPTVGISLDKDAVKDGNSGGVPALVKGGVGPYTYLTVPCDNTDASGNCALGD
FT                   TGLFLDKSTGQLVGTPKPGTSAAVVVSVTDSDSPAQTKKSNLVFSIADTRKPVVRATKI
FT                   NAEVDTAVHQVIPVNDGSGQYRSISDSGKPRWMSLTLTNNVLTVTGTPESGDVTRADGT
FT                   FSVQVTDANGNVSESATITYTVEDNRVPDLSSLTNGSSRDLTGTEGQGIQGWTPLPKDA
FT                   AGYGPKITKWKVEGLPQGVTFNPATGTLSPNKIASGESGTYPITITATTENGKTATIVK
FT                   TLEVRASDLTVTESKVQNLTGGQLTSPVTVATVSGGAGNYGLDVQGLPNGVTAELDNSG
FT                   NIVLKGTIPAGNNDFPVTFTVRDADGVERTLTRTLHIGAGLSVAKTTMPTATIGKAYEQ
FT                   RCLGVSGGTEPYGISGTLNGLPEGMALAANAGGKDICLTGTPSGNAGAFTVTFTLQDSA
FT                   TNPPATKEVTLTIPVNDEFTANRPTPPMGNLYVGSKTTDFTPTEGKGDTCYGLDASGAC
FT                   QKAKFTYSASGLPAGLSINPQTGVISGTPTEPVKNREISVTVASNAPGGDAVTQTFMIT
FT                   VASAFSNPENQFHMPSAASSTSLDGNGTVKNDSNQVLSAPEIKKNGQVIATGKYSIHGG
FT                   TPDSQGNYPLGDTGLALTPDGKLVGTLKPGQPLAAGNDGTFGLGSYAVVLQDDAGGDQI
FT                   GPQTIAFTVTDTRKPAITVTSATVEVGQAADISIGVTGGSGKIDTVELMSCNPGNNNVR
FT                   VDGATIKVLAAAFTKGGTTACQVKITDHNGLAKTEPFTIKVNDSRLPKFNASNRERYAW
FT                   QGLDFAKVTLGSNTKPGIPVMTWLVDPATDASAAPLKTVTIAGLPENFKVTSQNGTVTE
FT                   NSGAYTCSNPADCTIVGYAAKNVIGIPFFTLTITANTQNSERQPTNLTARKSIPLRVFA
FT                   SPLQLNTKTPVGMIRGAANYNSPIGTVDYLGGTITPTTSAGQAFLNSPSAWDGTYALDN
FT                   ANYDIVKVTAYNRNGTSSEVSGHGLTITAANSVAAAMPTGSQKAQTLTLSSAGTDAIPR
FT                   GTTSLAVELKVTDGHGIVRSATVNIPVVQKLEWAGPPFNRADSTVKLDTIGVQGAPYPA
FT                   YYAQAKGGDGSFSTSLAEETVAIRTAVDADAKAKFNGGTSYTGYKGITPVYCKAQGKIQ
FT                   SDTRPKCFPIPGLGGTIPADNAWNNPLTADHQGLFMLSNGKLSGSIPVDAATGVHTAQV
FT                   LVIDGSDQLIKKTFSIKVEKKLTLTIDNNNELPKGKKGVCYGSTTVKPDGDGKCPTTGD
FT                   GSGVQVGTYGGTNGITAKCELIPQVAGLKVTCTGGKVTISGAPTQTYDGNATVKVALTG
FT                   GAGQSVEKTVPLLIETDMIFKDHSAIGADVKVETQLDGTQKIEVNTTADGNKFPKVKLD
FT                   IEGGVPPYTYHVENSDGSAVSPVPCPAGVTSTTSKPIMCYPIGTTGLVLDSEGNVHGTP
FT                   IPGGNADGKLVVADSDTTSRTKKAAITVNIADQRPPQVYDLTINTTVGATSLSGSTQLV
FT                   AEDPQNPTVDPSSSNWTPEQVRAASQKGFHAKEPVNTLGTVKGCSASSLPNWLTLGSNG
FT                   AISLVNGEQVPIAAAGQTLRFCVWYVGPNGVNAPKPAVVSVNVTDQRRVTIDSGNGGTK
FT                   EVKIGKPVNPDPTTLVEAKIPADMVGNTSKPITVKKLNPNGTACAGNDCKFTSDSAGFT
FT                   DKSIDGLTVTGLNCTGSADPRSCSVTVTGTPTPQAAGNHQLSYQVILPNGQTQIISHTI
FT                   YIPPYDLALSVEPMSPAVGGLEYLQTSKPVLAVGGSGKYWFQLWDPNYPVADASDPSNK
FT                   AKVGNMDLVTTDNQVKLKWIPTTVDLAQAQQGNVPVTITVWDKDACHMRPADLVENKPG
FT                   PASCPYQVTKTVKIPVHAAPETAEINVPDVTEGTRTPAPSVYTGSGRPELTLLNTVPTG
FT                   NEDLFEFDANSGVVTLKASARPGTYTAVIRLTLPGVAIPFYRNVTFTVKEKTVTGPTPT
FT                   PNPQPGYGSSAAGNSGAVYDDLVLRHGGRDRIGTSLEVLDYFSERFATPSLSKQNAVPA
FT                   YSEYAGKVNRPWSDTAVLVRDDDYPDALVAGPLAANYNAPILMTPSKRVPQRVVETLRR
FT                   HGFTKVILVGNSSAISAGAVSQLQNAGFQVQRLGGQDRYRTAGVVADHLLASRGRDKSD
FT                   VYLATGVDFPDALSASSAAIKNAGVVLLTPRRTVDGTSQGWMNSAKTAKVVAVGGPAVT
FT                   AAERSVHLDEKQVGADRYETAQKVASAYFPPNPGRIAVATGKDFPDATLAASLTARTGA
FT                   PLVLTRVNTLTKPTTQFLTRNRASVRKVDLVGGTRAVSEKVRGEIYHALR"
FT   gene            complement(623555..624364)
FT                   /locus_tag="HMPREF0573_10526"
FT   CDS_pept        complement(623555..624364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10526"
FT                   /product="putative exodeoxyribonuclease III"
FT                   /note="COG: COG0708; Pfam: PF03372; InterPro: IPR004808"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10526"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66845"
FT                   /db_xref="GOA:D6ZJE6"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJE6"
FT                   /protein_id="ADI66845.1"
FT                   /translation="MTAFLERENIDVLAMQEIKCRNDQFPTLAFETAGYQVFVNGLNQW
FT                   NGVAVAARQGISAHLLGTEFYGAIDQPYFSVPPKPPQLEPRVLGVRVAGVECWSLYVPN
FT                   GREVGHLHYQYKLKWLDSLRSHVIRTLDTDPESLGLYLGDFNVAPRDEDVWDLADFAAA
FT                   THVSEPERQVFAKLLDPDTVADAVTLHDDLIGGLPGNLTEITRKFAPGWTYWDYQRARW
FT                   RRNQGMKIDFALATPRLVSRVTGAYIDTAERDGEQPSDHAPVIVDFE"
FT   gene            complement(624555..625382)
FT                   /locus_tag="HMPREF0573_10527"
FT   CDS_pept        complement(624555..625382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10527"
FT                   /product="putative HAD hydrolase, TIGR01457 family"
FT                   /note="COG: COG0647; Pfam: PF00702; InterPro: IPR005834"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10527"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66846"
FT                   /db_xref="GOA:D6ZJE7"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJE7"
FT                   /protein_id="ADI66846.1"
FT                   /translation="MMDATFGTKEEREKEITPVMKPIKYWLTDMDGVLVHETKAIPGAA
FT                   EFLQALRDKGREYLVLTNNSVFTPRDLSARLEASGLEVPEERIWTSALATASFLKTQSP
FT                   KSSAYVVGEAGLTTALYQAGYVMTSTNPEYVVLGETRSYSFDQIATAVQLISKGAKFIA
FT                   TNPDKTGPTKDGPIPATGAVAAMITAATGKNPYFIGKPNPVMFRTGLNKIGAHSEETAM
FT                   IGDRMETDMLAGVESGLHTFLVLTGSTHREHITDFSYRPNEVVDSIADIIARV"
FT   gene            625582..626433
FT                   /locus_tag="HMPREF0573_10528"
FT   CDS_pept        625582..626433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10528"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family protein"
FT                   /note="COG: COG0300; Pfam: PF00106; InterPro: IPR016040"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10528"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66847"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJE8"
FT                   /protein_id="ADI66847.1"
FT                   /translation="MVKWALITGASSGLGEEFAWQLAAEPLNVVLVARRQERLQALAQR
FT                   IHATLGVETEVLAQDLSTKTGQDAVIRRLRDDSRPIAVLVNNAGFGLGQNFVGGQWERE
FT                   DNALEVMVRALCRLTFEGARAMRLRTHRHKPGKVERLLQMLIGRPAIGKVSGGGAIINV
FT                   SSATAYTAMGTYAAIKTWVRFFSESVSTELRGTGVSVTALAPGLMKTEFHQSAQMNASV
FT                   WPEYGFISPEAVVTAAIEAARRRRVLVTPTVRYKIAMAGARLAPRWLIRTLFNSRLFSR
FT                   AL"
FT   gene            complement(626454..627986)
FT                   /locus_tag="HMPREF0573_10529"
FT   CDS_pept        complement(626454..627986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10529"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="COG: COG1129; Pfam: PF00005; InterPro: IPR003439"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10529"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66848"
FT                   /db_xref="GOA:D6ZJE9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJE9"
FT                   /protein_id="ADI66848.1"
FT                   /translation="MMEVFEARNIAKYYSSVPALAGVSIKIHPGEIVGLVGHNGAGKST
FT                   LLKVLSGAHGADGGEVLIDGTEVNFASPAGALAKGVGTVYQELSLLPNLTVAQNVFLGR
FT                   EKSDWKGLKKEEMRNQAKELVKSFGIDVNVDAPLGHYAVATRQLLEIAVATSKNIKYLL
FT                   LDEPTTSLEGEQVDSLLKYIKNLAETSNIGVLIVDHKLDELYRICDRIVALVDGKVRID
FT                   GNVNEVSHEDVVVAIAGEDVSSLLDSEPKRDAVSVPTSETSKVQGRGEPLVQVRNLRSA
FT                   ALKGVNLDIYPGEVLGIYGLIGSGRTEFLRALGTLHPIESGSISVQGKSFKGYKPVDSL
FT                   KAGLVYVTEERKMDGIVPQLSPIVNTSLPVTKKFSKLTWLSLKKMDSTMQKILARLQIR
FT                   GNLQGPVVSLSGGNQQKVLLGRAIALNPKLLMLDEPTKGVDIGAKGEIHRIFKDMAHQE
FT                   QVAVVVVSSEEEEILEVSDRVCVFAQGRNICEPEDVANFSVQRLRKLAWSKD"
FT   gene            complement(628036..629037)
FT                   /locus_tag="HMPREF0573_10530"
FT   CDS_pept        complement(628036..629037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10530"
FT                   /product="sugar-binding domain protein"
FT                   /note="COG: COG1879; Pfam: PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10530"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66849"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJF0"
FT                   /protein_id="ADI66849.1"
FT                   /translation="MKKILATIGAGALAAFALSACGNALDTGTSGSPGKDNGAASIPEA
FT                   CKGDNPYLAVLLPNQTNPYYVAMKEGFEDEGSKNGFKVEVQIANDDDANQLAQAQAMLG
FT                   KNPCALALNPVKSEPAAAIVKAANDKGVPVFTVNISADPDALKAQGASVVQYLGADNAA
FT                   GGAQMAEQIMKDLGADTAMEIGFVTEPDEVVVVERDEGFKKAIAKNPNAKVVAEVDGNV
FT                   KLTDALNVTSEMLQGHPGISVIFASTGPAAQGAVEAVKASGKDIKVYGFCASEMQTNDA
FT                   YPACVAQEPEDYGRRTVQQIKTYIGGDKVEDNILRPLKLFTKGQTPAPGEVG"
FT   gene            complement(629040..630116)
FT                   /locus_tag="HMPREF0573_10531"
FT   CDS_pept        complement(629040..630116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10531"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   permease protein"
FT                   /note="COG: COG1172; Pfam: PF02653; InterPro: IPR001851"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10531"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66850"
FT                   /db_xref="GOA:D6ZJF1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJF1"
FT                   /protein_id="ADI66850.1"
FT                   /translation="MKDFRLPQELGVAGVVLAVGIIMGVISPAFRTLDNLEVLFLNGSV
FT                   VLFLALGQTFVLLTGGIDLSVGSNIALTGVIAALTMQSGVPWWAAALIALLVGVVVGLF
FT                   NGAMVYWGKMPPFIVTFATFGISASIPKILTDAKSVTVSDPMFAIFGRGSLFGIPIPVV
FT                   MVLIAAVLCALFLRHSATGVHIYAVGGNPATSRLAGINVAKITVLVYVISGVTAACGGI
FT                   ITASRLMVGYPTAGSGTEQFYSIASAVVGGVSLFGGIGSIPGAFLGALLIAEVSNGMNV
FT                   IGVSSYWQPLVIGVIILIGVLIDTNRKGFSMRRLLQHFTKTTDSAIDSDSPTQGDETLG
FT                   HSTSVKDDQKIQPSLKEG"
FT   gene            complement(630122..631522)
FT                   /locus_tag="HMPREF0573_10532"
FT   CDS_pept        complement(630122..631522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10532"
FT                   /product="carbohydrate kinase, FGGY family protein"
FT                   /note="COG: COG1070; Pfam: PF00370,PF02782; InterPro:
FT                   IPR000577"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10532"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66851"
FT                   /db_xref="GOA:D6ZJF2"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJF2"
FT                   /protein_id="ADI66851.1"
FT                   /translation="MIRDADTGALVRSGMAFHRTGTTVNPAVWVRAFDEAAQQAGGLED
FT                   ICAISVAGQQHGLVTLDEDGEVVRDAVLWNDTSAGADAKDLITELGQGDAIAGRKAWVA
FT                   KTGSVPVSSLTVSKLRHLAVNEPENLSRTRAIALPHDYLTWKITKRNKITDLVTDRSDA
FT                   SGTGYFDPVENVYLPDILELAAGKTGTDLILPKVLGPHTPVGEFSVQGKEMLVGPGAGD
FT                   NAGAALGLDQKPGHVIISLGTSGVVSLVSKKPTCDENGEVTGFADATGNYLPLVCTLNA
FT                   SRVLDTTAAALGVNYERFSEFALSAPPGSEGLVMVPYLTGERTPNAPLATGSLLGIRGD
FT                   NLTASNIARAAVEGMLCLVGYGLEIFKRLGVEVNAVSLIGGGAKSEAVRRIAPSVLGVK
FT                   VTIPEIGEYVADGAARQAAWVLNGGTRPPVWSPRLTSSYTAQSQPFIMERYQEVNGLFA
FT                   DTTQLELE"
FT   gene            631858..633186
FT                   /locus_tag="HMPREF0573_10533"
FT   CDS_pept        631858..633186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10533"
FT                   /product="ROK family protein"
FT                   /note="Pfam: PF00480; InterPro: IPR000600"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10533"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66852"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJF3"
FT                   /protein_id="ADI66852.1"
FT                   /translation="MIVPDDEGVNLSRTAKSKNTSLQSADHEVPGMRAESLRNHNLQLL
FT                   TYRIITGSEVMSRADLAHETGLNRSTVTRLIEHLLDFGIIREGSTRVGPSGRPSIMLTP
FT                   ARRTHGGIGAEVGRDYISACVMDLRGNIIAEQFDQVDVPAYSPQSTLGKLATMVNELTS
FT                   QIQHSGLSLCGITCGFSGIISSSTSNLHMSPHLGWRNIDLEKHFRSKLHIEVPVDYQNT
FT                   ANLSALAESIARQKTGHELSDFIFISQNSAIGSALVLDGKVSSGLHGWAGEIAHITVSD
FT                   EDKPCDCGAVGCLDAYIDKANLLERAGLPANAPWEQLFASLHKGNAQVTETVRLCGRYL
FT                   GRALSTYINLVDVTTIVLGGVLKKLLPYYEDALRDELTRRALCSNWMEIDLQESIVKEG
FT                   SSLQGAAWNSLLRFLSAPESWQRPTDIALSYFPVDETPTTFID"
FT   gene            complement(633296..634321)
FT                   /gene="fbaA"
FT                   /locus_tag="HMPREF0573_10534"
FT   CDS_pept        complement(633296..634321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbaA"
FT                   /locus_tag="HMPREF0573_10534"
FT                   /product="fructose-bisphosphate aldolase, class II"
FT                   /EC_number="4.1.2.13"
FT                   /note="COG: COG0191; Pfam: PF01116; InterPro: IPR006411"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10534"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66853"
FT                   /db_xref="GOA:D6ZJF4"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJF4"
FT                   /protein_id="ADI66853.1"
FT                   /translation="MAIATPEVYKEMLKRAKENKFAYPAINVTSSQTVTAALRGFAEAE
FT                   SDGIIQVSVGGAEYWSGSTIKDRVAGSLAMAAYIREVAQNYPVNVAIHTDHCTEDKLSS
FT                   WTEALIDLEIEEVKAGRLPFYQSHMFDGSSIPLEKNLEVAKRLLPKAAAAKTILEVEIG
FT                   VVGGEEDGVVGEINEKLYTTTEDGIKTVEALGLGENGQYLTALTFGNVHGVYKPGHVKL
FT                   RPELLGTIQEEVGAHFNAGNRPFDLVMHGGSGSTAEEIATAVANGVIKMNVDTDTQYAF
FT                   TRPVADFMLKNYEGVLKVDGEVGIKKQYDPRSWGKAAEAGMAARVVEACERLGSVGTKM
FT                   K"
FT   gene            complement(634510..635079)
FT                   /gene="pyrE"
FT                   /locus_tag="HMPREF0573_10535"
FT   CDS_pept        complement(634510..635079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="HMPREF0573_10535"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="COG: COG0461; Pfam: PF00156; InterPro: IPR004467"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10535"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66854"
FT                   /db_xref="GOA:D6ZJF5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJF5"
FT                   /protein_id="ADI66854.1"
FT                   /translation="MKKNDPQLMKLAELVKTLSVVHGKVTLASGKESDFYVDMRRATLH
FT                   HEAAPLIGHVMLDLLEENGFPVSEIDAVGGLTMGADPVATAMLHAAAARGLSLDAFVVR
FT                   KEAKDHGMKRQIEGPDVAGKRVVVLEDTSTTGGSPLQAAQALKAAGAEILAVAVVVDRA
FT                   TGAKEKIEAAGYPYFAALGLSDLGLS"
FT   gene            635199..635795
FT                   /locus_tag="HMPREF0573_10536"
FT   CDS_pept        635199..635795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10536"
FT                   /product="RNA methyltransferase, TrmH family"
FT                   /note="COG: COG0566; Pfam: PF00588; InterPro: IPR001537"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10536"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66855"
FT                   /db_xref="GOA:D6ZJF6"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJF6"
FT                   /protein_id="ADI66855.1"
FT                   /translation="MPTDPHYDPELLRDGDTRNVPDRYRYWRQEAIRDELDRLLQSGPG
FT                   EPTLEVAIENVGHDFNTGSIIRTANGLGVRHVHIVGRRRFNRRGAMVTDRYLHLHHHPE
FT                   VQDLVSYAAQQELTIVGMDNFPGAEPLETVTLPSRTLMVFGEESQGLTPAMQNALERLV
FT                   QITQYGSTRSLNVGHAAAISIWAWRRAYPPRPTNS"
FT   gene            complement(635834..636784)
FT                   /locus_tag="HMPREF0573_10537"
FT   CDS_pept        complement(635834..636784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10537"
FT                   /product="beta-lactamase"
FT                   /note="Pfam: PF00144; InterPro: IPR001466"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10537"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66856"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJF7"
FT                   /protein_id="ADI66856.1"
FT                   /translation="MSVAFGSLTLAHLPARQGFDFPYALAVLSRQANGDVYVWTTGSTP
FT                   AAVERSFPWMSVTKFLVALAFWRQSQRAPVLSLNTPVGSPVAPGVNLVDLLSHCSGLPF
FT                   DAPETAPDRPRLGVQLGISRPDARAIAPFTKRIYSNYNFELAGAIAEKVVGKSWTDWVR
FT                   EAVLEPLGMSGTILSHSPAWGAVGPVTDLARLAGELLCPEAGVLGFTEQDLDRFCAPQH
FT                   PGLRGLLPGYGPQKDNLWATGVELHGVKSPHYLPASFPPEVVGHFGQSGSFIWVDRAAG
FT                   VAGAFLGAQKFGPVHRALWSDLNAQIRELALLAQH"
FT   gene            complement(636808..637455)
FT                   /locus_tag="HMPREF0573_10538"
FT   CDS_pept        complement(636808..637455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10538"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="Pfam: PF00440; InterPro: IPR012287"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10538"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66857"
FT                   /db_xref="GOA:D6ZJF8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJF8"
FT                   /protein_id="ADI66857.1"
FT                   /translation="MAQKRERGPYQSGLARREAILDAAVDLLAEVGYHGMSLRDVARHV
FT                   GISHPGVIYHFPSKEVLLMSVVQRYEKQLGFDLDNLEKLDALPVLDTLLEVTSRLNENP
FT                   MIIEVECMMMVEACSEIHPAHDHYMRRSARLLSILRRAWSRLQQDGKVSATEDPLRLAE
FT                   IQAAVFNGILIHWLYDRDFDASEELARYFISVFLPQHQEELLLHYRESGWIH"
FT   gene            complement(637645..640401)
FT                   /locus_tag="HMPREF0573_10539"
FT   CDS_pept        complement(637645..640401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10539"
FT                   /product="putative ATP-dependent chaperone protein ClpB"
FT                   /note="COG: COG0542; Pfam: PF02861,PF00004,PF07724;
FT                   InterPro: IPR003959"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10539"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66858"
FT                   /db_xref="GOA:D6ZJF9"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJF9"
FT                   /protein_id="ADI66858.1"
FT                   /translation="MISMDQKFTTKSQEALATALRTAGAAGNAMLEPIHLLSALLEDRE
FT                   GIAFEVLSSVADADAIGREVRRELASLPGATGESVAEPQPSQAMLNVISAAGAKAQERG
FT                   DDYVSTEHLLLGLAENEGRVGKILRDAGANDKKLRQAIKKIRGDAKVTSPNPEATFKAL
FT                   EKYGDDLTQRAMDGNLDPVIGRDSEIRRVIQVLSRRTKNNPVLIGEPGVGKTAVVEGLA
FT                   QRIVAGDVPDSLKHKHLIALDLAAMVAGAQYRGQFEERLKAVLEEIKNAEGEVVTFIDE
FT                   LHTVVGAGASGGSMDASNMLKPMLARGELRLVGATTLDEYREHIEKDPALERRFQTVFV
FT                   GEPSVEDTVAILRGIAPKYEAHHKVTIADGALVAAAQLSNRYISGRQLPDKAIDLIDEA
FT                   ASRLRMELDSSPEEIDSLRREVERVNMELSYLNASDPNREDPATEGRVAQLQASLDEKQ
FT                   AQLDRLNLRWEAEKAGHNRVGELRVKLDELNTALEQAMREGRWEDAGRLQNGEIPAIQA
FT                   QITAAEGESSNQSSAAGHAPTDSAISGTNSTKPGHPDAGDSQDGPMIAEKVDAAEIAEV
FT                   VASWTGIPVGKLLRGESEKLLHMEEYLGQRLIGQKDAVRAVSNAVRRARAGVSDPNRPT
FT                   GSFLFLGPTGVGKTELAKALADFLFDDEKALTRIDMSEYGEKHSVARLIGAPPGYVGYE
FT                   EGGQLTEAVRRRPYGVVLLDEVEKAHPDVYDILLQVLDDGRLTDGQGRTVDFRNVILVL
FT                   TSNLGSQFLIDREADPAEAHRQVLDLVRAAFKPEFLNRLDETIMFEALSTEDLEQIVDI
FT                   QIHQLTTRLAESQLTLEVTESARSWLAVTGYDPTYGARPLRRLIQREIGDQLAEKLLAG
FT                   DITPGSTVVVDMPNFSPTDLIKSGDLSELTGPMSDQYRLELRVKNAQ"
FT   gene            complement(640370..640513)
FT                   /locus_tag="HMPREF0573_10540"
FT   CDS_pept        complement(640370..640513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10540"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66859"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJG0"
FT                   /protein_id="ADI66859.1"
FT                   /translation="MLNCFQITQRVKIGFYPCVAEYAARKYCLSKCRKGEGNDIYGSKI
FT                   YD"
FT   gene            complement(640573..641145)
FT                   /locus_tag="HMPREF0573_10541"
FT   CDS_pept        complement(640573..641145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10541"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="Pfam: PF00376; InterPro: IPR000551"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10541"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66860"
FT                   /db_xref="GOA:D6ZJG1"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJG1"
FT                   /protein_id="ADI66860.1"
FT                   /translation="MSLIDEMNAALALLCSNNRRLVETILTKEFGGAHGTAGLSEVEAQ
FT                   QVWVKPRFRVSQAAEMMSIHPQTLRQYDRLGLVVPRRTGGGGRRYSLRDLARLHQVQSL
FT                   SQGEGVNLEGIRRIMDLQRRVDELEAENAALSLAANRQNRVFAASSSGEVTKLNRGQRP
FT                   EKTQSIGFPLGASSQSSALVVWGQEIP"
FT   gene            complement(641154..642257)
FT                   /locus_tag="HMPREF0573_10542"
FT   CDS_pept        complement(641154..642257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10542"
FT                   /product="DnaJ domain protein"
FT                   /note="COG: COG2214; Pfam: PF00226,PF01556; InterPro:
FT                   IPR015609"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10542"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66861"
FT                   /db_xref="GOA:D6ZJG2"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJG2"
FT                   /protein_id="ADI66861.1"
FT                   /translation="MGTNDWIDKDYYAVLGVSKDVTDKDLKKAYRKLARQYHPDQNPGD
FT                   KAAEEKFKEIGEAYSVLSDSEQRQKYDALRAMVSGGPRFQAGGSRHGSASDFEDVFSAM
FT                   FSGGYGAGGSTYGGAGPDLSDILNTFTRYADSADGAGPGASYAGFGPGFSGRFPGGARP
FT                   TADPGYGAGASTAGARKFAFRAQDGADLTASTKLTFKQAYNGATIRLKLHGEVISVRIP
FT                   PGVRDGQKIRLKGKGKPGINGGEPGNLVVTCSVSPHPFLQLDGKDLLFTLPITFAEAVN
FT                   GALIEVPLPDGSTVKVNVPSGTQSGEEIRIPGYGLHTKKGRGNLRLTVQVAVPQKLSRA
FT                   AKKAVDDFAAATSSANPRAELDRKVAL"
FT   gene            complement(642291..643091)
FT                   /gene="grpE"
FT                   /locus_tag="HMPREF0573_10543"
FT   CDS_pept        complement(642291..643091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="HMPREF0573_10543"
FT                   /product="co-chaperone GrpE"
FT                   /note="COG: COG0576; Pfam: PF01025; InterPro: IPR000740"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10543"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66862"
FT                   /db_xref="GOA:D6ZJG3"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJG3"
FT                   /protein_id="ADI66862.1"
FT                   /translation="MSEDKLSQEARKAYAEAQKEFDEAAAHEAEKASATQNSAETEVKA
FT                   KSGSKNGKNADSAAEHSSHSHVSPGDSAGHENGGAAQAGGQPAADEADELTGELAHAQE
FT                   DRIATLNQDLDRAKDDLARARADLYNLQQEYSNYAKRTKAEIPQQQEAGVASVVDALMG
FT                   VLDDIDLARQHGDLEGPFGAVATKLESTLQTRFKVKRYGKVGDTFDPNLHQAIQMAPGA
FT                   DDGGEHIIDAVAQPGYLMGERVLRAAMVVVGVEKSPSADQTSEA"
FT   gene            complement(643088..644962)
FT                   /gene="dnaK"
FT                   /locus_tag="HMPREF0573_10544"
FT   CDS_pept        complement(643088..644962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="HMPREF0573_10544"
FT                   /product="chaperone protein DnaK"
FT                   /note="COG: COG0443; Pfam: PF00012; InterPro: IPR012725"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10544"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66863"
FT                   /db_xref="GOA:D6ZJG4"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJG4"
FT                   /protein_id="ADI66863.1"
FT                   /translation="MAKAVGIDLGTTNSALAVLEGGEPTIIANAEGMRTTPSVVAFSKT
FT                   GEVLVGEVAKRQAVTNVDRTISSVKRHMGTDWKIDIDDKQYTPQEISARILGKLKQDAE
FT                   AYLGESVESAVITVPAYFNDSQRTATQEAGKIAGLKVLRIINEPTAAALAYGLEKGKED
FT                   ELILVFDLGGGTFDVSLLEVGKDDDGFSTIQVRATNGDNKLGGDDWDQRIVDWLVDQVK
FT                   TKDGVDLSKDKIALQRLRDAAEQAKKELSSAMSTNINLQYLSMSENGPIHLDEKLTRAK
FT                   FEEMTADLLNRCKTPFNAVIKDAGIKLSEIDHVVLVGGSTRMPAVTELVKELTGGREPN
FT                   KGVNPDEVVAVGAALQAGVIEGDRKDVLLIDVTPLSLGIETKGGIMTPLIERNTAIPTK
FT                   HSEVFSTAEDNQPSVLIQVYQGERQFARDNKPLGTFELTGIAPAPRGLPQIEVTFDIDA
FT                   NGIVHVSAKDRGTGQEQSMTITGGSSLPKDEIDRMIKEAEAHSAEDKQRRDEAEVRNGA
FT                   EQAVYRIEKLLKDNAEKLPEDVVAPVKESLEHLKKANEGEDIEAIKTAMSELEEKAQAI
FT                   GQALYAHAQENESAPADGAAAEPNTASTDDDDVIDAEVIDEDDEGDNK"
FT   gene            complement(645097..645240)
FT                   /locus_tag="HMPREF0573_10545"
FT   CDS_pept        complement(645097..645240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10545"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66864"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJG5"
FT                   /protein_id="ADI66864.1"
FT                   /translation="MFSFRGKASGLLSGRFALSGFDFTSPLRQFSFWFSFSGINPRLDK
FT                   LS"
FT   gene            complement(645277..645573)
FT                   /locus_tag="HMPREF0573_10546"
FT   CDS_pept        complement(645277..645573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10546"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66865"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJG6"
FT                   /protein_id="ADI66865.1"
FT                   /translation="MKMSEQLGGTDKLQTPQMFAVAVASTAGRSAYDNVPAFPKIVAPS
FT                   NVNRADANARAFNSGTLADAVNRLVGLPPFNVPASGIVGILSSRTVANQGFVA"
FT   gene            645621..645764
FT                   /locus_tag="HMPREF0573_10547"
FT   CDS_pept        645621..645764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10547"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66866"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJG7"
FT                   /protein_id="ADI66866.1"
FT                   /translation="MTLATTVTIGWFSTSLGSFQIFSSRVGFELAFSVQKGYLSGQKIV
FT                   LG"
FT   gene            645863..646525
FT                   /locus_tag="HMPREF0573_10548"
FT   CDS_pept        645863..646525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10548"
FT                   /product="TrkA N-terminal domain protein"
FT                   /note="COG: COG0569; Pfam: PF02254,PF02080; InterPro:
FT                   IPR016040"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10548"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66867"
FT                   /db_xref="GOA:D6ZJG8"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJG8"
FT                   /protein_id="ADI66867.1"
FT                   /translation="MAEKEKSSGTLVIGLGRFGSAVAMTLNSLDREILAVENDPAQVER
FT                   FSPLFPVVEADATRLDAMEQLGAKDFSSTVVGVGALEASVLITANLVDLGMEQIWAKAI
FT                   SREQGKILRRIGAHHVIYPEFDAGRRTAHLVDGRMLDYVEMDREGFSIVKMRPPAEIQG
FT                   FTLLESDVRRRYGVNILGVISPGQHFEYAGPDTVVAANDLIIVSGDGKLLEDFANRP"
FT   gene            complement(646534..647709)
FT                   /locus_tag="HMPREF0573_10549"
FT   CDS_pept        complement(646534..647709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10549"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66868"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJG9"
FT                   /protein_id="ADI66868.1"
FT                   /translation="MAMTNWAFPSLETKPGAWRRYWVVLVAFPDLFREVFADSTLEAFC
FT                   LGMVDDPLSRKLFVSYMRSHARKERHALKALQNGTDVRDIPGATPVIQQFKTRFEELRR
FT                   ENVQGVSEQKLPLLVERLSTAACDYTFCENLQPRIADRVIGPSGRKIADALAQQWLDYP
FT                   QLKYLNQRFHPRAQHLRFDSLDAVTFRQPSVPSAVQRTAGQLPRYVEAHGGTNPQTFPY
FT                   ISSFIGPVPPIPDPTSGLRFPQAPLRQFACTRDLFDPTWAGSPEQARELPFRFEEIPPL
FT                   SFDRVYQVNTLQDWRELVRRYPLEFTNPDVRQEFQRLSGKDALFLGVDWDRVRRDYDVV
FT                   FFGFRAVLDGADVGVDLEASELGEVAQSCTGTRLTALMYRVVPGSTYWLNL"
FT   gene            complement(647732..649102)
FT                   /locus_tag="HMPREF0573_10550"
FT   CDS_pept        complement(647732..649102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10550"
FT                   /product="cation transport protein"
FT                   /note="COG: COG0168; Pfam: PF02386; InterPro: IPR003445"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10550"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66869"
FT                   /db_xref="GOA:D6ZJH0"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJH0"
FT                   /protein_id="ADI66869.1"
FT                   /translation="MKFFANLREKSGKWFDELARRAPARLTLAVFLSIIVVQTVLLSLP
FT                   IATRDPGHARFIDALFTSTSAVCVTGLTVVPTDTYWSPFGLVVIMLGVEIGGLGVMTLA
FT                   SMLSLAVSRHIGLTARILAAGEKKSSLGEVGSLGKMALLVSVSVESVIALMLFPEFIRQ
FT                   DYGIGLSAWYALFMAVSVFNNAGFVIVPGGVEQFVADFGIIGPMCLGVFIGAIGFPVSL
FT                   DLARNWRRPKHLSLHSKLTITTYLALSVVGGGINGIIEWDNPRTLGALDLPGKLLAALL
FT                   GAFNARSLGVSTIDVGSMHEASWFVSSIMMFIGGGSASTAGGIKVTTFAVMVLAIVAEV
FT                   RGNRDIEAFGRRIGPSTVRLAVAVVAMSALVIGLSTATLLLLTNLPLSEALFEVNSAFG
FT                   TVGLSTGVTGSLPDSGKILLSLLMFTGRVGTMTFGAALAMRNRRRVIRFPEEAPSIG"
FT   gene            649407..649637
FT                   /locus_tag="HMPREF0573_10551"
FT   CDS_pept        649407..649637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10551"
FT                   /product="DNA binding domain, excisionase family"
FT                   /note="InterPro: IPR010093"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10551"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66870"
FT                   /db_xref="GOA:D6ZJH1"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJH1"
FT                   /protein_id="ADI66870.1"
FT                   /translation="MTGMTQSQAPRFLTVAEVADLLRVSKMTVYRMVHAGDLPAVRVKR
FT                   SFRVPLKAVEELSASNLDNWMIGNDDEAVAQ"
FT   gene            649755..649853
FT                   /locus_tag="HMPREF0573_10552"
FT   CDS_pept        649755..649853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10552"
FT                   /product="hypothetical protein"
FT                   /note="Pfam: PF08213"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10552"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66871"
FT                   /db_xref="InterPro:IPR013177"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJH2"
FT                   /protein_id="ADI66871.1"
FT                   /translation="MGSVIKKRRKRMAKKKHRKLLRKTRHQRRNKK"
FT   gene            649931..650758
FT                   /locus_tag="HMPREF0573_10553"
FT   CDS_pept        649931..650758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10553"
FT                   /product="HAD hydrolase, family IB"
FT                   /note="COG: COG0560; Pfam: PF00702; InterPro: IPR006385"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10553"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66872"
FT                   /db_xref="GOA:D6ZJH3"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJH3"
FT                   /protein_id="ADI66872.1"
FT                   /translation="MAKIAAFFDVDGTLIRGASTWYLARDLYSRGYFGLDFFVFAARQA
FT                   LLYVIFGESIHRVEQVKKRSLQIIEGKLESDLVLVGEELYDRFLQERLFPGALKIIQKH
FT                   LDAGHDVWLVSATPREIAQSMAHRLGLTGALGTVVEVDERGRYTGKMPQSLMHGTMKAK
FT                   AVLELSWEHDYDLKQCYAYSDSMSDEKLFNLVGHPCVVNPEPKLRRIAKRRHWPIYDFA
FT                   HRRLDIAIKVRSRYLPAITIGFLWTLRVLWRYVIRRILHVPGRIWRSRFPRRR"
FT   gene            650810..651487
FT                   /locus_tag="HMPREF0573_10554"
FT   CDS_pept        650810..651487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10554"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /note="COG: COG0406; Pfam: PF00300; InterPro: IPR013078"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10554"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66873"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJH4"
FT                   /protein_id="ADI66873.1"
FT                   /translation="MALTTVHLMRHGEVDNPEGVLYERLDGFGLTERGREMTTLTARWL
FT                   AAENRDIAMIMSSPLQRAQESAAPAAEIFQLPVHLDSRLTEAGNKLRGQKIHRSSLTLA
FT                   HPQYWPLYVAPWLPSWGEHYRDIVQRMFRAVAHARALTPPGRESLVVSHQLPIWTLRRF
FT                   VEGKSLVHDPRKRECALASVTSFYFDNATLIGMEYASPAESLVAEARDVTPGRSSAAVN
FT                   TGR"
FT   gene            651801..652208
FT                   /locus_tag="HMPREF0573_10555"
FT   CDS_pept        651801..652208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10555"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3602"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10555"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66874"
FT                   /db_xref="InterPro:IPR018717"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJH5"
FT                   /protein_id="ADI66874.1"
FT                   /translation="MSENATYEQMLAQINPRIGVEYVFASVTQLPPDVEPVALIREPEG
FT                   ITIGVTLEEAARAGLSTADPYTIITLSAPGSLDVVGLNSGIAQVLSSRSIPANIFSGIY
FT                   HTHIFVPSKLANDAKAVLEDVSGQAKAWLDM"
FT   gene            652243..653574
FT                   /locus_tag="HMPREF0573_10556"
FT   CDS_pept        652243..653574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10556"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66875"
FT                   /db_xref="InterPro:IPR032576"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJH6"
FT                   /protein_id="ADI66875.1"
FT                   /translation="MKDKNPLQLTPDPMDRMADGTIKQRNPLTGTQVWTVTSRGNRPHF
FT                   HREVVTEPAPLLQPSDFTNTCAFCTDRYFDTPPEKSRLVKGLDAKFHKIEGLPAASMQD
FT                   MVAEFRRIPNLFEIVSYDYWHENHNHYPTEAQNRRMADYLASAAGYDHVLHVVKMRLEA
FT                   SGEDHLETIPDDALLQYATGLFAGGHDVIVARRHYVDGATRADQNASAGTLSVAEHRAY
FT                   IGYTIATLQDLYKLNPAVKYVTAFQNWLRPAGASFDHLHKQLVAVDEYGVQIEAEAARV
FT                   AADPAIYRRILHYVTHRQMMILGNDYAVGFADFGHRYQTIAVWPLGPALLPWEYTREQV
FT                   DGISDVLHALHCAVGPAVPTNEEWYHRPVDLDVPLRFRILLKQRTSTLAGFEGSTRIYL
FT                   NSVDPWTLGDEMVTLLEKKREQGLIAPSLRLGNEYRLPKDSLGE"
FT   gene            653705..653974
FT                   /locus_tag="HMPREF0573_10557"
FT   CDS_pept        653705..653974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10557"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66876"
FT                   /db_xref="GOA:D6ZJH7"
FT                   /db_xref="InterPro:IPR025329"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJH7"
FT                   /protein_id="ADI66876.1"
FT                   /translation="MDIGEKVVNVAAVGLAGLVSDNIVKLGWRMATGANPPQDDDVEVG
FT                   LAQAIVFAVLSGVLLAIIKRFTVRTASQWWVNKHSEAGIGIESA"
FT   gene            complement(654004..655041)
FT                   /locus_tag="HMPREF0573_10558"
FT   CDS_pept        complement(654004..655041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10558"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66877"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJH8"
FT                   /protein_id="ADI66877.1"
FT                   /translation="MLSPANRHDSLDLSAAQPFHLLAVADDVQPEEIDILAGQIWTECS
FT                   RLGPGLLELKKEAYLTGPWDLTPEAIVGLGLPSRLKFAYLAGVPALRGKPVPQWLQGRD
FT                   PLWDAFREGGPEGLELEVLQGLRRMARRLAGALRFSTGPIIVPDPDSAVSLRVLSEIWL
FT                   EPAACLQVVQRALPIAALLMGNETEQTQRRSGPKPPRLTTPEERANYDPDGLRSRIQAG
FT                   VSPDERAWLHAEAEAYDEAAMSMPLMVDAYAIAADVTQKSSVHVVVQGETAIPPVLGHA
FT                   EDGCVSYAISWIAPEITITEESRLKRTMRLDRLTVIDAIEAVARQLAEATNGVIIDEDD
FT                   FVVTL"
FT   gene            complement(655183..655803)
FT                   /gene="dcd"
FT                   /locus_tag="HMPREF0573_10559"
FT   CDS_pept        complement(655183..655803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcd"
FT                   /locus_tag="HMPREF0573_10559"
FT                   /product="dCTP deaminase"
FT                   /EC_number="3.5.4.13"
FT                   /note="COG: COG0717; Pfam: PF00692; InterPro: IPR011962"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10559"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66878"
FT                   /db_xref="GOA:D6ZJH9"
FT                   /db_xref="InterPro:IPR010550"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJH9"
FT                   /protein_id="ADI66878.1"
FT                   /translation="MLISDRDIRALVAQGKVVLDPWDPDAVQPASVDIRLDRYFRLFDN
FT                   HKYGLIDPSKEQAELTRLVDSGDKPLILHPGEFVLGSTFEHVTLPDDIAARLEGKSSLG
FT                   RLGLLTHSTAGFIDPGFTGHITLELSNTATMPIALYPGMKIGQLCFFQMSSPAEAPYGS
FT                   GAKGSRYQGQRGPTASRSYLNFTQVEVPEGRGIVAEAHCDPEL"
FT   gene            complement(655822..656403)
FT                   /locus_tag="HMPREF0573_10560"
FT   CDS_pept        complement(655822..656403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10560"
FT                   /product="peptidyl-prolyl cis-trans isomerase, FKBP-type"
FT                   /note="COG: COG0545; Pfam: PF00254; InterPro: IPR001179"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10560"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66879"
FT                   /db_xref="GOA:D6ZJI0"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJI0"
FT                   /protein_id="ADI66879.1"
FT                   /translation="MTVKIVPKLFLLTGAAALTLSLSACSTHAKEQAASQSPTASNSAT
FT                   PTPEEPKSTPAAVVEGDRPQVVGSGADTAVGFPKDMPAPEQNTAWVVQEGTGAVVSETD
FT                   TVTANYVGQVWGQGNIFDSSFARGKATSFSLQQVIPGWTKGLAGQKVGAKVILGIPSEM
FT                   AYGQQGNPPVIPPNSPLAFYVEIVDSKPAS"
FT   gene            complement(656594..657451)
FT                   /locus_tag="HMPREF0573_10561"
FT   CDS_pept        complement(656594..657451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10561"
FT                   /product="sortase family protein"
FT                   /note="COG: COG3764; Pfam: PF04203; InterPro: IPR005754"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10561"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66880"
FT                   /db_xref="GOA:D6ZJI1"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042002"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJI1"
FT                   /protein_id="ADI66880.1"
FT                   /translation="MPLLFALAGIALFMYPVVATQWNNYRQNQITTYYARQVQEPQRLE
FT                   ALEASVAAARRYNEETPGAPILDPWLSRVSQTNNPYQEYLEQLNVMEQMGQLIIPKIRV
FT                   NLPIYHGTEPKTLERGIGHLYGSSLPVGGAGTHAVLTGHTGLTNATLLDHLEQMRVGDA
FT                   FYLNVAGLHMKYRVVSVVVVEPTEIGTLKRQDGRDLVTLITCTPYGINSHRLLVTGERT
FT                   ALDKNEENAFNSGFMLTWSWWMVAALVASTLMALLTLWWWRGKGRRRKEKHPRKQGIKH
FT                   AKAR"
FT   gene            complement(657480..658427)
FT                   /locus_tag="HMPREF0573_10562"
FT   CDS_pept        complement(657480..658427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10562"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10562"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66881"
FT                   /db_xref="GOA:D6ZJI2"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR032364"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJI2"
FT                   /protein_id="ADI66881.1"
FT                   /translation="MKLMGRWLAALALCLVVTIVNPAGALGVTRATAPIHSFTGDGDPA
FT                   SLFNAHVAAPTGTGTLTLVREAGNPYNDETPPSVQGVAFKVAKVTGVTLATAQSWQDIK
FT                   SLTPEKVADKLDSPVTQSTDSNGRAVFDHLSVGLYLISQEQEHASGKIAPFLITVPVAD
FT                   KTRHSWNYRLVITPKPQPRSPTGSTSGSGTGPYVSGEVSKDTTPTPTPSESKSPTPTAD
FT                   PSPGGGNKTYSANKDHNKQEPPVKSVWLRAPNGDLILVAPDGTIMARLPATGVIAVQVG
FT                   GMALFLIGVGMWILLRTKRRQESQDAASVEALHK"
FT   gene            complement(658452..659873)
FT                   /locus_tag="HMPREF0573_10563"
FT   CDS_pept        complement(658452..659873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10563"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="Pfam: PF05738,PF00746"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10563"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66882"
FT                   /db_xref="GOA:D6ZJI3"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR026466"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJI3"
FT                   /protein_id="ADI66882.1"
FT                   /translation="MGLGIALVLAAVFSMLIWVPQGHADGTTVDMNKTGSITVHSVEGD
FT                   TGVPATGAEVNNLTNQIINGSEFKLTKDSTDVSTLAGMQAAAGVTTKNFTADTHFRAKN
FT                   CTTQTNGSCKFEPLTPGVYKLEQIKAPTGKQTAAPAIVVLPLTNPTGTGFMYDIHVYPK
FT                   NATIGSIKKVNATPADTLLKEGAEMTFKITVPIPKHDADAKKFTAFTVTDEPGSGLTVA
FT                   ESGITSVVLGTETLTSDTHYTVSKTNNNVKVTFVGDGLTKLSGSTESELIVNVKGTVTN
FT                   ITTAKVVENKAAYAYKLADGTNNTGGKDPNGNDPGSEGVETKDDDSSQTTFGYVQIKNT
FT                   DGTTNALTGGKFKVGKCAADGKSVVAGQEVATDATTAAQVGPIGPLAKLCVEQTTAPTG
FT                   YALNPEATAIEFTAEKIKSANNKPLEALVTNTSNNDFLGKLPLTGGPGVIALLSAGAVL
FT                   MLVAVALMSRKRHQD"
FT   gene            complement(659982..667631)
FT                   /locus_tag="HMPREF0573_10564"
FT   CDS_pept        complement(659982..667631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10564"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10564"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66883"
FT                   /db_xref="GOA:D6ZJI4"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJI4"
FT                   /protein_id="ADI66883.1"
FT                   /translation="MTTSVQGRIAMASMRTKRLASFVLAPCIVLTALAFTLPALTVAEN
FT                   AAAATGQSAKPNTGPIGTDNDPWPQSFPRDTDMSHVSKMKQGRIALVFDFDPRYTWETM
FT                   GGNRIPQGRNQKTTRNFDQSEQIKKYLKNLEGAPVQVGIYTFDRFDRTDRYQNVAWANT
FT                   PDLPATSLENKDGFDKVMAKLDSLDATDGTGRRKGDGTAADDVSNQEQGLQKVLNDMDK
FT                   YHYTDVFLFTVGMPNKCGVHDGGCPDVIKNLTEDQKKFLKKSGALKDDGTSAITEPHRW
FT                   TYKSDPAIAAAVKAYEIQKKGAKLRLMHMYVNWGINDRAFQYAGYMLGEKIEGTIVPGP
FT                   LGAEDHVKLNIPESIKDQWVTIRHAGNLGLYHSDRSMIDGRYDGKKIVEACNNWHGLGT
FT                   LDLPKRDGFAQDIKLGGNNGNQYCNHVRDGKFGKTVVDWLQKAQGLAVINDQVDQDLRF
FT                   IKPNANRQFSIKVAGGNDTSVKTAADGFFDHDGADGQVTEVKFTQPSPREQITPFKGTD
FT                   HKLHNARCHGWNAGKKPETFYPEDINDPNGIPIGFKFTDEQLNVSRAGYQLAKCAVYSR
FT                   PFQEVEIVKRAITAKDDPINTVLGPGKVKENNQVVTKPGAKYEFAWKCVDPLNHDVNKV
FT                   ISSSEGIPAGKRTLEIKGKVNNLYEWEPLGIGKTITENNQPKSMLPVGAKCEVTEKIKL
FT                   PAGYYADERENAAKANQLYTSENRVEGRNYQIEIPANASDQEKQHPGSVGQAQNKDKQA
FT                   TGGHTFGATIRYEQGSITASGVSPISQLVSTTTYRSRKAGIHFTLKLDNPENDPAYDTV
FT                   LAKEKAKTARNGVTLVPVYYNCRFMPDPKKPLELPETNQGYIPTPVQSGWMYVPVKQGE
FT                   ATGEAYIGYQGVNERGELPKQGGQEVKVPTWPVGTHCLFSTVAPPEAEQQSTGRPLDLP
FT                   GFTSTEKYSSTVCAGHDYQPGDGEIECGKNYFWVGSDREHTIKLTQEFYRQHGQLEVSK
FT                   VLKGSAISQGLATPYEMKLGCQQERVKLPVNDNGLTRGNDGSYTFTVKPGEPRTIQGVP
FT                   AAANCQLSETNSNKTKIRNVTVTIPRTQEIAPLKDLSKPHQVEVENTLEYTPGSLKITH
FT                   KGTYDNNLTSAMQEQIQNQNRNIELRCTDLDGKVTTQSVQLHPGDTSVIPNLSAGSKCV
FT                   VSADTSGFSVQTQDDPNAGPSEHYIQVASKPVEVTINPGSNESTVESSFSHLTAGELTI
FT                   FSRVKQWPAYGAVRGKLPRNVSAEITCGSQSYWTKTLDLDMTVPSTISGTNLPENTACK
FT                   LHVKVFNTWPTEIEGTTEFKAGAGNKLTAANSPAEEFDFTTPRSNQTGTSLVLAHSFRE
FT                   AQSTAKFRLDTPQMWTSADENANTGVKVPDSWKAALLKGMSAVPNEVTCKLGNDTVSRP
FT                   VNLDPQGNFAQTQVPRGWKCQAAVSPRLLKIAGTDLKESKWSPSGPAGATAKNFDAKVA
FT                   GADPQAPVTLDWTAGDEFSATLSNTYRVQLASFNVKKKVGGEGVGAIPAEYQFKIHYSC
FT                   TLNGETIDLPAPANINDKTAEAYEVVNGNNSAWDAAAHLKKDLEKRFSGTLQTEKTVDI
FT                   VRFQQGEWHPIDALPAGAVCTVYEDAAAKVDSSRLDNYWELAAGYRGREPAAKCEADSK
FT                   KCTPTSETNNDGLGGAKVFLPTDTSSQANSFYKDKQNATNDHGIPLNPQVPQKFPENFA
FT                   GTVVAWNNYTFDKAKKLRLTMKLEGNGKELLAGQTLHTRLYCQPPAMRDQNKRLVASQS
FT                   TKGRNVINADLEFKVTPDALRLGRIDATSDVKLPVNYKCVIAQKMFSLGDGLATIRLSA
FT                   DSGPDSIQPQSSAPADLGTGTTGSTPVKSNSATTEQLQEFFTSRDDPDATGKKIEFKEY
FT                   TADDRNLFQGADENYIAAFQMPAKLQEGATVGFTLTNLLSRPGVDFTVAHQLIDNVSGY
FT                   YNLGGKLNDAHALSYKLAYECQDQYLKEKYQDGGTEKTRPLTYQGEVALGVNREVQLFA
FT                   AADPNAASSGTVSSGQPKFIPASSSCAFWLNNAGNDPIAGYPAVQLLTSSMVQGDAKLA
FT                   GRFRNQRKSAERDPGQLKAKPIVFEKDPSATANSGNSGATAPNGVASGNSSQPANPAKA
FT                   GEKATPLKAKLTFDTWYFTERQELSLSTYTYGAKADEAIAPGTKFTYEYTCNYPQLPGM
FT                   TFDGATRKLEGISLGDRVSLGQDTSEPCDRAPSGGGTAVSSQPGGPAPAPKQCVKRVVP
FT                   AGTSCTVTGHQPSRPAAQNYLNVVTNQVTNQPDLWNIDKNGQPKGKPRITSKTVEKIVK
FT                   QTGADGSFTVQLGGQTNGKDNPLDVIIGHIVYMHGAEIYVRRVDDQHHPVKDAKFDLYT
FT                   QPVSAVTAGTSPAAKSQVSFTPDLDSSGQASGWYRAILAPGTYWVGTTNTGANGAELLW
FT                   QRYQFDVSIADKKNGKNLNPEFDTVVTLSEKSQHSGLVTLSKRELTTTPGSTAGSTPSS
FT                   SSNPTPSSSPNATESYTSSQDLNSLDATDFVKWDLEIGDIRFGTLPLTGGKLPWMLGSA
FT                   GMLMGAAVILMWRLPRREDFTSGKEA"
FT   gene            667950..668378
FT                   /locus_tag="HMPREF0573_10565"
FT   CDS_pept        667950..668378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10565"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66884"
FT                   /db_xref="GOA:D6ZJI5"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJI5"
FT                   /protein_id="ADI66884.1"
FT                   /translation="MKELANQRSKVSRFATLAIIVVLGIATSAVLFKVLGEPVIPRWWA
FT                   VFSFVILIMASVLAGKQTANVNQSWVYVVDVLLAVLLGIAFLTSQENEPLSGFAAFAWN
FT                   LFSLLVIASCAAHYLDKRHPKAPKDAVASPAPETPSEN"
FT   gene            complement(668395..668649)
FT                   /locus_tag="HMPREF0573_10566"
FT   CDS_pept        complement(668395..668649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10566"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10566"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66885"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJI6"
FT                   /protein_id="ADI66885.1"
FT                   /translation="MLNAQGKPISKTYDDTFFTSDPEGAVIVAIIHESGDSYKVKKTIS
FT                   TNPTTSIGFMPLLRGMATESGATSDTNRNTKRESVGAPY"
FT   gene            668850..670469
FT                   /locus_tag="HMPREF0573_10567"
FT   CDS_pept        668850..670469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10567"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="COG: COG0488; Pfam: PF00005; InterPro: IPR003439"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10567"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66886"
FT                   /db_xref="GOA:D6ZJI7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJI7"
FT                   /protein_id="ADI66886.1"
FT                   /translation="MPAINLVNISFSYATVPVLNDVSLHVSDGERACLVGPNGCGKTTL
FT                   LRIASGDLPAQRGKVEGTESERFRVPSIEQFDGSVGDYLDAALRPLRTIAGQFAEVTVR
FT                   IDEGGALGEWEREYDQLLAQMTSFDIWSLDARVAEVLAGLGLISFTRSGRNRELSRLSP
FT                   GQRGRLQLAATLILKPAVLILDEPTNHLDAQALSFLTQTVNSWGGPVLMASHDRAFIED
FT                   TATVIYDMDVEVFNALAKAEGVGETAGLYRCTGGYSDYLAEKARARTKYVELHAAQQAE
FT                   TRKVRRHRQAAGKISRGGVRLASAEGKAKKYFSDRAAATATRRIRNDDQRLDTLAAREV
FT                   RKPRNYELSFAFAQPAERTGVAVSARQASVEQRLAPLSFDVVYGEHLLVTGANGSGKST
FT                   LLNWISSGQPPADATASGTITRDKAISLVPQHLPKVRDFGFTTEVWRGGIGEAGKGILH
FT                   PAMWTTPIPELSAGNQRRAQIALALASTPTILIIDEPTNYLDLDSMQALEDALSRWKGT
FT                   LIIASHDRWLIDHWQGSTIDIQ"
FT   gene            complement(670813..671067)
FT                   /locus_tag="HMPREF0573_10568"
FT   CDS_pept        complement(670813..671067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10568"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10568"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66887"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJI8"
FT                   /protein_id="ADI66887.1"
FT                   /translation="MLSNPGYLEKPELDMIADTVNRIFGQLTLIQYLLVHLDLGNVAIL
FT                   PELLEQYPRVKPLPISHLGMPDNWQENPLWATKTVLSFR"
FT   gene            complement(670955..671770)
FT                   /locus_tag="HMPREF0573_10569"
FT   CDS_pept        complement(670955..671770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10569"
FT                   /product="Abi-like protein"
FT                   /note="COG: COG4823; Pfam: PF07751; InterPro: IPR011664"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10569"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66888"
FT                   /db_xref="InterPro:IPR011664"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJI9"
FT                   /protein_id="ADI66888.1"
FT                   /translation="MPQSLATPQVNQFKTHSEQIALLRERGMLIESDSKACRLLDQVNY
FT                   YRLSGYWYSWRKLLKTGERADSFIAGTTLADVVAVYMFDCKLREAVFTCLAPIELSVRS
FT                   MLGHELGRIDPFSHLHPDSLGSLARASDCEGSSSGHQKWLERYEKELRASREDFVDHHK
FT                   KKYGGKLPIWAAVEVMDWGSLTHLYKLAPIGVRDTIAARVDLNATQLGSWLKALNILRN
FT                   YSSHHARMFNRVYAIKPWLPRKARTGHDCGHGKPDFWSANFDPISSGSP"
FT   gene            complement(672062..673111)
FT                   /locus_tag="HMPREF0573_10570"
FT   CDS_pept        complement(672062..673111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10570"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3943"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10570"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66889"
FT                   /db_xref="InterPro:IPR011204"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJJ0"
FT                   /protein_id="ADI66889.1"
FT                   /translation="MTTRDGSQTDEPKGQMLIYQSPDNSVTIEVRLEGETVWLTQQQMA
FT                   ELFQSSRSNIIEHIGNIYAEDELDEEATCREFRQVRREGSRNVTRTLPHYNLDMIISLG
FT                   YRVKSKTATQFRRWATERLKEYLVKGFTLDDERLKNLGGGSYWYELLERIRDIRSSEKV
FT                   MYRQVLDLYATSVDYDPRSAESIAFFKMVQNKLHYATHGHTAAEIIHERADASKPFMGM
FT                   TAFKGSQPTLEEAKVAKNYLTEDELRVLNRLVSGYFDFAEVQAMNHRPMHMSDYVEHLD
FT                   NILAATGQQQLQGAGKISHQVAIEKATTEYRKYQTHTLSQVERDYLETIKALETKAKKG
FT                   ESDAPDSDR"
FT   gene            complement(673190..673516)
FT                   /locus_tag="HMPREF0573_10571"
FT   CDS_pept        complement(673190..673516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10571"
FT                   /product="TfoX C-terminal domain protein"
FT                   /note="Pfam: PF04994; InterPro: IPR007077"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10571"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66890"
FT                   /db_xref="InterPro:IPR007077"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJJ1"
FT                   /protein_id="ADI66890.1"
FT                   /translation="MQKLVEGVGPGVLSALRVLLVWRNGALMNDLTDLPNIGPKLAQAL
FT                   IEAGIDTPAKLAEVGSVEAWWRVHPRFTCQHSLLALEGAIQGVPKSLLNQEIRERLRQE
FT                   TLSD"
FT   gene            673802..673939
FT                   /locus_tag="HMPREF0573_10572"
FT   CDS_pept        673802..673939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10572"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66891"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJJ2"
FT                   /protein_id="ADI66891.1"
FT                   /translation="MPTGHCFYAASTVFATAHSRYARCRRAICLIPAGAYFVERATEDF
FT                   "
FT   gene            complement(674104..674177)
FT                   /locus_tag="HMPREF0573_t10014"
FT   tRNA            complement(674104..674177)
FT                   /locus_tag="HMPREF0573_t10014"
FT                   /product="tRNA-Gly"
FT   gene            complement(674361..675173)
FT                   /locus_tag="HMPREF0573_10573"
FT   CDS_pept        complement(674361..675173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10573"
FT                   /product="hydrolase, alpha/beta domain protein"
FT                   /note="Pfam: PF00561; InterPro: IPR000073"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10573"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66892"
FT                   /db_xref="GOA:D6ZJJ3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJJ3"
FT                   /protein_id="ADI66892.1"
FT                   /translation="MRSGSFTTNLGVIRYWVTDAPLAGKPWLVLLPGLTADHRLFARQI
FT                   KYFTGRYNLFVWDAPAHYRSRPFELAFDLDDMARWLGEILDVECIERPVLVGQSLGGYI
FT                   SQAFMGLFPGRAEGFVSIDSAPLQKRFYPDWELAALKRMDAITRYIPWSVLKPWGARGT
FT                   ATTKYGRRLVYRFLETYGEAEYRRLMVFGYGMLARAVEKDRAYRIDCPPLLICGQRDHA
FT                   GDVKTYNRKWSRAIGCPVHWIRGAGHNSNTDRPGEINSLIEGFVGSLQ"
FT   gene            complement(675259..675912)
FT                   /locus_tag="HMPREF0573_10574"
FT   CDS_pept        complement(675259..675912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10574"
FT                   /product="HAD hydrolase, family IA, variant 3"
FT                   /note="COG: COG0637; Pfam: PF00702; InterPro: IPR005834"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10574"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66893"
FT                   /db_xref="GOA:D6ZJJ4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJJ4"
FT                   /protein_id="ADI66893.1"
FT                   /translation="MIKGAIFDCDGTLLDTMPLWREAAGKYLTTLGIEVEKGLGAQFFE
FT                   MTLPESARLVRQRFGLDLTVNEVVNGIKDAVYTGYLEDVQLKPGARGFLEVLSEAGVPM
FT                   TVVSSGSEGLIRPAFRRLGIEEMFAQYFASSETGMHKREPTMFLQAAEAMGSVPEDAWV
FT                   FEDAVYAVRVANAAGFHTVGIADDASLGESDVLAREAEAYWEEFPAAIPDFMLQ"
FT   gene            complement(675909..676550)
FT                   /locus_tag="HMPREF0573_10575"
FT   CDS_pept        complement(675909..676550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10575"
FT                   /product="base excision DNA repair protein, HhH-GPD family"
FT                   /note="COG: COG2231; Pfam: PF00730,PF00633; InterPro:
FT                   IPR003265"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10575"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66894"
FT                   /db_xref="GOA:D6ZJJ5"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJJ5"
FT                   /protein_id="ADI66894.1"
FT                   /translation="MTSAVGQVSGFRELFEILQRNVRDAGKWWPAETKFEILVGSVLTQ
FT                   NTTWTSVEKSLENLRKQGLLNPMRLVGAKSSELETLIRPSGFMRAKAQYLKNLTEWYIK
FT                   TDARAGEIDTPTLRNSLLRVPGVGEETADDILLYAYDRPVFIFDTYARRLLAAAGLGEF
FT                   RTYRQAKQVCDAAWRVEGFTVAELAIFHGLVVQAGKDARREGSWEGILRT"
FT   gene            complement(676570..677364)
FT                   /locus_tag="HMPREF0573_10576"
FT   CDS_pept        complement(676570..677364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10576"
FT                   /product="thiamine diphosphokinase"
FT                   /EC_number="2.7.6.2"
FT                   /note="COG: COG1564; Pfam: PF04263; InterPro: IPR006282"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10576"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66895"
FT                   /db_xref="GOA:D6ZJJ6"
FT                   /db_xref="InterPro:IPR006282"
FT                   /db_xref="InterPro:IPR007371"
FT                   /db_xref="InterPro:IPR007373"
FT                   /db_xref="InterPro:IPR036371"
FT                   /db_xref="InterPro:IPR036759"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJJ6"
FT                   /protein_id="ADI66895.1"
FT                   /translation="MTKMCEYLDDSAKNGAVSVGSRCLVVVGGVQGLRALCADSWDFLT
FT                   YELVICGDSGQDVARTLGINPDVYIGDFDSSPRPAGQTEFADGRTRSPETLAAVPVITP
FT                   SDAVPGDGVEVIVLPVAKEVTDSEAAVDLAYSRGYRHIDVIGGLGGRLDHTLGNLGILA
FT                   KYAHTSARLRWIDGYNMVSLVGPGTHTVPRNDYRYFGLIPFDGDVQGLTLAGTRYLVED
FT                   FTLVRGSTRGVSNEITAQCATVSFTSGRLLMVSSRDLQISGQ"
FT   gene            677477..678388
FT                   /locus_tag="HMPREF0573_10577"
FT   CDS_pept        677477..678388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10577"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="COG: COG1131; Pfam: PF00005; InterPro: IPR003593"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10577"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66896"
FT                   /db_xref="GOA:D6ZJJ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJJ7"
FT                   /protein_id="ADI66896.1"
FT                   /translation="MNTTTTAALQLTHLHKHFGKVHAVDGIELNVPTGTVMALLGPNGA
FT                   GKTTTLDMVLGLSAPTSGEVQVLGESPKTAISRGQIASVLQTGGLLKDMYVSEVVRWIA
FT                   AAYGHDVDTPENRERVISAANLEPIRKRKIGKCSGGEQQRIKFALALLPNPDLLILDEP
FT                   TAGMDANARHDFWEVMHGQAQNGKTIIFATHYLQEAADYADRIVVMNHGKIIADASPAE
FT                   ITAQRTRNVSFQVDSSHLDALTAQIQQHWPQESVEIKGHRMYLSVQKSDDFARFILSQP
FT                   GVSHLEIVPPSMEDTFFTLTSN"
FT   gene            678401..679165
FT                   /locus_tag="HMPREF0573_10578"
FT   CDS_pept        678401..679165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10578"
FT                   /product="ABC-2 type transporter"
FT                   /note="Pfam: PF01061"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10578"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66897"
FT                   /db_xref="GOA:D6ZJJ8"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJJ8"
FT                   /protein_id="ADI66897.1"
FT                   /translation="MNTKIFALDLKRILRSPEVPMFVIGLPVVIYLIFGVAATYAKEMV
FT                   ADTTVNWAWVIMVNIAAYGAILSTASFAAGTSVEKIQGWGRQIALTPLSNGRYLGTKIA
FT                   LGALLAALPVAVIFLLGGLTQAKAEPSAWIISVLVILGGSLTFTLYGLAFGLLLHSDTA
FT                   VSIASGLTTLFAFIANFFMPLGGWLLDFAKFMPGYGYGILARYAGTNGNQITMDGKPYT
FT                   ENLGIGIVNFVVWILIFALLALWGYQRSRRHA"
FT   gene            679162..680376
FT                   /locus_tag="HMPREF0573_10579"
FT   CDS_pept        679162..680376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10579"
FT                   /product="histidine kinase"
FT                   /note="COG: COG4585; Pfam: PF07730,PF02518; InterPro:
FT                   IPR003594"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10579"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66898"
FT                   /db_xref="GOA:D6ZJJ9"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJJ9"
FT                   /protein_id="ADI66898.1"
FT                   /translation="MNPESSPALAIEDRSLTSSPSNSYIFTSTFMSLVWLGFLYFPISR
FT                   ALTLPLGPKIISLVLTAIFALAYVAAFSLSWRKPIMGERNFRYFDGRHRLRKSDAIVFV
FT                   VLVLITLLQVAVLGPLKSLTFLPFIAAAAPFALPQAAGYIAGALTVLASFLIPRFVPNG
FT                   QEYFGLSISTSAVFMFVAGIAFFIGSGIESQRQARTQAILEERERVARDVHDVLGHTLT
FT                   VIALKSELAGKLLERDSGRAQAELHEITNLARESIEEVRQTVAGLKVQSLFEEIAAASQ
FT                   ALESAGIDLQREGTAWSNLDSIPAVNQAIFAWVIREATTNIIRHAAARQVTIEMNRSSL
FT                   TITDNGVGISPDATGHGLEGLKARVEQVGGTLSIVGKREVTSAASAESERQNIPETGTV
FT                   VEVKL"
FT   gene            680373..680978
FT                   /locus_tag="HMPREF0573_10580"
FT   CDS_pept        680373..680978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10580"
FT                   /product="response regulator receiver domain protein"
FT                   /note="COG: COG2197; Pfam: PF00072,PF00196; InterPro:
FT                   IPR001789"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10580"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66899"
FT                   /db_xref="GOA:D6ZJK0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJK0"
FT                   /protein_id="ADI66899.1"
FT                   /translation="MISVVLADDQALVRGAIAALLELEGDIEVVAQASNGRELLDAVQT
FT                   HHPQVAVVDIEMPDLDGIAATQAITETAADTKTLILTTFGRPGYLKRALNAGAKGFMVK
FT                   ETPAEELAAAVRTIAAGGTAVDQKLATESLFEGDNPLTEREIEVLKIAEKGLKVQEIAT
FT                   QVYLSPGTVRNYLSSAISKTHADTSAGAARKARELGWL"
FT   gene            681183..681863
FT                   /locus_tag="HMPREF0573_10581"
FT   CDS_pept        681183..681863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10581"
FT                   /product="methyltransferase domain protein"
FT                   /note="COG: COG0500; Pfam: PF08241; InterPro: IPR013216"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10581"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66900"
FT                   /db_xref="GOA:D6ZJK1"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJK1"
FT                   /protein_id="ADI66900.1"
FT                   /translation="MLQAADIPGKRVVEFAPGLGKTAKIIIDAPVESYTGVDKDPDAAQ
FT                   RVQNIVADSGGRVVQADAQDTGLESQSAQVVVGEAMLTMQSEKNKEKIVSEAYRILEPG
FT                   GCYAIHELGLTPNDIDMQLADELRKRLAQVIRANARPLTENEWRKVLENAGFIIEWVGF
FT                   EPMASLSPRRNLADEGLKGVLRILGNVLRDRELRARILEMRATFKHYRKNLTGIAITAR
FT                   KPSK"
FT   gene            681889..682239
FT                   /locus_tag="HMPREF0573_10582"
FT   CDS_pept        681889..682239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10582"
FT                   /product="cupin domain protein"
FT                   /note="Pfam: PF07883"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10582"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66901"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJK2"
FT                   /protein_id="ADI66901.1"
FT                   /translation="MDSKEESVTTDLGYIDNLAEQIEYSPNSTVSKTLMRAEGVNVVLF
FT                   SFDSGEELSEHTAAMPVIVQTLEGEIEITADGKTVKLLPGGMVHFSTRLPHAVKALTPA
FT                   KMVLYMLSEQGK"
FT   gene            complement(682295..683272)
FT                   /locus_tag="HMPREF0573_10583"
FT   CDS_pept        complement(682295..683272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10583"
FT                   /product="SPFH/Band 7/PHB domain protein"
FT                   /note="COG: COG0330; Pfam: PF01145; InterPro: IPR001107"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10583"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66902"
FT                   /db_xref="GOA:D6ZJK3"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJK3"
FT                   /protein_id="ADI66902.1"
FT                   /translation="MGAFLALFENVLTLAVIVVIVLALLIIGGMFFVVKQQTNYVIERF
FT                   GKYHKVALPGLRMKIPFVDRIAKKVPLRIMQLDSVVETKTKDNVFVTIPVSVQYQVQNV
FT                   VDSFYRLANPERQIQSYVYDRVRTSLAKLDLDEAFSSKDQIAQDVETTLAAAMNAYGFA
FT                   IINTLVTDINPDPTVRASMNSINAAQREREAAVSLAEAEKIKTVKQAEADAEYKRLQGE
FT                   GIAAQRKAIVDGLVSQYEALRDAGIGAEAQEMLLLTQYFDTLQEVAKASNTQTLMLPSN
FT                   PGGVSNAMEELRNSLFAATRAADQKPKTAVPPRSRTVPTTSAQQ"
FT   gene            complement(683326..684738)
FT                   /locus_tag="HMPREF0573_10584"
FT   CDS_pept        complement(683326..684738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10584"
FT                   /product="transporter, major facilitator family protein"
FT                   /note="Pfam: PF07690; InterPro: IPR011701"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10584"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66903"
FT                   /db_xref="GOA:D6ZJK4"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJK4"
FT                   /protein_id="ADI66903.1"
FT                   /translation="MDSVEATGRNEKSSENQGNNYLSGYLAAWFKIIATGMITLVAFEA
FT                   IAVNTAMPFIVDRLDGKNLFALAAGISMSTQLITTALAGTWVDTRGPKPVIYVGIAAFT
FT                   GGLLVASFAPNIWFVVVGRAVQGLGGGLLIVPLYVMVGSYVLPHKQPAFFAVFAIAWVV
FT                   PSLVGPLVAGFLVDYVHWRFVFGICPILFLVFFPLLWPKFRQFPQLHDPVPFRPSPRLL
FT                   WGSIFSGILIGTLQVISGVERETVSPIFIVAALTLTLALFFAARPILPSGTFRAVRGVP
FT                   ATVAMRGLLNGTFVTVDLYLPLLLKEIHGWGPTMAGLSMTVSSITWAFSSWIQGRIVDP
FT                   AHRRWLIFIGPIIEIFGTLVVLLAVVPGFSPWFVLVGWAIAGSGQGLIFPLATVHALSL
FT                   TPAQRHGEVSAALNVADTLAAAALVAYGGITYATTLFLGPWAFAATIGLMVVMMFVQFW
FT                   VGTRIFESSSHK"
FT   gene            complement(684943..685887)
FT                   /locus_tag="HMPREF0573_10585"
FT   CDS_pept        complement(684943..685887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10585"
FT                   /product="kinase, PfkB family"
FT                   /note="Pfam: PF00294; InterPro: IPR011611"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10585"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66904"
FT                   /db_xref="GOA:D6ZJK5"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJK5"
FT                   /protein_id="ADI66904.1"
FT                   /translation="MSSDELGDSLETQFENGGAICFIGEPVLDIYINLDHWPKLGDKAC
FT                   LLSQETLPGGTVANMAVNASWLGLKTRMIGCLKSGEISDQLIKDLNEHGVNTDFISLTT
FT                   DAPDPVCYVFLTEGSNVAAYPDRSREKLFLDQESLETISKSRVVCSTPEKLRRICNHDD
FT                   FLQSIRKVKRSGGHLVLDIDTGAEFDAKHPLETEASIVIMNEFGAERLFGMNWEQLSSR
FT                   LPDQSPDIKSVFTCPDITLFVTGSEKGVWTYRDGWRLWEVTPAPVVDPTGAGDAFVAGI
FT                   VTGIAQGYSFERCVLQALDCGKQAVGIKGARLR"
FT   gene            complement(685877..686380)
FT                   /locus_tag="HMPREF0573_10586"
FT   CDS_pept        complement(685877..686380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10586"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10586"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66905"
FT                   /db_xref="GOA:D6ZJK6"
FT                   /db_xref="InterPro:IPR007247"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR024060"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJK6"
FT                   /protein_id="ADI66905.1"
FT                   /translation="MSKRLVVGKDDVSKWGIALLFSPGSDSVVVTNGDGWHDFKSAAKI
FT                   SDGAVNLAMTQVSVLPKRIERMERHDHTKETLCPTNHSIVLGVCAKEFDVPETDQCVLL
FT                   EIPCGTALVMDKGTWHSPCFGVSEPTQYYWIATSDPRFPSEWIPLAGGSLETYMETESD
FT                   SDVL"
FT   gene            complement(686382..687140)
FT                   /locus_tag="HMPREF0573_10587"
FT   CDS_pept        complement(686382..687140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10587"
FT                   /product="membrane complex biogenesis protein, BtpA family"
FT                   /note="Pfam: PF03437; InterPro: IPR005137"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10587"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66906"
FT                   /db_xref="GOA:D6ZJK7"
FT                   /db_xref="InterPro:IPR005137"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJK7"
FT                   /protein_id="ADI66906.1"
FT                   /translation="MMQTKQNLLGNWPGNGEKLLLGMIHLKGNEIDDIYSRAVRECDIY
FT                   ARGGFDGVIVENYFGTIDDVRYCLPRLQDKFPQLYVGVDVIWDNDKSFDLAVEHQLPFI
FT                   ELDSLAGQLPPQEEPQFEERIRWCQENSPAVILGGVRLKNQPVLSGNPLEVDLMLAKKR
FT                   GDGVIVTGVDTGVETELSKIIQFREIIGDFPLLVGAGVNEKNCTEQLTIADGAIIGSSL
FT                   KQGGNAKGDLEMDRVERLVTAVRALRGKVK"
FT   gene            complement(687170..687988)
FT                   /locus_tag="HMPREF0573_10588"
FT   CDS_pept        complement(687170..687988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10588"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="COG: COG1122; Pfam: PF00005; InterPro: IPR003593"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10588"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66907"
FT                   /db_xref="GOA:D6ZJK8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJK8"
FT                   /protein_id="ADI66907.1"
FT                   /translation="MAMINCDHVEYCYPGGTRALTSVSLKIECGECVALIGQNGAGKST
FT                   LSKLLNGLIRPTSGTIYLEGQDTSNYRTDEIAQRVGYVFQNPDDQIFSKTVHEECEYAL
FT                   KRLGVEQTEREERITQALSVCNLLEEAETNPLDLPLAQRKFVAIAAVLAMDPNYVILDE
FT                   PTAGLDELGRRDLVAIMQWASNAGKSVIAVSHDMRFVIENFPRVVVMSQGGIISDNSVA
FT                   DAFSNDQVLAEAKLTVPPAVQISRHAGAPKELLQMDQIFNWCKDFLYRKS"
FT   gene            complement(687979..688815)
FT                   /locus_tag="HMPREF0573_10589"
FT   CDS_pept        complement(687979..688815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10589"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="COG: COG1122; Pfam: PF00005; InterPro: IPR003593"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10589"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66908"
FT                   /db_xref="GOA:D6ZJK9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJK9"
FT                   /protein_id="ADI66908.1"
FT                   /translation="MAIKTTQVAVKHPLAKTWALEDINLNLESGKVYGLMGANGSGKTT
FT                   LCNTLKGLIPGVLGGEVKGKIEIFGKDLNGLSQRELVETIALVFENPYTQLTGTCQTVV
FT                   EEIAFGLENLGWERERIIEQTARVICDMDLQDLAFRDPLELSGGQRQRVSVAAVMAMDT
FT                   PVIVIDEPTSQLDPATTEMIFAAITKMKDAGKTVLLCENKIDQLVEIADEIIILDNGRV
FT                   YTAGQPGEVLSRAKSDGLHCGFPELFTLSSGLNVSPRWITFAQAKASVNTYVEEWQ"
FT   gene            complement(688815..689621)
FT                   /locus_tag="HMPREF0573_10590"
FT   CDS_pept        complement(688815..689621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10590"
FT                   /product="cobalt transport protein"
FT                   /note="Pfam: PF02361"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10590"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66909"
FT                   /db_xref="GOA:D6ZJL0"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJL0"
FT                   /protein_id="ADI66909.1"
FT                   /translation="MAQVEEISNDIRRFVFHPRKTHRYQHINPVVRFLIPLVLMAGVLA
FT                   SGDPLTFYIFTGLNIAAAAALQVLILFWSRFWKIALTVSIFTLGVRAFFEYGDHVVFNV
FT                   GPLAVTQEGLASANWYVAMLLAVCAPLVLLTSILSLQDLSHALELLGARRQVCYVVINS
FT                   ARLIPELATRGKAVRDAQRSRGIQVEGSRLVKLKAVLPTIAPLVLSALSSVEERAVAME
FT                   VRGASITEIKGTRLIPQDKISGFGYLGIFVAALLSVFIGIGGRLLW"
FT   gene            complement(689630..690229)
FT                   /locus_tag="HMPREF0573_10591"
FT   CDS_pept        complement(689630..690229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10591"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10591"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66910"
FT                   /db_xref="GOA:D6ZJL1"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJL1"
FT                   /protein_id="ADI66910.1"
FT                   /translation="MNKMTIYLIPVAIALNIVVSQIVFALKLPIWLDSIGVVLTAVICG
FT                   FWPATIVGVLTGAASLITNPSNIFYIPLFVVTAGVAALLARKHGYSSFLRSLLSGILNG
FT                   LATGITGSLITIMVYGGLSSTGTGIIAGLLRQVGAPNWTAAMAAGVSGDITDKVLTALI
FT                   VFYILIALPQRTLAKFPRGEAYLLTREKKQSDKDSE"
FT   gene            complement(690222..690977)
FT                   /locus_tag="HMPREF0573_10592"
FT   CDS_pept        complement(690222..690977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10592"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="COG: COG2188; Pfam: PF00392,PF07702; InterPro:
FT                   IPR011663"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10592"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66911"
FT                   /db_xref="GOA:D6ZJL2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJL2"
FT                   /protein_id="ADI66911.1"
FT                   /translation="MVNTSPPVYEQIAEVIRRQIHDGDYLVGDKLPSENELCEIHKVAR
FT                   GTIRRAINGLIAEGLLESEKGKGTFVTSPESKTLLWNFGSLTDRLNDTSERALAKVLEQ
FT                   TVVIRGNRKMLRLKRLRSIETENTVIPISLDISFLPVDLLPGIEKYDFEDESIYRILRE
FT                   KYNRNPTQSLVSLKARIADQGTKRILKELPSTRCLLHATGATYDNVHVCIEESEITYSS
FT                   RVQAVMHIDHHNGYTKPLQMTKELHHVHE"
FT   gene            complement(691287..692099)
FT                   /locus_tag="HMPREF0573_10593"
FT   CDS_pept        complement(691287..692099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10593"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10593"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66912"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJL3"
FT                   /protein_id="ADI66912.1"
FT                   /translation="MGLFSKSRPDTNGPVRPYLKSFAGWEAPSTFATVEDSLELQDDFA
FT                   ALFAEYNVDDIHGAEFDDWAYLVRDRNNSDDYAAVCVWVKGHFVGYLDHATAGKYVVEL
FT                   NGLDSQELNLVVPCHLWAQRTKSRLANRVTLSLPPVGGVGPVNQFPKKAFTILPPGEEI
FT                   PLEDYDDHIAPLHPYISTGKTVPVALWMQEDKTGLGAYLDKKTYIGRVPDRAAELIAPL
FT                   VRIAVAHKLIPIARGMLTGSNIRNDLTIVTGDTRTVGSHWNPTHDGGK"
FT   gene            complement(692260..692865)
FT                   /locus_tag="HMPREF0573_10594"
FT   CDS_pept        complement(692260..692865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10594"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10594"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66913"
FT                   /db_xref="GOA:D6ZJL4"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJL4"
FT                   /protein_id="ADI66913.1"
FT                   /translation="MPRIEAKDLIGQGDSKEIRIKRRRRTLARQTVIFGWIVLAMAAVL
FT                   VVSLPFAMGLVSLPFGNSFVLSEEAKAKAPPCTPKGKPVSLKGVTVNIFNGSSQNGLAT
FT                   QTAQRLKEFGVKVNVVGNSPDSYAGAARINTSKKNIAKAFSLARALPEADVRIDLNRGA
FT                   EINILLGEQFQGALAMDNLSDGDLGPYPQAPKNCQELD"
FT   gene            complement(692852..694276)
FT                   /locus_tag="HMPREF0573_10595"
FT   CDS_pept        complement(692852..694276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10595"
FT                   /product="putative permease"
FT                   /note="COG: COG2233; Pfam: PF00860; InterPro: IPR006042"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10595"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66914"
FT                   /db_xref="GOA:D6ZJL5"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJL5"
FT                   /protein_id="ADI66914.1"
FT                   /translation="MSETKTSNFKWKLHGDGKRISTGEVVQPNERLTWPRTIGIGAQHI
FT                   VAMFGATFLVPLLTGFSPATTLFFTGLGTILFILITSGRLPSYLGSSFALIAPIGAVTG
FT                   YVSGGGAPIDSDKMALAQGGVISAGALLLLVGVLVHFAGAAWIDRIMPPIVTGAIVSLI
FT                   GFNLAPSAWNNVKQAPVTATVTILSVLLITVLFKGIIGRLSILIGVLIGYATAVIRHEV
FT                   NFEAISKADWVGFPSFHAPTFSPALLGLFLPVVLVLIAENVGHVKSVSAMTGQNLDDLT
FT                   GRALIADGLSTMIAGSGGGSGTTTYAENIGVMAATRVYSTVAYIVAAIGALALSMLPKF
FT                   GEIIATIPPGVLGGAATILYGMIGMLGVRIWVQNQVDFADPVNLNTAAVAMVMAIANYT
FT                   LVVGDVKFEGIAMGSFGAIVMYHVMRAISNLRGTKLEQASPASAPAGTELHSEAYSKRH
FT                   ADQEIRAAQGRSDAQN"
FT   gene            694372..694728
FT                   /locus_tag="HMPREF0573_10596"
FT   CDS_pept        694372..694728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10596"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10596"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66915"
FT                   /db_xref="GOA:D6ZJL6"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJL6"
FT                   /protein_id="ADI66915.1"
FT                   /translation="MSDAYVSDFPDLEKVNPQEVFSQPGYTDSAQKIPGVVITLFVVSL
FT                   ISFLVPVFLSIAALIVAVLAGGLLRVRTLSSEHQPGDGLLRAAFGLSFLSIGWGTVWFL
FT                   AWVITKVTVTVVPF"
FT   gene            complement(694793..696265)
FT                   /locus_tag="HMPREF0573_10597"
FT   CDS_pept        complement(694793..696265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10597"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10597"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66916"
FT                   /db_xref="GOA:D6ZJL7"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJL7"
FT                   /protein_id="ADI66916.1"
FT                   /translation="MTGVNVPGSGQGGRPAPKPANANPNLVSLGDTPSGAVPLDSVAVP
FT                   LDSQAIPPQGYAGAPNNGNLVSLGEGMGGAVPLNGAGDFYSNQTVPLNGEPSGMDGVMG
FT                   MPPATPMGMPAHDPNSQPLDPNAYAGYGYGNSNMVQPPYSGGQMPVSDGSGYPDYSGYP
FT                   VQNPPNAPGQFGAFPMQPTGYPPMGAPAPQYEPEPMDPRLVAQRAEEQHPDLQDIRTRV
FT                   PFNMPTLGSDQSAVVGRASRRKKRDSGQKENKSEGVLGNLTLPGDPNAGLSLKELLGQP
FT                   VSNMAAATILSPKEIEDSDGLQMRAVGLAVGAVPEVDARYEIPYIAREHPSYYTGYEIS
FT                   LIMESIRDPEHARQVLARIVAIPRWIRWVISLFGGVCGAAVSALNAFLSLLAFTVLMSI
FT                   VLLFTYSFASRIGSGRFYDPTGYKVIWLGSFMPIGLLSAIIVARSMVGQPWLAFIAFVI
FT                   TTICGIVWTTWIQSFQVRRLLSSEIPDEPADE"
FT   gene            696598..696681
FT                   /locus_tag="HMPREF0573_t10015"
FT   tRNA            696598..696681
FT                   /locus_tag="HMPREF0573_t10015"
FT                   /product="tRNA-Leu"
FT   gene            696807..697637
FT                   /locus_tag="HMPREF0573_10598"
FT   CDS_pept        696807..697637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10598"
FT                   /product="NLPA lipoprotein"
FT                   /note="COG: COG1464; Pfam: PF03180; InterPro: IPR004872"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10598"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66917"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJL8"
FT                   /protein_id="ADI66917.1"
FT                   /translation="MNKFMARAVAVLGASALAISLTACGGGGTSDANVLTVGASPTPHA
FT                   KILQYLQDSGAAKKAGITIKVQEFSDYIQPNEALKSGDIDANYYQTVPYLEEQSASRGY
FT                   KFTAGKGIHLEPMGIFSSKIKSLDELKDGAKIAIINDPSNQARQLKLLEDNNLLQLKGI
FT                   KDLSVVNVKAKPDANPHGFQFTEVDGASEPSLLPDVDIAVINGNFAQGGGLNPADALVL
FT                   EDPKDNPAVNVLVWRADEKKKLEAIKKLDELLHSDVTKKYIEDTWKDRSVIPAF"
FT   gene            complement(697711..698346)
FT                   /gene="upp"
FT                   /locus_tag="HMPREF0573_10599"
FT   CDS_pept        complement(697711..698346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="upp"
FT                   /locus_tag="HMPREF0573_10599"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="COG: COG0035; Pfam: PF00156; InterPro: IPR005765"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10599"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66918"
FT                   /db_xref="GOA:D6ZJL9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJL9"
FT                   /protein_id="ADI66918.1"
FT                   /translation="MHLYVADHPLINHKLTLLRDKNTPSPMFRQLVDELTTLLAYESTH
FT                   NVRVETIDVETPLTKTQGQILADPRPIVIPILRAGLGMLEGMTRLLPTAEVGFLGMKRD
FT                   EETLAIETYANRLPSDLSGRQCFIVDPMLATGGTLVAAINYVLERGARDVTCTCILAAP
FT                   EGIKVVTDAVGDRADVSVVVAGVDDHLNDDAYIVPGLGDAGDRLYGLV"
FT   gene            698414..698956
FT                   /locus_tag="HMPREF0573_10600"
FT   CDS_pept        698414..698956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10600"
FT                   /product="cytidine and deoxycytidylate deaminase
FT                   zinc-binding region"
FT                   /note="COG: COG0590; Pfam: PF00383; InterPro: IPR002125"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10600"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66919"
FT                   /db_xref="GOA:D6ZJM0"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJM0"
FT                   /protein_id="ADI66919.1"
FT                   /translation="MVFSNISPVPNRSDDFLVNSQGGGAAYGLSSAEVRALDTAYGLAQ
FT                   KAGRAGDIPVGAVVLTPEGIVAGLGLNQRENPPYDPSAHAEIVALREAAGRLERWNLKG
FT                   CTLVATLEPCTMCAGAIVNARISRLIFGAWDPKAGACGSIRDVVRDSRLNHQVEVKGGV
FT                   DEPRIKALLKAFFGERR"
FT   gene            complement(699042..699129)
FT                   /locus_tag="HMPREF0573_t10016"
FT   tRNA            complement(699042..699129)
FT                   /locus_tag="HMPREF0573_t10016"
FT                   /product="tRNA-Ser"
FT   gene            699165..699311
FT                   /locus_tag="HMPREF0573_10601"
FT   CDS_pept        699165..699311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10601"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10601"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66920"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJM1"
FT                   /protein_id="ADI66920.1"
FT                   /translation="MKLRAKSSRVSRTLIRGAANVQTDRFNLPIELQTLQFLEFFTAPQ
FT                   HPR"
FT   gene            699433..700197
FT                   /gene="mtnN"
FT                   /locus_tag="HMPREF0573_10602"
FT   CDS_pept        699433..700197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtnN"
FT                   /locus_tag="HMPREF0573_10602"
FT                   /product="MTA/SAH nucleosidase"
FT                   /EC_number="3.2.2.9"
FT                   /EC_number="3.2.2.16"
FT                   /note="COG: COG0775; Pfam: PF01048; InterPro: IPR010049"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10602"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66921"
FT                   /db_xref="GOA:D6ZJM2"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJM2"
FT                   /protein_id="ADI66921.1"
FT                   /translation="MSVDRDLNLPLPPARIPVLAIITAAMEDEAAPLWDLAKGGGNLVR
FT                   LGAKGSLQLLQIEDATVALLTTGIGLVNAASSLAAALAYVSPRYIFSCGSAGGLDANSQ
FT                   VRDVVAASSCLFSTADAREFGYALGQIPGMPERYLADGDLLGRFHALPTRLAGSRTRSG
FT                   EFLSADQFVGTETALQLRESYPEAITVDMESAALAQVAYGVEVPFLAIRGISDLCGPEA
FT                   AAENYSRAGDVARLSFLVALCLLGLREPEEVM"
FT   gene            complement(700232..700699)
FT                   /gene="luxS"
FT                   /locus_tag="HMPREF0573_10603"
FT   CDS_pept        complement(700232..700699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="luxS"
FT                   /locus_tag="HMPREF0573_10603"
FT                   /product="S-ribosylhomocysteinase LuxS"
FT                   /EC_number="4.4.1.21"
FT                   /note="COG: COG1854; Pfam: PF02664; InterPro: IPR003815"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10603"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66922"
FT                   /db_xref="GOA:D6ZJM3"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR037005"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJM3"
FT                   /protein_id="ADI66922.1"
FT                   /translation="MEIEKTNVESFQLDHTKVKAPFVRVAHQETLPGGDEFIKYDVRFC
FT                   QPNVEHLDMPVVHSLEHSMAEHMRDHTDKLLDFSPMGCQTGFYAMTLGIQPEEFMSILQ
FT                   ATLVDIVNMNEVPAANEVQCGWGKSHSLAGAQAAAQKMLDHREEWGRIYSH"
FT   gene            701067..701312
FT                   /locus_tag="HMPREF0573_10604"
FT   CDS_pept        701067..701312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10604"
FT                   /product="glutaredoxin"
FT                   /note="COG: COG0695; Pfam: PF00462; InterPro: IPR012335"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10604"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66923"
FT                   /db_xref="GOA:D6ZJM4"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011909"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJM4"
FT                   /protein_id="ADI66923.1"
FT                   /translation="MSITLYTKPNCVQCNATKRALDKQGLDYETVDLTEDVNALDHIKS
FT                   LGFQQAPVVFAGDDAWSGFRPDKIKALAVTALAAAI"
FT   gene            complement(701458..701580)
FT                   /locus_tag="HMPREF0573_10605"
FT   CDS_pept        complement(701458..701580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10605"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10605"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66924"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJM5"
FT                   /protein_id="ADI66924.1"
FT                   /translation="MSTYSSSTSKGSVPGRIGIRNAGTPTRSTNRLVFSVAEEK"
FT   gene            701579..701890
FT                   /locus_tag="HMPREF0573_10606"
FT   CDS_pept        701579..701890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10606"
FT                   /product="putative nrdI protein"
FT                   /note="COG: COG1780; Pfam: PF07972; InterPro: IPR004465"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10606"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66925"
FT                   /db_xref="GOA:D6ZJM6"
FT                   /db_xref="InterPro:IPR004465"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJM6"
FT                   /protein_id="ADI66925.1"
FT                   /translation="MVPSYGGGDISKAVPKQVIKFLNIEHNRNLCRGVISSGNTNFGEA
FT                   YCIAGKVLSNKLKVPFLYKFELLGTPEDVTAVRKGLEEFWANLHSQQADLDSPASPES"
FT   gene            701887..704031
FT                   /locus_tag="HMPREF0573_10607"
FT   CDS_pept        701887..704031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10607"
FT                   /product="ribonucleoside-diphosphate reductase, alpha
FT                   subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="COG: COG0209; Pfam: PF08343,PF00317,PF02867;
FT                   InterPro: IPR013346"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10607"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66926"
FT                   /db_xref="GOA:D6ZJM7"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR013554"
FT                   /db_xref="InterPro:IPR026459"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJM7"
FT                   /protein_id="ADI66926.1"
FT                   /translation="MTDTQEDEFLDAEHDYHSLNAKLNLYGEDGKIQFDADREAARQYF
FT                   LQHVNKNTVFFHDLREKLDYLVEEGYYEEDTLKQYSFKFIKSLYEKAYSHKFRFPTFLG
FT                   AFKYYTSYTLKTFDGKRYLERFEDRVCMVALYLARGDEQLAVDIMEEIIAGRYQPATPT
FT                   FLNAGKKARGEMVSCFLVRLEDNMESIARGINSALQLSKRGGGVALLLTNLREAGAPIK
FT                   KIQNQSSGVVPVMKLLEDSFSYANQLGARQGAGAVYISAFHPDIMSFLDTKRENADEKI
FT                   RIKTLSLGVMVPDITFELARNKEPMYLFSPYDVERVYGVPFSDISVTEKYREMVDNPNI
FT                   RKKKIDARKFFQTLAEIQFESGYPYIVFEDTVNRANPIDGRIIMSNLCSEILQVSEPSV
FT                   LNEDLSYAKVGKDISCNLGSMNIAKALESPDFAKSINVAIRALTAVSDLTNVGCVPTIQ
FT                   RGNSMSHAIGLGAMNLHGCLAKNQIFYGSDEGLDFTNMYFYATAFYALKASHALAVERG
FT                   VTFEGFERSQYASGEYFEKYLQGDWTPRTAKVRELFEKSSIHLPTPEDWRALAADIKRD
FT                   GLYNQNLQAIPPTGSISYINNSTSSIHPIASKIEIRKEGKIGRVYYPAPYMTNDNLDYY
FT                   QDAYEIGYEKIIDTYAEATKHVDQGLSLTLFFPDTITTRDVNKAQIYAWRKGIKSLYYI
FT                   RLRQAALEGTEVQGCVSCML"
FT   gene            complement(704126..705031)
FT                   /locus_tag="HMPREF0573_10608"
FT   CDS_pept        complement(704126..705031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10608"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10608"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66927"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJM8"
FT                   /protein_id="ADI66927.1"
FT                   /translation="MEDSDLIRLATQLPVSQLGDQLLHLQPGSRLGLYLLELSNQSITP
FT                   AMVATAEQALNRPLAWILSQLRKSCAGLDMQDFVELVQHPGPDLLDFVLPGDASLPDRS
FT                   DGADLAAGEYISSAVSPQSPRREQDNLVQIKAARPHPSLDANHLPDEFVDALSSSLQAY
FT                   FLMAVKSKLINLVGSQVMLSLMGIRQLRSPQPILPMVAFALSDSDEDEFFLRLIIGALA
FT                   QAFASCDWAESTDPRMVAVDLLHEMGQDATPEAVGEAVEVFNNFLFSAGCLNSRGEVDL
FT                   RAHTPIVLLQYLVSEALQPK"
FT   gene            705238..706206
FT                   /locus_tag="HMPREF0573_10609"
FT   CDS_pept        705238..706206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10609"
FT                   /product="ribonucleoside-diphosphate reductase, beta
FT                   subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="COG: COG0208; Pfam: PF00268; InterPro: IPR000358"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10609"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66928"
FT                   /db_xref="GOA:D6ZJM9"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR026494"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJM9"
FT                   /protein_id="ADI66928.1"
FT                   /translation="MVIGIPKTVQAINWNDIEDDKDLEVWDRLTGNFWLPEKIPLSNDI
FT                   PSWKTLNEDEKNMTNRVFTGLTLLDTIQGTVGAVSLIPDSRTPHEEAVYTNIAFMESVH
FT                   AKSYSSVFSTLLSTEEIKESFRWSEENEYLQKKAHIVLDYYHGNDSEKRKVASTMLESF
FT                   LFYSGFYAPMYWSAHAKLTNTADLIRLIIRDEAVHGYYIGYKYQLAMRESSESRRQEMK
FT                   DYTFSLLMDLYDNEELYTETLYDPLGLTEDVKKFLKYNANKALMNLGYEALFTADQVNV
FT                   NPAILAALSPAADENHDFFSGSGSSYAIGTAEETEDEDWEF"
FT   gene            706397..707146
FT                   /locus_tag="HMPREF0573_10610"
FT   CDS_pept        706397..707146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10610"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66929"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJN0"
FT                   /protein_id="ADI66929.1"
FT                   /translation="MSRQIILSQEAVEAGLWYVLSLRYQDEIDRELKRFPADMIEYWAA
FT                   KLKIDSRMKTELAQVLADECEVVKTQQVTDKELGAEKESYIFPSLDEVWPRIVLAKKRA
FT                   RDHQETTIPAAVYERLRTQDITSRGVYSSQGMVRWPPTCQTITKRCGGSWNEALRNMGL
FT                   MTSKRGRSRGSLKFTDETYLRAGAEFLTHCHDTGKGATVAYYCQWVARERRAGRIWPSA
FT                   AAQRQLRGTWNHVMELADRMVKSKTFS"
FT   gene            707143..709104
FT                   /locus_tag="HMPREF0573_10611"
FT   CDS_pept        707143..709104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10611"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10611"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66930"
FT                   /db_xref="GOA:D6ZJN1"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJN1"
FT                   /protein_id="ADI66930.1"
FT                   /translation="MRFSARKGILVVASLFFRFHWEAKVKKLHGERHLFRLLGGTCLAV
FT                   SALAGLVFAGSGLSPAYGQDSDTTPTVESEPTSAVVGFNPGMIISDEVFYNPNTMDPNA
FT                   IQQFLNTQGRACVPGVDTVPGPNGGPQPVTVVCLKDYVESTPDRPADAYCRAAYQGAVG
FT                   ESAAQIIWKVSQACQVNPQVLLVTLQKEQGLLTRSGKSLKLSNYQKAMGYGCPDTAPCN
FT                   TQYYGFFNQLYRAAHRFHYYQHHPEKFRHRAGRVNNLLYHPSRNSDGSYKCGTTPVFIE
FT                   NQATAGLYNYTPYTPNAAALAAGGGLGDKCSSYGNRNFYRFFTSWFGSTGSASAIPSLR
FT                   ISGADRTETAVGISARAFAGGSDRVYLARSDKPIDALAGGILTDGPVLLVPVDRPLPAA
FT                   LTAEINRLQAKTVVALGGPGAIPDEVLAAAAQGRETSRIYGPDRYATAIAISHQAFPQG
FT                   AKRIYIADGVGSDGTGSPDAVVGGTLSDGPVLMVNPSDPETWKYVASEVSDLHISEVVG
FT                   LGGLGALPQEALTTIAAESGASVSRLAGADRYGTAATIAAYAYPAIARQDKAGSPISSD
FT                   YVAYIARGDNFADALVAGALRDGPVLLVPSRTNQAPAPVANYLGSLHPNTIIALGGLGA
FT                   VHPDTVDAVVAATKSGLH"
FT   gene            complement(709138..709806)
FT                   /locus_tag="HMPREF0573_10612"
FT   CDS_pept        complement(709138..709806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10612"
FT                   /product="putative fructose transport system kinase"
FT                   /note="COG: COG1072"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10612"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66931"
FT                   /db_xref="GOA:D6ZJN2"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJN2"
FT                   /protein_id="ADI66931.1"
FT                   /translation="MVQTFSGTLDELLSDLATELKDLSDNGRVLRMVGFTGAPGVGKSE
FT                   AVTRLTQLLNGYVRGTQPLLAGIIPMDGFHKSNEVLQAEGLSEYKGRPDTFDVVGYLMA
FT                   LDRAHDAKTVVYAPGYDRQLGQAVAARYKVEREGVVLTEGNYLALQDGAWSLVREAIDL
FT                   LIYLDVPPEVTQTRLVARHTQHGRTPEQALAWVQRVDEPNRLLVQSSKSRADRVWNLSE
FT                   "
FT   gene            710017..710832
FT                   /locus_tag="HMPREF0573_10613"
FT   CDS_pept        710017..710832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10613"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10613"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66932"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJN3"
FT                   /protein_id="ADI66932.1"
FT                   /translation="MGIALIALGLGGALTAAGIHFFANTAQPTTPTATGPVAPALNLSG
FT                   FDPGNIISDTVFYDYQSMTQADIENFIRNQNAGCVSLSAPCLADYTEDTMDIPASPRCE
FT                   GYQGAPGESAGAIIYKTAQSCKINPQVLLVLLQKEQGLLTASDERLSPRSYEVATGFAC
FT                   PDGADCDPQYFGFGTQVYYAAAQFQRYRQNPAQFPFHTGITNDIPYSPQASCGSAPVVL
FT                   ANQATAALYNYTPYQPDADLLSGNPGECSSYGNANFYSLFKGWFGDSRR"
FT   gene            complement(710916..714743)
FT                   /gene="hrpA"
FT                   /locus_tag="HMPREF0573_10614"
FT   CDS_pept        complement(710916..714743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrpA"
FT                   /locus_tag="HMPREF0573_10614"
FT                   /product="ATP-dependent helicase HrpA"
FT                   /note="COG: COG1643; Pfam: PF00271,PF04408,PF07717;
FT                   InterPro: IPR010222"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10614"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66933"
FT                   /db_xref="GOA:D6ZJN4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010222"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJN4"
FT                   /protein_id="ADI66933.1"
FT                   /translation="MSLELSYPSDLPLSEARPRILAALRQHQVVVISGATGSGKTTQLP
FT                   KMCLEVGRGTRGMIGHTQPRRLAARTVASRIASELGQSLGSTVGYQVRFRQTLGPETQI
FT                   KLMTDGILLAEISHDPLLKQYDALIIDEAHERSLNIDFILGYLQRLVVKRPDLLVIITS
FT                   ATIDSERFATAFGPDTPIIEVAGRTYPVEVRYRPLVDIDDGESGAGDDSEETSVITEPG
FT                   EIDQVTGILRAVDELCREGPGDILVFLAGERDIRDTAQALQGHLGRRYVAPGQRTSVPG
FT                   AVEVLPLYSRLSETEQKRVFAPHPYRRIVLATNVAETSLTVPGIIYVVDPGVARISRYS
FT                   NKTRVQRLPIEPISQASANQRKGRCGRVAPGVCIRLYSEADFLSRPAYTEPEIQRTSLS
FT                   SVILQMAALGLGEVADFPFLDPPSPRSITDGVTELSQLGALDTRQKPARLTRLGRKLSR
FT                   FPLDPRLARILVEADHLGVIDLAVVVVAALAMQDVRERPTERKTEADLAHARFEDERSD
FT                   FLGYLKLWSYLQDRIEMLSASAFRRLCSREFFHFLRVREWIDLVAELRGMCREVGIKTQ
FT                   EITEINLDQVDVERLHQAILSGMLTQIGFWSETKREYRGAHGTRFVVWPGSGLSRKHYD
FT                   WVMAAELVETSRLFARTVAKVEPEWIERAGRHLLTRTYFDSYWSTRFGCAMIHERVSLF
FT                   GMVLSADRSLPLASLRDTVVEGTPARTLARELFIRHGIVRGEWRSVYPFRQENQRRLEM
FT                   AAEARRRRQIPGEVDPYSLEKWLETRIDPAVTSGATFEAWWKDQRLKHPDWLEYPWDLL
FT                   VPDNGENAEQFPDFWQAGEHLLPLAYTFSGKRGPTPEVANRRNASGSKGKKSHKTTERE
FT                   IDTVDLPEGVTIIIDEAILESVNSQGFDWPIPGSLRDYLLACVKALPKAVRKYVVPAAN
FT                   FVDEILPSFEQFVNEPPQERPIFDEIFAQGVTAFRHVDLTETDLVAMHAAMEESQRNHF
FT                   AIVGRGGKVLALGDDFQALRDRLIVKTTQEQSKVWAQQEAEKAKVERPRDFAQQLSQAL
FT                   CLTETRVSTRWRGAEAAALAASPYPSTSALIAAAQSAAGRALVEEYLAEGHSLTDDTDL
FT                   AKLREWAIDRYEDQVYRILQAVVSAMQAQGELEQQLRNATGPSLTATKADIVNHVNQLV
FT                   GGDFLARTPAKWLPQLARYLRADTLRLDKARRNSAGDTQLAARFAEVTTAFDAAATAVK
FT                   ARPFNAETHRRLQELRWLLEEYRVQTFAQQLGTIEKVSAKRINKQILALK"
FT   gene            714827..715810
FT                   /locus_tag="HMPREF0573_10615"
FT   CDS_pept        714827..715810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10615"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10615"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66934"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJN5"
FT                   /protein_id="ADI66934.1"
FT                   /translation="MRENRGVNNSTPNHPPEPSDAASLRAPLVPASDFSQFLPVQVPIL
FT                   PWQNAKLLSQTLGDTVYVSSAFATALRLELQLGVPAQRGEIGVRIPVTDPDSWSEFFCL
FT                   DDASLQLSRALRAEVSAPEVLENPQTCATLLSRLADNGWYGIEIEVRGENLNPQLIQVA
FT                   QHAADAGLHPGLSVLPGTLHSQNHGIISAFETVSLDLLNGTQPRREQLKYLAAQRVVGK
FT                   IIDAKSSERTNLEAALETLVLMRAKLPSQSEVVVGIAGDFGLESLTLPLREDLDFIAKT
FT                   RLAGAQAKILEALDLASALTQGKTTVASAFVADVLSRAGKATSLPI"
FT   gene            715874..716257
FT                   /locus_tag="HMPREF0573_10616"
FT   CDS_pept        715874..716257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10616"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10616"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66935"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJN6"
FT                   /protein_id="ADI66935.1"
FT                   /translation="MSEGKWLFLAGLGAGAALALRMNEKQFSNVKGFAAKIANSESVTD
FT                   ARKIAAEKLNDILRTQGAKLVDKLAENLKSQLNAGGNASWAGFANAEGTASRSPHPSTT
FT                   STDRDGVTRDKDGHVIIDGKIVA"
FT   gene            716288..717541
FT                   /locus_tag="HMPREF0573_10617"
FT   CDS_pept        716288..717541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10617"
FT                   /product="membrane protein"
FT                   /note="Pfam: PF01988; InterPro: IPR008217"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10617"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66936"
FT                   /db_xref="GOA:D6ZJN7"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="InterPro:IPR039376"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJN7"
FT                   /protein_id="ADI66936.1"
FT                   /translation="MNAHSLPDPTPEQIKRWRRYLAEERDEAKIYRAIAKKRYGMNREI
FT                   LLELADAEKRHENYWLAHLGPYAEPAPHSPWYIRLLQELAIKIGSIFVLAMMQRSEERG
FT                   TYDVDADATPQMAADEHLHSEVVRALAARSRARFSGRARAMVFGINDGLVSNLALVAGI
FT                   AGTGVPVSIVLVTGLTGLVAGALSMGAGEFISITSQRELLESSLPNPDVKQRLPMLDRA
FT                   ANELKLLFMARGENPEDAAIHAVLALETIDAQLQSRTQAKAVSPDHPEDLGQGGESPDQ
FT                   KTSAGNDTTTPCASKTSTDSPTEIADNAFALAFDNAPTSELEAIGSGSQAAVSSFLAFT
FT                   LGAFVPLIPFLLGFSGIPAICAAVILVGLILLMIGGTIGILSGKPPFLRALRQAAIGIG
FT                   AAVVTYLLGLAAGGALSL"
FT   gene            717715..718536
FT                   /locus_tag="HMPREF0573_10618"
FT   CDS_pept        717715..718536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10618"
FT                   /product="hypothetical protein"
FT                   /note="Pfam: PF03458; InterPro: IPR005115"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10618"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66937"
FT                   /db_xref="GOA:D6ZJN8"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJN8"
FT                   /protein_id="ADI66937.1"
FT                   /translation="MTNTVLAQISFSSLLPDMFRALDITGVLLNGILGGRLARQKHFDL
FT                   VGFGVLAVVSALGGGIVRDLMLNNAPPVALTDKFYLTMALAGALVAGLWKFDGKWSRRT
FT                   LLLFDGLVLGIWAGTGTQKALSLGFDVIPSILMGVITAIGGGMIRDIAAGNVPMVFGGS
FT                   SLYAIPAILAASADAAFYKLGYPMTGLVAAILVGSILTVLASWRRWVLPETHEWTISMT
FT                   HQQWKAAQRARQLARGEYPDAKTKKLWKNKFSTGETEKDSDNGDSGTTLEK"
FT   gene            718809..719264
FT                   /locus_tag="HMPREF0573_10619"
FT   CDS_pept        718809..719264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10619"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10619"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66938"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJN9"
FT                   /protein_id="ADI66938.1"
FT                   /translation="MDPDGNGCDTRADILARDFQSPRFGNSAKPCRLTGGTLHDPYTGK
FT                   TMQFETPPGRKVQIDHVVALGNAWKSGAWAWTKAQREAYANDPSVLLAADGPANQQKSD
FT                   ASADAWMPSNRNFRCAYARQQIDIKYRWNLTVTAPEKAALLSALAKC"
FT   gene            complement(719286..720950)
FT                   /gene="pgm"
FT                   /locus_tag="HMPREF0573_10620"
FT   CDS_pept        complement(719286..720950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgm"
FT                   /locus_tag="HMPREF0573_10620"
FT                   /product="phosphoglucomutase, alpha-D-glucose
FT                   phosphate-specific"
FT                   /EC_number="5.4.2.2"
FT                   /note="COG: COG0033; Pfam: PF02878,PF02879,PF02880,PF00408;
FT                   InterPro: IPR005852"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10620"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66939"
FT                   /db_xref="GOA:D6ZJP0"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR005852"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJP0"
FT                   /protein_id="ADI66939.1"
FT                   /translation="MHARAGKLAKPEDLINVDEVIGAYYDLEPDVNEPAQAVSFGTSGH
FT                   RGSSLDRAFNEAHIVATTAAIVEYRQSQGYDGPLFIGRDTHALSEPAWRTALEVLAGME
FT                   VRTLTDARDSFTPTPSVSHAILKANGAGTPGGVRLTGAGLADGIVVTPSHNPPRDGGFK
FT                   YNPPSGGPADSDATSWIANHANEILRQGWRSVPRNPHPEQSDFIGKTDFLPSYVDSLID
FT                   VVDVEAIRSAGIRIGADPLGGASVDYWAAIAERYGLNLTVVNEKVDPRWSFMTLDWDGK
FT                   IRMDCSSPYAMASLRRVMEGGSAPYDIATGNDADSDRHGIVTADGLMNPNHYLAVAIEY
FT                   LFTHRPHWAQGCAVGKTLVSSALIDRVVADMGRKLVEVPVGFKHFVPGLLNGTIGFGGE
FT                   ESAGASFLRKDGTVWTTDKDGLIAALLASEILAVTGKTPSVLHQEQVARFGASAYERVD
FT                   APATKAEKAKLAALAPEDVAASTLGGEPIVDRLVKAPGNHASIGGLKVTTENAWFAARP
FT                   SGTEDIYKIYAESFKGPEHLQTIQEEAKQVVAQALAK"
FT   gene            721079..721888
FT                   /locus_tag="HMPREF0573_10621"
FT   CDS_pept        721079..721888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10621"
FT                   /product="glycosyltransferase, group 2 family protein"
FT                   /EC_number="2.4.-.-"
FT                   /note="COG: COG0463; Pfam: PF00535; InterPro: IPR001173"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10621"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66940"
FT                   /db_xref="GOA:D6ZJP1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJP1"
FT                   /protein_id="ADI66940.1"
FT                   /translation="MENSENSAAAVPHPDQKVAVVIPAKDEGDSIGATIRASKALPRAD
FT                   LFVVIDDGSTDNTGEAARSAGAVVVRHSVNRGKASAMETGAKVVAMRDPEDGPRRLILF
FT                   LDADLGDSAAQTFPLVEAVMQGRTDCAIAALPRQAGAGGHGFVTGLSRRAIRWATGWEP
FT                   LQPLSGQRCLNAEAFFDCLPLAHKWGVETGMTIDLLVKGYSVQEVPCDLTHRATGNDMA
FT                   GYRHRLSQFRDVFLASAARFVRHVRAPLRLRLSAANKQQPGEVYCLK"
FT   gene            complement(721905..723788)
FT                   /locus_tag="HMPREF0573_10622"
FT   CDS_pept        complement(721905..723788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10622"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10622"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66941"
FT                   /db_xref="GOA:D6ZJP2"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJP2"
FT                   /protein_id="ADI66941.1"
FT                   /translation="MGTSADGWSLGEAVLDSGANLRLFGDGAAAGMGFIHPGSSGTKLP
FT                   DSLIFSPAASYRGASPEVFADLLSQVMSPSTVVVVDMRVFPRHLQAQVLRAAWQRGDDL
FT                   GWNTIIASIADDKPATNKESDVYLIDNSAPQKTIVPRGNPRLQVFAARGPQFGDGGAVS
FT                   ASTHRSGWVQTADLTATILDYVGAEKPMWVQGSTISTGNAVTVKFLASAARRAAMIRSI
FT                   QIWFLPSLGVAVALLLIAAVWTLNRRTHPRLGENWAQPRMLLGFWRMTATFAALIPAMA
FT                   YLMNLVPWWELGPDDTDVAATSYLWLGCLLPVFLSALVVIVWSALGLNSLLGPLFIISV
FT                   SSLIVGILDPLIGSPMVLDSIMGLQSTVGGRFFGIDNVMFAVLATGALTLATVVYGLGE
FT                   ERKQTNISQKSLILVLSLMASAIVFLDAAPGLGADFGGTLALIPGFAILFLKFDRKPIT
FT                   VLSSALIALSTICVAAIFAYFDWLRPVAERTHLGNFIDTLTQGRVLPVLLNKSTMVWNA
FT                   GWPVWLIICVILAILLAMGIILAPLFANMRNPYRRDYGWLWGSVGAKLHPEGITWNHAE
FT                   RALFIAWLTTMVVGMLLNDSGILLGLAGAAVMFPAILAQGCHKFLIDQPQQ"
FT   gene            complement(724040..724615)
FT                   /locus_tag="HMPREF0573_10623"
FT   CDS_pept        complement(724040..724615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10623"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10623"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66942"
FT                   /db_xref="GOA:D6ZJP3"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJP3"
FT                   /protein_id="ADI66942.1"
FT                   /translation="MQTKAKPPSAPSLPMPGRTGNGARKPIKRSYKPLPTTRYLVAGLT
FT                   AIIVSMGLIAGAMSSTNTFDTRPWDPSQEMHWDPFEHHMIAGLDVGSLSEAGRRTSEAI
FT                   KPKKGATPTETKTQTEPEKTPEAGASESPAQPENPSSTVVQTFAVPGAPQEPTASEAPA
FT                   GPPPPVAMGPTSKDSPVDRVHEVAVPKA"
FT   gene            724614..724841
FT                   /locus_tag="HMPREF0573_10624"
FT   CDS_pept        724614..724841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0573_10624"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10624"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66943"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJP4"
FT                   /protein_id="ADI66943.1"
FT                   /translation="MVKIIPIFVEIALFHDDYLQTTARQHHIYQLNFPNFSRNITTQDK
FT                   SATSFTSHDRRQFGAFSAQATQKSFLTKSL"
FT   gene            724937..726268
FT                   /gene="serS"
FT                   /locus_tag="HMPREF0573_10625"
FT   CDS_pept        724937..726268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="HMPREF0573_10625"
FT                   /product="serine--tRNA ligase"
FT                   /EC_number="6.1.1.11"
FT                   /note="COG: COG0172; Pfam: PF02403,PF00587; InterPro:
FT                   IPR002317"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0573_10625"
FT                   /db_xref="EnsemblGenomes-Tr:ADI66944"
FT                   /db_xref="GOA:D6ZJP5"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZJP5"
FT                   /protein_id="ADI66944.1"
FT                   /translation="MLPKDAAQNGYALNMIDLRAMKDNPEPMRASQLARGNDPATVDQA
FT                   LAADERRRAALTAFETARAEQKAFSKQIGSASKEERPALLEQAKKLSENVKALEEASNQ
FT                   AA