(data stored in ACNUC7421 zone)

EMBL: CP001993

ID   CP001993; SV 1; circular; genomic DNA; STD; PRO; 2088772 BP.
AC   CP001993; ACJP01000000-ACJP01000369; GG696890-GG697127;
PR   Project:PRJNA34659;
DT   15-JUN-2010 (Rel. 105, Created)
DT   01-SEP-2013 (Rel. 118, Last updated, Version 6)
DE   Streptococcus pneumoniae TCH8431/19A, complete genome.
KW   .
OS   Streptococcus pneumoniae TCH8431/19A
OC   Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae;
OC   Streptococcus.
RN   [1]
RP   1-2088772
RA   Muzny D.M., Qin X., Buhay C.J., Dugan-Rocha S., Ding Y., Chen G.,
RA   Hawes A.C., Holder M., Jhangiani S.N., Johnson A.J., Khan Z.M., Li Z.,
RA   Liu W., Liu X., Perez L.M., Shen H., Wang Q., Watt J.E., Xi L., Xin Y.,
RA   Zhou J., Deng J., Jiang H., Liu Y., Qu J., Song X.-Z., Zhang L.,
RA   Villasana D., Liu J., Liyanage D., Lorensuhewa L.M., Robinson T., Song A.,
RA   Song B.-B., Dinh H.H., Thornton R., Coyle M.D., Francisco L., Jackson L.,
RA   Javaid M., Korchina V., Kovar C.L., Mata R., Mathew T., Ngo R., Nguyen L.,
RA   Nguyen N., Okwuonu G., Ongeri F., Pham C., Simmons D., Wilczek-Boney K.B.,
RA   Hale W., Jakkamsetti A., Opheim D., Pham P., Lucas F.San., Warren J.,
RA   Zhang J., Zhao Z., Zhou C., Zhu D., Lee S.L., Bess C.M., Blankenburg K.P.,
RA   Forbes L., Fu Q., Gubbala S., Hirani K., Jayaseelan J.C., Lara F.,
RA   Munidasa M., Palculict T., Patil S.S., Pu L.-L., Saada N., Tang L.-Y.,
RA   Weissenberger G.M., Zhu Y., Hemphill L., Shang Y., Youmans B., Ayvaz T.,
RA   Ross M., Santibanez J., Aqrawi P., Gross S., Joshi V., Fowler G.,
RA   Nazareth L., Reid J., Worley K.C., Petrosino J., Highlander S., Gibbs R.A.;
RT   ;
RL   Submitted (25-MAR-2010) to the INSDC.
RL   Human Genome Sequencing Center, Baylor College of Medicine, One Baylor
RL   Plaza, Houston, TX 77030, USA
DR   MD5; bef11c570ea71e21227f23f4930042b0.
DR   BioSample; SAMN00002223.
DR   EnsemblGenomes-Gn; EBG00001196783.
DR   EnsemblGenomes-Gn; EBG00001196784.
DR   EnsemblGenomes-Gn; EBG00001196785.
DR   EnsemblGenomes-Gn; EBG00001196786.
DR   EnsemblGenomes-Gn; EBG00001196787.
DR   EnsemblGenomes-Gn; EBG00001196788.
DR   EnsemblGenomes-Gn; EBG00001196789.
DR   EnsemblGenomes-Gn; EBG00001196790.
DR   EnsemblGenomes-Gn; EBG00001196791.
DR   EnsemblGenomes-Gn; EBG00001196792.
DR   EnsemblGenomes-Gn; EBG00001196793.
DR   EnsemblGenomes-Gn; EBG00001196794.
DR   EnsemblGenomes-Gn; EBG00001196795.
DR   EnsemblGenomes-Gn; EBG00001196796.
DR   EnsemblGenomes-Gn; EBG00001196797.
DR   EnsemblGenomes-Gn; EBG00001196798.
DR   EnsemblGenomes-Gn; EBG00001196799.
DR   EnsemblGenomes-Gn; EBG00001196800.
DR   EnsemblGenomes-Gn; EBG00001196801.
DR   EnsemblGenomes-Gn; EBG00001196802.
DR   EnsemblGenomes-Gn; EBG00001196803.
DR   EnsemblGenomes-Gn; EBG00001196804.
DR   EnsemblGenomes-Gn; EBG00001196805.
DR   EnsemblGenomes-Gn; EBG00001196806.
DR   EnsemblGenomes-Gn; EBG00001196807.
DR   EnsemblGenomes-Gn; EBG00001196808.
DR   EnsemblGenomes-Gn; EBG00001196809.
DR   EnsemblGenomes-Gn; EBG00001196810.
DR   EnsemblGenomes-Gn; EBG00001196811.
DR   EnsemblGenomes-Gn; EBG00001196812.
DR   EnsemblGenomes-Gn; EBG00001196813.
DR   EnsemblGenomes-Gn; EBG00001196814.
DR   EnsemblGenomes-Gn; EBG00001196815.
DR   EnsemblGenomes-Gn; EBG00001196816.
DR   EnsemblGenomes-Gn; EBG00001196817.
DR   EnsemblGenomes-Gn; EBG00001196818.
DR   EnsemblGenomes-Gn; EBG00001196819.
DR   EnsemblGenomes-Gn; EBG00001196820.
DR   EnsemblGenomes-Gn; EBG00001196821.
DR   EnsemblGenomes-Gn; EBG00001196822.
DR   EnsemblGenomes-Gn; EBG00001196823.
DR   EnsemblGenomes-Gn; EBG00001196824.
DR   EnsemblGenomes-Gn; EBG00001196825.
DR   EnsemblGenomes-Gn; EBG00001196826.
DR   EnsemblGenomes-Gn; EBG00001196827.
DR   EnsemblGenomes-Gn; EBG00001196828.
DR   EnsemblGenomes-Gn; EBG00001196829.
DR   EnsemblGenomes-Gn; EBG00001196830.
DR   EnsemblGenomes-Gn; EBG00001196831.
DR   EnsemblGenomes-Gn; EBG00001196832.
DR   EnsemblGenomes-Gn; EBG00001196833.
DR   EnsemblGenomes-Gn; EBG00001196834.
DR   EnsemblGenomes-Gn; EBG00001196835.
DR   EnsemblGenomes-Gn; EBG00001196836.
DR   EnsemblGenomes-Gn; EBG00001196837.
DR   EnsemblGenomes-Gn; EBG00001196838.
DR   EnsemblGenomes-Gn; EBG00001196839.
DR   EnsemblGenomes-Gn; EBG00001196840.
DR   EnsemblGenomes-Gn; EBG00001196841.
DR   EnsemblGenomes-Gn; EBG00001196842.
DR   EnsemblGenomes-Gn; EBG00001196843.
DR   EnsemblGenomes-Gn; EBG00001196844.
DR   EnsemblGenomes-Gn; EBG00001196845.
DR   EnsemblGenomes-Gn; EBG00001196846.
DR   EnsemblGenomes-Gn; EBG00001196847.
DR   EnsemblGenomes-Gn; EBG00001196848.
DR   EnsemblGenomes-Gn; EBG00001196849.
DR   EnsemblGenomes-Gn; EBG00001196850.
DR   EnsemblGenomes-Gn; EBG00001196851.
DR   EnsemblGenomes-Gn; EBG00001196852.
DR   EnsemblGenomes-Gn; EBG00001196853.
DR   EnsemblGenomes-Gn; EBG00001196854.
DR   EnsemblGenomes-Gn; EBG00001196855.
DR   EnsemblGenomes-Gn; EBG00001196856.
DR   EnsemblGenomes-Gn; EBG00001196857.
DR   EnsemblGenomes-Gn; EBG00001196858.
DR   EnsemblGenomes-Gn; EBG00001196859.
DR   EnsemblGenomes-Gn; EBG00001196860.
DR   EnsemblGenomes-Gn; EBG00001196861.
DR   EnsemblGenomes-Gn; EBG00001196862.
DR   EnsemblGenomes-Gn; EBG00001196863.
DR   EnsemblGenomes-Gn; EBG00001196864.
DR   EnsemblGenomes-Gn; EBG00001196865.
DR   EnsemblGenomes-Gn; EBG00001196866.
DR   EnsemblGenomes-Gn; EBG00001196867.
DR   EnsemblGenomes-Gn; EBG00001196868.
DR   EnsemblGenomes-Gn; EBG00001196869.
DR   EnsemblGenomes-Gn; EBG00001196870.
DR   EnsemblGenomes-Gn; EBG00001196871.
DR   EnsemblGenomes-Gn; EBG00001196872.
DR   EnsemblGenomes-Gn; EBG00001196873.
DR   EnsemblGenomes-Gn; EBG00001196874.
DR   EnsemblGenomes-Gn; EBG00001196875.
DR   EnsemblGenomes-Gn; EBG00001196876.
DR   EnsemblGenomes-Gn; EBG00001196877.
DR   EnsemblGenomes-Gn; EBG00001196878.
DR   EnsemblGenomes-Gn; EBG00001196879.
DR   EnsemblGenomes-Gn; EBG00001196880.
DR   EnsemblGenomes-Gn; EBG00001196881.
DR   EnsemblGenomes-Gn; EBG00001196882.
DR   EnsemblGenomes-Gn; EBG00001196883.
DR   EnsemblGenomes-Gn; EBG00001196884.
DR   EnsemblGenomes-Gn; EBG00001196885.
DR   EnsemblGenomes-Gn; EBG00001196886.
DR   EnsemblGenomes-Gn; EBG00001196887.
DR   EnsemblGenomes-Gn; EBG00001196888.
DR   EnsemblGenomes-Gn; EBG00001196889.
DR   EnsemblGenomes-Gn; EBG00001196890.
DR   EnsemblGenomes-Gn; EBG00001196892.
DR   EnsemblGenomes-Gn; EBG00001196893.
DR   EnsemblGenomes-Gn; EBG00001196894.
DR   EnsemblGenomes-Gn; EBG00001196895.
DR   EnsemblGenomes-Gn; HMPREF0837_nc10001.
DR   EnsemblGenomes-Gn; HMPREF0837_nc10002.
DR   EnsemblGenomes-Gn; HMPREF0837_nc10004.
DR   EnsemblGenomes-Gn; HMPREF0837_nc10005.
DR   EnsemblGenomes-Gn; HMPREF0837_nc10008.
DR   EnsemblGenomes-Gn; HMPREF0837_nc10011.
DR   EnsemblGenomes-Gn; HMPREF0837_nc10022.
DR   EnsemblGenomes-Gn; HMPREF0837_nc10026.
DR   EnsemblGenomes-Gn; HMPREF0837_nc10030.
DR   EnsemblGenomes-Gn; HMPREF0837_nc10031.
DR   EnsemblGenomes-Gn; HMPREF0837_r10001.
DR   EnsemblGenomes-Gn; HMPREF0837_r10002.
DR   EnsemblGenomes-Gn; HMPREF0837_r10003.
DR   EnsemblGenomes-Gn; HMPREF0837_r10004.
DR   EnsemblGenomes-Gn; HMPREF0837_r10005.
DR   EnsemblGenomes-Gn; HMPREF0837_r10006.
DR   EnsemblGenomes-Gn; HMPREF0837_r10007.
DR   EnsemblGenomes-Gn; HMPREF0837_r10008.
DR   EnsemblGenomes-Gn; HMPREF0837_r10009.
DR   EnsemblGenomes-Gn; HMPREF0837_r10010.
DR   EnsemblGenomes-Gn; HMPREF0837_r10011.
DR   EnsemblGenomes-Gn; HMPREF0837_r10012.
DR   EnsemblGenomes-Gn; HMPREF0837_t10001.
DR   EnsemblGenomes-Gn; HMPREF0837_t10002.
DR   EnsemblGenomes-Gn; HMPREF0837_t10003.
DR   EnsemblGenomes-Gn; HMPREF0837_t10004.
DR   EnsemblGenomes-Gn; HMPREF0837_t10005.
DR   EnsemblGenomes-Gn; HMPREF0837_t10006.
DR   EnsemblGenomes-Gn; HMPREF0837_t10007.
DR   EnsemblGenomes-Gn; HMPREF0837_t10008.
DR   EnsemblGenomes-Gn; HMPREF0837_t10009.
DR   EnsemblGenomes-Gn; HMPREF0837_t10010.
DR   EnsemblGenomes-Gn; HMPREF0837_t10011.
DR   EnsemblGenomes-Gn; HMPREF0837_t10012.
DR   EnsemblGenomes-Gn; HMPREF0837_t10013.
DR   EnsemblGenomes-Gn; HMPREF0837_t10014.
DR   EnsemblGenomes-Gn; HMPREF0837_t10015.
DR   EnsemblGenomes-Gn; HMPREF0837_t10016.
DR   EnsemblGenomes-Gn; HMPREF0837_t10017.
DR   EnsemblGenomes-Gn; HMPREF0837_t10018.
DR   EnsemblGenomes-Gn; HMPREF0837_t10019.
DR   EnsemblGenomes-Gn; HMPREF0837_t10020.
DR   EnsemblGenomes-Gn; HMPREF0837_t10021.
DR   EnsemblGenomes-Gn; HMPREF0837_t10022.
DR   EnsemblGenomes-Gn; HMPREF0837_t10023.
DR   EnsemblGenomes-Gn; HMPREF0837_t10024.
DR   EnsemblGenomes-Gn; HMPREF0837_t10025.
DR   EnsemblGenomes-Gn; HMPREF0837_t10026.
DR   EnsemblGenomes-Gn; HMPREF0837_t10027.
DR   EnsemblGenomes-Gn; HMPREF0837_t10028.
DR   EnsemblGenomes-Gn; HMPREF0837_t10029.
DR   EnsemblGenomes-Gn; HMPREF0837_t10030.
DR   EnsemblGenomes-Gn; HMPREF0837_t10031.
DR   EnsemblGenomes-Gn; HMPREF0837_t10032.
DR   EnsemblGenomes-Gn; HMPREF0837_t10033.
DR   EnsemblGenomes-Gn; HMPREF0837_t10034.
DR   EnsemblGenomes-Gn; HMPREF0837_t10035.
DR   EnsemblGenomes-Gn; HMPREF0837_t10036.
DR   EnsemblGenomes-Gn; HMPREF0837_t10037.
DR   EnsemblGenomes-Gn; HMPREF0837_t10038.
DR   EnsemblGenomes-Gn; HMPREF0837_t10039.
DR   EnsemblGenomes-Gn; HMPREF0837_t10040.
DR   EnsemblGenomes-Gn; HMPREF0837_t10041.
DR   EnsemblGenomes-Gn; HMPREF0837_t10042.
DR   EnsemblGenomes-Gn; HMPREF0837_t10043.
DR   EnsemblGenomes-Gn; HMPREF0837_t10044.
DR   EnsemblGenomes-Gn; HMPREF0837_t10045.
DR   EnsemblGenomes-Gn; HMPREF0837_t10046.
DR   EnsemblGenomes-Gn; HMPREF0837_t10047.
DR   EnsemblGenomes-Gn; HMPREF0837_t10048.
DR   EnsemblGenomes-Gn; HMPREF0837_t10049.
DR   EnsemblGenomes-Gn; HMPREF0837_t10050.
DR   EnsemblGenomes-Gn; HMPREF0837_t10051.
DR   EnsemblGenomes-Gn; HMPREF0837_t10052.
DR   EnsemblGenomes-Gn; HMPREF0837_t10053.
DR   EnsemblGenomes-Gn; HMPREF0837_t10054.
DR   EnsemblGenomes-Gn; HMPREF0837_t10055.
DR   EnsemblGenomes-Gn; HMPREF0837_t10056.
DR   EnsemblGenomes-Gn; HMPREF0837_t10057.
DR   EnsemblGenomes-Gn; HMPREF0837_t10058.
DR   EnsemblGenomes-Tr; EBT00001567837.
DR   EnsemblGenomes-Tr; EBT00001567838.
DR   EnsemblGenomes-Tr; EBT00001567839.
DR   EnsemblGenomes-Tr; EBT00001567840.
DR   EnsemblGenomes-Tr; EBT00001567841.
DR   EnsemblGenomes-Tr; EBT00001567842.
DR   EnsemblGenomes-Tr; EBT00001567843.
DR   EnsemblGenomes-Tr; EBT00001567844.
DR   EnsemblGenomes-Tr; EBT00001567845.
DR   EnsemblGenomes-Tr; EBT00001567846.
DR   EnsemblGenomes-Tr; EBT00001567847.
DR   EnsemblGenomes-Tr; EBT00001567848.
DR   EnsemblGenomes-Tr; EBT00001567849.
DR   EnsemblGenomes-Tr; EBT00001567850.
DR   EnsemblGenomes-Tr; EBT00001567851.
DR   EnsemblGenomes-Tr; EBT00001567852.
DR   EnsemblGenomes-Tr; EBT00001567853.
DR   EnsemblGenomes-Tr; EBT00001567854.
DR   EnsemblGenomes-Tr; EBT00001567855.
DR   EnsemblGenomes-Tr; EBT00001567856.
DR   EnsemblGenomes-Tr; EBT00001567857.
DR   EnsemblGenomes-Tr; EBT00001567858.
DR   EnsemblGenomes-Tr; EBT00001567859.
DR   EnsemblGenomes-Tr; EBT00001567860.
DR   EnsemblGenomes-Tr; EBT00001567861.
DR   EnsemblGenomes-Tr; EBT00001567862.
DR   EnsemblGenomes-Tr; EBT00001567863.
DR   EnsemblGenomes-Tr; EBT00001567864.
DR   EnsemblGenomes-Tr; EBT00001567865.
DR   EnsemblGenomes-Tr; EBT00001567866.
DR   EnsemblGenomes-Tr; EBT00001567867.
DR   EnsemblGenomes-Tr; EBT00001567868.
DR   EnsemblGenomes-Tr; EBT00001567869.
DR   EnsemblGenomes-Tr; EBT00001567870.
DR   EnsemblGenomes-Tr; EBT00001567871.
DR   EnsemblGenomes-Tr; EBT00001567872.
DR   EnsemblGenomes-Tr; EBT00001567873.
DR   EnsemblGenomes-Tr; EBT00001567875.
DR   EnsemblGenomes-Tr; EBT00001567876.
DR   EnsemblGenomes-Tr; EBT00001567877.
DR   EnsemblGenomes-Tr; EBT00001567878.
DR   EnsemblGenomes-Tr; EBT00001567879.
DR   EnsemblGenomes-Tr; EBT00001567880.
DR   EnsemblGenomes-Tr; EBT00001567881.
DR   EnsemblGenomes-Tr; EBT00001567882.
DR   EnsemblGenomes-Tr; EBT00001567883.
DR   EnsemblGenomes-Tr; EBT00001567884.
DR   EnsemblGenomes-Tr; EBT00001567885.
DR   EnsemblGenomes-Tr; EBT00001567886.
DR   EnsemblGenomes-Tr; EBT00001567887.
DR   EnsemblGenomes-Tr; EBT00001567888.
DR   EnsemblGenomes-Tr; EBT00001567889.
DR   EnsemblGenomes-Tr; EBT00001567890.
DR   EnsemblGenomes-Tr; EBT00001567891.
DR   EnsemblGenomes-Tr; EBT00001567892.
DR   EnsemblGenomes-Tr; EBT00001567893.
DR   EnsemblGenomes-Tr; EBT00001567894.
DR   EnsemblGenomes-Tr; EBT00001567895.
DR   EnsemblGenomes-Tr; EBT00001567896.
DR   EnsemblGenomes-Tr; EBT00001567897.
DR   EnsemblGenomes-Tr; EBT00001567898.
DR   EnsemblGenomes-Tr; EBT00001567899.
DR   EnsemblGenomes-Tr; EBT00001567900.
DR   EnsemblGenomes-Tr; EBT00001567901.
DR   EnsemblGenomes-Tr; EBT00001567902.
DR   EnsemblGenomes-Tr; EBT00001567903.
DR   EnsemblGenomes-Tr; EBT00001567904.
DR   EnsemblGenomes-Tr; EBT00001567905.
DR   EnsemblGenomes-Tr; EBT00001567906.
DR   EnsemblGenomes-Tr; EBT00001567907.
DR   EnsemblGenomes-Tr; EBT00001567908.
DR   EnsemblGenomes-Tr; EBT00001567909.
DR   EnsemblGenomes-Tr; EBT00001567910.
DR   EnsemblGenomes-Tr; EBT00001567911.
DR   EnsemblGenomes-Tr; EBT00001567912.
DR   EnsemblGenomes-Tr; EBT00001567913.
DR   EnsemblGenomes-Tr; EBT00001567914.
DR   EnsemblGenomes-Tr; EBT00001567915.
DR   EnsemblGenomes-Tr; EBT00001567916.
DR   EnsemblGenomes-Tr; EBT00001567917.
DR   EnsemblGenomes-Tr; EBT00001567918.
DR   EnsemblGenomes-Tr; EBT00001567919.
DR   EnsemblGenomes-Tr; EBT00001567920.
DR   EnsemblGenomes-Tr; EBT00001567921.
DR   EnsemblGenomes-Tr; EBT00001567922.
DR   EnsemblGenomes-Tr; EBT00001567923.
DR   EnsemblGenomes-Tr; EBT00001567924.
DR   EnsemblGenomes-Tr; EBT00001567925.
DR   EnsemblGenomes-Tr; EBT00001567926.
DR   EnsemblGenomes-Tr; EBT00001567927.
DR   EnsemblGenomes-Tr; EBT00001567928.
DR   EnsemblGenomes-Tr; EBT00001567929.
DR   EnsemblGenomes-Tr; EBT00001567930.
DR   EnsemblGenomes-Tr; EBT00001567931.
DR   EnsemblGenomes-Tr; EBT00001567932.
DR   EnsemblGenomes-Tr; EBT00001567933.
DR   EnsemblGenomes-Tr; EBT00001567934.
DR   EnsemblGenomes-Tr; EBT00001567935.
DR   EnsemblGenomes-Tr; EBT00001567936.
DR   EnsemblGenomes-Tr; EBT00001567937.
DR   EnsemblGenomes-Tr; EBT00001567938.
DR   EnsemblGenomes-Tr; EBT00001567939.
DR   EnsemblGenomes-Tr; EBT00001567940.
DR   EnsemblGenomes-Tr; EBT00001567941.
DR   EnsemblGenomes-Tr; EBT00001567942.
DR   EnsemblGenomes-Tr; EBT00001567943.
DR   EnsemblGenomes-Tr; EBT00001567944.
DR   EnsemblGenomes-Tr; EBT00001567945.
DR   EnsemblGenomes-Tr; EBT00001567946.
DR   EnsemblGenomes-Tr; EBT00001567947.
DR   EnsemblGenomes-Tr; EBT00001567948.
DR   EnsemblGenomes-Tr; EBT00001567949.
DR   EnsemblGenomes-Tr; HMPREF0837_nc10001-1.
DR   EnsemblGenomes-Tr; HMPREF0837_nc10002-1.
DR   EnsemblGenomes-Tr; HMPREF0837_nc10004-1.
DR   EnsemblGenomes-Tr; HMPREF0837_nc10005-1.
DR   EnsemblGenomes-Tr; HMPREF0837_nc10008-1.
DR   EnsemblGenomes-Tr; HMPREF0837_nc10011-1.
DR   EnsemblGenomes-Tr; HMPREF0837_nc10022-1.
DR   EnsemblGenomes-Tr; HMPREF0837_nc10026-1.
DR   EnsemblGenomes-Tr; HMPREF0837_nc10030-1.
DR   EnsemblGenomes-Tr; HMPREF0837_nc10031-1.
DR   EnsemblGenomes-Tr; HMPREF0837_r10001-1.
DR   EnsemblGenomes-Tr; HMPREF0837_r10002-1.
DR   EnsemblGenomes-Tr; HMPREF0837_r10003-1.
DR   EnsemblGenomes-Tr; HMPREF0837_r10004-1.
DR   EnsemblGenomes-Tr; HMPREF0837_r10005-1.
DR   EnsemblGenomes-Tr; HMPREF0837_r10006-1.
DR   EnsemblGenomes-Tr; HMPREF0837_r10007-1.
DR   EnsemblGenomes-Tr; HMPREF0837_r10008-1.
DR   EnsemblGenomes-Tr; HMPREF0837_r10009-1.
DR   EnsemblGenomes-Tr; HMPREF0837_r10010-1.
DR   EnsemblGenomes-Tr; HMPREF0837_r10011-1.
DR   EnsemblGenomes-Tr; HMPREF0837_r10012-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10001-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10002-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10003-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10004-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10005-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10006-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10007-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10008-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10009-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10010-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10011-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10012-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10013-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10014-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10015-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10016-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10017-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10018-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10019-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10020-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10021-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10022-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10023-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10024-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10025-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10026-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10027-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10028-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10029-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10030-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10031-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10032-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10033-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10034-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10035-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10036-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10037-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10038-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10039-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10040-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10041-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10042-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10043-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10044-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10045-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10046-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10047-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10048-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10049-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10050-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10051-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10052-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10053-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10054-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10055-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10056-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10057-1.
DR   EnsemblGenomes-Tr; HMPREF0837_t10058-1.
DR   EuropePMC; PMC3318815; 22307284.
DR   EuropePMC; PMC5207522; 28046133.
DR   EuropePMC; PMC6375853; 30800118.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01054; preQ1-II.
DR   RFAM; RF01065; 23S-methyl.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01708; L17DE.
DR   RFAM; RF01709; Lacto-rpoB.
DR   RFAM; RF01732; asd.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   SILVA-LSU; CP001993.
DR   SILVA-SSU; CP001993.
CC   Streptococcus pneumoniae TCH8431/19A
CC    Strain source, body site: Airways, respiratory tract
CC    Inquiries should be directed to microbe@hgsc.bcm.tmc.edu
CC    This sequence is an upgraded sequence that has been subjected to
CC   automatic finishing procedures including computational calculation
CC   with experimental execution of directed PCR experiments to order
CC   and orient many of the whole genome shotgun sequence contigs. The
CC   automatic finishing was followed by further experiments to fully
CC   order and orient the contigs within the genome and clarify the
CC   remaining ambiguous sequence. This sequence meets the quality
CC   standards for HMP grade (HTGS_PHASE3).
CC    This is a reference genome for the Human Microbiome Project. This
CC   project is co-owned with the Human Microbiome Project DACC. Source
CC   DNA provided by Kaplan, S., Mason, E., Hulten, K. (Department of
CC   Pediatric Infectious Diseases, Texas Children's Hospital, 1102
CC   Bates, #1150, Feigin Center, MC 3-1271, Houston, TX 77030). Funded
CC   by ###Genomes and Genetics at BCM-HGSC### (U54 HG003273).
CC   ##Genome-Assembly-Data-START##
CC   Finishing Goal           :: Finished
CC   Current Finishing Status :: Finished
CC   Assembly Method          :: Newbler Assembler v.
CC   Genome Coverage          :: 58x
CC   Sequencing Technology    :: 454
CC   ##Genome-Assembly-Data-END##
FH   Key             Location/Qualifiers
FT   source          1..2088772
FT                   /organism="Streptococcus pneumoniae TCH8431/19A"
FT                   /strain="TCH8431/19A"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:525381"
FT   gene            113..256
FT                   /locus_tag="HMPREF0837_10001"
FT   CDS_pept        113..256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10001"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10001"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68229"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZMQ8"
FT                   /protein_id="ADI68229.1"
FT                   LF"
FT   gene            complement(314..385)
FT                   /locus_tag="HMPREF0837_t10001"
FT   tRNA            complement(314..385)
FT                   /locus_tag="HMPREF0837_t10001"
FT                   /product="tRNA-Glu"
FT   gene            complement(479..958)
FT                   /gene="comX"
FT                   /locus_tag="HMPREF0837_10002"
FT   CDS_pept        complement(479..958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comX"
FT                   /locus_tag="HMPREF0837_10002"
FT                   /product="transcriptional regulator ComX1"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10002"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68230"
FT                   /db_xref="GOA:D6ZMQ9"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZMQ9"
FT                   /protein_id="ADI68230.1"
FT   gene            complement(1080..1631)
FT                   /gene="nusG"
FT                   /locus_tag="HMPREF0837_10003"
FT   CDS_pept        complement(1080..1631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="HMPREF0837_10003"
FT                   /product="transcription termination/antitermination factor
FT                   NusG"
FT                   /note="COG: COG0250; Pfam: PF02357,PF00467; InterPro:
FT                   IPR001062"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10003"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68231"
FT                   /db_xref="GOA:D6ZMR0"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZMR0"
FT                   /protein_id="ADI68231.1"
FT   gene            complement(1671..1847)
FT                   /gene="secE"
FT                   /locus_tag="HMPREF0837_10004"
FT   CDS_pept        complement(1671..1847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="HMPREF0837_10004"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="COG: COG0690"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10004"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68232"
FT                   /db_xref="GOA:D6ZMR1"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZMR1"
FT                   /protein_id="ADI68232.1"
FT                   LIVSGLIRFINIF"
FT   gene            complement(1857..2009)
FT                   /gene="rpmG"
FT                   /locus_tag="HMPREF0837_10005"
FT   CDS_pept        complement(1857..2009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="HMPREF0837_10005"
FT                   /product="ribosomal protein L33"
FT                   /note="COG: COG0267; Pfam: PF00471; InterPro: IPR001705"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10005"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68233"
FT                   /db_xref="GOA:D6ZMR2"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZMR2"
FT                   /protein_id="ADI68233.1"
FT                   HRETR"
FT   gene            complement(2062..4257)
FT                   /locus_tag="HMPREF0837_10006"
FT   CDS_pept        complement(2062..4257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10006"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /note="COG: COG0744; Pfam: PF00912,PF00905; InterPro:
FT                   IPR011816"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10006"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68234"
FT                   /db_xref="GOA:D6ZMR3"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZMR3"
FT                   /protein_id="ADI68234.1"
FT   gene            4344..5219
FT                   /locus_tag="HMPREF0837_10007"
FT   CDS_pept        4344..5219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10007"
FT                   /product="pseudouridine synthase, RluA family"
FT                   /EC_number="5.4.99.-"
FT                   /note="COG: COG0564; Pfam: PF00849; InterPro: IPR006225"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10007"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68235"
FT                   /db_xref="GOA:D6ZMR4"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZMR4"
FT                   /protein_id="ADI68235.1"
FT                   TFETELKKNG"
FT   gene            complement(5288..6322)
FT                   /gene="gap"
FT                   /locus_tag="HMPREF0837_10008"
FT   CDS_pept        complement(5288..6322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gap"
FT                   /locus_tag="HMPREF0837_10008"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /EC_number="1.2.1.-"
FT                   /note="COG: COG0057; Pfam: PF00044,PF02800; InterPro:
FT                   IPR000173"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10008"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68236"
FT                   /db_xref="GOA:D6ZMR5"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZMR5"
FT                   /protein_id="ADI68236.1"
FT                   KIAK"
FT   gene            complement(6475..7437)
FT                   /locus_tag="HMPREF0837_10009"
FT   CDS_pept        complement(6475..7437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10009"
FT                   /product="efflux ABC transporter, permease protein"
FT                   /note="Pfam: PF02687; InterPro: IPR003838"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10009"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68237"
FT                   /db_xref="GOA:D6ZMR6"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZMR6"
FT                   /protein_id="ADI68237.1"
FT   gene            complement(7498..7836)
FT                   /locus_tag="HMPREF0837_10010"
FT   CDS_pept        complement(7498..7836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10010"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3335"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10010"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68238"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZMR7"
FT                   /protein_id="ADI68238.1"
FT                   FLSCSCFN"
FT   gene            complement(8016..8363)
FT                   /locus_tag="HMPREF0837_10011"
FT   CDS_pept        complement(8016..8363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10011"
FT                   /product="transposase"
FT                   /note="COG: COG3335; Pfam: PF01710; InterPro: IPR002622"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10011"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68239"
FT                   /db_xref="GOA:D6ZMR8"
FT                   /db_xref="InterPro:IPR002622"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZMR8"
FT                   /protein_id="ADI68239.1"
FT                   GYTRKKEPHLL"
FT   gene            complement(8476..9375)
FT                   /gene="nadC"
FT                   /locus_tag="HMPREF0837_10012"
FT   CDS_pept        complement(8476..9375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /locus_tag="HMPREF0837_10012"
FT                   /product="nicotinate-nucleotide diphosphorylase
FT                   (carboxylating)"
FT                   /EC_number=""
FT                   /note="COG: COG0157; Pfam: PF02749,PF01729; InterPro:
FT                   IPR004393"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10012"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68240"
FT                   /db_xref="GOA:D6ZMR9"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZMR9"
FT                   /protein_id="ADI68240.1"
FT                   HSAKSLDFSMKGLTYLDV"
FT   gene            9585..10895
FT                   /locus_tag="HMPREF0837_10013"
FT   CDS_pept        9585..10895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10013"
FT                   /product="dicarboxylate carrier MatC domain protein"
FT                   /note="COG: COG0471; Pfam: PF07158; InterPro: IPR009827"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10013"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68241"
FT                   /db_xref="GOA:D6ZMS0"
FT                   /db_xref="InterPro:IPR009827"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZMS0"
FT                   /protein_id="ADI68241.1"
FT   gene            complement(11261..11455)
FT                   /locus_tag="HMPREF0837_10014"
FT   CDS_pept        complement(11261..11455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10014"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68242"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZMS1"
FT                   /protein_id="ADI68242.1"
FT   gene            complement(11915..12643)
FT                   /locus_tag="HMPREF0837_10015"
FT   CDS_pept        complement(11915..12643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10015"
FT                   /product="UbiC transcription regulator-associated domain
FT                   protein"
FT                   /note="COG: COG2188; Pfam: PF00392,PF07702; InterPro:
FT                   IPR011663"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10015"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68243"
FT                   /db_xref="GOA:D6ZMS2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZMS2"
FT                   /protein_id="ADI68243.1"
FT   gene            12801..14210
FT                   /locus_tag="HMPREF0837_10016"
FT   CDS_pept        12801..14210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10016"
FT                   /product="glycosyl hydrolase, family 1"
FT                   /note="COG: COG2723; Pfam: PF00232; InterPro: IPR001360"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10016"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68244"
FT                   /db_xref="GOA:D6ZMS3"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZMS3"
FT                   /protein_id="ADI68244.1"
FT                   DNNGFEVEIEE"
FT   gene            14228..15523
FT                   /locus_tag="HMPREF0837_10017"
FT   CDS_pept        14228..15523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10017"
FT                   /product="putative PTS system, cellobiose-specific IIC
FT                   component"
FT                   /note="COG: COG1455; Pfam: PF02378; InterPro: IPR004501"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10017"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68245"
FT                   /db_xref="GOA:D6ZMS4"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZMS4"
FT                   /protein_id="ADI68245.1"
FT   gene            15489..15836
FT                   /locus_tag="HMPREF0837_10018"
FT   CDS_pept        15489..15836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10018"
FT                   /product="PTS system, Lactose/Cellobiose specific IIB
FT                   subunit"
FT                   /note="COG: COG1440; Pfam: PF02302; InterPro: IPR003501"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10018"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68246"
FT                   /db_xref="GOA:D6ZMS5"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZMS5"
FT                   /protein_id="ADI68246.1"
FT                   EQALAWIGEIR"
FT   gene            15833..16141
FT                   /locus_tag="HMPREF0837_10019"
FT   CDS_pept        15833..16141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10019"
FT                   /product="PTS system, Lactose/Cellobiose specific IIA
FT                   subunit"
FT                   /note="COG: COG1447; Pfam: PF02255; InterPro: IPR003188"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10019"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68247"
FT                   /db_xref="GOA:D6ZMS6"
FT                   /db_xref="InterPro:IPR003188"
FT                   /db_xref="InterPro:IPR036542"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZMS6"
FT                   /protein_id="ADI68247.1"
FT   gene            complement(17127..19790)
FT                   /locus_tag="HMPREF0837_10020"
FT   CDS_pept        complement(17127..19790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10020"
FT                   /product="alcohol dehydrogenase, iron-dependent"
FT                   /EC_number=""
FT                   /note="Pfam: PF00465; InterPro: IPR001670"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10020"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68248"
FT                   /db_xref="GOA:D6ZMS7"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR012079"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR034789"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZMS7"
FT                   /protein_id="ADI68248.1"
FT                   IEDAYYGYKERPGRRK"
FT   gene            complement(19981..20118)
FT                   /locus_tag="HMPREF0837_10021"
FT   CDS_pept        complement(19981..20118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10021"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68249"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZMS8"
FT                   /protein_id="ADI68249.1"
FT                   "
FT   gene            complement(20078..20488)
FT                   /locus_tag="HMPREF0837_10022"
FT   CDS_pept        complement(20078..20488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10022"
FT                   /product="MORN repeat protein"
FT                   /note="Pfam: PF02493"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10022"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68250"
FT                   /db_xref="GOA:D6ZMS9"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="InterPro:IPR014590"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZMS9"
FT                   /protein_id="ADI68250.1"
FT   gene            complement(20490..20870)
FT                   /locus_tag="HMPREF0837_10023"
FT   CDS_pept        complement(20490..20870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10023"
FT                   /product="low molecular weight phosphotyrosine protein
FT                   phosphatase"
FT                   /note="COG: COG0394; Pfam: PF01451; InterPro: IPR000106"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10023"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68251"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZMT0"
FT                   /protein_id="ADI68251.1"
FT   gene            complement(20964..21263)
FT                   /gene="yajC"
FT                   /locus_tag="HMPREF0837_10024"
FT   CDS_pept        complement(20964..21263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajC"
FT                   /locus_tag="HMPREF0837_10024"
FT                   /product="preprotein translocase, YajC subunit"
FT                   /note="COG: COG1862; Pfam: PF02699; InterPro: IPR003849"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10024"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68252"
FT                   /db_xref="GOA:D6ZMT1"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZMT1"
FT                   /protein_id="ADI68252.1"
FT   gene            complement(21380..23356)
FT                   /gene="tkt"
FT                   /locus_tag="HMPREF0837_10025"
FT   CDS_pept        complement(21380..23356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tkt"
FT                   /locus_tag="HMPREF0837_10025"
FT                   /product="transketolase"
FT                   /EC_number=""
FT                   /note="COG: COG0021; Pfam: PF00456,PF02779,PF02780;
FT                   InterPro: IPR005478"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10025"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68253"
FT                   /db_xref="GOA:D6ZN62"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZN62"
FT                   /protein_id="ADI68253.1"
FT   gene            complement(23470..24561)
FT                   /locus_tag="HMPREF0837_10026"
FT                   /note="ulaG"
FT   CDS_pept        complement(23470..24561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10026"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2220; 3.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10026"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68254"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZN63"
FT                   /protein_id="ADI68254.1"
FT   gene            complement(24673..26304)
FT                   /locus_tag="HMPREF0837_10027"
FT   CDS_pept        complement(24673..26304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10027"
FT                   /product="PRD domain protein"
FT                   /note="COG: COG3711; Pfam: PF08279,PF00874; InterPro:
FT                   IPR011608"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10027"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68255"
FT                   /db_xref="GOA:D6ZN64"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZN64"
FT                   /protein_id="ADI68255.1"
FT   gene            complement(26304..26480)
FT                   /locus_tag="HMPREF0837_10028"
FT   CDS_pept        complement(26304..26480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10028"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68256"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZN65"
FT                   /protein_id="ADI68256.1"
FT                   WYWIRQVVIYFNI"
FT   gene            complement(26529..27233)
FT                   /locus_tag="HMPREF0837_10029"
FT   CDS_pept        complement(26529..27233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10029"
FT                   /product="putative L-ribulose-5-phosphate 4-epimerase"
FT                   /note="COG: COG0235; Pfam: PF00596; InterPro: IPR001303"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10029"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68257"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZN66"
FT                   /protein_id="ADI68257.1"
FT                   RKHGPNAYYGQK"
FT   gene            complement(27235..28098)
FT                   /locus_tag="HMPREF0837_10030"
FT   CDS_pept        complement(27235..28098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10030"
FT                   /product="putative hexulose-6-phosphate isomerase"
FT                   /note="COG: COG3623; Pfam: PF01261; InterPro: IPR004560"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10030"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68258"
FT                   /db_xref="GOA:D6ZN67"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR004560"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZN67"
FT                   /protein_id="ADI68258.1"
FT                   KKAGLM"
FT   gene            complement(28102..28767)
FT                   /gene="pyrF"
FT                   /locus_tag="HMPREF0837_10031"
FT   CDS_pept        complement(28102..28767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrF"
FT                   /locus_tag="HMPREF0837_10031"
FT                   /product="orotidine 5'-phosphate decarboxylase/HUMPS
FT                   family"
FT                   /EC_number=""
FT                   /note="COG: COG0269; Pfam: PF00215; InterPro: IPR013785"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10031"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68259"
FT                   /db_xref="GOA:D6ZN68"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041710"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZN68"
FT                   /protein_id="ADI68259.1"
FT   gene            complement(28784..29269)
FT                   /locus_tag="HMPREF0837_10032"
FT   CDS_pept        complement(28784..29269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10032"
FT                   /product="phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system, EIIA 2"
FT                   /note="COG: COG1762; Pfam: PF00359; InterPro: IPR002178"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10032"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68260"
FT                   /db_xref="GOA:D6ZN69"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZN69"
FT                   /protein_id="ADI68260.1"
FT   gene            complement(29345..29626)
FT                   /locus_tag="HMPREF0837_10033"
FT   CDS_pept        complement(29345..29626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10033"
FT                   /product="PTS system, Lactose/Cellobiose specific IIB
FT                   subunit"
FT                   /note="COG: COG3414; Pfam: PF02302; InterPro: IPR003501"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10033"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68261"
FT                   /db_xref="GOA:D6ZN70"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZN70"
FT                   /protein_id="ADI68261.1"
FT   gene            complement(29649..31106)
FT                   /locus_tag="HMPREF0837_10034"
FT   CDS_pept        complement(29649..31106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10034"
FT                   /product="putative sugar-specific permease, SgaT/UlaA"
FT                   /note="COG: COG3037; Pfam: PF04215; InterPro: IPR007333"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10034"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68262"
FT                   /db_xref="GOA:D6ZN71"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZN71"
FT                   /protein_id="ADI68262.1"
FT   gene            complement(31235..31858)
FT                   /locus_tag="HMPREF0837_10035"
FT   CDS_pept        complement(31235..31858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10035"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68263"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZN72"
FT                   /protein_id="ADI68263.1"
FT   gene            complement(31909..32895)
FT                   /locus_tag="HMPREF0837_10036"
FT   CDS_pept        complement(31909..32895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10036"
FT                   /product="R3H domain protein"
FT                   /note="COG: COG1847; Pfam: PF01424; InterPro: IPR001374"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10036"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68264"
FT                   /db_xref="GOA:D6ZN73"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR032782"
FT                   /db_xref="InterPro:IPR034079"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="InterPro:IPR038008"
FT                   /db_xref="InterPro:IPR038247"
FT                   /db_xref="InterPro:IPR039247"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZN73"
FT                   /protein_id="ADI68264.1"
FT   gene            complement(32914..33744)
FT                   /locus_tag="HMPREF0837_10037"
FT   CDS_pept        complement(32914..33744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10037"
FT                   /product="membrane protein insertase, YidC/Oxa1 family"
FT                   /note="COG: COG0706; Pfam: PF02096; InterPro: IPR001708"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10037"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68265"
FT                   /db_xref="GOA:D6ZN74"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR023060"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZN74"
FT                   /protein_id="ADI68265.1"
FT   gene            complement(33713..34084)
FT                   /gene="rnpA"
FT                   /locus_tag="HMPREF0837_10038"
FT   CDS_pept        complement(33713..34084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnpA"
FT                   /locus_tag="HMPREF0837_10038"
FT                   /product="ribonuclease P protein component"
FT                   /EC_number=""
FT                   /note="COG: COG0594; Pfam: PF00825; InterPro: IPR014721"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10038"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68266"
FT                   /db_xref="GOA:D6ZN75"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZN75"
FT                   /protein_id="ADI68266.1"
FT   gene            complement(34101..34232)
FT                   /locus_tag="HMPREF0837_10039"
FT   CDS_pept        complement(34101..34232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10039"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68267"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZN76"
FT                   /protein_id="ADI68267.1"
FT   gene            complement(34233..35423)
FT                   /gene="ackA"
FT                   /locus_tag="HMPREF0837_10040"
FT   CDS_pept        complement(34233..35423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ackA"
FT                   /locus_tag="HMPREF0837_10040"
FT                   /product="acetate kinase"
FT                   /EC_number=""
FT                   /note="COG: COG0282; Pfam: PF00871; InterPro: IPR004372"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10040"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68268"
FT                   /db_xref="GOA:D6ZN77"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZN77"
FT                   /protein_id="ADI68268.1"
FT   gene            complement(35474..36427)
FT                   /locus_tag="HMPREF0837_10041"
FT   CDS_pept        complement(35474..36427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10041"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0827;"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10041"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68269"
FT                   /db_xref="GOA:D6ZN78"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZN78"
FT                   /protein_id="ADI68269.1"
FT   gene            complement(36488..37075)
FT                   /locus_tag="HMPREF0837_10042"
FT   CDS_pept        complement(36488..37075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10042"
FT                   /product="methyltransferase domain protein"
FT                   /note="Pfam: PF08242; InterPro: IPR013217"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10042"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68270"
FT                   /db_xref="GOA:D6ZN79"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZN79"
FT                   /protein_id="ADI68270.1"
FT   gene            complement(37212..37625)
FT                   /locus_tag="HMPREF0837_10043"
FT   CDS_pept        complement(37212..37625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10043"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68271"
FT                   /db_xref="GOA:D6ZN80"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZN80"
FT                   /protein_id="ADI68271.1"
FT   gene            complement(37603..38064)
FT                   /locus_tag="HMPREF0837_10044"
FT   CDS_pept        complement(37603..38064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10044"
FT                   /product="prepilin-type cleavage/methylation N-terminal
FT                   domain protein"
FT                   /note="COG: COG4940"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10044"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68272"
FT                   /db_xref="GOA:D6ZN81"
FT                   /db_xref="InterPro:IPR016977"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZN81"
FT                   /protein_id="ADI68272.1"
FT   gene            complement(38027..38329)
FT                   /locus_tag="HMPREF0837_10045"
FT   CDS_pept        complement(38027..38329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10045"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68273"
FT                   /db_xref="GOA:D6ZN82"
FT                   /db_xref="InterPro:IPR021749"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZN82"
FT                   /protein_id="ADI68273.1"
FT   gene            complement(38292..38696)
FT                   /locus_tag="HMPREF0837_10046"
FT   CDS_pept        complement(38292..38696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10046"
FT                   /product="prepilin-type cleavage/methylation N-terminal
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10046"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68274"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZN83"
FT                   /protein_id="ADI68274.1"
FT   gene            complement(38689..39015)
FT                   /locus_tag="HMPREF0837_10047"
FT   CDS_pept        complement(38689..39015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10047"
FT                   /product="prepilin-type cleavage/methylation N-terminal
FT                   domain protein"
FT                   /note="COG: COG4537; Pfam: PF07963"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10047"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68275"
FT                   /db_xref="GOA:D6ZN84"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR016940"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZN84"
FT                   /protein_id="ADI68275.1"
FT                   KVND"
FT   gene            complement(39017..40033)
FT                   /locus_tag="HMPREF0837_10048"
FT   CDS_pept        complement(39017..40033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10048"
FT                   /product="bacterial type II secretion system domain protein
FT                   F"
FT                   /note="COG: COG1459; Pfam: PF00482; InterPro: IPR001992"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10048"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68276"
FT                   /db_xref="GOA:D6ZN85"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZN85"
FT                   /protein_id="ADI68276.1"
FT   gene            complement(39981..40922)
FT                   /locus_tag="HMPREF0837_10049"
FT   CDS_pept        complement(39981..40922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10049"
FT                   /product="type II/IV secretion system protein"
FT                   /note="COG: COG2804; Pfam: PF00437; InterPro: IPR001482"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10049"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68277"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZN86"
FT                   /protein_id="ADI68277.1"
FT   gene            complement(40998..41369)
FT                   /locus_tag="HMPREF0837_10050"
FT   CDS_pept        complement(40998..41369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10050"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4699; Pfam: PF06279; InterPro: IPR010434"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10050"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68278"
FT                   /db_xref="InterPro:IPR010434"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZN87"
FT                   /protein_id="ADI68278.1"
FT   gene            complement(41514..42572)
FT                   /locus_tag="HMPREF0837_10051"
FT   CDS_pept        complement(41514..42572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10051"
FT                   /product="GroES-like protein"
FT                   /note="COG: COG1063; Pfam: PF08240,PF00107; InterPro:
FT                   IPR002085"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10051"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68279"
FT                   /db_xref="GOA:D6ZN88"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZN88"
FT                   /protein_id="ADI68279.1"
FT                   IKVIIENDISEA"
FT   gene            complement(42735..43886)
FT                   /gene="nagA"
FT                   /locus_tag="HMPREF0837_10052"
FT   CDS_pept        complement(42735..43886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagA"
FT                   /locus_tag="HMPREF0837_10052"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /EC_number=""
FT                   /note="COG: COG1820; Pfam: PF01979; InterPro: IPR003764"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10052"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68280"
FT                   /db_xref="GOA:D6ZN89"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZN89"
FT                   /protein_id="ADI68280.1"
FT   gene            complement(44039..45856)
FT                   /locus_tag="HMPREF0837_10053"
FT   CDS_pept        complement(44039..45856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10053"
FT                   /product="acyltransferase"
FT                   /note="COG: COG1835; Pfam: PF01757; InterPro: IPR002656"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10053"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68281"
FT                   /db_xref="GOA:D6ZN90"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZN90"
FT                   /protein_id="ADI68281.1"
FT   gene            complement(45957..47099)
FT                   /gene="tgt"
FT                   /locus_tag="HMPREF0837_10054"
FT   CDS_pept        complement(45957..47099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="HMPREF0837_10054"
FT                   /product="tRNA-guanine transglycosylase"
FT                   /EC_number=""
FT                   /note="COG: COG0343; Pfam: PF01702; InterPro: IPR004803"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10054"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68282"
FT                   /db_xref="GOA:D6ZN91"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZN91"
FT                   /protein_id="ADI68282.1"
FT   gene            47229..48086
FT                   /locus_tag="HMPREF0837_10055"
FT   CDS_pept        47229..48086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10055"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG5523; Pfam: PF06161; InterPro: IPR010380"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10055"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68283"
FT                   /db_xref="GOA:D6ZN92"
FT                   /db_xref="InterPro:IPR010380"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZN92"
FT                   /protein_id="ADI68283.1"
FT                   RPKA"
FT   gene            complement(48114..48758)
FT                   /gene="pcp"
FT                   /locus_tag="HMPREF0837_10056"
FT   CDS_pept        complement(48114..48758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcp"
FT                   /locus_tag="HMPREF0837_10056"
FT                   /product="pyroglutamyl-peptidase I"
FT                   /EC_number=""
FT                   /note="COG: COG2039; Pfam: PF01470; InterPro: IPR000816"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10056"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68284"
FT                   /db_xref="GOA:D6ZN93"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="InterPro:IPR029762"
FT                   /db_xref="InterPro:IPR033693"
FT                   /db_xref="InterPro:IPR033694"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZN93"
FT                   /protein_id="ADI68284.1"
FT   gene            complement(48833..49234)
FT                   /locus_tag="HMPREF0837_10057"
FT   CDS_pept        complement(48833..49234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10057"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3759; Pfam: PF06993; InterPro: IPR009732"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10057"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68285"
FT                   /db_xref="GOA:D6ZN94"
FT                   /db_xref="InterPro:IPR009732"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZN94"
FT                   /protein_id="ADI68285.1"
FT   gene            complement(49245..49670)
FT                   /locus_tag="HMPREF0837_10058"
FT   CDS_pept        complement(49245..49670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10058"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="COG: COG1846; Pfam: PF01047; InterPro: IPR000835"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10058"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68286"
FT                   /db_xref="GOA:D6ZN95"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZN95"
FT                   /protein_id="ADI68286.1"
FT   gene            complement(49754..49945)
FT                   /locus_tag="HMPREF0837_10059"
FT   CDS_pept        complement(49754..49945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10059"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68287"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZN96"
FT                   /protein_id="ADI68287.1"
FT                   FIEYQFEWKMESYHLVMS"
FT   gene            complement(49993..51135)
FT                   /locus_tag="HMPREF0837_10060"
FT   CDS_pept        complement(49993..51135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10060"
FT                   /product="LysM domain protein"
FT                   /note="Pfam: PF01476"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10060"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68288"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZN97"
FT                   /protein_id="ADI68288.1"
FT   gene            complement(51301..51921)
FT                   /locus_tag="HMPREF0837_10061"
FT   CDS_pept        complement(51301..51921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10061"
FT                   /product="HAD hydrolase, family IA, variant 1"
FT                   /note="COG: COG0546; Pfam: PF00702; InterPro: IPR005834"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10061"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68289"
FT                   /db_xref="GOA:D6ZN98"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZN98"
FT                   /protein_id="ADI68289.1"
FT   gene            complement(51925..53205)
FT                   /locus_tag="HMPREF0837_10062"
FT   CDS_pept        complement(51925..53205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10062"
FT                   /product="MATE efflux family protein"
FT                   /note="COG: COG0534; Pfam: PF01554; InterPro: IPR002528"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10062"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68290"
FT                   /db_xref="GOA:D6ZN99"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZN99"
FT                   /protein_id="ADI68290.1"
FT   gene            complement(53266..54750)
FT                   /gene="thrC"
FT                   /locus_tag="HMPREF0837_10063"
FT   CDS_pept        complement(53266..54750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrC"
FT                   /locus_tag="HMPREF0837_10063"
FT                   /product="threonine synthase"
FT                   /EC_number=""
FT                   /note="COG: COG0498; Pfam: PF00291; InterPro: IPR004450"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10063"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68291"
FT                   /db_xref="GOA:D6ZNA0"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNA0"
FT                   /protein_id="ADI68291.1"
FT   gene            complement(54826..56103)
FT                   /locus_tag="HMPREF0837_10064"
FT   CDS_pept        complement(54826..56103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10064"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3572"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10064"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68292"
FT                   /db_xref="GOA:D6ZNA1"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR035434"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNA1"
FT                   /protein_id="ADI68292.1"
FT   gene            complement(56210..56293)
FT                   /locus_tag="HMPREF0837_t10002"
FT   tRNA            complement(56210..56293)
FT                   /locus_tag="HMPREF0837_t10002"
FT                   /product="tRNA-Leu"
FT   gene            complement(56303..56374)
FT                   /locus_tag="HMPREF0837_t10003"
FT   tRNA            complement(56303..56374)
FT                   /locus_tag="HMPREF0837_t10003"
FT                   /product="tRNA-Gln"
FT   gene            complement(56385..56457)
FT                   /locus_tag="HMPREF0837_t10004"
FT   tRNA            complement(56385..56457)
FT                   /locus_tag="HMPREF0837_t10004"
FT                   /product="tRNA-His"
FT   gene            complement(56472..56542)
FT                   /locus_tag="HMPREF0837_t10005"
FT   tRNA            complement(56472..56542)
FT                   /locus_tag="HMPREF0837_t10005"
FT                   /product="tRNA-Trp"
FT   gene            complement(56547..56627)
FT                   /locus_tag="HMPREF0837_t10006"
FT   tRNA            complement(56547..56627)
FT                   /locus_tag="HMPREF0837_t10006"
FT                   /product="tRNA-Tyr"
FT   gene            complement(56640..56712)
FT                   /locus_tag="HMPREF0837_t10007"
FT   tRNA            complement(56640..56712)
FT                   /locus_tag="HMPREF0837_t10007"
FT                   /product="tRNA-Phe"
FT   gene            complement(56716..56789)
FT                   /locus_tag="HMPREF0837_t10008"
FT   tRNA            complement(56716..56789)
FT                   /locus_tag="HMPREF0837_t10008"
FT                   /product="tRNA-Met"
FT   gene            complement(56800..56889)
FT                   /locus_tag="HMPREF0837_t10009"
FT   tRNA            complement(56800..56889)
FT                   /locus_tag="HMPREF0837_t10009"
FT                   /product="tRNA-Ser"
FT   gene            complement(56972..57045)
FT                   /locus_tag="HMPREF0837_t10010"
FT   tRNA            complement(56972..57045)
FT                   /locus_tag="HMPREF0837_t10010"
FT                   /product="tRNA-Ile"
FT   gene            complement(57080..57150)
FT                   /locus_tag="HMPREF0837_t10011"
FT   tRNA            complement(57080..57150)
FT                   /locus_tag="HMPREF0837_t10011"
FT                   /product="tRNA-Gly"
FT   gene            complement(57156..57228)
FT                   /locus_tag="HMPREF0837_t10012"
FT   tRNA            complement(57156..57228)
FT                   /locus_tag="HMPREF0837_t10012"
FT                   /product="tRNA-Val"
FT   gene            complement(57232..57345)
FT                   /locus_tag="HMPREF0837_r10001"
FT   rRNA            complement(57232..57345)
FT                   /locus_tag="HMPREF0837_r10001"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(57425..60324)
FT                   /locus_tag="HMPREF0837_r10002"
FT   rRNA            complement(57425..60324)
FT                   /locus_tag="HMPREF0837_r10002"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(60163..60314)
FT                   /locus_tag="HMPREF0837_nc10001"
FT   ncRNA           complement(60163..60314)
FT                   /locus_tag="HMPREF0837_nc10001"
FT                   /note="similar to 5.8S ribosomal RNA"
FT                   /ncRNA_class="other"
FT   gene            complement(60451..60523)
FT                   /locus_tag="HMPREF0837_t10013"
FT   tRNA            complement(60451..60523)
FT                   /locus_tag="HMPREF0837_t10013"
FT                   /product="tRNA-Ala"
FT   gene            complement(60580..62113)
FT                   /locus_tag="HMPREF0837_r10003"
FT   rRNA            complement(60580..62113)
FT                   /locus_tag="HMPREF0837_r10003"
FT                   /product="16S ribosomal RNA"
FT   gene            62171..62314
FT                   /locus_tag="HMPREF0837_10065"
FT   CDS_pept        62171..62314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10065"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68293"
FT                   /db_xref="GOA:D6ZNA2"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNA2"
FT                   /protein_id="ADI68293.1"
FT                   LF"
FT   gene            complement(62372..62443)
FT                   /locus_tag="HMPREF0837_t10014"
FT   tRNA            complement(62372..62443)
FT                   /locus_tag="HMPREF0837_t10014"
FT                   /product="tRNA-Glu"
FT   gene            complement(62564..62998)
FT                   /locus_tag="HMPREF0837_10066"
FT   CDS_pept        complement(62564..62998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10066"
FT                   /product="cytidine/deoxycytidylate deaminase family
FT                   protein"
FT                   /note="COG: COG0295"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10066"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68294"
FT                   /db_xref="GOA:D6ZNA3"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNA3"
FT                   /protein_id="ADI68294.1"
FT   gene            complement(63012..64472)
FT                   /gene="gltX"
FT                   /locus_tag="HMPREF0837_10067"
FT   CDS_pept        complement(63012..64472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="HMPREF0837_10067"
FT                   /product="glutamate--tRNA ligase"
FT                   /EC_number=""
FT                   /note="COG: COG0008; Pfam: PF00749; InterPro: IPR004527"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10067"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68295"
FT                   /db_xref="GOA:D6ZNA4"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNA4"
FT                   /protein_id="ADI68295.1"
FT   gene            complement(64596..65978)
FT                   /gene="pgi"
FT                   /locus_tag="HMPREF0837_10068"
FT   CDS_pept        complement(64596..65978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgi"
FT                   /locus_tag="HMPREF0837_10068"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /EC_number=""
FT                   /note="COG: COG0166; Pfam: PF00342; InterPro: IPR001672"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10068"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68296"
FT                   /db_xref="GOA:D6ZNA5"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNA5"
FT                   /protein_id="ADI68296.1"
FT                   RL"
FT   gene            complement(65932..66111)
FT                   /locus_tag="HMPREF0837_10069"
FT   CDS_pept        complement(65932..66111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10069"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68297"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNA6"
FT                   /protein_id="ADI68297.1"
FT                   DRKEEILEEEHVTY"
FT   gene            complement(66115..66843)
FT                   /locus_tag="HMPREF0837_10070"
FT   CDS_pept        complement(66115..66843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10070"
FT                   /product="peptidase C26"
FT                   /note="COG: COG2071; Pfam: PF07722; InterPro: IPR011697"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10070"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68298"
FT                   /db_xref="GOA:D6ZNA7"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNA7"
FT                   /protein_id="ADI68298.1"
FT   gene            complement(66943..68709)
FT                   /locus_tag="HMPREF0837_10071"
FT   CDS_pept        complement(66943..68709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10071"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="COG: COG1132; Pfam: PF00664,PF00005; InterPro:
FT                   IPR001140"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10071"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68299"
FT                   /db_xref="GOA:D6ZNA8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNA8"
FT                   /protein_id="ADI68299.1"
FT                   YSELYHNQFVFE"
FT   gene            68862..69170
FT                   /locus_tag="HMPREF0837_10072"
FT   CDS_pept        68862..69170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10072"
FT                   /product="hypothetical protein"
FT                   /note="Pfam: PF02371"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10072"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68300"
FT                   /db_xref="GOA:D6ZNA9"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNA9"
FT                   /protein_id="ADI68300.1"
FT   gene            complement(69501..71195)
FT                   /locus_tag="HMPREF0837_10073"
FT   CDS_pept        complement(69501..71195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10073"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="COG: COG1132; Pfam: PF00664,PF00005; InterPro:
FT                   IPR001140"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10073"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68301"
FT                   /db_xref="GOA:D6ZNB0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNB0"
FT                   /protein_id="ADI68301.1"
FT   gene            complement(71342..73876)
FT                   /gene="mutS"
FT                   /locus_tag="HMPREF0837_10074"
FT   CDS_pept        complement(71342..73876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutS"
FT                   /locus_tag="HMPREF0837_10074"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /note="COG: COG0249; Pfam:
FT                   PF01624,PF05188,PF05192,PF05190,PF00488; InterPro:
FT                   IPR005748"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10074"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68302"
FT                   /db_xref="GOA:D6ZNB1"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNB1"
FT                   /protein_id="ADI68302.1"
FT   gene            complement(73927..74373)
FT                   /gene="argR"
FT                   /locus_tag="HMPREF0837_10075"
FT   CDS_pept        complement(73927..74373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argR"
FT                   /locus_tag="HMPREF0837_10075"
FT                   /product="arginine repressor"
FT                   /note="COG: COG1438; Pfam: PF01316,PF02863; InterPro:
FT                   IPR001669"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10075"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68303"
FT                   /db_xref="GOA:D6ZNB2"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR036251"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNB2"
FT                   /protein_id="ADI68303.1"
FT   gene            74509..76200
FT                   /gene="argS"
FT                   /locus_tag="HMPREF0837_10076"
FT   CDS_pept        74509..76200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="HMPREF0837_10076"
FT                   /product="arginine--tRNA ligase"
FT                   /EC_number=""
FT                   /note="COG: COG0018; Pfam: PF03485,PF00750,PF05746;
FT                   InterPro: IPR001278"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10076"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68304"
FT                   /db_xref="GOA:D6ZNB3"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNB3"
FT                   /protein_id="ADI68304.1"
FT   gene            complement(76515..76904)
FT                   /locus_tag="HMPREF0837_10077"
FT   CDS_pept        complement(76515..76904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10077"
FT                   /product="transposase, IS4 family"
FT                   /note="COG: COG3293; Pfam: PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10077"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68305"
FT                   /db_xref="InterPro:IPR027806"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNB4"
FT                   /protein_id="ADI68305.1"
FT   gene            77034..77543
FT                   /locus_tag="HMPREF0837_10078"
FT   CDS_pept        77034..77543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10078"
FT                   /product="cupin family protein"
FT                   /note="COG: COG3542; Pfam: PF06172; InterPro: IPR014710"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10078"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68306"
FT                   /db_xref="InterPro:IPR009327"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR039935"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNB5"
FT                   /protein_id="ADI68306.1"
FT                   ERLTRY"
FT   gene            77627..78334
FT                   /locus_tag="HMPREF0837_10079"
FT   CDS_pept        77627..78334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10079"
FT                   /product="response regulator receiver domain protein"
FT                   /note="COG: COG0745; Pfam: PF00072,PF00486; InterPro:
FT                   IPR001789"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10079"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68307"
FT                   /db_xref="GOA:D6ZNB6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNB6"
FT                   /protein_id="ADI68307.1"
FT                   RTIRGYGYKFKEL"
FT   gene            78335..79666
FT                   /locus_tag="HMPREF0837_10080"
FT   CDS_pept        78335..79666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10080"
FT                   /product="ATPase/histidine kinase/DNA gyrase B/HSP90 domain
FT                   protein"
FT                   /note="COG: COG0642; Pfam: PF00512,PF02518; InterPro:
FT                   IPR003594"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10080"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68308"
FT                   /db_xref="GOA:D6ZNB7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNB7"
FT                   /protein_id="ADI68308.1"
FT   gene            79833..80708
FT                   /locus_tag="HMPREF0837_10081"
FT   CDS_pept        79833..80708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10081"
FT                   /product="putative Phosphate-binding protein PstS 2"
FT                   /note="COG: COG0226"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10081"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68309"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNB8"
FT                   /protein_id="ADI68309.1"
FT                   GKLTTWDKIK"
FT   gene            80826..81689
FT                   /gene="pstC"
FT                   /locus_tag="HMPREF0837_10082"
FT   CDS_pept        80826..81689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstC"
FT                   /locus_tag="HMPREF0837_10082"
FT                   /product="phosphate ABC transporter, permease protein PstC"
FT                   /note="COG: COG0573; Pfam: PF00528; InterPro: IPR011864"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10082"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68310"
FT                   /db_xref="GOA:D6ZNB9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNB9"
FT                   /protein_id="ADI68310.1"
FT                   GKSSYE"
FT   gene            81682..82497
FT                   /gene="pstA"
FT                   /locus_tag="HMPREF0837_10083"
FT   CDS_pept        81682..82497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstA"
FT                   /locus_tag="HMPREF0837_10083"
FT                   /product="phosphate ABC transporter, permease protein PstA"
FT                   /note="COG: COG0581; Pfam: PF00528; InterPro: IPR005672"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10083"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68311"
FT                   /db_xref="GOA:D6ZNC0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNC0"
FT                   /protein_id="ADI68311.1"
FT   gene            82499..83251
FT                   /gene="pstB"
FT                   /locus_tag="HMPREF0837_10084"
FT   CDS_pept        82499..83251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB"
FT                   /locus_tag="HMPREF0837_10084"
FT                   /product="phosphate ABC transporter, ATP-binding protein"
FT                   /EC_number=""
FT                   /note="COG: COG1117; Pfam: PF00005; InterPro: IPR005670"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10084"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68312"
FT                   /db_xref="GOA:D6ZNC1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNC1"
FT                   /protein_id="ADI68312.1"
FT   gene            83266..83916
FT                   /gene="phoU"
FT                   /locus_tag="HMPREF0837_10085"
FT   CDS_pept        83266..83916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoU"
FT                   /locus_tag="HMPREF0837_10085"
FT                   /product="phosphate transport system regulatory protein
FT                   PhoU"
FT                   /note="COG: COG0704; Pfam: PF01895; InterPro: IPR008170"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10085"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68313"
FT                   /db_xref="GOA:D6ZNC2"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNC2"
FT                   /protein_id="ADI68313.1"
FT   gene            83984..84409
FT                   /locus_tag="HMPREF0837_10086"
FT   CDS_pept        83984..84409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10086"
FT                   /product="hypothetical protein"
FT                   /note="Pfam: PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10086"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68314"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNC3"
FT                   /protein_id="ADI68314.1"
FT   gene            complement(84583..84963)
FT                   /locus_tag="HMPREF0837_10087"
FT   CDS_pept        complement(84583..84963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10087"
FT                   /product="DNA-binding helix-turn-helix protein"
FT                   /note="Pfam: PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10087"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68315"
FT                   /db_xref="GOA:D6ZNC4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNC4"
FT                   /protein_id="ADI68315.1"
FT   gene            85175..86191
FT                   /gene="gpsA"
FT                   /locus_tag="HMPREF0837_10088"
FT   CDS_pept        85175..86191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="HMPREF0837_10088"
FT                   /product="glycerol-3-phosphate dehydrogenase [NAD(P)+]"
FT                   /EC_number=""
FT                   /note="COG: COG0240; Pfam: PF01210,PF07479; InterPro:
FT                   IPR006168"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10088"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68316"
FT                   /db_xref="GOA:D6ZNC5"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNC5"
FT                   /protein_id="ADI68316.1"
FT   gene            86213..87112
FT                   /gene="galU"
FT                   /locus_tag="HMPREF0837_10089"
FT   CDS_pept        86213..87112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galU"
FT                   /locus_tag="HMPREF0837_10089"
FT                   /product="UTP--glucose-1-phosphate uridylyltransferase"
FT                   /EC_number=""
FT                   /note="COG: COG1210; Pfam: PF00483; InterPro: IPR005835"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10089"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68317"
FT                   /db_xref="GOA:D6ZNC6"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNC6"
FT                   /protein_id="ADI68317.1"
FT                   DDLKNYLIQLGKELTEKE"
FT   gene            complement(87184..87861)
FT                   /locus_tag="HMPREF0837_10090"
FT   CDS_pept        complement(87184..87861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10090"
FT                   /product="peptidase, S54 family"
FT                   /EC_number="3.4.21.-"
FT                   /note="COG: COG0705; Pfam: PF01694; InterPro: IPR002610"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10090"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68318"
FT                   /db_xref="GOA:D6ZNC7"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNC7"
FT                   /protein_id="ADI68318.1"
FT                   MGM"
FT   gene            complement(87845..88384)
FT                   /locus_tag="HMPREF0837_10091"
FT   CDS_pept        complement(87845..88384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10091"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /EC_number=""
FT                   /note="COG: COG0212; Pfam: PF01812; InterPro: IPR002698"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10091"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68319"
FT                   /db_xref="GOA:D6ZNC8"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNC8"
FT                   /protein_id="ADI68319.1"
FT                   NHDIPVQEVLIDEGNL"
FT   gene            complement(88396..89526)
FT                   /locus_tag="HMPREF0837_10092"
FT   CDS_pept        complement(88396..89526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10092"
FT                   /product="amidohydrolase"
FT                   /note="COG: COG1473; Pfam: PF01546,PF07687; InterPro:
FT                   IPR010168"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10092"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68320"
FT                   /db_xref="GOA:D6ZNC9"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR023905"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNC9"
FT                   /protein_id="ADI68320.1"
FT   gene            complement(89594..90292)
FT                   /gene="dapD"
FT                   /locus_tag="HMPREF0837_10093"
FT   CDS_pept        complement(89594..90292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapD"
FT                   /locus_tag="HMPREF0837_10093"
FT                   /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-acetyltransferase"
FT                   /EC_number=""
FT                   /note="COG: COG2171; Pfam: PF08503,PF00132; InterPro:
FT                   IPR013710"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10093"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68321"
FT                   /db_xref="GOA:D6ZND0"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR013710"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR019873"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZND0"
FT                   /protein_id="ADI68321.1"
FT                   TALEDALRTL"
FT   gene            complement(90522..91484)
FT                   /locus_tag="HMPREF0837_10094"
FT   CDS_pept        complement(90522..91484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10094"
FT                   /product="putative membrane protein"
FT                   /note="COG: COG0697; Pfam: PF00892; InterPro: IPR000620"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10094"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68322"
FT                   /db_xref="GOA:D6ZND1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZND1"
FT                   /protein_id="ADI68322.1"
FT   gene            complement(91498..93963)
FT                   /locus_tag="HMPREF0837_10095"
FT   CDS_pept        complement(91498..93963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10095"
FT                   /product="transglycosylase"
FT                   /note="COG: COG0744; Pfam: PF00912,PF00905; InterPro:
FT                   IPR001460"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10095"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68323"
FT                   /db_xref="GOA:D6ZND2"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZND2"
FT                   /protein_id="ADI68323.1"
FT                   RPSSSRARR"
FT   gene            94105..95361
FT                   /gene="tyrS"
FT                   /locus_tag="HMPREF0837_10096"
FT   CDS_pept        94105..95361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="HMPREF0837_10096"
FT                   /product="tyrosine--tRNA ligase"
FT                   /EC_number=""
FT                   /note="COG: COG0162; Pfam: PF00579,PF01479; InterPro:
FT                   IPR002307"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10096"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68324"
FT                   /db_xref="GOA:D6ZND3"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZND3"
FT                   /protein_id="ADI68324.1"
FT   gene            complement(95439..97511)
FT                   /locus_tag="HMPREF0837_10097"
FT   CDS_pept        complement(95439..97511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10097"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /EC_number="3.6.3.-"
FT                   /note="COG: COG2217; Pfam: PF00122,PF00702; InterPro:
FT                   IPR006404"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10097"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68325"
FT                   /db_xref="GOA:D6ZND4"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZND4"
FT                   /protein_id="ADI68325.1"
FT   gene            complement(97504..97815)
FT                   /locus_tag="HMPREF0837_10098"
FT   CDS_pept        complement(97504..97815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10098"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10098"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68326"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZND5"
FT                   /protein_id="ADI68326.1"
FT   gene            97934..98782
FT                   /locus_tag="HMPREF0837_10099"
FT   CDS_pept        97934..98782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10099"
FT                   /product="methyltransferase domain protein"
FT                   /note="COG: COG0500; Pfam: PF08241; InterPro: IPR013216"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10099"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68327"
FT                   /db_xref="GOA:D6ZND6"
FT                   /db_xref="InterPro:IPR016718"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZND6"
FT                   /protein_id="ADI68327.1"
FT                   F"
FT   gene            complement(98978..99157)
FT                   /locus_tag="HMPREF0837_10100"
FT   CDS_pept        complement(98978..99157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10100"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68328"
FT                   /db_xref="GOA:D6ZND7"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZND7"
FT                   /protein_id="ADI68328.1"
FT                   TFAKSSLYSMKIKE"
FT   gene            complement(99343..99549)
FT                   /locus_tag="HMPREF0837_10101"
FT   CDS_pept        complement(99343..99549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10101"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68329"
FT                   /db_xref="GOA:D6ZND8"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZND8"
FT                   /protein_id="ADI68329.1"
FT   gene            complement(99633..99788)
FT                   /locus_tag="HMPREF0837_10102"
FT   CDS_pept        complement(99633..99788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10102"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68330"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZND9"
FT                   /protein_id="ADI68330.1"
FT                   KRNDLV"
FT   gene            complement(100001..100147)
FT                   /locus_tag="HMPREF0837_10103"
FT   CDS_pept        complement(100001..100147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10103"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10103"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68331"
FT                   /db_xref="GOA:D6ZNE0"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNE0"
FT                   /protein_id="ADI68331.1"
FT                   FMY"
FT   gene            complement(100504..102762)
FT                   /gene="glgP"
FT                   /locus_tag="HMPREF0837_10104"
FT   CDS_pept        complement(100504..102762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgP"
FT                   /locus_tag="HMPREF0837_10104"
FT                   /product="phosphorylase, glycogen/starch/alpha-glucan
FT                   family"
FT                   /EC_number=""
FT                   /note="COG: COG0058; Pfam: PF00343; InterPro: IPR011833"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10104"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68332"
FT                   /db_xref="GOA:D6ZNE1"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNE1"
FT                   /protein_id="ADI68332.1"
FT   gene            complement(102788..104305)
FT                   /gene="malQ"
FT                   /locus_tag="HMPREF0837_10105"
FT   CDS_pept        complement(102788..104305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malQ"
FT                   /locus_tag="HMPREF0837_10105"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number=""
FT                   /note="COG: COG1640; Pfam: PF02446; InterPro: IPR003385"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10105"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68333"
FT                   /db_xref="GOA:D6ZNE2"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNE2"
FT                   /protein_id="ADI68333.1"
FT   gene            104870..106126
FT                   /locus_tag="HMPREF0837_10106"
FT   CDS_pept        104870..106126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10106"
FT                   /product="ABC transporter, solute-binding protein"
FT                   /note="COG: COG2182; Pfam: PF01547; InterPro: IPR006059"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10106"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68334"
FT                   /db_xref="GOA:D6ZNE3"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006060"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNE3"
FT                   /protein_id="ADI68334.1"
FT   gene            106222..107529
FT                   /locus_tag="HMPREF0837_10107"
FT   CDS_pept        106222..107529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10107"
FT                   /product="ABC transporter, permease protein"
FT                   /note="COG: COG1175; Pfam: PF05154,PF00528; InterPro:
FT                   IPR000515"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10107"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68335"
FT                   /db_xref="GOA:D6ZNE4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR030156"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNE4"
FT                   /protein_id="ADI68335.1"
FT   gene            107531..108373
FT                   /locus_tag="HMPREF0837_10108"
FT   CDS_pept        107531..108373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10108"
FT                   /product="ABC transporter, permease protein"
FT                   /note="COG: COG3833; Pfam: PF00528; InterPro: IPR000515"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10108"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68336"
FT                   /db_xref="GOA:D6ZNE5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNE5"
FT                   /protein_id="ADI68336.1"
FT   gene            108749..109426
FT                   /locus_tag="HMPREF0837_10109"
FT   CDS_pept        108749..109426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10109"
FT                   /product="putative maltodextrose utilization protein MalA"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10109"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68337"
FT                   /db_xref="GOA:D6ZNE6"
FT                   /db_xref="InterPro:IPR009574"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNE6"
FT                   /protein_id="ADI68337.1"
FT                   YHK"
FT   gene            109436..110422
FT                   /gene="malR"
FT                   /locus_tag="HMPREF0837_10110"
FT   CDS_pept        109436..110422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="malR"
FT                   /locus_tag="HMPREF0837_10110"
FT                   /product="HTH-type transcriptional regulator MalR"
FT                   /note="COG: COG1609; Pfam: PF00356,PF00532; InterPro:
FT                   IPR001761"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10110"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68338"
FT                   /db_xref="GOA:D6ZNE7"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNE7"
FT                   /protein_id="ADI68338.1"
FT   gene            complement(110464..110655)
FT                   /locus_tag="HMPREF0837_10111"
FT   CDS_pept        complement(110464..110655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10111"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10111"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68339"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNE8"
FT                   /protein_id="ADI68339.1"
FT                   KEVNLPTLKRIVSSFFNT"
FT   gene            complement(110713..111654)
FT                   /locus_tag="HMPREF0837_10112"
FT   CDS_pept        complement(110713..111654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10112"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1284; Pfam: PF02588; InterPro: IPR003740"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10112"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68340"
FT                   /db_xref="GOA:D6ZNE9"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNE9"
FT                   /protein_id="ADI68340.1"
FT   gene            complement(111632..113395)
FT                   /gene="aspS"
FT                   /locus_tag="HMPREF0837_10113"
FT   CDS_pept        complement(111632..113395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspS"
FT                   /locus_tag="HMPREF0837_10113"
FT                   /product="aspartate--tRNA ligase"
FT                   /EC_number=""
FT                   /note="COG: COG0173; Pfam: PF01336,PF00152,PF02938;
FT                   InterPro: IPR004524"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10113"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68341"
FT                   /db_xref="GOA:D6ZNF0"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNF0"
FT                   /protein_id="ADI68341.1"
FT                   QVEEDETSKTN"
FT   gene            complement(113514..113705)
FT                   /locus_tag="HMPREF0837_10114"
FT   CDS_pept        complement(113514..113705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10114"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10114"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68342"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNF1"
FT                   /protein_id="ADI68342.1"
FT                   HTYGKATLTWFEEIFEEY"
FT   gene            complement(113747..113977)
FT                   /locus_tag="HMPREF0837_10115"
FT   CDS_pept        complement(113747..113977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10115"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68343"
FT                   /db_xref="GOA:D6ZNF2"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNF2"
FT                   /protein_id="ADI68343.1"
FT   gene            complement(113995..114636)
FT                   /locus_tag="HMPREF0837_10116"
FT   CDS_pept        complement(113995..114636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10116"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /note="Pfam: PF02517; InterPro: IPR003675"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10116"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68344"
FT                   /db_xref="GOA:D6ZNF3"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNF3"
FT                   /protein_id="ADI68344.1"
FT   gene            complement(114648..115388)
FT                   /locus_tag="HMPREF0837_10117"
FT   CDS_pept        complement(114648..115388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10117"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68345"
FT                   /db_xref="GOA:D6ZNF4"
FT                   /db_xref="InterPro:IPR021509"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNF4"
FT                   /protein_id="ADI68345.1"
FT   gene            complement(115385..115582)
FT                   /locus_tag="HMPREF0837_10118"
FT   CDS_pept        complement(115385..115582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10118"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68346"
FT                   /db_xref="GOA:D6ZNF5"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNF5"
FT                   /protein_id="ADI68346.1"
FT   gene            complement(115582..115788)
FT                   /locus_tag="HMPREF0837_10119"
FT   CDS_pept        complement(115582..115788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10119"
FT                   /product="DNA-binding helix-turn-helix protein"
FT                   /note="COG: COG1476; Pfam: PF01381; InterPro: IPR001387"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10119"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68347"
FT                   /db_xref="GOA:D6ZNF6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNF6"
FT                   /protein_id="ADI68347.1"
FT   gene            complement(115798..116262)
FT                   /locus_tag="HMPREF0837_10120"
FT   CDS_pept        complement(115798..116262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10120"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68348"
FT                   /db_xref="GOA:D6ZNF7"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNF7"
FT                   /protein_id="ADI68348.1"
FT   gene            complement(116262..116408)
FT                   /locus_tag="HMPREF0837_10121"
FT   CDS_pept        complement(116262..116408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10121"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68349"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNF8"
FT                   /protein_id="ADI68349.1"
FT                   EEY"
FT   gene            complement(116405..117694)
FT                   /gene="hisS"
FT                   /locus_tag="HMPREF0837_10122"
FT   CDS_pept        complement(116405..117694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisS"
FT                   /locus_tag="HMPREF0837_10122"
FT                   /product="histidine--tRNA ligase"
FT                   /EC_number=""
FT                   /note="COG: COG0124; Pfam: PF00587,PF03129; InterPro:
FT                   IPR015805"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10122"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68350"
FT                   /db_xref="GOA:D6ZNF9"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNF9"
FT                   /protein_id="ADI68350.1"
FT   gene            complement(117772..119019)
FT                   /locus_tag="HMPREF0837_10123"
FT   CDS_pept        complement(117772..119019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10123"
FT                   /product="hypothetical protein"
FT                   /note="Pfam: PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10123"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68351"
FT                   /db_xref="GOA:D6ZNG0"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNG0"
FT                   /protein_id="ADI68351.1"
FT                   SLLAIFLTILNLKNDI"
FT   gene            complement(119210..120061)
FT                   /locus_tag="HMPREF0837_10124"
FT   CDS_pept        complement(119210..120061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10124"
FT                   /product="transcriptional activator, Rgg/GadR/MutR family
FT                   domain protein"
FT                   /note="InterPro: IPR010057"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10124"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68352"
FT                   /db_xref="GOA:D6ZNG1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010057"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNG1"
FT                   /protein_id="ADI68352.1"
FT                   EC"
FT   gene            complement(120036..120170)
FT                   /locus_tag="HMPREF0837_10125"
FT   CDS_pept        complement(120036..120170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10125"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68353"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNG2"
FT                   /protein_id="ADI68353.1"
FT   gene            120185..120526
FT                   /locus_tag="HMPREF0837_10126"
FT   CDS_pept        120185..120526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10126"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2151; Pfam: PF01883; InterPro: IPR002744"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10126"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68354"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNG3"
FT                   /protein_id="ADI68354.1"
FT                   RIALGLPPR"
FT   gene            120590..120709
FT                   /locus_tag="HMPREF0837_10127"
FT   CDS_pept        120590..120709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10127"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10127"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68355"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNG4"
FT                   /protein_id="ADI68355.1"
FT   gene            complement(120735..122438)
FT                   /gene="ilvD"
FT                   /locus_tag="HMPREF0837_10128"
FT   CDS_pept        complement(120735..122438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="HMPREF0837_10128"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number=""
FT                   /note="COG: COG0129; Pfam: PF00920; InterPro: IPR000581"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10128"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68356"
FT                   /db_xref="GOA:D6ZNG5"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNG5"
FT                   /protein_id="ADI68356.1"
FT   gene            complement(122671..123603)
FT                   /locus_tag="HMPREF0837_10129"
FT   CDS_pept        complement(122671..123603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10129"
FT                   /product="Transketolase, C-terminal domain protein"
FT                   /note="COG: COG3958; Pfam: PF02779,PF02780; InterPro:
FT                   IPR005475"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10129"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68357"
FT                   /db_xref="GOA:D6ZNG6"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNG6"
FT                   /protein_id="ADI68357.1"
FT   gene            complement(123600..124457)
FT                   /locus_tag="HMPREF0837_10130"
FT   CDS_pept        complement(123600..124457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10130"
FT                   /product="Transketolase, thiamine diphosphate binding
FT                   domain protein"
FT                   /note="COG: COG3959; Pfam: PF00456; InterPro: IPR005474"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10130"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68358"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNG7"
FT                   /protein_id="ADI68358.1"
FT                   EETE"
FT   gene            complement(124461..125807)
FT                   /locus_tag="HMPREF0837_10131"
FT   CDS_pept        complement(124461..125807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10131"
FT                   /product="putative sugar-specific permease, SgaT/UlaA"
FT                   /note="COG: COG3037; Pfam: PF04215; InterPro: IPR007333"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10131"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68359"
FT                   /db_xref="GOA:D6ZNG8"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNG8"
FT                   /protein_id="ADI68359.1"
FT   gene            complement(125820..126104)
FT                   /locus_tag="HMPREF0837_10132"
FT   CDS_pept        complement(125820..126104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10132"
FT                   /product="PTS system, Lactose/Cellobiose specific IIB
FT                   subunit"
FT                   /note="COG: COG3414; Pfam: PF02302; InterPro: IPR003501"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10132"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68360"
FT                   /db_xref="GOA:D6ZNG9"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNG9"
FT                   /protein_id="ADI68360.1"
FT   gene            complement(126108..128138)
FT                   /locus_tag="HMPREF0837_10133"
FT   CDS_pept        complement(126108..128138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10133"
FT                   /product="phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system, EIIA 2"
FT                   /note="COG: COG3711; Pfam: PF00874,PF00359; InterPro:
FT                   IPR002178"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10133"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68361"
FT                   /db_xref="GOA:D6ZNH0"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNH0"
FT                   /protein_id="ADI68361.1"
FT   gene            128329..129336
FT                   /locus_tag="HMPREF0837_10134"
FT   CDS_pept        128329..129336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10134"
FT                   /product="SPFH/Band 7/PHB domain protein"
FT                   /note="COG: COG0330; Pfam: PF01145; InterPro: IPR001107"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10134"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68362"
FT                   /db_xref="GOA:D6ZNH1"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNH1"
FT                   /protein_id="ADI68362.1"
FT   gene            129339..129539
FT                   /locus_tag="HMPREF0837_10135"
FT   CDS_pept        129339..129539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10135"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4877"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10135"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68363"
FT                   /db_xref="GOA:D6ZNH2"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNH2"
FT                   /protein_id="ADI68363.1"
FT   gene            129691..129873
FT                   /gene="rpmF"
FT                   /locus_tag="HMPREF0837_10136"
FT   CDS_pept        129691..129873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmF"
FT                   /locus_tag="HMPREF0837_10136"
FT                   /product="ribosomal protein L32"
FT                   /note="COG: COG0333; Pfam: PF01783; InterPro: IPR002677"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10136"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68364"
FT                   /db_xref="GOA:D6ZNH3"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNH3"
FT                   /protein_id="ADI68364.1"
FT                   GYYKGRKIAKAASAE"
FT   gene            129889..130038
FT                   /gene="rpmG"
FT                   /locus_tag="HMPREF0837_10137"
FT   CDS_pept        129889..130038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="HMPREF0837_10137"
FT                   /product="ribosomal protein L33"
FT                   /note="COG: COG0267; Pfam: PF00471; InterPro: IPR001705"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10137"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68365"
FT                   /db_xref="GOA:D6ZNH4"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNH4"
FT                   /protein_id="ADI68365.1"
FT                   TEVK"
FT   gene            complement(130518..132383)
FT                   /locus_tag="HMPREF0837_10138"
FT   CDS_pept        complement(130518..132383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10138"
FT                   /product="cell wall-binding repeat protein"
FT                   /note="COG: COG5263; Pfam: PF01473"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10138"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68366"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="InterPro:IPR026906"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNH5"
FT                   /protein_id="ADI68366.1"
FT   gene            132718..132900
FT                   /locus_tag="HMPREF0837_10139"
FT   CDS_pept        132718..132900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10139"
FT                   /product="hypothetical protein"
FT                   /note="Pfam: PF04326"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10139"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68367"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNH6"
FT                   /protein_id="ADI68367.1"
FT                   NIDTYQRVNRLPAKL"
FT   gene            133305..133694
FT                   /locus_tag="HMPREF0837_10140"
FT   CDS_pept        133305..133694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10140"
FT                   /product="transposase, IS4 family"
FT                   /note="COG: COG3293; Pfam: PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10140"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68368"
FT                   /db_xref="InterPro:IPR027806"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNH7"
FT                   /protein_id="ADI68368.1"
FT   gene            complement(133746..134072)
FT                   /locus_tag="HMPREF0837_10141"
FT   CDS_pept        complement(133746..134072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10141"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68369"
FT                   /db_xref="InterPro:IPR012912"
FT                   /db_xref="InterPro:IPR024047"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNH8"
FT                   /protein_id="ADI68369.1"
FT                   YEEW"
FT   gene            complement(134109..134219)
FT                   /locus_tag="HMPREF0837_10142"
FT   CDS_pept        complement(134109..134219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10142"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68370"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNT6"
FT                   /protein_id="ADI68370.1"
FT   gene            complement(134399..136279)
FT                   /locus_tag="HMPREF0837_10143"
FT   CDS_pept        complement(134399..136279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10143"
FT                   /product="putative viral phosphatase"
FT                   /note="Pfam: PF00728; InterPro: IPR015883"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10143"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68371"
FT                   /db_xref="GOA:D6ZNT7"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR038901"
FT                   /db_xref="InterPro:IPR041063"
FT                   /db_xref="InterPro:IPR041272"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNT7"
FT                   /protein_id="ADI68371.1"
FT   gene            complement(136273..137154)
FT                   /locus_tag="HMPREF0837_10144"
FT   CDS_pept        complement(136273..137154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10144"
FT                   /product="ROK family protein"
FT                   /note="COG: COG1940; Pfam: PF00480; InterPro: IPR000600"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10144"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68372"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNT8"
FT                   /protein_id="ADI68372.1"
FT                   ALVNWLQEEKQW"
FT   gene            complement(137226..139871)
FT                   /locus_tag="HMPREF0837_10145"
FT   CDS_pept        complement(137226..139871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10145"
FT                   /product="glycosyl hydrolase family 38 N-terminal domain
FT                   protein"
FT                   /note="COG: COG0383; Pfam: PF01074,PF07748; InterPro:
FT                   IPR000602"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10145"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68373"
FT                   /db_xref="GOA:D6ZNT9"
FT                   /db_xref="InterPro:IPR000602"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR011682"
FT                   /db_xref="InterPro:IPR015341"
FT                   /db_xref="InterPro:IPR027291"
FT                   /db_xref="InterPro:IPR028995"
FT                   /db_xref="InterPro:IPR037094"
FT                   /db_xref="InterPro:IPR041509"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNT9"
FT                   /protein_id="ADI68373.1"
FT                   RTEFIKKEEI"
FT   gene            complement(139962..141242)
FT                   /locus_tag="HMPREF0837_10146"
FT   CDS_pept        complement(139962..141242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10146"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3538; Pfam: PF06824; InterPro: IPR008313"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10146"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68374"
FT                   /db_xref="GOA:D6ZNU0"
FT                   /db_xref="InterPro:IPR008313"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNU0"
FT                   /protein_id="ADI68374.1"
FT   gene            141413..143497
FT                   /locus_tag="HMPREF0837_10147"
FT   CDS_pept        141413..143497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10147"
FT                   /product="putative alpha-1,2-mannosidase"
FT                   /note="COG: COG3537; Pfam: PF07971; InterPro: IPR005887"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10147"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68375"
FT                   /db_xref="GOA:D6ZNU1"
FT                   /db_xref="InterPro:IPR005887"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012939"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR041371"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNU1"
FT                   /protein_id="ADI68375.1"
FT                   "
FT   gene            complement(143537..145216)
FT                   /locus_tag="HMPREF0837_10148"
FT   CDS_pept        complement(143537..145216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10148"
FT                   /product="F5/8 type C domain protein"
FT                   /note="COG: COG3669; Pfam: PF00754; InterPro: IPR000933"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10148"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68376"
FT                   /db_xref="GOA:D6ZNU2"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR000933"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNU2"
FT                   /protein_id="ADI68376.1"
FT   gene            145609..145776
FT                   /locus_tag="HMPREF0837_10149"
FT   CDS_pept        145609..145776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10149"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68377"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNU3"
FT                   /protein_id="ADI68377.1"
FT                   KFFKKILYPL"
FT   gene            145972..147201
FT                   /gene="arcA"
FT                   /locus_tag="HMPREF0837_10150"
FT   CDS_pept        145972..147201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcA"
FT                   /locus_tag="HMPREF0837_10150"
FT                   /product="arginine deiminase"
FT                   /EC_number=""
FT                   /note="COG: COG2235; Pfam: PF02274; InterPro: IPR003876"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10150"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68378"
FT                   /db_xref="GOA:D6ZNU4"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNU4"
FT                   /protein_id="ADI68378.1"
FT                   MSMPFEREEV"
FT   gene            147259..148275
FT                   /gene="argF"
FT                   /locus_tag="HMPREF0837_10151"
FT   CDS_pept        147259..148275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argF"
FT                   /locus_tag="HMPREF0837_10151"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number=""
FT                   /note="COG: COG0078; Pfam: PF02729,PF00185; InterPro:
FT                   IPR002292"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10151"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68379"
FT                   /db_xref="GOA:D6ZNU5"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNU5"
FT                   /protein_id="ADI68379.1"
FT   gene            148440..149387
FT                   /gene="arcC"
FT                   /locus_tag="HMPREF0837_10152"
FT   CDS_pept        148440..149387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcC"
FT                   /locus_tag="HMPREF0837_10152"
FT                   /product="carbamate kinase"
FT                   /EC_number=""
FT                   /note="COG: COG0549; Pfam: PF00696; InterPro: IPR001048"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10152"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68380"
FT                   /db_xref="GOA:D6ZNU6"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNU6"
FT                   /protein_id="ADI68380.1"
FT   gene            149598..151109
FT                   /locus_tag="HMPREF0837_10153"
FT   CDS_pept        149598..151109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10153"
FT                   /product="C4-dicarboxylate anaerobic carrier"
FT                   /note="COG: COG1288; Pfam: PF03606; InterPro: IPR004669"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10153"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68381"
FT                   /db_xref="GOA:D6ZNU7"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNU7"
FT                   /protein_id="ADI68381.1"
FT   gene            151131..152462
FT                   /locus_tag="HMPREF0837_10154"
FT   CDS_pept        151131..152462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10154"
FT                   /product="putative dipeptidase"
FT                   /EC_number="3.4.13.-"
FT                   /note="COG: COG0624; Pfam: PF01546; InterPro: IPR010964"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10154"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68382"
FT                   /db_xref="GOA:D6ZNU8"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010964"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNU8"
FT                   /protein_id="ADI68382.1"
FT   gene            152557..152685
FT                   /locus_tag="HMPREF0837_10155"
FT   CDS_pept        152557..152685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10155"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68383"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNU9"
FT                   /protein_id="ADI68383.1"
FT   gene            complement(152943..153158)
FT                   /locus_tag="HMPREF0837_10156"
FT   CDS_pept        complement(152943..153158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10156"
FT                   /product="hypothetical protein"
FT                   /note="Pfam: PF07580; InterPro: IPR011505"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10156"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68384"
FT                   /db_xref="GOA:D6ZNV0"
FT                   /db_xref="InterPro:IPR011505"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNV0"
FT                   /protein_id="ADI68384.1"
FT   gene            complement(153146..153412)
FT                   /locus_tag="HMPREF0837_10157"
FT   CDS_pept        complement(153146..153412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10157"
FT                   /product="Gram-positive signal peptide protein, YSIRK
FT                   family"
FT                   /note="Pfam: PF04650; InterPro: IPR005877"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10157"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68385"
FT                   /db_xref="GOA:D6ZNV1"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNV1"
FT                   /protein_id="ADI68385.1"
FT   gene            153601..153768
FT                   /locus_tag="HMPREF0837_10158"
FT   CDS_pept        153601..153768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10158"
FT                   /product="chlorohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10158"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68386"
FT                   /db_xref="GOA:D6ZNV2"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNV2"
FT                   /protein_id="ADI68386.1"
FT                   NIRQGDADVV"
FT   gene            complement(153795..154694)
FT                   /locus_tag="HMPREF0837_10159"
FT   CDS_pept        complement(153795..154694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10159"
FT                   /product="SPFH/Band 7/PHB domain protein"
FT                   /note="COG: COG0330; Pfam: PF01145; InterPro: IPR001107"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10159"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68387"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNV3"
FT                   /protein_id="ADI68387.1"
FT                   GVDDIRTQILSALRAEKK"
FT   gene            complement(154824..155975)
FT                   /locus_tag="HMPREF0837_10160"
FT   CDS_pept        complement(154824..155975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10160"
FT                   /product="alcohol dehydrogenase, iron-dependent"
FT                   /EC_number=""
FT                   /note="COG: COG1454; Pfam: PF00465; InterPro: IPR001670"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10160"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68388"
FT                   /db_xref="GOA:D6ZNV4"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNV4"
FT                   /protein_id="ADI68388.1"
FT   gene            complement(156121..157887)
FT                   /gene="fucI"
FT                   /locus_tag="HMPREF0837_10161"
FT   CDS_pept        complement(156121..157887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fucI"
FT                   /locus_tag="HMPREF0837_10161"
FT                   /product="arabinose isomerase"
FT                   /EC_number=""
FT                   /note="COG: COG2407; Pfam: PF07881,PF07882,PF02952;
FT                   InterPro: IPR005763"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10161"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68389"
FT                   /db_xref="GOA:D6ZNV5"
FT                   /db_xref="InterPro:IPR004216"
FT                   /db_xref="InterPro:IPR005763"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR012888"
FT                   /db_xref="InterPro:IPR012889"
FT                   /db_xref="InterPro:IPR015888"
FT                   /db_xref="InterPro:IPR038391"
FT                   /db_xref="InterPro:IPR038392"
FT                   /db_xref="InterPro:IPR038393"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNV5"
FT                   /protein_id="ADI68389.1"
FT                   YRACQLLGPLHK"
FT   gene            complement(157944..161060)
FT                   /locus_tag="HMPREF0837_10162"
FT   CDS_pept        complement(157944..161060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10162"
FT                   /product="glycosyl hydrolase family 98 C-terminal domain
FT                   protein"
FT                   /note="Pfam: PF08306,PF08307,PF00754; InterPro: IPR000421"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10162"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68390"
FT                   /db_xref="GOA:D6ZNV6"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR006585"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011071"
FT                   /db_xref="InterPro:IPR013190"
FT                   /db_xref="InterPro:IPR013191"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNV6"
FT                   /protein_id="ADI68390.1"
FT   gene            complement(161070..163364)
FT                   /locus_tag="HMPREF0837_10163"
FT   CDS_pept        complement(161070..163364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10163"
FT                   /product="hypothetical protein"
FT                   /note=""
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10163"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68391"
FT                   /db_xref="GOA:D6ZNV7"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR016518"
FT                   /db_xref="InterPro:IPR027414"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNV7"
FT                   /protein_id="ADI68391.1"
FT                   FNSEKIIELNF"
FT   gene            complement(163423..164223)
FT                   /locus_tag="HMPREF0837_10164"
FT   CDS_pept        complement(163423..164223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10164"
FT                   /product="PTS system, mannose/fructose/sorbose family, IID
FT                   component"
FT                   /note="COG: COG3716; Pfam: PF03613; InterPro: IPR004704"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10164"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68392"
FT                   /db_xref="GOA:D6ZNV8"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNV8"
FT                   /protein_id="ADI68392.1"
FT   gene            complement(164220..164993)
FT                   /locus_tag="HMPREF0837_10165"
FT   CDS_pept        complement(164220..164993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10165"
FT                   /product="PTS system sorbose-specific iic component"
FT                   /note="COG: COG3715; Pfam: PF03609; InterPro: IPR004700"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10165"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68393"
FT                   /db_xref="GOA:D6ZNV9"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNV9"
FT                   /protein_id="ADI68393.1"
FT   gene            complement(165018..165488)
FT                   /locus_tag="HMPREF0837_10166"
FT   CDS_pept        complement(165018..165488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10166"
FT                   /product="PTS system sorbose subfamily IIB component"
FT                   /note="COG: COG3444; Pfam: PF03830; InterPro: IPR004720"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10166"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68394"
FT                   /db_xref="GOA:D6ZNW0"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNW0"
FT                   /protein_id="ADI68394.1"
FT   gene            complement(165479..165910)
FT                   /locus_tag="HMPREF0837_10167"
FT   CDS_pept        complement(165479..165910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10167"
FT                   /product="PTS system fructose IIA component"
FT                   /note="COG: COG2893; Pfam: PF03610; InterPro: IPR004701"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10167"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68395"
FT                   /db_xref="GOA:D6ZNW1"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNW1"
FT                   /protein_id="ADI68395.1"
FT   gene            complement(165903..166343)
FT                   /locus_tag="HMPREF0837_10168"
FT   CDS_pept        complement(165903..166343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10168"
FT                   /product="RbsD/FucU transport family protein"
FT                   /note="COG: COG4154; Pfam: PF05025; InterPro: IPR007721"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10168"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68396"
FT                   /db_xref="GOA:D6ZNW2"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNW2"
FT                   /protein_id="ADI68396.1"
FT   gene            complement(166355..166993)
FT                   /locus_tag="HMPREF0837_10169"
FT   CDS_pept        complement(166355..166993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10169"
FT                   /product="putative L-ribulose-5-phosphate 4-epimerase"
FT                   /note="COG: COG0235; Pfam: PF00596; InterPro: IPR001303"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10169"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68397"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNW3"
FT                   /protein_id="ADI68397.1"
FT   gene            complement(167108..168556)
FT                   /locus_tag="HMPREF0837_10170"
FT   CDS_pept        complement(167108..168556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10170"
FT                   /product="carbohydrate kinase, FGGY family protein"
FT                   /note="COG: COG1070; Pfam: PF00370,PF02782; InterPro:
FT                   IPR000577"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10170"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68398"
FT                   /db_xref="GOA:D6ZNW4"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR013449"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNW4"
FT                   /protein_id="ADI68398.1"
FT   gene            168687..169460
FT                   /locus_tag="HMPREF0837_10171"
FT   CDS_pept        168687..169460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10171"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="COG: COG1349; Pfam: PF08220,PF00455; InterPro:
FT                   IPR014036"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10171"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68399"
FT                   /db_xref="GOA:D6ZNW5"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNW5"
FT                   /protein_id="ADI68399.1"
FT   gene            170280..170378
FT                   /locus_tag="HMPREF0837_10172"
FT   CDS_pept        170280..170378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10172"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68400"
FT                   /db_xref="GOA:D6ZNW6"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNW6"
FT                   /protein_id="ADI68400.1"
FT                   /translation="MSLIPELALTIIADVIAGIILYFVCKWLDGKK"
FT   gene            complement(170631..172136)
FT                   /locus_tag="HMPREF0837_10173"
FT   CDS_pept        complement(170631..172136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10173"
FT                   /product="ABC transporter, substrate-binding protein"
FT                   /note="COG: COG0803; Pfam: PF01297,PF09223; InterPro:
FT                   IPR006127"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10173"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68401"
FT                   /db_xref="GOA:D6ZNW7"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR015304"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNW7"
FT                   /protein_id="ADI68401.1"
FT   gene            complement(172146..172952)
FT                   /locus_tag="HMPREF0837_10174"
FT   CDS_pept        complement(172146..172952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10174"
FT                   /product="ABC 3 transport family protein"
FT                   /note="COG: COG1108; Pfam: PF00950; InterPro: IPR001626"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10174"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68402"
FT                   /db_xref="GOA:D6ZNW8"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNW8"
FT                   /protein_id="ADI68402.1"
FT   gene            complement(172945..173649)
FT                   /locus_tag="HMPREF0837_10175"
FT   CDS_pept        complement(172945..173649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10175"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="COG: COG1121; Pfam: PF00005; InterPro: IPR003593"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10175"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68403"
FT                   /db_xref="GOA:D6ZNW9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNW9"
FT                   /protein_id="ADI68403.1"
FT                   NVHENGQEVGHA"
FT   gene            complement(173649..174149)
FT                   /locus_tag="HMPREF0837_10176"
FT   CDS_pept        complement(173649..174149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10176"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="Pfam: PF01047; InterPro: IPR000835"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10176"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68404"
FT                   /db_xref="GOA:D6ZNX0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNX0"
FT                   /protein_id="ADI68404.1"
FT                   EIK"
FT   gene            complement(174306..175508)
FT                   /locus_tag="HMPREF0837_10177"
FT   CDS_pept        complement(174306..175508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10177"
FT                   /product="DltD central region"
FT                   /note="COG: COG3966; Pfam: PF04915,PF04918,PF04914;
FT                   InterPro: IPR007002"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10177"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68405"
FT                   /db_xref="GOA:D6ZNX1"
FT                   /db_xref="InterPro:IPR006998"
FT                   /db_xref="InterPro:IPR023896"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNX1"
FT                   /protein_id="ADI68405.1"
FT                   I"
FT   gene            complement(175501..175740)
FT                   /gene="dltC"
FT                   /locus_tag="HMPREF0837_10178"
FT   CDS_pept        complement(175501..175740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dltC"
FT                   /locus_tag="HMPREF0837_10178"
FT                   /product="D-alanine--poly(phosphoribitol) ligase, subunit
FT                   2"
FT                   /EC_number=""
FT                   /note="COG: COG0236; Pfam: PF00550; InterPro: IPR009081"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10178"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68406"
FT                   /db_xref="GOA:D6ZNX2"
FT                   /db_xref="InterPro:IPR003230"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNX2"
FT                   /protein_id="ADI68406.1"
FT   gene            complement(175754..176998)
FT                   /locus_tag="HMPREF0837_10179"
FT   CDS_pept        complement(175754..176998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10179"
FT                   /product="MBOAT family protein"
FT                   /note="COG: COG1696; Pfam: PF03062; InterPro: IPR004299"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10179"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68407"
FT                   /db_xref="GOA:D6ZNX3"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024024"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNX3"
FT                   /protein_id="ADI68407.1"
FT                   FLIFSGFLNNLWFKK"
FT   gene            complement(176995..178521)
FT                   /gene="dltA"
FT                   /locus_tag="HMPREF0837_10180"
FT   CDS_pept        complement(176995..178521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dltA"
FT                   /locus_tag="HMPREF0837_10180"
FT                   /product="D-alanine--poly(phosphoribitol) ligase, subunit
FT                   1"
FT                   /EC_number=""
FT                   /note="COG: COG1020; Pfam: PF00501; InterPro: IPR010072"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10180"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68408"
FT                   /db_xref="GOA:D6ZNX4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR010072"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNX4"
FT                   /protein_id="ADI68408.1"
FT   gene            complement(178566..178697)
FT                   /locus_tag="HMPREF0837_10181"
FT   CDS_pept        complement(178566..178697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10181"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10181"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68409"
FT                   /db_xref="GOA:D6ZNX5"
FT                   /db_xref="InterPro:IPR021008"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNX5"
FT                   /protein_id="ADI68409.1"
FT   gene            complement(179011..180189)
FT                   /locus_tag="HMPREF0837_10182"
FT   CDS_pept        complement(179011..180189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10182"
FT                   /product="transporter, major facilitator family protein"
FT                   /note="Pfam: PF07690; InterPro: IPR011701"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10182"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68410"
FT                   /db_xref="GOA:D6ZNX6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNX6"
FT                   /protein_id="ADI68410.1"
FT   gene            complement(180398..180535)
FT                   /locus_tag="HMPREF0837_10183"
FT   CDS_pept        complement(180398..180535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10183"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10183"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68411"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNX7"
FT                   /protein_id="ADI68411.1"
FT                   "
FT   gene            complement(180584..180649)
FT                   /locus_tag="HMPREF0837_nc10002"
FT   ncRNA           complement(180584..180649)
FT                   /locus_tag="HMPREF0837_nc10002"
FT                   /product="group II catalytic intron"
FT                   /ncRNA_class="autocatalytically_spliced_intron"
FT   gene            complement(180649..181563)
FT                   /locus_tag="HMPREF0837_10184"
FT   CDS_pept        complement(180649..181563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10184"
FT                   /product="group II intron, maturase-specific domain
FT                   protein"
FT                   /note="COG: COG3344; Pfam: PF00078,PF08388; InterPro:
FT                   IPR015706"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10184"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68412"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNX8"
FT                   /protein_id="ADI68412.1"
FT   gene            complement(181645..181926)
FT                   /locus_tag="HMPREF0837_10185"
FT   CDS_pept        complement(181645..181926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10185"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3344"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10185"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68413"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNX9"
FT                   /protein_id="ADI68413.1"
FT   gene            complement(182684..182794)
FT                   /locus_tag="HMPREF0837_10186"
FT   CDS_pept        complement(182684..182794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10186"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68414"
FT                   /db_xref="GOA:D6ZNY0"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNY0"
FT                   /protein_id="ADI68414.1"
FT   gene            183035..183622
FT                   /locus_tag="HMPREF0837_10187"
FT   CDS_pept        183035..183622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10187"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68415"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNY1"
FT                   /protein_id="ADI68415.1"
FT   gene            complement(183709..183912)
FT                   /locus_tag="HMPREF0837_10188"
FT   CDS_pept        complement(183709..183912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10188"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10188"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68416"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNY2"
FT                   /protein_id="ADI68416.1"
FT   gene            184005..184130
FT                   /locus_tag="HMPREF0837_10189"
FT   CDS_pept        184005..184130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10189"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNY3"
FT                   /protein_id="ADI68417.1"
FT   gene            complement(184209..184913)
FT                   /locus_tag="HMPREF0837_10190"
FT   CDS_pept        complement(184209..184913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10190"
FT                   /product="MIP family channel protein"
FT                   /note="COG: COG0580; Pfam: PF00230; InterPro: IPR000425"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10190"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68418"
FT                   /db_xref="GOA:D6ZNY4"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNY4"
FT                   /protein_id="ADI68418.1"
FT                   GAALAVLVFSLF"
FT   gene            complement(184983..186809)
FT                   /locus_tag="HMPREF0837_10191"
FT   CDS_pept        complement(184983..186809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10191"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="COG: COG0578; Pfam: PF01266; InterPro: IPR006076"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10191"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68419"
FT                   /db_xref="GOA:D6ZNY5"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNY5"
FT                   /protein_id="ADI68419.1"
FT   gene            complement(186851..188359)
FT                   /gene="glpK"
FT                   /locus_tag="HMPREF0837_10192"
FT   CDS_pept        complement(186851..188359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpK"
FT                   /locus_tag="HMPREF0837_10192"
FT                   /product="glycerol kinase"
FT                   /EC_number=""
FT                   /note="COG: COG0554; Pfam: PF00370,PF02782; InterPro:
FT                   IPR005999"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10192"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68420"
FT                   /db_xref="GOA:D6ZNY6"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNY6"
FT                   /protein_id="ADI68420.1"
FT   gene            complement(188518..189945)
FT                   /locus_tag="HMPREF0837_10193"
FT   CDS_pept        complement(188518..189945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10193"
FT                   /product="M protein trans-acting positive regulator (MGA)"
FT                   /note="Pfam: PF05043; InterPro: IPR007737"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10193"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68421"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNY7"
FT                   /protein_id="ADI68421.1"
FT                   NDLDMEDLAGIRQLLFT"
FT   gene            complement(189936..190088)
FT                   /locus_tag="HMPREF0837_10194"
FT   CDS_pept        complement(189936..190088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10194"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68422"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNY8"
FT                   /protein_id="ADI68422.1"
FT                   GNKCI"
FT   gene            190110..190982
FT                   /gene="hslO"
FT                   /locus_tag="HMPREF0837_10195"
FT   CDS_pept        190110..190982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /locus_tag="HMPREF0837_10195"
FT                   /product="chaperonin HslO"
FT                   /note="COG: COG1281; Pfam: PF01430; InterPro: IPR000397"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10195"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68423"
FT                   /db_xref="GOA:D6ZNY9"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNY9"
FT                   /protein_id="ADI68423.1"
FT                   LEELIRDKS"
FT   gene            190969..191904
FT                   /locus_tag="HMPREF0837_10196"
FT   CDS_pept        190969..191904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10196"
FT                   /product="TIM-barrel protein, nifR3 family"
FT                   /note="COG: COG0042; Pfam: PF01207; InterPro: IPR004652"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10196"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68424"
FT                   /db_xref="GOA:D6ZNZ0"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNZ0"
FT                   /protein_id="ADI68424.1"
FT   gene            complement(192646..194244)
FT                   /locus_tag="HMPREF0837_10197"
FT   CDS_pept        complement(192646..194244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10197"
FT                   /product="Gram-positive signal peptide protein, YSIRK
FT                   family"
FT                   /note="Pfam: PF04650,PF05062,PF02095; InterPro: IPR004829"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10197"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68425"
FT                   /db_xref="GOA:D6ZNZ1"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR007756"
FT                   /db_xref="InterPro:IPR038183"
FT                   /db_xref="InterPro:IPR038924"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNZ1"
FT                   /protein_id="ADI68425.1"
FT                   KPEVKPQLEKPKPEV"
FT   gene            complement(194272..194418)
FT                   /locus_tag="HMPREF0837_10198"
FT   CDS_pept        complement(194272..194418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10198"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68426"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNZ2"
FT                   /protein_id="ADI68426.1"
FT                   NSY"
FT   gene            194432..195214
FT                   /locus_tag="HMPREF0837_10199"
FT   CDS_pept        194432..195214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10199"
FT                   /product="transposase"
FT                   /note="COG: COG3464; Pfam: PF01610; InterPro: IPR002560"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10199"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68427"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNZ3"
FT                   /protein_id="ADI68427.1"
FT   gene            195211..195738
FT                   /locus_tag="HMPREF0837_10200"
FT   CDS_pept        195211..195738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10200"
FT                   /product="putative IS1167, transposase"
FT                   /note="COG: COG3464"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10200"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68428"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNZ4"
FT                   /protein_id="ADI68428.1"
FT                   KKERTKFVLSQA"
FT   gene            complement(195941..197437)
FT                   /locus_tag="HMPREF0837_10201"
FT   CDS_pept        complement(195941..197437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10201"
FT                   /product="Gram-positive signal peptide protein, YSIRK
FT                   family"
FT                   /note="COG: COG5263; Pfam: PF04650,PF05062,PF01473;
FT                   InterPro: IPR007756"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10201"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68429"
FT                   /db_xref="GOA:D6ZNZ5"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR007756"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="InterPro:IPR038183"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNZ5"
FT                   /protein_id="ADI68429.1"
FT   gene            complement(197516..198043)
FT                   /locus_tag="HMPREF0837_10202"
FT   CDS_pept        complement(197516..198043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10202"
FT                   /product="isoprenylcysteine carboxyl methyltransferase
FT                   family protein"
FT                   /note="COG: COG1755; Pfam: PF04140; InterPro: IPR007269"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10202"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68430"
FT                   /db_xref="GOA:D6ZNZ6"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNZ6"
FT                   /protein_id="ADI68430.1"
FT                   HEVIIPNGSIKR"
FT   gene            complement(198138..199469)
FT                   /locus_tag="HMPREF0837_10203"
FT   CDS_pept        complement(198138..199469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10203"
FT                   /product="HAMP domain protein"
FT                   /note="COG: COG0642; Pfam: PF00672,PF00512,PF02518;
FT                   InterPro: IPR003594"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10203"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68431"
FT                   /db_xref="GOA:D6ZNZ7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNZ7"
FT                   /protein_id="ADI68431.1"
FT   gene            complement(199466..200119)
FT                   /locus_tag="HMPREF0837_10204"
FT   CDS_pept        complement(199466..200119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10204"
FT                   /product="response regulator receiver domain protein"
FT                   /note="COG: COG0745; Pfam: PF00072,PF00486; InterPro:
FT                   IPR001789"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10204"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68432"
FT                   /db_xref="GOA:D6ZNZ8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNZ8"
FT                   /protein_id="ADI68432.1"
FT   gene            200211..200369
FT                   /locus_tag="HMPREF0837_10205"
FT   CDS_pept        200211..200369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10205"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68433"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZNZ9"
FT                   /protein_id="ADI68433.1"
FT                   SNLRLAS"
FT   gene            complement(200408..200542)
FT                   /locus_tag="HMPREF0837_10206"
FT   CDS_pept        complement(200408..200542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10206"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68434"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP00"
FT                   /protein_id="ADI68434.1"
FT   gene            200559..200690
FT                   /locus_tag="HMPREF0837_10207"
FT   CDS_pept        200559..200690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10207"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10207"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68435"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP01"
FT                   /protein_id="ADI68435.1"
FT   gene            complement(200761..203193)
FT                   /locus_tag="HMPREF0837_10208"
FT   CDS_pept        complement(200761..203193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10208"
FT                   /product="ATPase family associated with various cellular
FT                   activities (AAA)"
FT                   /note="COG: COG0542; Pfam: PF02861,PF00004,PF07724;
FT                   InterPro: IPR003593"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10208"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68436"
FT                   /db_xref="GOA:D6ZP02"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP02"
FT                   /protein_id="ADI68436.1"
FT   gene            complement(203195..203716)
FT                   /locus_tag="HMPREF0837_10209"
FT   CDS_pept        complement(203195..203716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10209"
FT                   /product="transcriptional repressor of CtsR"
FT                   /note="COG: COG4463; Pfam: PF05848; InterPro: IPR008463"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10209"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68437"
FT                   /db_xref="GOA:D6ZP03"
FT                   /db_xref="InterPro:IPR008463"
FT                   /db_xref="InterPro:IPR040465"
FT                   /db_xref="InterPro:IPR041473"
FT                   /db_xref="InterPro:IPR041902"
FT                   /db_xref="InterPro:IPR041908"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP03"
FT                   /protein_id="ADI68437.1"
FT                   IIQEVDRKGK"
FT   gene            complement(203772..204500)
FT                   /locus_tag="HMPREF0837_10210"
FT   CDS_pept        complement(203772..204500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10210"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="COG: COG1116; Pfam: PF00005; InterPro: IPR003593"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10210"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68438"
FT                   /db_xref="GOA:D6ZP04"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP04"
FT                   /protein_id="ADI68438.1"
FT   gene            complement(204500..205507)
FT                   /locus_tag="HMPREF0837_10211"
FT   CDS_pept        complement(204500..205507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10211"
FT                   /product="NMT1/THI5-like protein"
FT                   /note="COG: COG0715; Pfam: PF09084; InterPro: IPR015168"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10211"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68439"
FT                   /db_xref="GOA:D6ZP05"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP05"
FT                   /protein_id="ADI68439.1"
FT   gene            complement(205545..206261)
FT                   /locus_tag="HMPREF0837_10212"
FT   CDS_pept        complement(205545..206261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10212"
FT                   /product="ABC transporter, permease protein"
FT                   /note="COG: COG0600; Pfam: PF00528; InterPro: IPR000515"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10212"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68440"
FT                   /db_xref="GOA:D6ZP06"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP06"
FT                   /protein_id="ADI68440.1"
FT                   KLVDISEKYVIKWKRT"
FT   gene            complement(206266..206556)
FT                   /locus_tag="HMPREF0837_10213"
FT   CDS_pept        complement(206266..206556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10213"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0011; InterPro: IPR002767"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10213"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68441"
FT                   /db_xref="InterPro:IPR002767"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP07"
FT                   /protein_id="ADI68441.1"
FT   misc_binding    complement(206627..206729)
FT                   /function="TPP riboswitch (THI element)"
FT                   /bound_moiety="thiamine/thiamin pyrophosphate"
FT                   /note="HMPREF0837_nc10003"
FT   gene            complement(206812..208158)
FT                   /locus_tag="HMPREF0837_10214"
FT   CDS_pept        complement(206812..208158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10214"
FT                   /product="SH3 domain protein"
FT                   /note="COG: COG3942; Pfam: PF05257,PF08460,PF01473;
FT                   InterPro: IPR013667"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10214"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68442"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP08"
FT                   /protein_id="ADI68442.1"
FT   gene            complement(208247..208513)
FT                   /locus_tag="HMPREF0837_10215"
FT   CDS_pept        complement(208247..208513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10215"
FT                   /product="hypothetical protein"
FT                   /note="Pfam: PF06257; InterPro: IPR009366"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10215"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68443"
FT                   /db_xref="GOA:D6ZP09"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP09"
FT                   /protein_id="ADI68443.1"
FT   gene            complement(208515..209867)
FT                   /gene="dnaB"
FT                   /locus_tag="HMPREF0837_10216"
FT   CDS_pept        complement(208515..209867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="HMPREF0837_10216"
FT                   /product="replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="COG: COG0305; Pfam: PF00772,PF03796; InterPro:
FT                   IPR007692"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10216"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68444"
FT                   /db_xref="GOA:D6ZP10"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP10"
FT                   /protein_id="ADI68444.1"
FT   gene            complement(209911..210363)
FT                   /gene="rplI"
FT                   /locus_tag="HMPREF0837_10217"
FT   CDS_pept        complement(209911..210363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="HMPREF0837_10217"
FT                   /product="ribosomal protein L9"
FT                   /note="COG: COG0359; Pfam: PF01281,PF03948; InterPro:
FT                   IPR000244"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10217"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68445"
FT                   /db_xref="GOA:D6ZP11"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP11"
FT                   /protein_id="ADI68445.1"
FT   gene            complement(210360..212333)
FT                   /locus_tag="HMPREF0837_10218"
FT   CDS_pept        complement(210360..212333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10218"
FT                   /product="DHHA1 domain protein"
FT                   /note="COG: COG3887; Pfam: PF01368,PF02272; InterPro:
FT                   IPR001667"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10218"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68446"
FT                   /db_xref="GOA:D6ZP12"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR014528"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP12"
FT                   /protein_id="ADI68446.1"
FT   gene            complement(212469..213017)
FT                   /gene="raiA"
FT                   /locus_tag="HMPREF0837_10219"
FT   CDS_pept        complement(212469..213017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="raiA"
FT                   /locus_tag="HMPREF0837_10219"
FT                   /product="ribosomal subunit interface protein"
FT                   /note="COG: COG1544; Pfam: PF02482; InterPro: IPR003489"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10219"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68447"
FT                   /db_xref="GOA:D6ZP13"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP13"
FT                   /protein_id="ADI68447.1"
FT   gene            complement(213097..213759)
FT                   /locus_tag="HMPREF0837_10220"
FT   CDS_pept        complement(213097..213759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10220"
FT                   /product="comF family protein"
FT                   /note="COG: COG1040; Pfam: PF00156"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10220"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68448"
FT                   /db_xref="GOA:D6ZP14"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP14"
FT                   /protein_id="ADI68448.1"
FT   gene            complement(213756..213947)
FT                   /locus_tag="HMPREF0837_10221"
FT   CDS_pept        complement(213756..213947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10221"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4098"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10221"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68449"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP15"
FT                   /protein_id="ADI68449.1"
FT                   SIKKAIKEIQMMNKEAGL"
FT   gene            complement(214020..215054)
FT                   /locus_tag="HMPREF0837_10222"
FT   CDS_pept        complement(214020..215054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10222"
FT                   /product="type III restriction enzyme, res subunit"
FT                   /note="COG: COG4098; Pfam: PF04851"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10222"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68450"
FT                   /db_xref="GOA:D6ZP16"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP16"
FT                   /protein_id="ADI68450.1"
FT                   LEQV"
FT   gene            215110..215745
FT                   /locus_tag="HMPREF0837_10223"
FT   CDS_pept        215110..215745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10223"
FT                   /product="YigZ family protein"
FT                   /note="COG: COG1739; Pfam: PF01205,PF09186; InterPro:
FT                   IPR015796"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10223"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68451"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP17"
FT                   /protein_id="ADI68451.1"
FT   gene            216030..216950
FT                   /gene="cysK"
FT                   /locus_tag="HMPREF0837_10224"
FT   CDS_pept        216030..216950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysK"
FT                   /locus_tag="HMPREF0837_10224"
FT                   /product="cysteine synthase A"
FT                   /EC_number=""
FT                   /note="COG: COG0031; Pfam: PF00291; InterPro: IPR005859"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10224"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68452"
FT                   /db_xref="GOA:D6ZP18"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP18"
FT                   /protein_id="ADI68452.1"
FT   gene            complement(217147..217545)
FT                   /locus_tag="HMPREF0837_10225"
FT   CDS_pept        complement(217147..217545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10225"
FT                   /product="IS66 family element, transposase"
FT                   /note="Pfam: PF03050"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10225"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68453"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP19"
FT                   /protein_id="ADI68453.1"
FT   gene            217578..217844
FT                   /locus_tag="HMPREF0837_10226"
FT   CDS_pept        217578..217844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10226"
FT                   /product="transposase"
FT                   /note="COG: COG3335"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10226"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68454"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP20"
FT                   /protein_id="ADI68454.1"
FT   gene            complement(217985..218308)
FT                   /locus_tag="HMPREF0837_10227"
FT   CDS_pept        complement(217985..218308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10227"
FT                   /product="IS66 family element, Orf2 protein"
FT                   /note="COG: COG3436; Pfam: PF05717; InterPro: IPR008878"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10227"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68455"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP21"
FT                   /protein_id="ADI68455.1"
FT                   PQI"
FT   gene            complement(218554..219594)
FT                   /gene="tsf"
FT                   /locus_tag="HMPREF0837_10228"
FT   CDS_pept        complement(218554..219594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="HMPREF0837_10228"
FT                   /product="translation elongation factor Ts"
FT                   /note="COG: COG0264; Pfam: PF00627,PF00889; InterPro:
FT                   IPR001816"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10228"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68456"
FT                   /db_xref="GOA:D6ZP22"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP22"
FT                   /protein_id="ADI68456.1"
FT                   AAALNN"
FT   gene            complement(219673..220533)
FT                   /gene="rpsB"
FT                   /locus_tag="HMPREF0837_10229"
FT   CDS_pept        complement(219673..220533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="HMPREF0837_10229"
FT                   /product="ribosomal protein S2"
FT                   /note="COG: COG0052; Pfam: PF00318; InterPro: IPR005706"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10229"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68457"
FT                   /db_xref="GOA:D6ZP23"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP23"
FT                   /protein_id="ADI68457.1"
FT                   EGDNA"
FT   gene            complement(220676..221854)
FT                   /locus_tag="HMPREF0837_10230"
FT   CDS_pept        complement(220676..221854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10230"
FT                   /product="CHAP domain protein"
FT                   /note="COG: COG3883; Pfam: PF05257; InterPro: IPR007921"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10230"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68458"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR009148"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP24"
FT                   /protein_id="ADI68458.1"
FT   gene            complement(221948..222442)
FT                   /gene="mreD"
FT                   /locus_tag="HMPREF0837_10231"
FT   CDS_pept        complement(221948..222442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreD"
FT                   /locus_tag="HMPREF0837_10231"
FT                   /product="rod shape-determining protein MreD"
FT                   /note="Pfam: PF04093; InterPro: IPR007227"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10231"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68459"
FT                   /db_xref="GOA:D6ZP25"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP25"
FT                   /protein_id="ADI68459.1"
FT                   L"
FT   gene            complement(222442..223260)
FT                   /gene="mreC"
FT                   /locus_tag="HMPREF0837_10232"
FT   CDS_pept        complement(222442..223260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreC"
FT                   /locus_tag="HMPREF0837_10232"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="COG: COG1792; Pfam: PF04085; InterPro: IPR005223"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10232"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68460"
FT                   /db_xref="GOA:D6ZP26"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP26"
FT                   /protein_id="ADI68460.1"
FT   gene            complement(223319..224113)
FT                   /locus_tag="HMPREF0837_10233"
FT   CDS_pept        complement(223319..224113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10233"
FT                   /product="cobalt transport protein"
FT                   /note="COG: COG0619; Pfam: PF02361; InterPro: IPR003339"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10233"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68461"
FT                   /db_xref="GOA:D6ZP27"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR024919"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP27"
FT                   /protein_id="ADI68461.1"
FT   gene            complement(224106..224945)
FT                   /locus_tag="HMPREF0837_10234"
FT   CDS_pept        complement(224106..224945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10234"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="COG: COG1122; Pfam: PF00005; InterPro: IPR003593"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10234"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68462"
FT                   /db_xref="GOA:D6ZP28"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030946"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP28"
FT                   /protein_id="ADI68462.1"
FT   gene            complement(224930..225757)
FT                   /locus_tag="HMPREF0837_10235"
FT   CDS_pept        complement(224930..225757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10235"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="COG: COG1122; Pfam: PF00005; InterPro: IPR003593"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10235"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68463"
FT                   /db_xref="GOA:D6ZP29"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP29"
FT                   /protein_id="ADI68463.1"
FT   gene            complement(225754..226299)
FT                   /gene="pgsA"
FT                   /locus_tag="HMPREF0837_10236"
FT   CDS_pept        complement(225754..226299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgsA"
FT                   /locus_tag="HMPREF0837_10236"
FT                   /product="CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /EC_number=""
FT                   /note="COG: COG0558; Pfam: PF01066; InterPro: IPR004570"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10236"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68464"
FT                   /db_xref="GOA:D6ZP30"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP30"
FT                   /protein_id="ADI68464.1"
FT                   YDYFKGSAYVFKGTFGSK"
FT   gene            complement(226310..227140)
FT                   /locus_tag="HMPREF0837_10237"
FT   CDS_pept        complement(226310..227140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10237"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10237"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68465"
FT                   /db_xref="GOA:D6ZP31"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP31"
FT                   /protein_id="ADI68465.1"
FT   gene            complement(227173..228456)
FT                   /locus_tag="HMPREF0837_10238"
FT   CDS_pept        complement(227173..228456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10238"
FT                   /product="peptidase M16 inactive domain protein"
FT                   /EC_number="3.4.24.-"
FT                   /note="COG: COG0612; Pfam: PF00675,PF05193; InterPro:
FT                   IPR011237"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10238"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68466"
FT                   /db_xref="GOA:D6ZP32"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP32"
FT                   /protein_id="ADI68466.1"
FT   gene            complement(228453..229703)
FT                   /locus_tag="HMPREF0837_10239"
FT   CDS_pept        complement(228453..229703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10239"
FT                   /product="peptidase M16 inactive domain protein"
FT                   /EC_number="3.4.24.-"
FT                   /note="COG: COG0612; Pfam: PF05193; InterPro: IPR007863"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10239"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68467"
FT                   /db_xref="GOA:D6ZP33"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP33"
FT                   /protein_id="ADI68467.1"
FT                   VANNVKLQAIYFMEGIE"
FT   gene            229862..230230
FT                   /gene="yaaA"
FT                   /locus_tag="HMPREF0837_10240"
FT   CDS_pept        229862..230230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaA"
FT                   /locus_tag="HMPREF0837_10240"
FT                   /product="S4 domain protein YaaA"
FT                   /note="COG: COG2501; InterPro: IPR014330"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10240"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68468"
FT                   /db_xref="GOA:D6ZP34"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP34"
FT                   /protein_id="ADI68468.1"
FT                   SKPASSPKSQQAPRFPGR"
FT   gene            230233..231330
FT                   /gene="recF"
FT                   /locus_tag="HMPREF0837_10241"
FT   CDS_pept        230233..231330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="HMPREF0837_10241"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="COG: COG1195; Pfam: PF02463; InterPro: IPR001238"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10241"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68469"
FT                   /db_xref="GOA:D6ZP35"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP35"
FT                   /protein_id="ADI68469.1"
FT   gene            complement(231381..232859)
FT                   /gene="guaB"
FT                   /locus_tag="HMPREF0837_10242"
FT   CDS_pept        complement(231381..232859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="HMPREF0837_10242"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number=""
FT                   /note="COG: COG0516; Pfam: PF00478,PF00571; InterPro:
FT                   IPR013785"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10242"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68470"
FT                   /db_xref="GOA:D6ZP36"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP36"
FT                   /protein_id="ADI68470.1"
FT   gene            complement(233011..234036)
FT                   /gene="trpS"
FT                   /locus_tag="HMPREF0837_10243"
FT   CDS_pept        complement(233011..234036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="HMPREF0837_10243"
FT                   /product="tryptophan--tRNA ligase"
FT                   /EC_number=""
FT                   /note="COG: COG0180; Pfam: PF00579; InterPro: IPR002306"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10243"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68471"
FT                   /db_xref="GOA:D6ZP37"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP37"
FT                   /protein_id="ADI68471.1"
FT                   N"
FT   gene            234242..235864
FT                   /locus_tag="HMPREF0837_10244"
FT   CDS_pept        234242..235864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10244"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="COG: COG0488; Pfam: PF00005; InterPro: IPR003439"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10244"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68472"
FT                   /db_xref="GOA:D6ZP38"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP38"
FT                   /protein_id="ADI68472.1"
FT   gene            235989..238478
FT                   /locus_tag="HMPREF0837_10245"
FT   CDS_pept        235989..238478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10245"
FT                   /product="bacterial membrane protein YfhO"
FT                   /note="COG: COG4485"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10245"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68473"
FT                   /db_xref="GOA:D6ZP39"
FT                   /db_xref="InterPro:IPR018580"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP39"
FT                   /protein_id="ADI68473.1"
FT                   SLLLFGIYNHRRKSSKA"
FT   gene            complement(238580..238933)
FT                   /locus_tag="HMPREF0837_10246"
FT   CDS_pept        complement(238580..238933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10246"
FT                   /product="YhgE/Pip domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10246"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68474"
FT                   /db_xref="GOA:D6ZP40"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP40"
FT                   /protein_id="ADI68474.1"
FT                   GLRQTISINKSFS"
FT   gene            complement(238930..239583)
FT                   /locus_tag="HMPREF0837_10247"
FT   CDS_pept        complement(238930..239583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10247"
FT                   /product="YhgE/Pip domain protein"
FT                   /note="COG: COG1511"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10247"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68475"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP41"
FT                   /protein_id="ADI68475.1"
FT   gene            239763..240305
FT                   /locus_tag="HMPREF0837_10248"
FT   CDS_pept        239763..240305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10248"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="COG: COG1309; Pfam: PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10248"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68476"
FT                   /db_xref="GOA:D6ZP42"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039532"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP42"
FT                   /protein_id="ADI68476.1"
FT                   SSQEITDFLMKMLGDTN"
FT   gene            complement(240346..240419)
FT                   /locus_tag="HMPREF0837_t10015"
FT   tRNA            complement(240346..240419)
FT                   /locus_tag="HMPREF0837_t10015"
FT                   /product="tRNA-Asn"
FT   gene            complement(240425..240496)
FT                   /locus_tag="HMPREF0837_t10016"
FT   tRNA            complement(240425..240496)
FT                   /locus_tag="HMPREF0837_t10016"
FT                   /product="tRNA-Glu"
FT   gene            complement(240548..241300)
FT                   /locus_tag="HMPREF0837_10249"
FT   CDS_pept        complement(240548..241300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10249"
FT                   /product="LytTr DNA-binding domain protein"
FT                   /note="COG: COG3279; Pfam: PF00072,PF04397; InterPro:
FT                   IPR001789"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10249"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68477"
FT                   /db_xref="GOA:D6ZP43"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP43"
FT                   /protein_id="ADI68477.1"
FT   gene            complement(241297..242622)
FT                   /locus_tag="HMPREF0837_10250"
FT   CDS_pept        complement(241297..242622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10250"
FT                   /product="ATPase/histidine kinase/DNA gyrase B/HSP90 domain
FT                   protein"
FT                   /note="COG: COG2972; Pfam: PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10250"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68478"
FT                   /db_xref="GOA:D6ZP44"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP44"
FT                   /protein_id="ADI68478.1"
FT   gene            complement(242643..242768)
FT                   /gene="comC"
FT                   /locus_tag="HMPREF0837_10251"
FT   CDS_pept        complement(242643..242768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comC"
FT                   /locus_tag="HMPREF0837_10251"
FT                   /product="competence-stimulating peptide type 1"
FT                   /note="Pfam: PF03047; InterPro: IPR004288"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10251"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68479"
FT                   /db_xref="GOA:D6ZP45"
FT                   /db_xref="InterPro:IPR004288"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP45"
FT                   /protein_id="ADI68479.1"
FT   gene            complement(242933..243006)
FT                   /locus_tag="HMPREF0837_t10017"
FT   tRNA            complement(242933..243006)
FT                   /locus_tag="HMPREF0837_t10017"
FT                   /product="tRNA-Arg"
FT   gene            complement(243050..243529)
FT                   /gene="rlmH"
FT                   /locus_tag="HMPREF0837_10252"
FT   CDS_pept        complement(243050..243529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlmH"
FT                   /locus_tag="HMPREF0837_10252"
FT                   /product="rRNA large subunit m3Psi methyltransferase RlmH"
FT                   /EC_number="2.1.-.-"
FT                   /note="COG: COG1576; Pfam: PF02590; InterPro: IPR016051"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10252"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68480"
FT                   /db_xref="GOA:D6ZP46"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP46"
FT                   /protein_id="ADI68480.1"
FT   gene            243700..244893
FT                   /locus_tag="HMPREF0837_10253"
FT   CDS_pept        243700..244893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10253"
FT                   /product="trypsin"
FT                   /note="COG: COG0265; Pfam: PF00089; InterPro: IPR001254"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10253"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68481"
FT                   /db_xref="GOA:D6ZP47"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP47"
FT                   /protein_id="ADI68481.1"
FT   gene            244951..245709
FT                   /locus_tag="HMPREF0837_10254"
FT   CDS_pept        244951..245709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10254"
FT                   /product="ParB-like protein"
FT                   /note="COG: COG1475; Pfam: PF02195; InterPro: IPR004437"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10254"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68482"
FT                   /db_xref="GOA:D6ZP48"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP48"
FT                   /protein_id="ADI68482.1"
FT   gene            245985..247283
FT                   /gene="dnaA"
FT                   /locus_tag="HMPREF0837_10255"
FT   CDS_pept        245985..247283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="HMPREF0837_10255"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="COG: COG0593; Pfam: PF00308,PF08299; InterPro:
FT                   IPR001957"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10255"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68483"
FT                   /db_xref="GOA:D6ZP49"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP49"
FT                   /protein_id="ADI68483.1"
FT   gene            247442..248578
FT                   /gene="dnaN"
FT                   /locus_tag="HMPREF0837_10256"
FT   CDS_pept        247442..248578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="HMPREF0837_10256"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number=""
FT                   /note="COG: COG0592; Pfam: PF00712,PF02767,PF02768;
FT                   InterPro: IPR001001"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10256"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68484"
FT                   /db_xref="GOA:D6ZP50"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP50"
FT                   /protein_id="ADI68484.1"
FT   gene            248589..248837
FT                   /locus_tag="HMPREF0837_10257"
FT   CDS_pept        248589..248837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10257"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4481; Pfam: PF06107; InterPro: IPR009296"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10257"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68485"
FT                   /db_xref="InterPro:IPR009296"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP51"
FT                   /protein_id="ADI68485.1"
FT   gene            complement(249288..249707)
FT                   /locus_tag="HMPREF0837_10258"
FT   CDS_pept        complement(249288..249707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10258"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68486"
FT                   /db_xref="InterPro:IPR010861"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP52"
FT                   /protein_id="ADI68486.1"
FT   gene            complement(249704..249856)
FT                   /locus_tag="HMPREF0837_10259"
FT   CDS_pept        complement(249704..249856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10259"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68487"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP53"
FT                   /protein_id="ADI68487.1"
FT                   QEAET"
FT   gene            complement(250326..250577)
FT                   /locus_tag="HMPREF0837_10260"
FT   CDS_pept        complement(250326..250577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10260"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68488"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP54"
FT                   /protein_id="ADI68488.1"
FT   gene            complement(250564..250905)
FT                   /locus_tag="HMPREF0837_10261"
FT   CDS_pept        complement(250564..250905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10261"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68489"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP55"
FT                   /protein_id="ADI68489.1"
FT                   EAKILDEGD"
FT   gene            complement(250956..251222)
FT                   /locus_tag="HMPREF0837_10262"
FT   CDS_pept        complement(250956..251222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10262"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68490"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP56"
FT                   /protein_id="ADI68490.1"
FT   gene            complement(251285..251809)
FT                   /locus_tag="HMPREF0837_10263"
FT   CDS_pept        complement(251285..251809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10263"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68491"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP57"
FT                   /protein_id="ADI68491.1"
FT                   EYKGLADYSGQ"
FT   gene            complement(251902..252099)
FT                   /locus_tag="HMPREF0837_10264"
FT   CDS_pept        complement(251902..252099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10264"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68492"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP58"
FT                   /protein_id="ADI68492.1"
FT   gene            complement(252419..253984)
FT                   /locus_tag="HMPREF0837_10265"
FT   CDS_pept        complement(252419..253984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10265"
FT                   /product="phage/plasmid primase, P4 family domain protein"
FT                   /note="COG: COG3378; Pfam: PF08706; InterPro: IPR006500"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10265"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68493"
FT                   /db_xref="InterPro:IPR006500"
FT                   /db_xref="InterPro:IPR014015"
FT                   /db_xref="InterPro:IPR014818"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP59"
FT                   /protein_id="ADI68493.1"
FT                   EDLG"
FT   gene            complement(253953..254813)
FT                   /locus_tag="HMPREF0837_10266"
FT   CDS_pept        complement(253953..254813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10266"
FT                   /product="primase alpha helix C-terminal domain protein"
FT                   /note="Pfam: PF08708; InterPro: IPR014820"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10266"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68494"
FT                   /db_xref="InterPro:IPR014820"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP60"
FT                   /protein_id="ADI68494.1"
FT                   YRKRG"
FT   gene            complement(254810..255082)
FT                   /locus_tag="HMPREF0837_10267"
FT   CDS_pept        complement(254810..255082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10267"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68495"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP61"
FT                   /protein_id="ADI68495.1"
FT   gene            complement(255075..255416)
FT                   /locus_tag="HMPREF0837_10268"
FT   CDS_pept        complement(255075..255416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10268"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68496"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZP62"
FT                   /protein_id="ADI68496.1"
FT                   TLKEVGGYV"
FT   gene            complement(255397..255690)
FT                   /locus_tag="HMPREF0837_10269"
FT   CDS_pept        complement(255397..255690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10269"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68497"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPF8"
FT                   /protein_id="ADI68497.1"
FT   gene            complement(255687..255902)
FT                   /locus_tag="HMPREF0837_10270"
FT   CDS_pept        complement(255687..255902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10270"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68498"
FT                   /db_xref="GOA:D6ZPF9"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPF9"
FT                   /protein_id="ADI68498.1"
FT   gene            complement(255895..256161)
FT                   /locus_tag="HMPREF0837_10271"
FT   CDS_pept        complement(255895..256161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10271"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68499"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPG0"
FT                   /protein_id="ADI68499.1"
FT   gene            complement(256179..256319)
FT                   /locus_tag="HMPREF0837_10272"
FT   CDS_pept        complement(256179..256319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10272"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10272"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68500"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPG1"
FT                   /protein_id="ADI68500.1"
FT                   D"
FT   gene            complement(256331..256843)
FT                   /locus_tag="HMPREF0837_10273"
FT   CDS_pept        complement(256331..256843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10273"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68501"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPG2"
FT                   /protein_id="ADI68501.1"
FT                   TRGMMID"
FT   gene            complement(256828..256968)
FT                   /locus_tag="HMPREF0837_10274"
FT   CDS_pept        complement(256828..256968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10274"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10274"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68502"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPG3"
FT                   /protein_id="ADI68502.1"
FT                   T"
FT   gene            complement(257233..257382)
FT                   /locus_tag="HMPREF0837_10275"
FT   CDS_pept        complement(257233..257382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10275"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68503"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPG4"
FT                   /protein_id="ADI68503.1"
FT                   TKKN"
FT   gene            complement(257369..257515)
FT                   /locus_tag="HMPREF0837_10276"
FT   CDS_pept        complement(257369..257515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10276"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68504"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPG5"
FT                   /protein_id="ADI68504.1"
FT                   DKL"
FT   gene            complement(257519..257947)
FT                   /locus_tag="HMPREF0837_10277"
FT   CDS_pept        complement(257519..257947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10277"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10277"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68505"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPG6"
FT                   /protein_id="ADI68505.1"
FT   gene            complement(258101..258334)
FT                   /locus_tag="HMPREF0837_10278"
FT   CDS_pept        complement(258101..258334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10278"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68506"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPG7"
FT                   /protein_id="ADI68506.1"
FT   gene            complement(258513..258761)
FT                   /locus_tag="HMPREF0837_10279"
FT   CDS_pept        complement(258513..258761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10279"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10279"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68507"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPG8"
FT                   /protein_id="ADI68507.1"
FT   gene            complement(258773..259378)
FT                   /locus_tag="HMPREF0837_10280"
FT   CDS_pept        complement(258773..259378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10280"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68508"
FT                   /db_xref="InterPro:IPR014054"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPG9"
FT                   /protein_id="ADI68508.1"
FT   gene            complement(259400..259777)
FT                   /locus_tag="HMPREF0837_10281"
FT   CDS_pept        complement(259400..259777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10281"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68509"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPH0"
FT                   /protein_id="ADI68509.1"
FT   gene            complement(259852..260004)
FT                   /locus_tag="HMPREF0837_10282"
FT   CDS_pept        complement(259852..260004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10282"
FT                   /product="hypothetical protein"
FT                   /note="Pfam: PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10282"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68510"
FT                   /db_xref="GOA:D6ZPH1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPH1"
FT                   /protein_id="ADI68510.1"
FT                   IIFLS"
FT   gene            260223..260963
FT                   /locus_tag="HMPREF0837_10283"
FT   CDS_pept        260223..260963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10283"
FT                   /product="peptidase S24-like protein"
FT                   /note="COG: COG2932; Pfam: PF01381,PF00717; InterPro:
FT                   IPR011056"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10283"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68511"
FT                   /db_xref="GOA:D6ZPH2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPH2"
FT                   /protein_id="ADI68511.1"
FT   gene            260982..261650
FT                   /locus_tag="HMPREF0837_10284"
FT   CDS_pept        260982..261650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10284"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68512"
FT                   /db_xref="GOA:D6ZPH3"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPH3"
FT                   /protein_id="ADI68512.1"
FT                   "
FT   gene            261789..262457
FT                   /locus_tag="HMPREF0837_10285"
FT   CDS_pept        261789..262457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10285"
FT                   /product="Fic family protein"
FT                   /note="COG: COG3177; Pfam: PF02661; InterPro: IPR003812"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10285"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68513"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPH4"
FT                   /protein_id="ADI68513.1"
FT                   "
FT   gene            complement(262920..263378)
FT                   /locus_tag="HMPREF0837_10286"
FT   CDS_pept        complement(262920..263378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10286"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10286"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68514"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPH5"
FT                   /protein_id="ADI68514.1"
FT   gene            263715..263858
FT                   /locus_tag="HMPREF0837_10287"
FT   CDS_pept        263715..263858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10287"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10287"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68515"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPH6"
FT                   /protein_id="ADI68515.1"
FT                   QR"
FT   gene            264282..264518
FT                   /locus_tag="HMPREF0837_10288"
FT   CDS_pept        264282..264518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10288"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10288"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68516"
FT                   /db_xref="GOA:D6ZPH7"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPH7"
FT                   /protein_id="ADI68516.1"
FT   gene            264801..265106
FT                   /locus_tag="HMPREF0837_10289"
FT   CDS_pept        264801..265106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10289"
FT                   /product="putative protein rep"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10289"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68517"
FT                   /db_xref="GOA:D6ZPH8"
FT                   /db_xref="InterPro:IPR000989"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPH8"
FT                   /protein_id="ADI68517.1"
FT   gene            265211..265771
FT                   /gene="dinD"
FT                   /locus_tag="HMPREF0837_10290"
FT   CDS_pept        265211..265771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinD"
FT                   /locus_tag="HMPREF0837_10290"
FT                   /product="DNA-damage-inducible protein D"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10290"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68518"
FT                   /db_xref="InterPro:IPR003497"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPH9"
FT                   /protein_id="ADI68518.1"
FT   gene            266207..267373
FT                   /locus_tag="HMPREF0837_10291"
FT   CDS_pept        266207..267373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10291"
FT                   /product="site-specific recombinase, phage integrase
FT                   family"
FT                   /note="COG: COG0582; Pfam: PF00589; InterPro: IPR013762"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10291"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68519"
FT                   /db_xref="GOA:D6ZPI0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPI0"
FT                   /protein_id="ADI68519.1"
FT   gene            267484..268608
FT                   /gene="ychF"
FT                   /locus_tag="HMPREF0837_10292"
FT   CDS_pept        267484..268608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ychF"
FT                   /locus_tag="HMPREF0837_10292"
FT                   /product="GTP-binding protein YchF"
FT                   /note="COG: COG0012; Pfam: PF01926,PF06071; InterPro:
FT                   IPR004396"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10292"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68520"
FT                   /db_xref="GOA:D6ZPI1"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPI1"
FT                   /protein_id="ADI68520.1"
FT   gene            268679..269248
FT                   /gene="pth"
FT                   /locus_tag="HMPREF0837_10293"
FT   CDS_pept        268679..269248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="HMPREF0837_10293"
FT                   /product="aminoacyl-tRNA hydrolase"
FT                   /EC_number=""
FT                   /note="COG: COG0193; Pfam: PF01195; InterPro: IPR001328"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10293"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68521"
FT                   /db_xref="GOA:D6ZPI2"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPI2"
FT                   /protein_id="ADI68521.1"
FT   gene            269249..272758
FT                   /gene="mfd"
FT                   /locus_tag="HMPREF0837_10294"
FT   CDS_pept        269249..272758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="HMPREF0837_10294"
FT                   /product="transcription-repair coupling factor"
FT                   /EC_number="3.6.1.-"
FT                   /note="COG: COG1197; Pfam: PF02559,PF00270,PF00271,PF03461;
FT                   InterPro: IPR004576"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10294"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68522"
FT                   /db_xref="GOA:D6ZPI3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPI3"
FT                   /protein_id="ADI68522.1"
FT                   NSI"
FT   gene            272816..273082
FT                   /locus_tag="HMPREF0837_10295"
FT   CDS_pept        272816..273082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10295"
FT                   /product="S4 domain protein"
FT                   /note="COG: COG1188; Pfam: PF01479; InterPro: IPR002942"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10295"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68523"
FT                   /db_xref="GOA:D6ZPI4"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPI4"
FT                   /protein_id="ADI68523.1"
FT   gene            273075..273443
FT                   /locus_tag="HMPREF0837_10296"
FT   CDS_pept        273075..273443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10296"
FT                   /product="septum formation initiator"
FT                   /note="Pfam: PF04977; InterPro: IPR007060"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10296"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68524"
FT                   /db_xref="GOA:D6ZPI5"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR039076"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPI5"
FT                   /protein_id="ADI68524.1"
FT                   YYSKSREKVYTIPDLLQR"
FT   gene            273448..273570
FT                   /locus_tag="HMPREF0837_10297"
FT   CDS_pept        273448..273570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10297"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10297"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68525"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPI6"
FT                   /protein_id="ADI68525.1"
FT   gene            273563..274831
FT                   /locus_tag="HMPREF0837_10298"
FT   CDS_pept        273563..274831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10298"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2367;"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10298"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68526"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPI7"
FT                   /protein_id="ADI68526.1"
FT   gene            274828..276105
FT                   /gene="tilS"
FT                   /locus_tag="HMPREF0837_10299"
FT   CDS_pept        274828..276105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tilS"
FT                   /locus_tag="HMPREF0837_10299"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /EC_number="6.3.4.-"
FT                   /note="COG: COG0037; Pfam: PF01171; InterPro: IPR012094"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10299"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68527"
FT                   /db_xref="GOA:D6ZPI8"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPI8"
FT                   /protein_id="ADI68527.1"
FT   gene            276109..276651
FT                   /gene="hpt"
FT                   /locus_tag="HMPREF0837_10300"
FT   CDS_pept        276109..276651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt"
FT                   /locus_tag="HMPREF0837_10300"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number=""
FT                   /note="COG: COG0634; Pfam: PF00156; InterPro: IPR005904"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10300"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68528"
FT                   /db_xref="GOA:D6ZPI9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPI9"
FT                   /protein_id="ADI68528.1"
FT                   YRNLPYIGVLKEEVYSN"
FT   gene            276667..278625
FT                   /gene="hflB"
FT                   /locus_tag="HMPREF0837_10301"
FT   CDS_pept        276667..278625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflB"
FT                   /locus_tag="HMPREF0837_10301"
FT                   /product="ATP-dependent metallopeptidase HflB"
FT                   /EC_number="3.4.24.-"
FT                   /note="COG: COG0465; Pfam: PF06480,PF00004,PF01434;
FT                   InterPro: IPR005936"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10301"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68529"
FT                   /db_xref="GOA:D6ZPJ0"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPJ0"
FT                   /protein_id="ADI68529.1"
FT                   SHALSYDEVKSKMNDEK"
FT   gene            278747..279226
FT                   /gene="comX"
FT                   /locus_tag="HMPREF0837_10302"
FT   CDS_pept        278747..279226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comX"
FT                   /locus_tag="HMPREF0837_10302"
FT                   /product="transcriptional regulator ComX1"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10302"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68530"
FT                   /db_xref="GOA:D6ZMQ9"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZMQ9"
FT                   /protein_id="ADI68530.1"
FT   gene            279320..279391
FT                   /locus_tag="HMPREF0837_t10018"
FT   tRNA            279320..279391
FT                   /locus_tag="HMPREF0837_t10018"
FT                   /product="tRNA-Glu"
FT   gene            complement(279449..279592)
FT                   /locus_tag="HMPREF0837_10303"
FT   CDS_pept        complement(279449..279592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10303"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10303"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68531"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZMQ8"
FT                   /protein_id="ADI68531.1"
FT                   LF"
FT   gene            279650..281183
FT                   /locus_tag="HMPREF0837_r10004"
FT   rRNA            279650..281183
FT                   /locus_tag="HMPREF0837_r10004"
FT                   /product="16S ribosomal RNA"
FT   gene            281240..281312
FT                   /locus_tag="HMPREF0837_t10019"
FT   tRNA            281240..281312
FT                   /locus_tag="HMPREF0837_t10019"
FT                   /product="tRNA-Ala"
FT   gene            281439..284338
FT                   /locus_tag="HMPREF0837_r10005"
FT   rRNA            281439..284338
FT                   /locus_tag="HMPREF0837_r10005"
FT                   /product="23S ribosomal RNA"
FT   gene            281449..281600
FT                   /locus_tag="HMPREF0837_nc10004"
FT   ncRNA           281449..281600
FT                   /locus_tag="HMPREF0837_nc10004"
FT                   /note="similar to 5.8S ribosomal RNA"
FT                   /ncRNA_class="other"
FT   gene            284418..284531
FT                   /locus_tag="HMPREF0837_r10006"
FT   rRNA            284418..284531
FT                   /locus_tag="HMPREF0837_r10006"
FT                   /product="5S ribosomal RNA"
FT   gene            284536..284609
FT                   /locus_tag="HMPREF0837_t10020"
FT   tRNA            284536..284609
FT                   /locus_tag="HMPREF0837_t10020"
FT                   /product="tRNA-Asn"
FT   gene            284894..285028
FT                   /locus_tag="HMPREF0837_10304"
FT   CDS_pept        284894..285028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10304"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68532"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPJ3"
FT                   /protein_id="ADI68532.1"
FT   gene            complement(285368..285511)
FT                   /locus_tag="HMPREF0837_10305"
FT   CDS_pept        complement(285368..285511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10305"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68533"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPJ4"
FT                   /protein_id="ADI68533.1"
FT                   RN"
FT   gene            complement(285559..285765)
FT                   /locus_tag="HMPREF0837_10306"
FT   CDS_pept        complement(285559..285765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10306"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3464"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10306"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68534"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPJ5"
FT                   /protein_id="ADI68534.1"
FT   gene            286082..286318
FT                   /locus_tag="HMPREF0837_10307"
FT                   /note="recX"
FT   CDS_pept        286082..286318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10307"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10307"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68535"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPJ6"
FT                   /protein_id="ADI68535.1"
FT   gene            286507..287835
FT                   /gene="purA"
FT                   /locus_tag="HMPREF0837_10308"
FT   CDS_pept        286507..287835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="HMPREF0837_10308"
FT                   /product="adenylosuccinate synthase"
FT                   /EC_number=""
FT                   /note="COG: COG0104; Pfam: PF00709; InterPro: IPR001114"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10308"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68536"
FT                   /db_xref="GOA:D6ZPJ7"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPJ7"
FT                   /protein_id="ADI68536.1"
FT   gene            288036..288503
FT                   /locus_tag="HMPREF0837_10309"
FT   CDS_pept        288036..288503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10309"
FT                   /product="cytidine and deoxycytidylate deaminase
FT                   zinc-binding region"
FT                   /note="COG: COG0590; Pfam: PF00383; InterPro: IPR002125"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10309"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68537"
FT                   /db_xref="GOA:D6ZPJ8"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPJ8"
FT                   /protein_id="ADI68537.1"
FT   gene            288540..288627
FT                   /locus_tag="HMPREF0837_nc10005"
FT   ncRNA           288540..288627
FT                   /locus_tag="HMPREF0837_nc10005"
FT                   /product="bacterial signal recognition particle RNA"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            288690..289133
FT                   /gene="dut"
FT                   /locus_tag="HMPREF0837_10310"
FT   CDS_pept        288690..289133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="HMPREF0837_10310"
FT                   /product="dUTP diphosphatase"
FT                   /EC_number=""
FT                   /note="COG: COG0756; Pfam: PF00692; InterPro: IPR008180"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10310"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68538"
FT                   /db_xref="GOA:D6ZPJ9"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPJ9"
FT                   /protein_id="ADI68538.1"
FT   gene            289135..289650
FT                   /locus_tag="HMPREF0837_10311"
FT   CDS_pept        289135..289650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10311"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /note="COG: COG0406; Pfam: PF00300; InterPro: IPR013078"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10311"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68539"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPK0"
FT                   /protein_id="ADI68539.1"
FT                   VIECELEI"
FT   gene            289763..291025
FT                   /gene="radA"
FT                   /locus_tag="HMPREF0837_10312"
FT   CDS_pept        289763..291025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="HMPREF0837_10312"
FT                   /product="DNA repair protein RadA"
FT                   /note="COG: COG1066; InterPro: IPR004504"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10312"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68540"
FT                   /db_xref="GOA:D6ZPK1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPK1"
FT                   /protein_id="ADI68540.1"
FT   gene            291029..291595
FT                   /gene="cah"
FT                   /locus_tag="HMPREF0837_10313"
FT   CDS_pept        291029..291595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cah"
FT                   /locus_tag="HMPREF0837_10313"
FT                   /product="carbonate dehydratase"
FT                   /EC_number=""
FT                   /note="COG: COG0288; Pfam: PF00484; InterPro: IPR001765"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10313"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68541"
FT                   /db_xref="GOA:D6ZPK2"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPK2"
FT                   /protein_id="ADI68541.1"
FT   gene            291620..292435
FT                   /locus_tag="HMPREF0837_10314"
FT   CDS_pept        291620..292435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10314"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68542"
FT                   /db_xref="GOA:D6ZPK3"
FT                   /db_xref="InterPro:IPR026898"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPK3"
FT                   /protein_id="ADI68542.1"
FT   gene            292529..293548
FT                   /gene="prs"
FT                   /locus_tag="HMPREF0837_10315"
FT   CDS_pept        292529..293548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prs"
FT                   /locus_tag="HMPREF0837_10315"
FT                   /product="ribose-phosphate diphosphokinase"
FT                   /EC_number=""
FT                   /note="COG: COG0462; Pfam: PF00156; InterPro: IPR005946"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10315"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68543"
FT                   /db_xref="GOA:D6ZPK4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPK4"
FT                   /protein_id="ADI68543.1"
FT   gene            complement(293484..293963)
FT                   /locus_tag="HMPREF0837_10316"
FT   CDS_pept        complement(293484..293963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10316"
FT                   /product="IS1167, transposase"
FT                   /note="COG: COG3464"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10316"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68544"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPK5"
FT                   /protein_id="ADI68544.1"
FT   gene            complement(294091..294429)
FT                   /locus_tag="HMPREF0837_10317"
FT   CDS_pept        complement(294091..294429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10317"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68545"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPK6"
FT                   /protein_id="ADI68545.1"
FT                   VSEFEALL"
FT   gene            complement(294648..294905)
FT                   /locus_tag="HMPREF0837_10318"
FT   CDS_pept        complement(294648..294905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10318"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10318"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68546"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPK7"
FT                   /protein_id="ADI68546.1"
FT   gene            295254..297887
FT                   /gene="polA"
FT                   /locus_tag="HMPREF0837_10319"
FT   CDS_pept        295254..297887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="HMPREF0837_10319"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number=""
FT                   /note="COG: COG0749; Pfam: PF02739,PF01367,PF00476;
FT                   InterPro: IPR002298"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10319"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68547"
FT                   /db_xref="GOA:D6ZPK8"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPK8"
FT                   /protein_id="ADI68547.1"
FT                   TWYEAK"
FT   gene            297972..298409
FT                   /locus_tag="HMPREF0837_10320"
FT   CDS_pept        297972..298409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10320"
FT                   /product="CoA binding domain protein"
FT                   /note="COG: COG1832; Pfam: PF02629; InterPro: IPR016040"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10320"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68548"
FT                   /db_xref="GOA:D6ZPK9"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPK9"
FT                   /protein_id="ADI68548.1"
FT   gene            298396..298653
FT                   /locus_tag="HMPREF0837_10321"
FT   CDS_pept        298396..298653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10321"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68549"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPL0"
FT                   /protein_id="ADI68549.1"
FT   gene            complement(298682..299569)
FT                   /locus_tag="HMPREF0837_10322"
FT   CDS_pept        complement(298682..299569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10322"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2855; Pfam: PF03601; InterPro: IPR004630"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10322"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68550"
FT                   /db_xref="GOA:D6ZPL1"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPL1"
FT                   /protein_id="ADI68550.1"
FT                   ILTSLGMQTLIGIF"
FT   gene            299841..301010
FT                   /locus_tag="HMPREF0837_10323"
FT   CDS_pept        299841..301010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10323"
FT                   /product="aromatic-amino-acid transaminase"
FT                   /note="COG: COG0436; Pfam: PF00155; InterPro: IPR004839"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10323"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68551"
FT                   /db_xref="GOA:D6ZPL2"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPL2"
FT                   /protein_id="ADI68551.1"
FT   gene            301007..301777
FT                   /gene="recO"
FT                   /locus_tag="HMPREF0837_10324"
FT   CDS_pept        301007..301777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recO"
FT                   /locus_tag="HMPREF0837_10324"
FT                   /product="DNA repair protein RecO"
FT                   /note="COG: COG1381; Pfam: PF02565; InterPro: IPR003717"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10324"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68552"
FT                   /db_xref="GOA:D6ZPL3"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="InterPro:IPR042242"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPL3"
FT                   /protein_id="ADI68552.1"
FT   gene            301774..302766
FT                   /gene="plsX"
FT                   /locus_tag="HMPREF0837_10325"
FT   CDS_pept        301774..302766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsX"
FT                   /locus_tag="HMPREF0837_10325"
FT                   /product="fatty acid/phospholipid synthesis protein PlsX"
FT                   /note="COG: COG0416; Pfam: PF02504; InterPro: IPR003664"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10325"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68553"
FT                   /db_xref="GOA:D6ZPL4"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPL4"
FT                   /protein_id="ADI68553.1"
FT   gene            302772..303005
FT                   /locus_tag="HMPREF0837_10326"
FT   CDS_pept        302772..303005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10326"
FT                   /product="putative acyl carrier protein"
FT                   /note="Pfam: PF00550; InterPro: IPR009081"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10326"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68554"
FT                   /db_xref="GOA:D6ZPL5"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPL5"
FT                   /protein_id="ADI68554.1"
FT   gene            303048..303341
FT                   /locus_tag="HMPREF0837_10327"
FT   CDS_pept        303048..303341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10327"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3293; Pfam: PF01609"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10327"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68555"
FT                   /db_xref="InterPro:IPR027806"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPL6"
FT                   /protein_id="ADI68555.1"
FT   gene            complement(303389..303514)
FT                   /locus_tag="HMPREF0837_10328"
FT   CDS_pept        complement(303389..303514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10328"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10328"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68556"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPL7"
FT                   /protein_id="ADI68556.1"
FT   gene            303544..303774
FT                   /locus_tag="HMPREF0837_10329"
FT   CDS_pept        303544..303774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10329"
FT                   /product="class IIb bacteriocin, lactobin A/cerein 7B
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10329"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68557"
FT                   /db_xref="GOA:D6ZPL8"
FT                   /db_xref="InterPro:IPR010133"
FT                   /db_xref="InterPro:IPR019493"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPL8"
FT                   /protein_id="ADI68557.1"
FT   gene            303762..303902
FT                   /locus_tag="HMPREF0837_10330"
FT   CDS_pept        303762..303902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10330"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68558"
FT                   /db_xref="GOA:D6ZPL9"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPL9"
FT                   /protein_id="ADI68558.1"
FT                   K"
FT   gene            304483..306642
FT                   /locus_tag="HMPREF0837_10331"
FT   CDS_pept        304483..306642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10331"
FT                   /product="ABC-type bacteriocin transporter"
FT                   /note="COG: COG2274; Pfam: PF03412,PF00664,PF00005;
FT                   InterPro: IPR005897"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10331"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68559"
FT                   /db_xref="GOA:D6ZPM0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR005897"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPM0"
FT                   /protein_id="ADI68559.1"
FT   gene            306655..308004
FT                   /gene="mesE"
FT                   /locus_tag="HMPREF0837_10332"
FT   CDS_pept        306655..308004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mesE"
FT                   /locus_tag="HMPREF0837_10332"
FT                   /product="bacteriocin secretion accessory protein"
FT                   /note="InterPro: IPR005696"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10332"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68560"
FT                   /db_xref="GOA:D6ZPM1"
FT                   /db_xref="InterPro:IPR005696"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPM1"
FT                   /protein_id="ADI68560.1"
FT   gene            308132..308881
FT                   /gene="purC"
FT                   /locus_tag="HMPREF0837_10333"
FT   CDS_pept        308132..308881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="HMPREF0837_10333"
FT                   /product="phosphoribosylaminoimidazolesuccinocarboxamide
FT                   synthase"
FT                   /EC_number=""
FT                   /note="COG: COG0152; Pfam: PF01259; InterPro: IPR001636"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10333"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68561"
FT                   /db_xref="GOA:D6ZPM2"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPM2"
FT                   /protein_id="ADI68561.1"
FT   gene            308938..312663
FT                   /locus_tag="HMPREF0837_10334"
FT   CDS_pept        308938..312663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10334"
FT                   /product="phosphoribosylformylglycinamidine synthase"
FT                   /EC_number=""
FT                   /note="COG: COG0046; Pfam: PF00586,PF02769; InterPro:
FT                   IPR010141"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10334"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68562"
FT                   /db_xref="GOA:D6ZPM3"
FT                   /db_xref="InterPro:IPR010141"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPM3"
FT                   /protein_id="ADI68562.1"
FT                   KDQHLFASAVKHFTGK"
FT   gene            312756..314198
FT                   /gene="purF"
FT                   /locus_tag="HMPREF0837_10335"
FT   CDS_pept        312756..314198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="HMPREF0837_10335"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number=""
FT                   /note="COG: COG0034; Pfam: PF00310,PF00156; InterPro:
FT                   IPR005854"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10335"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68563"
FT                   /db_xref="GOA:D6ZPM4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPM4"
FT                   /protein_id="ADI68563.1"
FT   gene            314235..315257
FT                   /gene="purM"
FT                   /locus_tag="HMPREF0837_10336"
FT   CDS_pept        314235..315257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="HMPREF0837_10336"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number=""
FT                   /note="COG: COG0150; Pfam: PF00586,PF02769; InterPro:
FT                   IPR004733"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10336"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68564"
FT                   /db_xref="GOA:D6ZPM5"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPM5"
FT                   /protein_id="ADI68564.1"
FT                   "
FT   gene            315254..315799
FT                   /gene="purN"
FT                   /locus_tag="HMPREF0837_10337"
FT   CDS_pept        315254..315799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="HMPREF0837_10337"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /EC_number=""
FT                   /note="COG: COG0299; Pfam: PF00551; InterPro: IPR004607"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10337"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68565"
FT                   /db_xref="GOA:D6ZPM6"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPM6"
FT                   /protein_id="ADI68565.1"
FT                   HEAEYRLYPEVVKALFTD"
FT   gene            315883..316392
FT                   /locus_tag="HMPREF0837_10338"
FT   CDS_pept        315883..316392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10338"
FT                   /product="VanZ-like protein"
FT                   /note="Pfam: PF04892; InterPro: IPR006976"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10338"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68566"
FT                   /db_xref="GOA:D6ZPM7"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPM7"
FT                   /protein_id="ADI68566.1"
FT                   LHLIGV"
FT   gene            316396..317964
FT                   /gene="purH"
FT                   /locus_tag="HMPREF0837_10339"
FT   CDS_pept        316396..317964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="HMPREF0837_10339"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG: COG0138; Pfam: PF02142,PF01808; InterPro:
FT                   IPR002695"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10339"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68567"
FT                   /db_xref="GOA:D6ZPM8"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPM8"
FT                   /protein_id="ADI68567.1"
FT                   RHFRH"
FT   gene            318086..319348
FT                   /gene="purD"
FT                   /locus_tag="HMPREF0837_10340"
FT   CDS_pept        318086..319348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="HMPREF0837_10340"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number=""
FT                   /note="COG: COG0151; Pfam: PF02844,PF01071,PF02843;
FT                   InterPro: IPR000115"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10340"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68568"
FT                   /db_xref="GOA:D6ZPM9"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPM9"
FT                   /protein_id="ADI68568.1"
FT   gene            319421..319588
FT                   /locus_tag="HMPREF0837_10341"
FT   CDS_pept        319421..319588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10341"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68569"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPN0"
FT                   /protein_id="ADI68569.1"
FT                   VWFASVSELI"
FT   gene            319718..320239
FT                   /gene="purE"
FT                   /locus_tag="HMPREF0837_10342"
FT   CDS_pept        319718..320239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="HMPREF0837_10342"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number=""
FT                   /note="COG: COG0041; Pfam: PF00731; InterPro: IPR000031"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10342"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68570"
FT                   /db_xref="GOA:D6ZPN1"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPN1"
FT                   /protein_id="ADI68570.1"
FT                   IAEESSNELI"
FT   gene            320226..321317
FT                   /gene="purK"
FT                   /locus_tag="HMPREF0837_10343"
FT   CDS_pept        320226..321317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="HMPREF0837_10343"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /EC_number=""
FT                   /note="COG: COG0026; Pfam: PF02222; InterPro: IPR005875"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10343"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68571"
FT                   /db_xref="GOA:D6ZPN2"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPN2"
FT                   /protein_id="ADI68571.1"
FT   gene            321327..321554
FT                   /locus_tag="HMPREF0837_10344"
FT   CDS_pept        321327..321554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10344"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10344"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68572"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPN3"
FT                   /protein_id="ADI68572.1"
FT   gene            321644..322915
FT                   /gene="purB"
FT                   /locus_tag="HMPREF0837_10345"
FT   CDS_pept        321644..322915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="HMPREF0837_10345"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number=""
FT                   /note="COG: COG0015; Pfam: PF00206; InterPro: IPR004769"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10345"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68573"
FT                   /db_xref="GOA:D6ZPN4"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPN4"
FT                   /protein_id="ADI68573.1"
FT   gene            complement(322970..326995)
FT                   /locus_tag="HMPREF0837_10346"
FT   CDS_pept        complement(322970..326995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10346"
FT                   /product="Gram-positive signal peptide protein, YSIRK
FT                   family"
FT                   /note="COG: COG3525; Pfam: PF04650,PF00728,PF07501,PF00746;
FT                   InterPro: IPR013781"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10346"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68574"
FT                   /db_xref="GOA:D6ZPN5"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR015883"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPN5"
FT                   /protein_id="ADI68574.1"
FT   gene            complement(327223..327981)
FT                   /locus_tag="HMPREF0837_10347"
FT   CDS_pept        complement(327223..327981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10347"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="COG: COG2188; Pfam: PF00392,PF07702; InterPro:
FT                   IPR011663"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10347"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68575"
FT                   /db_xref="GOA:D6ZPN6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPN6"
FT                   /protein_id="ADI68575.1"
FT   gene            328287..330074
FT                   /locus_tag="HMPREF0837_10348"
FT   CDS_pept        328287..330074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10348"
FT                   /product="glycosyl hydrolase family 35"
FT                   /note="COG: COG1874; Pfam: PF01301; InterPro: IPR001944"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10348"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68576"
FT                   /db_xref="GOA:D6ZPN7"
FT                   /db_xref="InterPro:IPR001944"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026283"
FT                   /db_xref="InterPro:IPR031330"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPN7"
FT                   /protein_id="ADI68576.1"
FT   gene            330071..330547
FT                   /locus_tag="HMPREF0837_10349"
FT   CDS_pept        330071..330547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10349"
FT                   /product="PTS system sorbose subfamily IIB component"
FT                   /note="COG: COG3444; Pfam: PF03830; InterPro: IPR004720"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10349"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68577"
FT                   /db_xref="GOA:D6ZPN8"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPN8"
FT                   /protein_id="ADI68577.1"
FT   gene            330575..331480
FT                   /locus_tag="HMPREF0837_10350"
FT   CDS_pept        330575..331480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10350"
FT                   /product="PTS system sorbose-specific iic component"
FT                   /note="COG: COG3715; Pfam: PF03609; InterPro: IPR004700"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10350"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68578"
FT                   /db_xref="GOA:D6ZPN9"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPN9"
FT                   /protein_id="ADI68578.1"
FT   gene            331467..332282
FT                   /locus_tag="HMPREF0837_10351"
FT   CDS_pept        331467..332282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10351"
FT                   /product="PTS system mannose/fructose/sorbose family IID
FT                   component"
FT                   /note="COG: COG3716; Pfam: PF03613; InterPro: IPR004704"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10351"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68579"
FT                   /db_xref="GOA:D6ZPP0"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPP0"
FT                   /protein_id="ADI68579.1"
FT   gene            332289..332693
FT                   /locus_tag="HMPREF0837_10352"
FT   CDS_pept        332289..332693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10352"
FT                   /product="PTS system fructose IIA component"
FT                   /note="COG: COG2893; Pfam: PF03610; InterPro: IPR004701"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10352"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68580"
FT                   /db_xref="GOA:D6ZPP1"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPP1"
FT                   /protein_id="ADI68580.1"
FT   gene            332987..334153
FT                   /locus_tag="HMPREF0837_10353"
FT   CDS_pept        332987..334153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10353"
FT                   /product="sugar isomerase, AgaS family"
FT                   /note="COG: COG2222; Pfam: PF01380"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10353"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68581"
FT                   /db_xref="GOA:D6ZPP2"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035464"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPP2"
FT                   /protein_id="ADI68581.1"
FT   gene            334269..335306
FT                   /locus_tag="HMPREF0837_10354"
FT   CDS_pept        334269..335306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10354"
FT                   /product="aldose 1-epimerase"
FT                   /EC_number=""
FT                   /note="COG: COG2017; Pfam: PF01263; InterPro: IPR014718"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10354"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68582"
FT                   /db_xref="GOA:D6ZPP3"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015443"
FT                   /db_xref="InterPro:IPR018052"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPP3"
FT                   /protein_id="ADI68582.1"
FT                   ELVVK"
FT   gene            335513..336367
FT                   /locus_tag="HMPREF0837_10355"
FT   CDS_pept        335513..336367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10355"
FT                   /product="glyoxalase family protein"
FT                   /note="COG: COG2514; Pfam: PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10355"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68583"
FT                   /db_xref="GOA:D6ZPP4"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPP4"
FT                   /protein_id="ADI68583.1"
FT                   LAR"
FT   gene            336517..336774
FT                   /locus_tag="HMPREF0837_10356"
FT   CDS_pept        336517..336774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10356"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1937; Pfam: PF02583; InterPro: IPR003735"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10356"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68584"
FT                   /db_xref="GOA:D6ZPP5"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPP5"
FT                   /protein_id="ADI68584.1"
FT   gene            complement(336816..337178)
FT                   /locus_tag="HMPREF0837_10357"
FT   CDS_pept        complement(336816..337178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10357"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68585"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPP6"
FT                   /protein_id="ADI68585.1"
FT                   NFKDFLQLLLTHIKLF"
FT   gene            complement(337232..337528)
FT                   /locus_tag="HMPREF0837_10358"
FT   CDS_pept        complement(337232..337528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10358"
FT                   /product="rhodanese-like protein"
FT                   /note="COG: COG0607; Pfam: PF00581; InterPro: IPR001763"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10358"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68586"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPP7"
FT                   /protein_id="ADI68586.1"
FT   gene            complement(337518..337637)
FT                   /locus_tag="HMPREF0837_10359"
FT                   /note="cdr"
FT   CDS_pept        complement(337518..337637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10359"
FT                   /product="hypothetical protein"
FT                   /note=""
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10359"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68587"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPP8"
FT                   /protein_id="ADI68587.1"
FT   gene            337749..338513
FT                   /locus_tag="HMPREF0837_10360"
FT   CDS_pept        337749..338513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10360"
FT                   /product="phosphorylase family"
FT                   /note="Pfam: PF01048"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10360"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68588"
FT                   /db_xref="GOA:D6ZPP9"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPP9"
FT                   /protein_id="ADI68588.1"
FT   gene            338769..338909
FT                   /locus_tag="HMPREF0837_10361"
FT   CDS_pept        338769..338909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10361"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68589"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPQ0"
FT                   /protein_id="ADI68589.1"
FT                   E"
FT   gene            339078..340457
FT                   /locus_tag="HMPREF0837_10362"
FT   CDS_pept        339078..340457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10362"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /note="COG: COG0168; Pfam: PF02386; InterPro: IPR003445"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10362"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68590"
FT                   /db_xref="GOA:D6ZPQ1"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPQ1"
FT                   /protein_id="ADI68590.1"
FT                   G"
FT   gene            340450..341136
FT                   /locus_tag="HMPREF0837_10363"
FT   CDS_pept        340450..341136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10363"
FT                   /product="TrkA N-terminal domain protein"
FT                   /note="COG: COG0569; Pfam: PF02254; InterPro: IPR016040"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10363"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68591"
FT                   /db_xref="GOA:D6ZPQ2"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPQ2"
FT                   /protein_id="ADI68591.1"
FT                   LVALNS"
FT   gene            341160..341264
FT                   /locus_tag="HMPREF0837_10364"
FT   CDS_pept        341160..341264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10364"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10364"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68592"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPQ3"
FT                   /protein_id="ADI68592.1"
FT   gene            341271..341429
FT                   /locus_tag="HMPREF0837_10365"
FT   CDS_pept        341271..341429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10365"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10365"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68593"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPQ4"
FT                   /protein_id="ADI68593.1"
FT                   IYTARRR"
FT   gene            341491..342030
FT                   /locus_tag="HMPREF0837_10366"
FT   CDS_pept        341491..342030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10366"
FT                   /product="glycosyltransferase, group 2 family protein"
FT                   /EC_number="2.4.-.-"
FT                   /note="Pfam: PF00535; InterPro: IPR001173"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10366"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68594"
FT                   /db_xref="GOA:D6ZPQ5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPQ5"
FT                   /protein_id="ADI68594.1"
FT                   MHSLIYRTALLRASQF"
FT   gene            342031..342507
FT                   /locus_tag="HMPREF0837_10367"
FT   CDS_pept        342031..342507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10367"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68595"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPQ6"
FT                   /protein_id="ADI68595.1"
FT   gene            342623..345652
FT                   /locus_tag="HMPREF0837_10368"
FT   CDS_pept        342623..345652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10368"
FT                   /product="Gram-positive signal peptide protein, YSIRK
FT                   family"
FT                   /note="Pfam: PF04650,PF00746; InterPro: IPR005877"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10368"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68596"
FT                   /db_xref="GOA:D6ZPQ7"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR021021"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPQ7"
FT                   /protein_id="ADI68596.1"
FT   gene            345819..346517
FT                   /gene="saeR"
FT                   /locus_tag="HMPREF0837_10369"
FT   CDS_pept        345819..346517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="saeR"
FT                   /locus_tag="HMPREF0837_10369"
FT                   /product="response regulator SaeR"
FT                   /note="COG: COG0745; Pfam: PF00072,PF00486; InterPro:
FT                   IPR001789"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10369"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68597"
FT                   /db_xref="GOA:D6ZPQ8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPQ8"
FT                   /protein_id="ADI68597.1"
FT                   YKIEKPRGQT"
FT   gene            346514..347566
FT                   /locus_tag="HMPREF0837_10370"
FT   CDS_pept        346514..347566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10370"
FT                   /product="ATPase/histidine kinase/DNA gyrase B/HSP90 domain
FT                   protein"
FT                   /note="COG: COG0642; Pfam: PF00672,PF00512,PF02518;
FT                   InterPro: IPR003594"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10370"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68598"
FT                   /db_xref="GOA:D6ZPQ9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPQ9"
FT                   /protein_id="ADI68598.1"
FT                   LNLSGSENKA"
FT   gene            347761..348372
FT                   /gene="rpsD"
FT                   /locus_tag="HMPREF0837_10371"
FT   CDS_pept        347761..348372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="HMPREF0837_10371"
FT                   /product="ribosomal protein S4"
FT                   /note="COG: COG0522; Pfam: PF00163,PF01479; InterPro:
FT                   IPR005709"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10371"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68599"
FT                   /db_xref="GOA:D6ZPR0"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPR0"
FT                   /protein_id="ADI68599.1"
FT   gene            348557..348715
FT                   /locus_tag="HMPREF0837_10372"
FT   CDS_pept        348557..348715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10372"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3335; Pfam: PF01710; InterPro: IPR002622"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10372"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68600"
FT                   /db_xref="GOA:D6ZPR1"
FT                   /db_xref="InterPro:IPR002622"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPR1"
FT                   /protein_id="ADI68600.1"
FT                   GELNHQV"
FT   gene            349313..349573
FT                   /locus_tag="HMPREF0837_10373"
FT   CDS_pept        349313..349573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10373"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68601"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPR2"
FT                   /protein_id="ADI68601.1"
FT   gene            349862..350821
FT                   /locus_tag="HMPREF0837_10374"
FT   CDS_pept        349862..350821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10374"
FT                   /product="ABC transporter, permease protein"
FT                   /note="COG: COG4209; Pfam: PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10374"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68602"
FT                   /db_xref="GOA:D6ZPR3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPR3"
FT                   /protein_id="ADI68602.1"
FT   gene            350835..351758
FT                   /locus_tag="HMPREF0837_10375"
FT   CDS_pept        350835..351758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10375"
FT                   /product="ABC transporter, permease protein"
FT                   /note="COG: COG0395; Pfam: PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10375"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68603"
FT                   /db_xref="GOA:D6ZPR4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPR4"
FT                   /protein_id="ADI68603.1"
FT   gene            complement(351832..352017)
FT                   /locus_tag="HMPREF0837_10376"
FT   CDS_pept        complement(351832..352017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10376"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68604"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPR5"
FT                   /protein_id="ADI68604.1"
FT                   DEVSYIYLRQGDVDAV"
FT   gene            352016..353491
FT                   /locus_tag="HMPREF0837_10377"
FT   CDS_pept        352016..353491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10377"
FT                   /product="ABC transporter, solute-binding protein"
FT                   /note="COG: COG1653; Pfam: PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10377"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68605"
FT                   /db_xref="InterPro:IPR022627"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPR6"
FT                   /protein_id="ADI68605.1"
FT   gene            353763..354749
FT                   /locus_tag="HMPREF0837_10378"
FT   CDS_pept        353763..354749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10378"
FT                   /product="rhodanese-like protein"
FT                   /note="COG: COG1054; Pfam: PF00581; InterPro: IPR001763"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10378"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68606"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020936"
FT                   /db_xref="InterPro:IPR022111"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR040503"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPR7"
FT                   /protein_id="ADI68606.1"
FT   gene            354809..354934
FT                   /locus_tag="HMPREF0837_10379"
FT   CDS_pept        354809..354934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10379"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10379"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68607"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPR8"
FT                   /protein_id="ADI68607.1"
FT   gene            355024..355884
FT                   /locus_tag="HMPREF0837_10380"
FT   CDS_pept        355024..355884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10380"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68608"
FT                   /db_xref="InterPro:IPR025387"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPR9"
FT                   /protein_id="ADI68608.1"
FT                   LAQEK"
FT   gene            356271..356435
FT                   /locus_tag="HMPREF0837_10381"
FT   CDS_pept        356271..356435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10381"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68609"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPS0"
FT                   /protein_id="ADI68609.1"
FT                   NAKKERKYM"
FT   gene            356561..358507
FT                   /locus_tag="HMPREF0837_10382"
FT   CDS_pept        356561..358507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10382"
FT                   /product="transposase, IS4 family"
FT                   /note="Pfam: PF01609; InterPro: IPR002559"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10382"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68610"
FT                   /db_xref="GOA:D6ZPS1"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPS1"
FT                   /protein_id="ADI68610.1"
FT                   YEPPRKKASLMMH"
FT   gene            358689..359030
FT                   /locus_tag="HMPREF0837_10383"
FT   CDS_pept        358689..359030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10383"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68611"
FT                   /db_xref="GOA:D6ZPS2"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPS2"
FT                   /protein_id="ADI68611.1"
FT                   LYSSIRFII"
FT   gene            359429..359554
FT                   /locus_tag="HMPREF0837_10384"
FT   CDS_pept        359429..359554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10384"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68612"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPS3"
FT                   /protein_id="ADI68612.1"
FT   gene            359579..359776
FT                   /locus_tag="HMPREF0837_10385"
FT                   /note="macB"
FT   CDS_pept        359579..359776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10385"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68613"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPS4"
FT                   /protein_id="ADI68613.1"
FT   gene            complement(360013..361077)
FT                   /locus_tag="HMPREF0837_10386"
FT   CDS_pept        complement(360013..361077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10386"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10386"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68614"
FT                   /db_xref="GOA:D6ZPS5"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPS5"
FT                   /protein_id="ADI68614.1"
FT                   VALIGNYLRILAFL"
FT   gene            complement(361140..362051)
FT                   /locus_tag="HMPREF0837_10387"
FT   CDS_pept        complement(361140..362051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10387"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10387"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68615"
FT                   /db_xref="GOA:D6ZPS6"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPS6"
FT                   /protein_id="ADI68615.1"
FT   gene            complement(362044..362637)
FT                   /locus_tag="HMPREF0837_10388"
FT   CDS_pept        complement(362044..362637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10388"
FT                   /product="hypothetical protein"
FT                   /note="Pfam: PF08006"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10388"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68616"
FT                   /db_xref="GOA:D6ZPS7"
FT                   /db_xref="InterPro:IPR012963"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPS7"
FT                   /protein_id="ADI68616.1"
FT   gene            complement(362624..362950)
FT                   /locus_tag="HMPREF0837_10389"
FT   CDS_pept        complement(362624..362950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10389"
FT                   /product="transcriptional regulator, PadR family"
FT                   /note="COG: COG1695; Pfam: PF03551; InterPro: IPR011991"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10389"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68617"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPS8"
FT                   /protein_id="ADI68617.1"
FT                   HDKN"
FT   gene            complement(363089..364255)
FT                   /locus_tag="HMPREF0837_10390"
FT   CDS_pept        complement(363089..364255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10390"
FT                   /product="transporter, major facilitator family protein"
FT                   /note="COG: COG2807; Pfam: PF07690; InterPro: IPR011701"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10390"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68618"
FT                   /db_xref="GOA:D6ZPS9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPS9"
FT                   /protein_id="ADI68618.1"
FT   gene            364313..365470
FT                   /locus_tag="HMPREF0837_10391"
FT   CDS_pept        364313..365470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10391"
FT                   /product="glycosyltransferase, group 2 family protein"
FT                   /EC_number="2.4.-.-"
FT                   /note="Pfam: PF00535; InterPro: IPR001173"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10391"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68619"
FT                   /db_xref="GOA:D6ZPT0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPT0"
FT                   /protein_id="ADI68619.1"
FT   gene            365512..367362
FT                   /locus_tag="HMPREF0837_10392"
FT   CDS_pept        365512..367362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10392"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="COG: COG1086; Pfam: PF02719; InterPro: IPR003869"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10392"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68620"
FT                   /db_xref="GOA:D6ZPT1"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPT1"
FT                   /protein_id="ADI68620.1"
FT   gene            complement(367712..368344)
FT                   /locus_tag="HMPREF0837_10393"
FT   CDS_pept        complement(367712..368344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10393"
FT                   /product="HAD hydrolase, family IA, variant 1"
FT                   /note="COG: COG0546; Pfam: PF00702; InterPro: IPR005834"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10393"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68621"
FT                   /db_xref="GOA:D6ZPT2"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPT2"
FT                   /protein_id="ADI68621.1"
FT   gene            complement(368366..369238)
FT                   /gene="sdaAA"
FT                   /locus_tag="HMPREF0837_10394"
FT   CDS_pept        complement(368366..369238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdaAA"
FT                   /locus_tag="HMPREF0837_10394"
FT                   /product="L-serine dehydratase, iron-sulfur-dependent,
FT                   alpha subunit"
FT                   /EC_number=""
FT                   /note="COG: COG1760; Pfam: PF03313; InterPro: IPR004642"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10394"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68622"
FT                   /db_xref="GOA:D6ZPT3"
FT                   /db_xref="InterPro:IPR004642"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPT3"
FT                   /protein_id="ADI68622.1"
FT                   RLQKEIFGE"
FT   gene            complement(369247..369918)
FT                   /gene="sdaAB"
FT                   /locus_tag="HMPREF0837_10395"
FT   CDS_pept        complement(369247..369918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdaAB"
FT                   /locus_tag="HMPREF0837_10395"
FT                   /product="L-serine dehydratase, iron-sulfur-dependent, beta
FT                   subunit"
FT                   /EC_number=""
FT                   /note="COG: COG1760; Pfam: PF03315,PF01842; InterPro:
FT                   IPR004643"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10395"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68623"
FT                   /db_xref="GOA:D6ZPT4"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004643"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPT4"
FT                   /protein_id="ADI68623.1"
FT                   K"
FT   gene            370160..370747
FT                   /locus_tag="HMPREF0837_10396"
FT   CDS_pept        370160..370747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10396"
FT                   /product="LysM domain protein"
FT                   /note="Pfam: PF01476; InterPro: IPR002482"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10396"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68624"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPT5"
FT                   /protein_id="ADI68624.1"
FT   gene            complement(370799..371014)
FT                   /locus_tag="HMPREF0837_10397"
FT   CDS_pept        complement(370799..371014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10397"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68625"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPT6"
FT                   /protein_id="ADI68625.1"
FT   gene            371571..371819
FT                   /locus_tag="HMPREF0837_10398"
FT   CDS_pept        371571..371819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10398"
FT                   /product="bacteriocin, lactococcin 972 family"
FT                   /note="InterPro: IPR006540"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10398"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68626"
FT                   /db_xref="InterPro:IPR006540"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPT7"
FT                   /protein_id="ADI68626.1"
FT   gene            371874..373982
FT                   /locus_tag="HMPREF0837_10399"
FT   CDS_pept        371874..373982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10399"
FT                   /product="bacteriocin-associated integral membrane protein"
FT                   /note="InterPro: IPR006541"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10399"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68627"
FT                   /db_xref="GOA:D6ZPT8"
FT                   /db_xref="InterPro:IPR006541"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPT8"
FT                   /protein_id="ADI68627.1"
FT                   ELLKGGIL"
FT   gene            373979..374620
FT                   /locus_tag="HMPREF0837_10400"
FT   CDS_pept        373979..374620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10400"
FT                   /product="putative bacteriocin export ABC transporter,
FT                   lactococcin 972 group"
FT                   /note="COG: COG1136; Pfam: PF00005; InterPro: IPR003593"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10400"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68628"
FT                   /db_xref="GOA:D6ZPT9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR019895"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPT9"
FT                   /protein_id="ADI68628.1"
FT   gene            374725..375633
FT                   /locus_tag="HMPREF0837_10401"
FT   CDS_pept        374725..375633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10401"
FT                   /product="ABC transporter, substrate-binding protein,
FT                   family 3"
FT                   /note="COG: COG0834; Pfam: PF00497; InterPro: IPR001638"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10401"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68629"
FT                   /db_xref="GOA:D6ZPU0"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPU0"
FT                   /protein_id="ADI68629.1"
FT   gene            375605..376069
FT                   /locus_tag="HMPREF0837_10402"
FT   CDS_pept        375605..376069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10402"
FT                   /product="arginosuccinate synthase"
FT                   /note="COG: COG0137; Pfam: PF00764; InterPro: IPR001518"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10402"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68630"
FT                   /db_xref="GOA:D6ZPU1"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPU1"
FT                   /protein_id="ADI68630.1"
FT   gene            complement(376359..376574)
FT                   /locus_tag="HMPREF0837_10403"
FT   CDS_pept        complement(376359..376574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10403"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68631"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPU2"
FT                   /protein_id="ADI68631.1"
FT   gene            377438..377806
FT                   /locus_tag="HMPREF0837_10404"
FT   CDS_pept        377438..377806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10404"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10404"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68632"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPU3"
FT                   /protein_id="ADI68632.1"
FT                   IAYGVDWADGSLDGYIFA"
FT   gene            377858..378013
FT                   /locus_tag="HMPREF0837_10405"
FT   CDS_pept        377858..378013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10405"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68633"
FT                   /db_xref="GOA:D6ZPU4"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPU4"
FT                   /protein_id="ADI68633.1"
FT                   TFFYKE"
FT   gene            complement(378205..379068)
FT                   /locus_tag="HMPREF0837_10406"
FT   CDS_pept        complement(378205..379068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10406"
FT                   /product="DNA-binding helix-turn-helix protein"
FT                   /note="Pfam: PF01381; InterPro: IPR001387"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10406"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68634"
FT                   /db_xref="GOA:D6ZPU5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPU5"
FT                   /protein_id="ADI68634.1"
FT                   YQAKER"
FT   gene            379534..379872
FT                   /locus_tag="HMPREF0837_10407"
FT   CDS_pept        379534..379872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10407"
FT                   /product="peptidase, C39 family"
FT                   /note="Pfam: PF03412"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10407"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68635"
FT                   /db_xref="GOA:D6ZPU6"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPU6"
FT                   /protein_id="ADI68635.1"
FT                   IKGTRITK"
FT   gene            379969..380346
FT                   /locus_tag="HMPREF0837_10408"
FT   CDS_pept        379969..380346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10408"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10408"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68636"
FT                   /db_xref="GOA:D6ZPU7"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPU7"
FT                   /protein_id="ADI68636.1"
FT   gene            380500..380712
FT                   /locus_tag="HMPREF0837_10409"
FT   CDS_pept        380500..380712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10409"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10409"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68637"
FT                   /db_xref="GOA:D6ZPU8"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPU8"
FT                   /protein_id="ADI68637.1"
FT   gene            381128..381490
FT                   /locus_tag="HMPREF0837_10410"
FT   CDS_pept        381128..381490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10410"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68638"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPU9"
FT                   /protein_id="ADI68638.1"
FT                   YGLDIVDGKFDGYLWA"
FT   gene            381471..381716
FT                   /locus_tag="HMPREF0837_10411"
FT   CDS_pept        381471..381716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10411"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68639"
FT                   /db_xref="GOA:D6ZPV0"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPV0"
FT                   /protein_id="ADI68639.1"
FT   gene            381873..382931
FT                   /locus_tag="HMPREF0837_10412"
FT   CDS_pept        381873..382931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10412"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68640"
FT                   /db_xref="GOA:D6ZPV1"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPV1"
FT                   /protein_id="ADI68640.1"
FT                   PYIFSRKSPIKG"
FT   gene            383541..384224
FT                   /locus_tag="HMPREF0837_10413"
FT   CDS_pept        383541..384224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10413"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10413"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68641"
FT                   /db_xref="GOA:D6ZPV2"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPV2"
FT                   /protein_id="ADI68641.1"
FT                   VSIRR"
FT   gene            384205..384381
FT                   /locus_tag="HMPREF0837_10414"
FT   CDS_pept        384205..384381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10414"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10414"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68642"
FT                   /db_xref="GOA:D6ZPV3"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPV3"
FT                   /protein_id="ADI68642.1"
FT                   VLLIGIELLSQKK"
FT   gene            384601..384975
FT                   /locus_tag="HMPREF0837_10415"
FT   CDS_pept        384601..384975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10415"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68643"
FT                   /db_xref="GOA:D6ZPV4"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPV4"
FT                   /protein_id="ADI68643.1"
FT   gene            384982..385164
FT                   /locus_tag="HMPREF0837_10416"
FT   CDS_pept        384982..385164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10416"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10416"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68644"
FT                   /db_xref="GOA:D6ZPV5"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPV5"
FT                   /protein_id="ADI68644.1"
FT                   LILIIAMIIYPKLRK"
FT   gene            385183..386085
FT                   /locus_tag="HMPREF0837_10417"
FT   CDS_pept        385183..386085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10417"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10417"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68645"
FT                   /db_xref="GOA:D6ZPV6"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPV6"
FT                   /protein_id="ADI68645.1"
FT   gene            386108..386494
FT                   /locus_tag="HMPREF0837_10418"
FT   CDS_pept        386108..386494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10418"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10418"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68646"
FT                   /db_xref="GOA:D6ZPV7"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPV7"
FT                   /protein_id="ADI68646.1"
FT   gene            386491..387219
FT                   /locus_tag="HMPREF0837_10419"
FT   CDS_pept        386491..387219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10419"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68647"
FT                   /db_xref="GOA:D6ZPV8"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPV8"
FT                   /protein_id="ADI68647.1"
FT   gene            387683..387895
FT                   /locus_tag="HMPREF0837_10420"
FT   CDS_pept        387683..387895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10420"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68648"
FT                   /db_xref="GOA:D6ZPV9"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPV9"
FT                   /protein_id="ADI68648.1"
FT   gene            388354..388593
FT                   /locus_tag="HMPREF0837_10421"
FT   CDS_pept        388354..388593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10421"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68649"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPW0"
FT                   /protein_id="ADI68649.1"
FT   gene            388690..388857
FT                   /locus_tag="HMPREF0837_10422"
FT   CDS_pept        388690..388857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10422"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68650"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPW1"
FT                   /protein_id="ADI68650.1"
FT                   KTDVKEMKWL"
FT   gene            389143..391317
FT                   /locus_tag="HMPREF0837_10423"
FT   CDS_pept        389143..391317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10423"
FT                   /product="cell wall-binding repeat protein"
FT                   /note="COG: COG5263; Pfam: PF01473"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10423"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68651"
FT                   /db_xref="InterPro:IPR018337"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPW2"
FT                   /protein_id="ADI68651.1"
FT   gene            391437..391586
FT                   /locus_tag="HMPREF0837_10424"
FT   CDS_pept        391437..391586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10424"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68652"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPW3"
FT                   /protein_id="ADI68652.1"
FT                   DYKF"
FT   gene            391570..391695
FT                   /locus_tag="HMPREF0837_10425"
FT   CDS_pept        391570..391695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10425"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68653"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPW4"
FT                   /protein_id="ADI68653.1"
FT   gene            391718..392839
FT                   /gene="trmU"
FT                   /locus_tag="HMPREF0837_10426"
FT   CDS_pept        391718..392839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmU"
FT                   /locus_tag="HMPREF0837_10426"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number=""
FT                   /note="COG: COG0482; Pfam: PF03054; InterPro: IPR004506"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10426"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68654"
FT                   /db_xref="GOA:D6ZPW5"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPW5"
FT                   /protein_id="ADI68654.1"
FT   gene            392980..393435
FT                   /locus_tag="HMPREF0837_10427"
FT   CDS_pept        392980..393435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10427"
FT                   /product="hydrolase, NUDIX family"
FT                   /note="COG: COG0494; Pfam: PF00293; InterPro: IPR000086"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10427"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68655"
FT                   /db_xref="GOA:D6ZPW6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPW6"
FT                   /protein_id="ADI68655.1"
FT   gene            393445..395358
FT                   /gene="gidA"
FT                   /locus_tag="HMPREF0837_10428"
FT   CDS_pept        393445..395358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="HMPREF0837_10428"
FT                   /product="tRNA uridine 5-carboxymethylaminomethyl
FT                   modification enzyme GidA"
FT                   /note="COG: COG0445; Pfam: PF01134; InterPro: IPR004416"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10428"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68656"
FT                   /db_xref="GOA:D6ZPW7"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPW7"
FT                   /protein_id="ADI68656.1"
FT                   SK"
FT   gene            complement(395490..395639)
FT                   /locus_tag="HMPREF0837_10429"
FT   CDS_pept        complement(395490..395639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10429"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10429"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68657"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPW8"
FT                   /protein_id="ADI68657.1"
FT                   EEYQ"
FT   gene            complement(395711..397390)
FT                   /locus_tag="HMPREF0837_10430"
FT   CDS_pept        complement(395711..397390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10430"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0595; Pfam: PF00753,PF07521; InterPro:
FT                   IPR004613"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10430"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68658"
FT                   /db_xref="GOA:D6ZPW9"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001587"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041636"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPW9"
FT                   /protein_id="ADI68658.1"
FT   gene            complement(397392..397625)
FT                   /locus_tag="HMPREF0837_10431"
FT   CDS_pept        complement(397392..397625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10431"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG5503; Pfam: PF07288; InterPro: IPR009907"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10431"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68659"
FT                   /db_xref="InterPro:IPR009907"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPX0"
FT                   /protein_id="ADI68659.1"
FT   gene            397905..398120
FT                   /locus_tag="HMPREF0837_10432"
FT   CDS_pept        397905..398120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10432"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68660"
FT                   /db_xref="GOA:D6ZPX1"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPX1"
FT                   /protein_id="ADI68660.1"
FT   gene            complement(398443..398595)
FT                   /locus_tag="HMPREF0837_10433"
FT   CDS_pept        complement(398443..398595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10433"
FT                   /product="class IIb bacteriocin, lactobin A/cerein 7B
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10433"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68661"
FT                   /db_xref="GOA:D6ZPX2"
FT                   /db_xref="InterPro:IPR004288"
FT                   /db_xref="InterPro:IPR010133"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPX2"
FT                   /protein_id="ADI68661.1"
FT                   FGKSC"
FT   gene            complement(398597..398782)
FT                   /locus_tag="HMPREF0837_10434"
FT   CDS_pept        complement(398597..398782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10434"
FT                   /product="class IIb bacteriocin, lactobin A/cerein 7B
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10434"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68662"
FT                   /db_xref="GOA:D6ZPX3"
FT                   /db_xref="InterPro:IPR023991"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPX3"
FT                   /protein_id="ADI68662.1"
FT                   ALIGSGLAAGYFLGGD"
FT   gene            398960..399643
FT                   /gene="yeaZ"
FT                   /locus_tag="HMPREF0837_10435"
FT   CDS_pept        398960..399643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeaZ"
FT                   /locus_tag="HMPREF0837_10435"
FT                   /product="universal bacterial protein YeaZ"
FT                   /note="COG: COG1214; Pfam: PF00814; InterPro: IPR000905"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10435"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68663"
FT                   /db_xref="GOA:D6ZPX4"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPX4"
FT                   /protein_id="ADI68663.1"
FT                   YIKRL"
FT   gene            399640..400077
FT                   /gene="rimI"
FT                   /locus_tag="HMPREF0837_10436"
FT   CDS_pept        399640..400077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimI"
FT                   /locus_tag="HMPREF0837_10436"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /EC_number=""
FT                   /note="COG: COG0456; Pfam: PF00583; InterPro: IPR016181"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10436"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68664"
FT                   /db_xref="GOA:D6ZPX5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPX5"
FT                   /protein_id="ADI68664.1"
FT   gene            400067..401077
FT                   /locus_tag="HMPREF0837_10437"
FT   CDS_pept        400067..401077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10437"
FT                   /product="putative glycoprotease GCP"
FT                   /note="COG: COG0533; Pfam: PF00814; InterPro: IPR000905"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10437"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68665"
FT                   /db_xref="GOA:D6ZPX6"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPX6"
FT                   /protein_id="ADI68665.1"
FT   gene            complement(401117..401503)
FT                   /locus_tag="HMPREF0837_10438"
FT   CDS_pept        complement(401117..401503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10438"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3464"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10438"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68666"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPX7"
FT                   /protein_id="ADI68666.1"
FT   gene            complement(401494..402528)
FT                   /locus_tag="HMPREF0837_10439"
FT   CDS_pept        complement(401494..402528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10439"
FT                   /product="transposase"
FT                   /note="COG: COG3464; Pfam: PF01610; InterPro: IPR002560"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10439"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68667"
FT                   /db_xref="GOA:D6ZPX8"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPX8"
FT                   /protein_id="ADI68667.1"
FT                   FECT"
FT   gene            complement(402787..403050)
FT                   /locus_tag="HMPREF0837_10440"
FT   CDS_pept        complement(402787..403050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10440"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3335"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10440"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68668"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPX9"
FT                   /protein_id="ADI68668.1"
FT   gene            complement(403130..403396)
FT                   /locus_tag="HMPREF0837_10441"
FT   CDS_pept        complement(403130..403396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10441"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68669"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPY0"
FT                   /protein_id="ADI68669.1"
FT   gene            403684..404247
FT                   /locus_tag="HMPREF0837_10442"
FT   CDS_pept        403684..404247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10442"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68670"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPY1"
FT                   /protein_id="ADI68670.1"
FT   gene            404375..404836
FT                   /locus_tag="HMPREF0837_10443"
FT   CDS_pept        404375..404836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10443"
FT                   /product="glycosyltransferase, group 1 family protein"
FT                   /EC_number="2.4.-.-"
FT                   /note="COG: COG0438; Pfam: PF00534; InterPro: IPR001296"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10443"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68671"
FT                   /db_xref="GOA:D6ZPY2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPY2"
FT                   /protein_id="ADI68671.1"
FT   gene            404860..405735
FT                   /locus_tag="HMPREF0837_10444"
FT   CDS_pept        404860..405735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10444"
FT                   /product="glycosyltransferase, group 2 family protein"
FT                   /EC_number="2.4.-.-"
FT                   /note="COG: COG0463; Pfam: PF00535; InterPro: IPR001173"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10444"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68672"
FT                   /db_xref="GOA:D6ZPY3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPY3"
FT                   /protein_id="ADI68672.1"
FT                   EEKIFNEFLF"
FT   gene            405822..407438
FT                   /locus_tag="HMPREF0837_10445"
FT   CDS_pept        405822..407438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10445"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="COG: COG1132; Pfam: PF00664,PF00005; InterPro:
FT                   IPR003593"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10445"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68673"
FT                   /db_xref="GOA:D6ZPY4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPY4"
FT                   /protein_id="ADI68673.1"
FT   gene            407458..407613
FT                   /locus_tag="HMPREF0837_10446"
FT   CDS_pept        407458..407613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10446"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10446"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68674"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPY5"
FT                   /protein_id="ADI68674.1"
FT                   KVSFFM"
FT   gene            407786..408214
FT                   /locus_tag="HMPREF0837_10447"
FT   CDS_pept        407786..408214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10447"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68675"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPY6"
FT                   /protein_id="ADI68675.1"
FT   gene            408220..408447
FT                   /locus_tag="HMPREF0837_10448"
FT   CDS_pept        408220..408447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10448"
FT                   /product="hypothetical protein"
FT                   /note="Pfam: PF02585; InterPro: IPR003737"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10448"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68676"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPY7"
FT                   /protein_id="ADI68676.1"
FT   gene            408600..408965
FT                   /locus_tag="HMPREF0837_10449"
FT   CDS_pept        408600..408965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10449"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68677"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPY8"
FT                   /protein_id="ADI68677.1"
FT                   LYLRNGAVYSIIFWIKK"
FT   gene            408978..409628
FT                   /locus_tag="HMPREF0837_10450"
FT   CDS_pept        408978..409628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10450"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /note="COG: COG1004; Pfam: PF03721,PF00984; InterPro:
FT                   IPR016040"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10450"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68678"
FT                   /db_xref="GOA:D6ZPY9"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPY9"
FT                   /protein_id="ADI68678.1"
FT   gene            409799..410149
FT                   /locus_tag="HMPREF0837_10451"
FT   CDS_pept        409799..410149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10451"
FT                   /product="UDP-glucose/GDP-mannose dehydrogenase family, UDP
FT                   binding domain protein"
FT                   /note="COG: COG1004; Pfam: PF03720; InterPro: IPR014028"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10451"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68679"
FT                   /db_xref="GOA:D6ZPZ0"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPZ0"
FT                   /protein_id="ADI68679.1"
FT                   DKVYTRGIWIRD"
FT   gene            410520..411407
FT                   /locus_tag="HMPREF0837_10452"
FT   CDS_pept        410520..411407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10452"
FT                   /product="transcriptional activator, Rgg/GadR/MutR family
FT                   domain protein"
FT                   /note="COG: COG1396; Pfam: PF01381; InterPro: IPR010057"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10452"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68680"
FT                   /db_xref="GOA:D6ZPZ1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010057"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPZ1"
FT                   /protein_id="ADI68680.1"
FT                   LFELRFQQYKELID"
FT   gene            411698..411895
FT                   /locus_tag="HMPREF0837_10453"
FT   CDS_pept        411698..411895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10453"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68681"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPZ2"
FT                   /protein_id="ADI68681.1"
FT   gene            411963..412628
FT                   /locus_tag="HMPREF0837_10454"
FT   CDS_pept        411963..412628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10454"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /note="Pfam: PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10454"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68682"
FT                   /db_xref="GOA:D6ZPZ3"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPZ3"
FT                   /protein_id="ADI68682.1"
FT   gene            412700..413926
FT                   /locus_tag="HMPREF0837_10455"
FT   CDS_pept        412700..413926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10455"
FT                   /product="transporter, major facilitator family protein"
FT                   /note="Pfam: PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10455"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68683"
FT                   /db_xref="GOA:D6ZPZ4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPZ4"
FT                   /protein_id="ADI68683.1"
FT                   MLLNIRESI"
FT   gene            complement(414202..414399)
FT                   /locus_tag="HMPREF0837_10456"
FT   CDS_pept        complement(414202..414399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10456"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10456"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68684"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPZ5"
FT                   /protein_id="ADI68684.1"
FT   gene            414470..415126
FT                   /locus_tag="HMPREF0837_10457"
FT   CDS_pept        414470..415126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10457"
FT                   /product="AzlC protein"
FT                   /note="COG: COG1296; Pfam: PF03591; InterPro: IPR011606"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10457"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68685"
FT                   /db_xref="GOA:D6ZPZ6"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPZ6"
FT                   /protein_id="ADI68685.1"
FT   gene            415116..415439
FT                   /locus_tag="HMPREF0837_10458"
FT   CDS_pept        415116..415439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10458"
FT                   /product="Branched-chain amino acid transport protein
FT                   (AzlD)"
FT                   /note="COG: COG4392; Pfam: PF05437; InterPro: IPR008407"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10458"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68686"
FT                   /db_xref="GOA:D6ZPZ7"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPZ7"
FT                   /protein_id="ADI68686.1"
FT                   LVF"
FT   gene            415543..416373
FT                   /locus_tag="HMPREF0837_10459"
FT   CDS_pept        415543..416373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10459"
FT                   /product="ABC transporter, substrate-binding protein,
FT                   family 3"
FT                   /note="COG: COG0834; Pfam: PF00497; InterPro: IPR001638"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10459"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68687"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPZ8"
FT                   /protein_id="ADI68687.1"
FT   gene            416527..417381
FT                   /locus_tag="HMPREF0837_10460"
FT   CDS_pept        416527..417381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10460"
FT                   /product="NLPA lipoprotein"
FT                   /note="COG: COG1464; Pfam: PF03180; InterPro: IPR004872"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10460"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68688"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZPZ9"
FT                   /protein_id="ADI68688.1"
FT                   PVW"
FT   gene            417481..418854
FT                   /locus_tag="HMPREF0837_10461"
FT   CDS_pept        417481..418854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10461"
FT                   /product="peptidase dimerization domain protein"
FT                   /note="COG: COG0624; Pfam: PF01546,PF07687; InterPro:
FT                   IPR002933"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10461"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68689"
FT                   /db_xref="GOA:D6ZQ00"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ00"
FT                   /protein_id="ADI68689.1"
FT   gene            418847..419908
FT                   /locus_tag="HMPREF0837_10462"
FT   CDS_pept        418847..419908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10462"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="COG: COG1135; Pfam: PF00005; InterPro: IPR003593"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10462"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68690"
FT                   /db_xref="GOA:D6ZQ01"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ01"
FT                   /protein_id="ADI68690.1"
FT                   QAGVQLKVLKGVQ"
FT   gene            419910..420602
FT                   /locus_tag="HMPREF0837_10463"
FT   CDS_pept        419910..420602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10463"
FT                   /product="ABC transporter, permease protein"
FT                   /note="COG: COG2011; Pfam: PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10463"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68691"
FT                   /db_xref="GOA:D6ZQ02"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ02"
FT                   /protein_id="ADI68691.1"
FT                   LTKKLSHK"
FT   gene            complement(420632..421201)
FT                   /locus_tag="HMPREF0837_10464"
FT   CDS_pept        complement(420632..421201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10464"
FT                   /product="conserved hypothetical protein TIGR02185"
FT                   /note="InterPro: IPR011733"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10464"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68692"
FT                   /db_xref="GOA:D6ZQ03"
FT                   /db_xref="InterPro:IPR011733"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ03"
FT                   /protein_id="ADI68692.1"
FT   gene            421336..421950
FT                   /locus_tag="HMPREF0837_10465"
FT   CDS_pept        421336..421950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10465"
FT                   /product="hypothetical protein"
FT                   /note="Pfam: PF04854; InterPro: IPR006938"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10465"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68693"
FT                   /db_xref="GOA:D6ZQ04"
FT                   /db_xref="InterPro:IPR006938"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ04"
FT                   /protein_id="ADI68693.1"
FT   gene            421928..423598
FT                   /locus_tag="HMPREF0837_10466"
FT   CDS_pept        421928..423598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10466"
FT                   /product="ATPase/histidine kinase/DNA gyrase B/HSP90 domain
FT                   protein"
FT                   /note="COG: COG2972; Pfam: PF00672,PF06580,PF02518;
FT                   InterPro: IPR010559"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10466"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68694"
FT                   /db_xref="GOA:D6ZQ05"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ05"
FT                   /protein_id="ADI68694.1"
FT   gene            423610..424896
FT                   /locus_tag="HMPREF0837_10467"
FT   CDS_pept        423610..424896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10467"
FT                   /product="response regulator receiver domain protein"
FT                   /note="COG: COG4753; Pfam: PF00072,PF00165; InterPro:
FT                   IPR001789"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10467"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68695"
FT                   /db_xref="GOA:D6ZQ06"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ06"
FT                   /protein_id="ADI68695.1"
FT   gene            424957..425490
FT                   /locus_tag="HMPREF0837_10468"
FT   CDS_pept        424957..425490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10468"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10468"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68696"
FT                   /db_xref="GOA:D6ZQ07"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ07"
FT                   /protein_id="ADI68696.1"
FT                   QKALAEEEETEELT"
FT   gene            425556..426038
FT                   /locus_tag="HMPREF0837_10469"
FT   CDS_pept        425556..426038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10469"
FT                   /product="putative nrdI protein"
FT                   /note="COG: COG1780; Pfam: PF07972; InterPro: IPR004465"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10469"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68697"
FT                   /db_xref="GOA:D6ZQ08"
FT                   /db_xref="InterPro:IPR004465"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ08"
FT                   /protein_id="ADI68697.1"
FT   gene            complement(426331..427638)
FT                   /locus_tag="HMPREF0837_10470"
FT   CDS_pept        complement(426331..427638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10470"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1914"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10470"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68698"
FT                   /db_xref="GOA:D6ZQ09"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ09"
FT                   /protein_id="ADI68698.1"
FT   gene            complement(427903..428361)
FT                   /locus_tag="HMPREF0837_10471"
FT   CDS_pept        complement(427903..428361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10471"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10471"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68699"
FT                   /db_xref="GOA:D6ZQ10"
FT                   /db_xref="InterPro:IPR021560"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ10"
FT                   /protein_id="ADI68699.1"
FT   gene            complement(428358..428879)
FT                   /locus_tag="HMPREF0837_10472"
FT   CDS_pept        complement(428358..428879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10472"
FT                   /product="LytTr DNA-binding domain protein"
FT                   /note="Pfam: PF04397; InterPro: IPR007492"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10472"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68700"
FT                   /db_xref="GOA:D6ZQ11"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ11"
FT                   /protein_id="ADI68700.1"
FT                   LKTIKEKLEL"
FT   gene            428920..429093
FT                   /locus_tag="HMPREF0837_10473"
FT   CDS_pept        428920..429093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10473"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68701"
FT                   /db_xref="GOA:D6ZQ12"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ12"
FT                   /protein_id="ADI68701.1"
FT                   LGSYVVEFFCSF"
FT   gene            429154..431103
FT                   /gene="mutL"
FT                   /locus_tag="HMPREF0837_10474"
FT   CDS_pept        429154..431103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutL"
FT                   /locus_tag="HMPREF0837_10474"
FT                   /product="DNA mismatch repair domain protein"
FT                   /note="COG: COG0323; Pfam: PF02518,PF01119,PF08676;
FT                   InterPro: IPR002099"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10474"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68702"
FT                   /db_xref="GOA:D6ZQ13"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ13"
FT                   /protein_id="ADI68702.1"
FT                   IQENHTSLRELGKY"
FT   gene            complement(431428..431895)
FT                   /gene="ribH"
FT                   /locus_tag="HMPREF0837_10475"
FT   CDS_pept        complement(431428..431895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /locus_tag="HMPREF0837_10475"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="6.3.3.-"
FT                   /note="COG: COG0054; Pfam: PF00885; InterPro: IPR002180"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10475"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68703"
FT                   /db_xref="GOA:D6ZQ14"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ14"
FT                   /protein_id="ADI68703.1"
FT   gene            complement(431896..433131)
FT                   /gene="ribB"
FT                   /locus_tag="HMPREF0837_10476"
FT   CDS_pept        complement(431896..433131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribB"
FT                   /locus_tag="HMPREF0837_10476"
FT                   /product="3,4-dihydroxy-2-butanone-4-phosphate synthase"
FT                   /EC_number=""
FT                   /note="COG: COG0108; Pfam: PF00926,PF00925; InterPro:
FT                   IPR000422"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10476"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68704"
FT                   /db_xref="GOA:D6ZQ15"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR016299"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ15"
FT                   /protein_id="ADI68704.1"
FT                   NRMGHILNMEEK"
FT   gene            complement(433121..433756)
FT                   /gene="ribE"
FT                   /locus_tag="HMPREF0837_10477"
FT   CDS_pept        complement(433121..433756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribE"
FT                   /locus_tag="HMPREF0837_10477"
FT                   /product="riboflavin synthase, alpha subunit"
FT                   /EC_number=""
FT                   /note="COG: COG0307; Pfam: PF00677; InterPro: IPR001783"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10477"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68705"
FT                   /db_xref="GOA:D6ZQ16"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ16"
FT                   /protein_id="ADI68705.1"
FT   gene            complement(433741..434841)
FT                   /gene="ribD"
FT                   /locus_tag="HMPREF0837_10478"
FT   CDS_pept        complement(433741..434841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="HMPREF0837_10478"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="Pfam: PF00383,PF01872; InterPro: IPR004794"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10478"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68706"
FT                   /db_xref="GOA:D6ZQ17"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ17"
FT                   /protein_id="ADI68706.1"
FT   misc_binding    complement(434975..435089)
FT                   /function="FMN riboswitch (RFN element)"
FT                   /bound_moiety="flavin mononucleotide"
FT                   /note="HMPREF0837_nc10006"
FT   gene            435246..435839
FT                   /gene="ruvA"
FT                   /locus_tag="HMPREF0837_10479"
FT   CDS_pept        435246..435839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvA"
FT                   /locus_tag="HMPREF0837_10479"
FT                   /product="Holliday junction DNA helicase RuvA"
FT                   /EC_number="3.6.1.-"
FT                   /note="COG: COG0632; Pfam: PF01330,PF07499; InterPro:
FT                   IPR000085"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10479"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68707"
FT                   /db_xref="GOA:D6ZQ18"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ18"
FT                   /protein_id="ADI68707.1"
FT   gene            435876..436412
FT                   /gene="tag"
FT                   /locus_tag="HMPREF0837_10480"
FT   CDS_pept        435876..436412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tag"
FT                   /locus_tag="HMPREF0837_10480"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number=""
FT                   /note="COG: COG2818; Pfam: PF03352; InterPro: IPR005019"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10480"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68708"
FT                   /db_xref="GOA:D6ZQ19"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ19"
FT                   /protein_id="ADI68708.1"
FT                   LVDDHENDCEWKGLK"
FT   gene            436409..437086
FT                   /locus_tag="HMPREF0837_10481"
FT   CDS_pept        436409..437086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10481"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /note="Pfam: PF02517; InterPro: IPR003675"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10481"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68709"
FT                   /db_xref="GOA:D6ZQ20"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ20"
FT                   /protein_id="ADI68709.1"
FT                   IVK"
FT   gene            complement(437223..438254)
FT                   /locus_tag="HMPREF0837_10482"
FT   CDS_pept        complement(437223..438254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10482"
FT                   /product="LD-carboxypeptidase"
FT                   /note="COG: COG1619; Pfam: PF02016; InterPro: IPR003507"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10482"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68710"
FT                   /db_xref="GOA:D6ZQ21"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ21"
FT                   /protein_id="ADI68710.1"
FT                   YNK"
FT   gene            complement(438509..439213)
FT                   /locus_tag="HMPREF0837_10483"
FT   CDS_pept        complement(438509..439213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10483"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4858; Pfam: PF06570; InterPro: IPR009214"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10483"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68711"
FT                   /db_xref="GOA:D6ZQ22"
FT                   /db_xref="InterPro:IPR009214"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ22"
FT                   /protein_id="ADI68711.1"
FT                   RSASAGPTRYQE"
FT   gene            complement(439204..440148)
FT                   /locus_tag="HMPREF0837_10484"
FT   CDS_pept        complement(439204..440148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10484"
FT                   /product="CorA-like protein"
FT                   /note="COG: COG0598; Pfam: PF01544; InterPro: IPR002523"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10484"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68712"
FT                   /db_xref="GOA:D6ZQ23"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ23"
FT                   /protein_id="ADI68712.1"
FT   gene            complement(440309..440824)
FT                   /locus_tag="HMPREF0837_10485"
FT   CDS_pept        complement(440309..440824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10485"
FT                   /product="site-specific recombinase, phage integrase
FT                   family"
FT                   /note="COG: COG0582; Pfam: PF00589; InterPro: IPR013762"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10485"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68713"
FT                   /db_xref="GOA:D6ZQ24"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ24"
FT                   /protein_id="ADI68713.1"
FT                   YETALKAL"
FT   gene            complement(440875..441474)
FT                   /locus_tag="HMPREF0837_10486"
FT   CDS_pept        complement(440875..441474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10486"
FT                   /product="prophage Sa05, site-specific recombinase, phage
FT                   integrase family protein"
FT                   /note="COG: COG0582"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10486"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68714"
FT                   /db_xref="GOA:D6ZQ25"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ25"
FT                   /protein_id="ADI68714.1"
FT   gene            complement(441559..443073)
FT                   /locus_tag="HMPREF0837_10487"
FT   CDS_pept        complement(441559..443073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10487"
FT                   /product="divergent AAA domain protein"
FT                   /note="Pfam: PF04326; InterPro: IPR007421"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10487"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68715"
FT                   /db_xref="GOA:D6ZQ26"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ26"
FT                   /protein_id="ADI68715.1"
FT   gene            complement(443234..443947)
FT                   /locus_tag="HMPREF0837_10488"
FT   CDS_pept        complement(443234..443947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10488"
FT                   /product="DNA-binding helix-turn-helix protein"
FT                   /note="Pfam: PF01381; InterPro: IPR001387"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10488"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68716"
FT                   /db_xref="GOA:D6ZQ27"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ27"
FT                   /protein_id="ADI68716.1"
FT                   DKENLDDFALLWGID"
FT   gene            444100..444330
FT                   /locus_tag="HMPREF0837_10489"
FT   CDS_pept        444100..444330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10489"
FT                   /product="DNA-binding helix-turn-helix protein"
FT                   /note="Pfam: PF01381; InterPro: IPR001387"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10489"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68717"
FT                   /db_xref="GOA:D6ZQ28"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ28"
FT                   /protein_id="ADI68717.1"
FT   gene            444346..444972
FT                   /locus_tag="HMPREF0837_10490"
FT   CDS_pept        444346..444972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10490"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68718"
FT                   /db_xref="InterPro:IPR014054"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ29"
FT                   /protein_id="ADI68718.1"
FT   gene            445344..445796
FT                   /locus_tag="HMPREF0837_10491"
FT   CDS_pept        445344..445796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10491"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68719"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ30"
FT                   /protein_id="ADI68719.1"
FT   gene            445793..445993
FT                   /locus_tag="HMPREF0837_10492"
FT   CDS_pept        445793..445993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10492"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10492"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68720"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ31"
FT                   /protein_id="ADI68720.1"
FT   gene            445995..446210
FT                   /locus_tag="HMPREF0837_10493"
FT   CDS_pept        445995..446210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10493"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10493"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68721"
FT                   /db_xref="GOA:D6ZQ32"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ32"
FT                   /protein_id="ADI68721.1"
FT   gene            446207..446548
FT                   /locus_tag="HMPREF0837_10494"
FT   CDS_pept        446207..446548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10494"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10494"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68722"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ33"
FT                   /protein_id="ADI68722.1"
FT                   TLKEVGGYV"
FT   gene            446541..446822
FT                   /locus_tag="HMPREF0837_10495"
FT   CDS_pept        446541..446822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10495"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68723"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ34"
FT                   /protein_id="ADI68723.1"
FT   gene            446809..446955
FT                   /locus_tag="HMPREF0837_10496"
FT   CDS_pept        446809..446955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10496"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68724"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ35"
FT                   /protein_id="ADI68724.1"
FT                   KGR"
FT   gene            446957..447823
FT                   /locus_tag="HMPREF0837_10497"
FT   CDS_pept        446957..447823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10497"
FT                   /product="primase alpha helix C-terminal domain protein"
FT                   /note="Pfam: PF08708; InterPro: IPR014820"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10497"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68725"
FT                   /db_xref="InterPro:IPR014820"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ36"
FT                   /protein_id="ADI68725.1"
FT                   AEYRKRG"
FT   gene            447876..449345
FT                   /locus_tag="HMPREF0837_10498"
FT   CDS_pept        447876..449345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10498"
FT                   /product="phage/plasmid primase, P4 family domain protein"
FT                   /note="COG: COG3378; Pfam: PF08706; InterPro: IPR006500"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10498"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68726"
FT                   /db_xref="InterPro:IPR006500"
FT                   /db_xref="InterPro:IPR014015"
FT                   /db_xref="InterPro:IPR014818"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ37"
FT                   /protein_id="ADI68726.1"
FT   gene            449698..449865
FT                   /locus_tag="HMPREF0837_10499"
FT   CDS_pept        449698..449865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10499"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68727"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ38"
FT                   /protein_id="ADI68727.1"
FT                   SVAIVLVLYR"
FT   gene            449949..450479
FT                   /locus_tag="HMPREF0837_10500"
FT   CDS_pept        449949..450479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10500"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68728"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ39"
FT                   /protein_id="ADI68728.1"
FT                   EYKGLAGYTEHLK"
FT   gene            450550..451059
FT                   /locus_tag="HMPREF0837_10501"
FT   CDS_pept        450550..451059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10501"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68729"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ40"
FT                   /protein_id="ADI68729.1"
FT                   GLSSLR"
FT   gene            452138..452674
FT                   /locus_tag="HMPREF0837_10502"
FT   CDS_pept        452138..452674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10502"
FT                   /product="sigma-70, region 4"
FT                   /note="Pfam: PF08281"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10502"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68730"
FT                   /db_xref="InterPro:IPR010861"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ41"
FT                   /protein_id="ADI68730.1"
FT                   RQKAIEHLTGIVNGD"
FT   gene            453130..455994
FT                   /gene="uvrA"
FT                   /locus_tag="HMPREF0837_10503"
FT   CDS_pept        453130..455994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="HMPREF0837_10503"
FT                   /product="excinuclease ABC, A subunit"
FT                   /EC_number="3.1.25.-"
FT                   /note="COG: COG0178; Pfam: PF00005; InterPro: IPR004602"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10503"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68731"
FT                   /db_xref="GOA:D6ZQ42"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ42"
FT                   /protein_id="ADI68731.1"
FT   gene            455987..457048
FT                   /locus_tag="HMPREF0837_10504"
FT   CDS_pept        455987..457048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10504"
FT                   /product="Creatinase"
FT                   /note="COG: COG0006; Pfam: PF01321,PF00557; InterPro:
FT                   IPR000994"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10504"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68732"
FT                   /db_xref="GOA:D6ZQ43"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ43"
FT                   /protein_id="ADI68732.1"
FT                   ELLTLAPKELIVI"
FT   gene            457180..457578
FT                   /gene="spxA"
FT                   /locus_tag="HMPREF0837_10505"
FT   CDS_pept        457180..457578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spxA"
FT                   /locus_tag="HMPREF0837_10505"
FT                   /product="transcriptional regulator Spx"
FT                   /note="COG: COG1393; Pfam: PF03960; InterPro: IPR012335"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10505"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68733"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ44"
FT                   /protein_id="ADI68733.1"
FT   gene            457644..458213
FT                   /locus_tag="HMPREF0837_10506"
FT   CDS_pept        457644..458213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10506"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68734"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ45"
FT                   /protein_id="ADI68734.1"
FT   gene            458300..458566
FT                   /locus_tag="HMPREF0837_10507"
FT   CDS_pept        458300..458566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10507"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4472; Pfam: PF06135; InterPro: IPR009309"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10507"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68735"
FT                   /db_xref="InterPro:IPR009309"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ46"
FT                   /protein_id="ADI68735.1"
FT   gene            458579..458989
FT                   /locus_tag="HMPREF0837_10508"
FT   CDS_pept        458579..458989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10508"
FT                   /product="RNAse H domain protein, YqgF family"
FT                   /note="COG: COG0816; Pfam: PF03652; InterPro: IPR005227"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10508"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68736"
FT                   /db_xref="GOA:D6ZQ47"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ47"
FT                   /protein_id="ADI68736.1"
FT   gene            459005..459310
FT                   /locus_tag="HMPREF0837_10509"
FT   CDS_pept        459005..459310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10509"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3906; Pfam: PF06949; InterPro: IPR009711"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10509"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68737"
FT                   /db_xref="InterPro:IPR009711"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ48"
FT                   /protein_id="ADI68737.1"
FT   gene            459568..460818
FT                   /gene="folC"
FT                   /locus_tag="HMPREF0837_10510"
FT   CDS_pept        459568..460818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folC"
FT                   /locus_tag="HMPREF0837_10510"
FT                   /product="bifunctional protein FolC"
FT                   /note="COG: COG0285; Pfam: PF08245,PF02875; InterPro:
FT                   IPR001645"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10510"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68738"
FT                   /db_xref="GOA:D6ZQ49"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ49"
FT                   /protein_id="ADI68738.1"
FT                   YFISEVRGYLLDREQIN"
FT   gene            460815..461357
FT                   /locus_tag="HMPREF0837_10511"
FT   CDS_pept        460815..461357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10511"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68739"
FT                   /db_xref="InterPro:IPR020961"
FT                   /db_xref="InterPro:IPR027279"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ50"
FT                   /protein_id="ADI68739.1"
FT                   VVDDMDRDPSDQIVLTK"
FT   gene            461503..463035
FT                   /locus_tag="HMPREF0837_10512"
FT   CDS_pept        461503..463035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10512"
FT                   /product="phospholipase D domain protein"
FT                   /EC_number="3.1.-.-"
FT                   /note="COG: COG1502; Pfam: PF00614"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10512"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68740"
FT                   /db_xref="GOA:D6ZQ51"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ51"
FT                   /protein_id="ADI68740.1"
FT   gene            463113..463256
FT                   /locus_tag="HMPREF0837_10513"
FT   CDS_pept        463113..463256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10513"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10513"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68741"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ52"
FT                   /protein_id="ADI68741.1"
FT                   TF"
FT   gene            463293..464831
FT                   /gene="ccs"
FT                   /locus_tag="HMPREF0837_10514"
FT   CDS_pept        463293..464831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccs"
FT                   /locus_tag="HMPREF0837_10514"
FT                   /product="competence-induced protein Ccs4"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10514"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68742"
FT                   /db_xref="GOA:D6ZQ53"
FT                   /db_xref="InterPro:IPR016978"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ53"
FT                   /protein_id="ADI68742.1"
FT   gene            464945..467158
FT                   /gene="nrdD"
FT                   /locus_tag="HMPREF0837_10515"
FT   CDS_pept        464945..467158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdD"
FT                   /locus_tag="HMPREF0837_10515"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /EC_number=""
FT                   /note="COG: COG1328; Pfam: PF03477,PF01228; InterPro:
FT                   IPR012833"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10515"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68743"
FT                   /db_xref="GOA:D6ZQ54"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ54"
FT                   /protein_id="ADI68743.1"
FT   gene            467342..467482
FT                   /locus_tag="HMPREF0837_10516"
FT   CDS_pept        467342..467482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10516"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68744"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ55"
FT                   /protein_id="ADI68744.1"
FT                   K"
FT   gene            467526..468032
FT                   /locus_tag="HMPREF0837_10517"
FT   CDS_pept        467526..468032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10517"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="COG: COG3981; Pfam: PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10517"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68745"
FT                   /db_xref="GOA:D6ZQ56"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ56"
FT                   /protein_id="ADI68745.1"
FT                   EVANE"
FT   gene            468025..468615
FT                   /gene="nrdG"
FT                   /locus_tag="HMPREF0837_10518"
FT   CDS_pept        468025..468615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdG"
FT                   /locus_tag="HMPREF0837_10518"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /EC_number=""
FT                   /note="COG: COG0602; Pfam: PF04055; InterPro: IPR012837"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10518"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68746"
FT                   /db_xref="GOA:D6ZQ57"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ57"
FT                   /protein_id="ADI68746.1"
FT   gene            468612..469229
FT                   /locus_tag="HMPREF0837_10519"
FT   CDS_pept        468612..469229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10519"
FT                   /product="phosphoribulokinase/uridine kinase family
FT                   protein"
FT                   /note="Pfam: PF00485"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10519"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68747"
FT                   /db_xref="GOA:D6ZQ58"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ58"
FT                   /protein_id="ADI68747.1"
FT   gene            469495..469803
FT                   /gene="rpsJ"
FT                   /locus_tag="HMPREF0837_10520"
FT   CDS_pept        469495..469803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="HMPREF0837_10520"
FT                   /product="ribosomal protein S10"
FT                   /note="COG: COG0051; Pfam: PF00338; InterPro: IPR005731"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10520"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68748"
FT                   /db_xref="GOA:D6ZQ59"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ59"
FT                   /protein_id="ADI68748.1"
FT   gene            470020..470646
FT                   /gene="rplC"
FT                   /locus_tag="HMPREF0837_10521"
FT   CDS_pept        470020..470646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="HMPREF0837_10521"
FT                   /product="50S ribosomal protein L3"
FT                   /note="COG: COG0087; Pfam: PF00297; InterPro: IPR000597"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10521"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68749"
FT                   /db_xref="GOA:D6ZQ60"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ60"
FT                   /protein_id="ADI68749.1"
FT   gene            470671..471294
FT                   /gene="rplD"
FT                   /locus_tag="HMPREF0837_10522"
FT   CDS_pept        470671..471294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="HMPREF0837_10522"
FT                   /product="50S ribosomal protein L4"
FT                   /note="COG: COG0088; Pfam: PF00573; InterPro: IPR002136"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10522"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68750"
FT                   /db_xref="GOA:D6ZQ61"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ61"
FT                   /protein_id="ADI68750.1"
FT   gene            471294..471590
FT                   /gene="rplW"
FT                   /locus_tag="HMPREF0837_10523"
FT   CDS_pept        471294..471590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="HMPREF0837_10523"
FT                   /product="ribosomal protein L23"
FT                   /note="COG: COG0089; Pfam: PF00276; InterPro: IPR012677"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10523"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68751"
FT                   /db_xref="GOA:D6ZQ62"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ62"
FT                   /protein_id="ADI68751.1"
FT   gene            471653..472441
FT                   /gene="rplB"
FT                   /locus_tag="HMPREF0837_10524"
FT   CDS_pept        471653..472441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="HMPREF0837_10524"
FT                   /product="ribosomal protein L2"
FT                   /note="COG: COG0090; Pfam: PF00181,PF03947; InterPro:
FT                   IPR005880"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10524"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68752"
FT                   /db_xref="GOA:D6ZQ63"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ63"
FT                   /protein_id="ADI68752.1"
FT   gene            472545..472826
FT                   /gene="rpsS"
FT                   /locus_tag="HMPREF0837_10525"
FT   CDS_pept        472545..472826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="HMPREF0837_10525"
FT                   /product="ribosomal protein S19"
FT                   /note="COG: COG0185; Pfam: PF00203; InterPro: IPR002222"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10525"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68753"
FT                   /db_xref="GOA:D6ZQ64"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ64"
FT                   /protein_id="ADI68753.1"
FT   gene            472838..473182
FT                   /gene="rplV"
FT                   /locus_tag="HMPREF0837_10526"
FT   CDS_pept        472838..473182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="HMPREF0837_10526"
FT                   /product="ribosomal protein L22"
FT                   /note="COG: COG0091; Pfam: PF00237; InterPro: IPR001063"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10526"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68754"
FT                   /db_xref="GOA:D6ZQ65"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ65"
FT                   /protein_id="ADI68754.1"
FT                   AHITVAVAEK"
FT   gene            473195..473848
FT                   /gene="rpsC"
FT                   /locus_tag="HMPREF0837_10527"
FT   CDS_pept        473195..473848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="HMPREF0837_10527"
FT                   /product="ribosomal protein S3"
FT                   /note="COG: COG0092; Pfam: PF00417,PF07650,PF00189;
FT                   InterPro: IPR005704"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10527"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68755"
FT                   /db_xref="GOA:D6ZQ66"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ66"
FT                   /protein_id="ADI68755.1"
FT   gene            473852..474265
FT                   /gene="rplP"
FT                   /locus_tag="HMPREF0837_10528"
FT   CDS_pept        473852..474265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="HMPREF0837_10528"
FT                   /product="ribosomal protein L16"
FT                   /note="COG: COG0197; Pfam: PF00252; InterPro: IPR000114"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10528"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68756"
FT                   /db_xref="GOA:D6ZQ67"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ67"
FT                   /protein_id="ADI68756.1"
FT   gene            474275..474481
FT                   /gene="rpmC"
FT                   /locus_tag="HMPREF0837_10529"
FT   CDS_pept        474275..474481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="HMPREF0837_10529"
FT                   /product="ribosomal protein L29"
FT                   /note="COG: COG0255; Pfam: PF00831; InterPro: IPR001854"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10529"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68757"
FT                   /db_xref="GOA:D6ZQ68"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ68"
FT                   /protein_id="ADI68757.1"
FT   gene            474506..474766
FT                   /gene="rpsQ"
FT                   /locus_tag="HMPREF0837_10530"
FT   CDS_pept        474506..474766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="HMPREF0837_10530"
FT                   /product="30S ribosomal protein S17"
FT                   /note="COG: COG0186; Pfam: PF00366; InterPro: IPR000266"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10530"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68758"
FT                   /db_xref="GOA:D6ZQ69"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ69"
FT                   /protein_id="ADI68758.1"
FT   gene            474792..475160
FT                   /gene="rplN"
FT                   /locus_tag="HMPREF0837_10531"
FT   CDS_pept        474792..475160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="HMPREF0837_10531"
FT                   /product="ribosomal protein L14"
FT                   /note="COG: COG0093; Pfam: PF00238; InterPro: IPR005745"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10531"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68759"
FT                   /db_xref="GOA:D6ZQ70"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ70"
FT                   /protein_id="ADI68759.1"
FT                   ELREGGFMKIVSLAPEVL"
FT   gene            475238..475543
FT                   /gene="rplX"
FT                   /locus_tag="HMPREF0837_10532"
FT   CDS_pept        475238..475543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="HMPREF0837_10532"
FT                   /product="ribosomal protein L24"
FT                   /note="COG: COG0198; Pfam: PF00467; InterPro: IPR003256"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10532"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68760"
FT                   /db_xref="GOA:D6ZQ71"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ71"
FT                   /protein_id="ADI68760.1"
FT   gene            475567..476109
FT                   /gene="rplE"
FT                   /locus_tag="HMPREF0837_10533"
FT   CDS_pept        475567..476109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="HMPREF0837_10533"
FT                   /product="ribosomal protein L5"
FT                   /note="COG: COG0094; Pfam: PF00281,PF00673; InterPro:
FT                   IPR002132"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10533"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68761"
FT                   /db_xref="GOA:D6ZQ72"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ72"
FT                   /protein_id="ADI68761.1"
FT                   DEESRALLTGLGMPFAK"
FT   gene            476127..476396
FT                   /gene="rpsN"
FT                   /locus_tag="HMPREF0837_10534"
FT   CDS_pept        476127..476396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="HMPREF0837_10534"
FT                   /product="ribosomal protein S14p/S29e"
FT                   /note="COG: COG0199; Pfam: PF00253; InterPro: IPR001209"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10534"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68762"
FT                   /db_xref="GOA:D6ZQ73"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ73"
FT                   /protein_id="ADI68762.1"
FT   gene            476681..477079
FT                   /gene="rpsH"
FT                   /locus_tag="HMPREF0837_10535"
FT   CDS_pept        476681..477079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="HMPREF0837_10535"
FT                   /product="ribosomal protein S8"
FT                   /note="COG: COG0096; Pfam: PF00410; InterPro: IPR000630"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10535"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68763"
FT                   /db_xref="GOA:D6ZQ74"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ74"
FT                   /protein_id="ADI68763.1"
FT   gene            477271..477807
FT                   /gene="rplF"
FT                   /locus_tag="HMPREF0837_10536"
FT   CDS_pept        477271..477807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="HMPREF0837_10536"
FT                   /product="ribosomal protein L6"
FT                   /note="COG: COG0097; Pfam: PF00347; InterPro: IPR000702"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10536"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68764"
FT                   /db_xref="GOA:D6ZQ75"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ75"
FT                   /protein_id="ADI68764.1"
FT                   YVGEFVRRKEGKTGK"
FT   gene            477852..478247
FT                   /gene="rplR"
FT                   /locus_tag="HMPREF0837_10537"
FT   CDS_pept        477852..478247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="HMPREF0837_10537"
FT                   /product="ribosomal protein L18"
FT                   /note="COG: COG0256; Pfam: PF00861; InterPro: IPR005484"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10537"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68765"
FT                   /db_xref="GOA:D6ZQ76"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ76"
FT                   /protein_id="ADI68765.1"
FT   gene            478265..478759
FT                   /gene="rpsE"
FT                   /locus_tag="HMPREF0837_10538"
FT   CDS_pept        478265..478759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="HMPREF0837_10538"
FT                   /product="ribosomal protein S5"
FT                   /note="COG: COG0098; Pfam: PF00333,PF03719; InterPro:
FT                   IPR000851"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10538"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68766"
FT                   /db_xref="GOA:D6ZQ77"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ77"
FT                   /protein_id="ADI68766.1"
FT                   A"
FT   gene            478731..478955
FT                   /gene="rpmD"
FT                   /locus_tag="HMPREF0837_10539"
FT   CDS_pept        478731..478955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="HMPREF0837_10539"
FT                   /product="ribosomal protein L30"
FT                   /note="COG: COG1841; Pfam: PF00327; InterPro: IPR005996"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10539"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68767"
FT                   /db_xref="GOA:D6ZQ78"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ78"
FT                   /protein_id="ADI68767.1"
FT   gene            479100..479540
FT                   /gene="rplO"
FT                   /locus_tag="HMPREF0837_10540"
FT   CDS_pept        479100..479540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="HMPREF0837_10540"
FT                   /product="ribosomal protein L15"
FT                   /note="COG: COG0200; Pfam: PF01305,PF00256; InterPro:
FT                   IPR005749"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10540"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68768"
FT                   /db_xref="GOA:D6ZQ79"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ79"
FT                   /protein_id="ADI68768.1"
FT   gene            479553..480863
FT                   /gene="secY"
FT                   /locus_tag="HMPREF0837_10541"
FT   CDS_pept        479553..480863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="HMPREF0837_10541"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="COG: COG0201; Pfam: PF00344; InterPro: IPR002208"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10541"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68769"
FT                   /db_xref="GOA:D6ZQ80"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ80"
FT                   /protein_id="ADI68769.1"
FT   gene            481014..481652
FT                   /locus_tag="HMPREF0837_10542"
FT   CDS_pept        481014..481652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10542"
FT                   /product="adenylate kinase"
FT                   /EC_number=""
FT                   /note="COG: COG0563; Pfam: PF00406,PF05191; InterPro:
FT                   IPR000850"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10542"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68770"
FT                   /db_xref="GOA:D6ZQ81"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ81"
FT                   /protein_id="ADI68770.1"
FT   gene            481769..481987
FT                   /gene="infA"
FT                   /locus_tag="HMPREF0837_10543"
FT   CDS_pept        481769..481987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="HMPREF0837_10543"
FT                   /product="translation initiation factor IF-1"
FT                   /note="COG: COG0361; Pfam: PF01176; InterPro: IPR012340"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10543"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68771"
FT                   /db_xref="GOA:D6ZQ82"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ82"
FT                   /protein_id="ADI68771.1"
FT   gene            482012..482128
FT                   /gene="rpmJ"
FT                   /locus_tag="HMPREF0837_10544"
FT   CDS_pept        482012..482128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="HMPREF0837_10544"
FT                   /product="ribosomal protein L36"
FT                   /note="COG: COG0257; Pfam: PF00444; InterPro: IPR000473"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10544"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68772"
FT                   /db_xref="GOA:D6ZQ83"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ83"
FT                   /protein_id="ADI68772.1"
FT   gene            482146..482511
FT                   /gene="rpsM"
FT                   /locus_tag="HMPREF0837_10545"
FT   CDS_pept        482146..482511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="HMPREF0837_10545"
FT                   /product="30S ribosomal protein S13"
FT                   /note="COG: COG0099; Pfam: PF00416; InterPro: IPR001892"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10545"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68773"
FT                   /db_xref="GOA:D6ZQ84"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ84"
FT                   /protein_id="ADI68773.1"
FT                   NARTRKGKAVAIAGKKK"
FT   gene            482556..482912
FT                   /gene="rpsK"
FT                   /locus_tag="HMPREF0837_10546"
FT   CDS_pept        482556..482912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="HMPREF0837_10546"
FT                   /product="30S ribosomal protein S11"
FT                   /note="COG: COG0100; Pfam: PF00411; InterPro: IPR001971"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10546"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68774"
FT                   /db_xref="GOA:D6ZQ85"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ85"
FT                   /protein_id="ADI68774.1"
FT                   VPHNGARPPKRRRV"
FT   gene            482955..483890
FT                   /gene="rpoA"
FT                   /locus_tag="HMPREF0837_10547"
FT   CDS_pept        482955..483890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="HMPREF0837_10547"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /EC_number=""
FT                   /note="COG: COG0202; Pfam: PF01193,PF01000,PF03118;
FT                   InterPro: IPR011773"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10547"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68775"
FT                   /db_xref="GOA:D6ZQ86"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ86"
FT                   /protein_id="ADI68775.1"
FT   gene            483902..484288
FT                   /gene="rplQ"
FT                   /locus_tag="HMPREF0837_10548"
FT   CDS_pept        483902..484288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="HMPREF0837_10548"
FT                   /product="ribosomal protein L17"
FT                   /note="COG: COG0203; Pfam: PF01196; InterPro: IPR000456"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10548"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68776"
FT                   /db_xref="GOA:D6ZQ87"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ87"
FT                   /protein_id="ADI68776.1"
FT   gene            484481..484819
FT                   /locus_tag="HMPREF0837_10549"
FT   CDS_pept        484481..484819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10549"
FT                   /product="ACT domain protein"
FT                   /note="COG: COG3830; Pfam: PF01842"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10549"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68777"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR022986"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ88"
FT                   /protein_id="ADI68777.1"
FT                   IFEAMYNI"
FT   gene            484829..486166
FT                   /locus_tag="HMPREF0837_10550"
FT   CDS_pept        484829..486166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10550"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG2848; Pfam: PF05167; InterPro: IPR007841"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10550"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68778"
FT                   /db_xref="InterPro:IPR007841"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ89"
FT                   /protein_id="ADI68778.1"
FT   gene            486353..487102
FT                   /locus_tag="HMPREF0837_10551"
FT   CDS_pept        486353..487102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10551"
FT                   /product="phosphoglycerate mutase family protein"
FT                   /EC_number="5.4.2.-"
FT                   /note="COG: COG0406; Pfam: PF00300; InterPro: IPR013078"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10551"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68779"
FT                   /db_xref="GOA:D6ZQ90"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ90"
FT                   /protein_id="ADI68779.1"
FT   gene            complement(487205..487618)
FT                   /locus_tag="HMPREF0837_10552"
FT   CDS_pept        complement(487205..487618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10552"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1178"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10552"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68780"
FT                   /db_xref="GOA:D6ZQ91"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ91"
FT                   /protein_id="ADI68780.1"
FT   gene            complement(487615..488217)
FT                   /locus_tag="HMPREF0837_10553"
FT   CDS_pept        complement(487615..488217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10553"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10553"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68781"
FT                   /db_xref="GOA:D6ZQ92"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ92"
FT                   /protein_id="ADI68781.1"
FT   gene            complement(488214..488582)
FT                   /locus_tag="HMPREF0837_10554"
FT   CDS_pept        complement(488214..488582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10554"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68782"
FT                   /db_xref="GOA:D6ZQ93"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ93"
FT                   /protein_id="ADI68782.1"
FT                   VVLPLLVPTLLAAPCLYL"
FT   gene            complement(488830..489453)
FT                   /locus_tag="HMPREF0837_10555"
FT   CDS_pept        complement(488830..489453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10555"
FT                   /product="TOBE domain protein"
FT                   /note="COG: COG3842; Pfam: PF08402"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10555"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68783"
FT                   /db_xref="GOA:D6ZQ94"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ94"
FT                   /protein_id="ADI68783.1"
FT   gene            complement(489535..489921)
FT                   /locus_tag="HMPREF0837_10556"
FT   CDS_pept        complement(489535..489921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10556"
FT                   /product="Fe(3+) ions import ATP-binding protein FbpC
FT                   family protein"
FT                   /note="COG: COG3842; Pfam: PF00005; InterPro: IPR003439"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10556"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68784"
FT                   /db_xref="GOA:D6ZQ95"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ95"
FT                   /protein_id="ADI68784.1"
FT   gene            complement(489934..490383)
FT                   /locus_tag="HMPREF0837_10557"
FT   CDS_pept        complement(489934..490383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10557"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1840; InterPro: IPR011587"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10557"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68785"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ96"
FT                   /protein_id="ADI68785.1"
FT   gene            complement(490447..490641)
FT                   /locus_tag="HMPREF0837_10558"
FT   CDS_pept        complement(490447..490641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10558"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG1840"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10558"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68786"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ97"
FT                   /protein_id="ADI68786.1"
FT   gene            complement(490954..491055)
FT                   /locus_tag="HMPREF0837_10559"
FT   CDS_pept        complement(490954..491055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10559"
FT                   /product="iron ABC transporter, iron-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10559"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68787"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ98"
FT                   /protein_id="ADI68787.1"
FT   gene            complement(491253..491450)
FT                   /locus_tag="HMPREF0837_10560"
FT   CDS_pept        complement(491253..491450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10560"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="Pfam: PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10560"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68788"
FT                   /db_xref="GOA:D6ZQ99"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQ99"
FT                   /protein_id="ADI68788.1"
FT   gene            complement(491525..492301)
FT                   /locus_tag="HMPREF0837_10561"
FT   CDS_pept        complement(491525..492301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10561"
FT                   /product="glycyl-radical enzyme activating protein family
FT                   protein"
FT                   /EC_number="1.97.1.-"
FT                   /note="COG: COG1180; Pfam: PF04055; InterPro: IPR012839"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10561"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68789"
FT                   /db_xref="GOA:D6ZQA0"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQA0"
FT                   /protein_id="ADI68789.1"
FT   gene            492423..493169
FT                   /locus_tag="HMPREF0837_10562"
FT   CDS_pept        492423..493169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10562"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="COG: COG1349; Pfam: PF08220,PF00455; InterPro:
FT                   IPR014036"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10562"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68790"
FT                   /db_xref="GOA:D6ZQA1"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQA1"
FT                   /protein_id="ADI68790.1"
FT   gene            493182..494162
FT                   /locus_tag="HMPREF0837_10563"
FT   CDS_pept        493182..494162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10563"
FT                   /product="putative sugar-binding domain protein"
FT                   /note="COG: COG2390; Pfam: PF04198; InterPro: IPR007324"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10563"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68791"
FT                   /db_xref="GOA:D6ZQA2"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQA2"
FT                   /protein_id="ADI68791.1"
FT   gene            494357..494677
FT                   /locus_tag="HMPREF0837_10564"
FT   CDS_pept        494357..494677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10564"
FT                   /product="PTS system, Lactose/Cellobiose specific IIA
FT                   subunit"
FT                   /note="COG: COG1447; Pfam: PF02255; InterPro: IPR003188"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10564"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68792"
FT                   /db_xref="GOA:D6ZQA3"
FT                   /db_xref="InterPro:IPR003188"
FT                   /db_xref="InterPro:IPR036542"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQA3"
FT                   /protein_id="ADI68792.1"
FT                   KK"
FT   gene            494723..495031
FT                   /locus_tag="HMPREF0837_10565"
FT   CDS_pept        494723..495031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10565"
FT                   /product="PTS system, Lactose/Cellobiose specific IIB
FT                   subunit"
FT                   /note="COG: COG1440; Pfam: PF02302; InterPro: IPR003501"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10565"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68793"
FT                   /db_xref="GOA:D6ZQA4"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQA4"
FT                   /protein_id="ADI68793.1"
FT   gene            495024..496346
FT                   /locus_tag="HMPREF0837_10566"
FT   CDS_pept        495024..496346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10566"
FT                   /product="putative PTS system, cellobiose-specific IIC
FT                   component"
FT                   /note="COG: COG1455; Pfam: PF02378; InterPro: IPR004501"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10566"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68794"
FT                   /db_xref="GOA:D6ZQA5"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQA5"
FT                   /protein_id="ADI68794.1"
FT   gene            496497..498935
FT                   /locus_tag="HMPREF0837_10567"
FT   CDS_pept        496497..498935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10567"
FT                   /product="formate C-acetyltransferase"
FT                   /EC_number=""
FT                   /note="COG: COG1882; Pfam: PF02901,PF01228; InterPro:
FT                   IPR010098"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10567"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68795"
FT                   /db_xref="GOA:D6ZQA6"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR005949"
FT                   /db_xref="InterPro:IPR010098"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQA6"
FT                   /protein_id="ADI68795.1"
FT                   "
FT   gene            498954..499622
FT                   /locus_tag="HMPREF0837_10568"
FT   CDS_pept        498954..499622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10568"
FT                   /product="fructose-6-phosphate aldolase"
FT                   /EC_number="4.1.2.-"
FT                   /note="COG: COG0176; Pfam: PF00923; InterPro: IPR013785"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10568"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68796"
FT                   /db_xref="GOA:D6ZQA7"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQA7"
FT                   /protein_id="ADI68796.1"
FT                   "
FT   gene            499640..500728
FT                   /locus_tag="HMPREF0837_10569"
FT   CDS_pept        499640..500728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10569"
FT                   /product="alcohol dehydrogenase, iron-dependent"
FT                   /EC_number=""
FT                   /note="COG: COG0371; Pfam: PF00465; InterPro: IPR001670"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10569"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68797"
FT                   /db_xref="GOA:D6ZQA8"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQA8"
FT                   /protein_id="ADI68797.1"
FT   gene            501183..503684
FT                   /gene="leuS"
FT                   /locus_tag="HMPREF0837_10570"
FT   CDS_pept        501183..503684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="HMPREF0837_10570"
FT                   /product="leucine--tRNA ligase"
FT                   /EC_number=""
FT                   /note="COG: COG0495; Pfam: PF09334,PF08264; InterPro:
FT                   IPR002302"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10570"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68798"
FT                   /db_xref="GOA:D6ZQA9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQA9"
FT                   /protein_id="ADI68798.1"
FT   gene            503823..504665
FT                   /locus_tag="HMPREF0837_10571"
FT   CDS_pept        503823..504665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10571"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10571"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68799"
FT                   /db_xref="GOA:D6ZQB0"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQB0"
FT                   /protein_id="ADI68799.1"
FT   gene            504721..505416
FT                   /locus_tag="HMPREF0837_10572"
FT   CDS_pept        504721..505416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10572"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="COG: COG1670; Pfam: PF00583; InterPro: IPR016181"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10572"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68800"
FT                   /db_xref="GOA:D6ZQB1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQB1"
FT                   /protein_id="ADI68800.1"
FT                   QQYKSLREL"
FT   gene            505428..505844
FT                   /locus_tag="HMPREF0837_10573"
FT   CDS_pept        505428..505844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10573"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="Pfam: PF00583; InterPro: IPR016181"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10573"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68801"
FT                   /db_xref="GOA:D6ZQB2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQB2"
FT                   /protein_id="ADI68801.1"
FT   gene            506885..507883
FT                   /gene="ruvB"
FT                   /locus_tag="HMPREF0837_10574"
FT   CDS_pept        506885..507883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="HMPREF0837_10574"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /EC_number="3.6.1.-"
FT                   /note="COG: COG2255; Pfam: PF05496,PF00004,PF05491;
FT                   InterPro: IPR004605"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10574"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68802"
FT                   /db_xref="GOA:D6ZQB3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQB3"
FT                   /protein_id="ADI68802.1"
FT   gene            507864..507971
FT                   /locus_tag="HMPREF0837_10575"
FT   CDS_pept        507864..507971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10575"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3575"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10575"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68803"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQB4"
FT                   /protein_id="ADI68803.1"
FT   gene            507972..508436
FT                   /locus_tag="HMPREF0837_10576"
FT   CDS_pept        507972..508436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10576"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3575; Pfam: PF06042; InterPro: IPR009267"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10576"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68804"
FT                   /db_xref="InterPro:IPR009267"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQB5"
FT                   /protein_id="ADI68804.1"
FT   gene            508667..509425
FT                   /gene="uppS"
FT                   /locus_tag="HMPREF0837_10577"
FT   CDS_pept        508667..509425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppS"
FT                   /locus_tag="HMPREF0837_10577"
FT                   /product="di-trans,poly-cis-decaprenylcistransferase"
FT                   /EC_number=""
FT                   /note="COG: COG0020; Pfam: PF01255; InterPro: IPR001441"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10577"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68805"
FT                   /db_xref="GOA:D6ZQB6"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQB6"
FT                   /protein_id="ADI68805.1"
FT   gene            509434..510237
FT                   /gene="cdsA"
FT                   /locus_tag="HMPREF0837_10578"
FT   CDS_pept        509434..510237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /locus_tag="HMPREF0837_10578"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /EC_number=""
FT                   /note="COG: COG0575; Pfam: PF01148; InterPro: IPR000374"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10578"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68806"
FT                   /db_xref="GOA:D6ZQB7"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQB7"
FT                   /protein_id="ADI68806.1"
FT   gene            510259..511518
FT                   /gene="rseP"
FT                   /locus_tag="HMPREF0837_10579"
FT   CDS_pept        510259..511518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rseP"
FT                   /locus_tag="HMPREF0837_10579"
FT                   /product="RIP metalloprotease RseP"
FT                   /EC_number="3.4.24.-"
FT                   /note="COG: COG0750; Pfam: PF02163; InterPro: IPR004387"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10579"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68807"
FT                   /db_xref="GOA:D6ZQB8"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQB8"
FT                   /protein_id="ADI68807.1"
FT   gene            511531..513384
FT                   /gene="proS"
FT                   /locus_tag="HMPREF0837_10580"
FT   CDS_pept        511531..513384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="HMPREF0837_10580"
FT                   /product="proline--tRNA ligase"
FT                   /EC_number=""
FT                   /note="COG: COG0442; Pfam: PF00587,PF04073,PF03129;
FT                   InterPro: IPR004500"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10580"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68808"
FT                   /db_xref="GOA:D6ZQB9"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQB9"
FT                   /protein_id="ADI68808.1"
FT   gene            513484..514863
FT                   /locus_tag="HMPREF0837_10581"
FT   CDS_pept        513484..514863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10581"
FT                   /product="glycosyl hydrolase, family 1"
FT                   /note="COG: COG2723; Pfam: PF00232; InterPro: IPR001360"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10581"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68809"
FT                   /db_xref="GOA:D6ZQC0"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQC0"
FT                   /protein_id="ADI68809.1"
FT                   F"
FT   gene            515055..516863
FT                   /gene="glmS"
FT                   /locus_tag="HMPREF0837_10582"
FT   CDS_pept        515055..516863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="HMPREF0837_10582"
FT                   /product="glutamine-fructose-6-phosphate transaminase
FT                   (isomerizing)"
FT                   /EC_number=""
FT                   /note="COG: COG0449; Pfam: PF00310,PF01380; InterPro:
FT                   IPR005855"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10582"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68810"
FT                   /db_xref="GOA:D6ZQC1"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQC1"
FT                   /protein_id="ADI68810.1"
FT   gene            complement(516875..517078)
FT                   /locus_tag="HMPREF0837_10583"
FT   CDS_pept        complement(516875..517078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10583"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68811"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQC2"
FT                   /protein_id="ADI68811.1"
FT   gene            517135..518184
FT                   /locus_tag="HMPREF0837_10584"
FT   CDS_pept        517135..518184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10584"
FT                   /product="oxidoreductase, LLM family"
FT                   /EC_number="1.-.-.-"
FT                   /note="COG: COG2141; Pfam: PF00296; InterPro: IPR011251"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10584"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68812"
FT                   /db_xref="GOA:D6ZQC3"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR022290"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQC3"
FT                   /protein_id="ADI68812.1"
FT                   RAYFAMKEA"
FT   gene            complement(518284..522090)
FT                   /locus_tag="HMPREF0837_10585"
FT   CDS_pept        complement(518284..522090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10585"
FT                   /product="pullulanase, extracellular"
FT                   /note="COG: COG1523; Pfam:
FT                   PF04650,PF03714,PF02922,PF00128,PF00746; InterPro:
FT                   IPR011838"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10585"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68813"
FT                   /db_xref="GOA:D6ZQC4"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR005323"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011838"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR040806"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQC4"
FT                   /protein_id="ADI68813.1"
FT   gene            522507..522920
FT                   /gene="rpsL"
FT                   /locus_tag="HMPREF0837_10586"
FT   CDS_pept        522507..522920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="HMPREF0837_10586"
FT                   /product="ribosomal protein S12"
FT                   /note="COG: COG0048; Pfam: PF00164; InterPro: IPR005679"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10586"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68814"
FT                   /db_xref="GOA:D6ZQC5"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQC5"
FT                   /protein_id="ADI68814.1"
FT   gene            522940..523410
FT                   /gene="rpsG"
FT                   /locus_tag="HMPREF0837_10587"
FT   CDS_pept        522940..523410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="HMPREF0837_10587"
FT                   /product="ribosomal protein S7"
FT                   /note="COG: COG0049; Pfam: PF00177; InterPro: IPR000235"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10587"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68815"
FT                   /db_xref="GOA:D6ZQC6"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQC6"
FT                   /protein_id="ADI68815.1"
FT   gene            523835..525916
FT                   /gene="fusA"
FT                   /locus_tag="HMPREF0837_10588"
FT   CDS_pept        523835..525916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="HMPREF0837_10588"
FT                   /product="translation elongation factor G"
FT                   /note="COG: COG0480; Pfam: PF00009,PF03144,PF03764,PF00679;
FT                   InterPro: IPR004540"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10588"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68816"
FT                   /db_xref="GOA:D6ZQC7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQC7"
FT                   /protein_id="ADI68816.1"
FT   gene            526020..530411
FT                   /gene="polC"
FT                   /locus_tag="HMPREF0837_10589"
FT   CDS_pept        526020..530411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polC"
FT                   /locus_tag="HMPREF0837_10589"
FT                   /product="DNA polymerase III, alpha subunit, Gram-positive
FT                   type"
FT                   /EC_number=""
FT                   /note="COG: COG2176; Pfam: PF01336,PF02811,PF00929,PF07733;
FT                   InterPro: IPR006308"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10589"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68817"
FT                   /db_xref="GOA:D6ZQC8"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006308"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR024754"
FT                   /db_xref="InterPro:IPR028112"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQC8"
FT                   /protein_id="ADI68817.1"
FT                   LF"
FT   gene            530513..530776
FT                   /locus_tag="HMPREF0837_10590"
FT   CDS_pept        530513..530776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10590"
FT                   /product="addiction module antitoxin, RelB/DinJ family"
FT                   /note="COG: COG3077; Pfam: PF04221; InterPro: IPR007337"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10590"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68818"
FT                   /db_xref="GOA:D6ZQC9"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR026262"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQC9"
FT                   /protein_id="ADI68818.1"
FT   gene            530769..531047
FT                   /locus_tag="HMPREF0837_10591"
FT   CDS_pept        530769..531047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10591"
FT                   /product="addiction module toxin, RelE/StbE family"
FT                   /note="COG: COG3041; Pfam: PF05016; InterPro: IPR012753"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10591"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68819"
FT                   /db_xref="InterPro:IPR004386"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQD0"
FT                   /protein_id="ADI68819.1"
FT   gene            531068..531220
FT                   /locus_tag="HMPREF0837_10592"
FT   CDS_pept        531068..531220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10592"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10592"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68820"
FT                   /db_xref="GOA:D6ZQD1"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQD1"
FT                   /protein_id="ADI68820.1"
FT                   ALKEK"
FT   gene            531242..532483
FT                   /locus_tag="HMPREF0837_10593"
FT   CDS_pept        531242..532483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10593"
FT                   /product="thermophilic metalloprotease (M29)"
FT                   /note="COG: COG2309; Pfam: PF02073; InterPro: IPR000787"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10593"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68821"
FT                   /db_xref="GOA:D6ZQD2"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="InterPro:IPR035097"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQD2"
FT                   /protein_id="ADI68821.1"
FT                   GTRVPLFRNGNWAN"
FT   gene            532493..532723
FT                   /locus_tag="HMPREF0837_10594"
FT   CDS_pept        532493..532723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10594"
FT                   /product="transglycosylase associated protein"
FT                   /note="COG: COG2261; Pfam: PF04226; InterPro: IPR007341"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10594"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68822"
FT                   /db_xref="GOA:D6ZQD3"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQD3"
FT                   /protein_id="ADI68822.1"
FT   gene            532991..533713
FT                   /locus_tag="HMPREF0837_10595"
FT   CDS_pept        532991..533713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10595"
FT                   /product="pseudouridylate synthase"
FT                   /note="COG: COG1187; Pfam: PF01479,PF00849; InterPro:
FT                   IPR000748"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10595"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68823"
FT                   /db_xref="GOA:D6ZQD4"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQD4"
FT                   /protein_id="ADI68823.1"
FT                   EWRRLTKEELEILRANII"
FT   gene            533931..535265
FT                   /locus_tag="HMPREF0837_10596"
FT   CDS_pept        533931..535265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10596"
FT                   /product="peptidase C1-like family"
FT                   /note="COG: COG3579; Pfam: PF03051; InterPro: IPR004134"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10596"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68824"
FT                   /db_xref="GOA:D6ZQD5"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR004134"
FT                   /db_xref="InterPro:IPR025660"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQD5"
FT                   /protein_id="ADI68824.1"
FT   gene            complement(535321..536232)
FT                   /locus_tag="HMPREF0837_10597"
FT   CDS_pept        complement(535321..536232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10597"
FT                   /product="PTS system, mannose/fructose/sorbose family, IID
FT                   component"
FT                   /note="COG: COG3716; Pfam: PF03613; InterPro: IPR004704"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10597"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68825"
FT                   /db_xref="GOA:D6ZQD6"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQD6"
FT                   /protein_id="ADI68825.1"
FT   gene            complement(536256..537044)
FT                   /locus_tag="HMPREF0837_10598"
FT   CDS_pept        complement(536256..537044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10598"
FT                   /product="PTS system sorbose-specific iic component"
FT                   /note="COG: COG3715; Pfam: PF03609; InterPro: IPR004700"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10598"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68826"
FT                   /db_xref="GOA:D6ZQD7"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQD7"
FT                   /protein_id="ADI68826.1"
FT   gene            complement(537087..538085)
FT                   /locus_tag="HMPREF0837_10599"
FT   CDS_pept        complement(537087..538085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10599"
FT                   /product="PTS system, mannose/fructose/sorbose family, IIB
FT                   component"
FT                   /EC_number=""
FT                   /note="COG: COG3444; Pfam: PF03610,PF03830; InterPro:
FT                   IPR004720"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10599"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68827"
FT                   /db_xref="GOA:D6ZQD8"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQD8"
FT                   /protein_id="ADI68827.1"
FT   gene            complement(538309..539328)
FT                   /locus_tag="HMPREF0837_10600"
FT   CDS_pept        complement(538309..539328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10600"
FT                   /product="GroES-like protein"
FT                   /note="COG: COG1064; Pfam: PF08240,PF00107; InterPro:
FT                   IPR002085"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10600"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68828"
FT                   /db_xref="GOA:D6ZQD9"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQD9"
FT                   /protein_id="ADI68828.1"
FT   gene            complement(539437..539583)
FT                   /locus_tag="HMPREF0837_10601"
FT   CDS_pept        complement(539437..539583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10601"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10601"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68829"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQE0"
FT                   /protein_id="ADI68829.1"
FT                   FLL"
FT   gene            complement(539667..540479)
FT                   /locus_tag="HMPREF0837_10602"
FT   CDS_pept        complement(539667..540479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10602"
FT                   /product="Cof-like hydrolase"
FT                   /note="COG: COG0561; Pfam: PF08282; InterPro: IPR000150"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10602"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68830"
FT                   /db_xref="GOA:D6ZQE1"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQE1"
FT                   /protein_id="ADI68830.1"
FT   gene            540615..542087
FT                   /locus_tag="HMPREF0837_10603"
FT   CDS_pept        540615..542087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10603"
FT                   /product="putative permease"
FT                   /note="COG: COG2252; Pfam: PF00860; InterPro: IPR006043"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10603"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68831"
FT                   /db_xref="GOA:D6ZQE2"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQE2"
FT                   /protein_id="ADI68831.1"
FT   gene            542140..542847
FT                   /locus_tag="HMPREF0837_10604"
FT   CDS_pept        542140..542847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10604"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /note="Pfam: PF02517; InterPro: IPR003675"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10604"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68832"
FT                   /db_xref="GOA:D6ZQE3"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQE3"
FT                   /protein_id="ADI68832.1"
FT                   LVVIMSRTLGISV"
FT   gene            542942..543922
FT                   /gene="folP"
FT                   /locus_tag="HMPREF0837_10605"
FT   CDS_pept        542942..543922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folP"
FT                   /locus_tag="HMPREF0837_10605"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number=""
FT                   /note="COG: COG0294; Pfam: PF00809; InterPro: IPR000489"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10605"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68833"
FT                   /db_xref="GOA:D6ZQE4"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQE4"
FT                   /protein_id="ADI68833.1"
FT   gene            543924..545246
FT                   /gene="folC"
FT                   /locus_tag="HMPREF0837_10606"
FT   CDS_pept        543924..545246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folC"
FT                   /locus_tag="HMPREF0837_10606"
FT                   /product="bifunctional protein FolC"
FT                   /note="COG: COG0285; Pfam: PF08245,PF02875; InterPro:
FT                   IPR001645"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10606"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68834"
FT                   /db_xref="GOA:D6ZQE5"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQE5"
FT                   /protein_id="ADI68834.1"
FT   gene            545227..545781
FT                   /gene="folE"
FT                   /locus_tag="HMPREF0837_10607"
FT   CDS_pept        545227..545781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /locus_tag="HMPREF0837_10607"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number=""
FT                   /note="COG: COG0302; Pfam: PF01227; InterPro: IPR001474"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10607"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68835"
FT                   /db_xref="GOA:D6ZQE6"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQE6"
FT                   /protein_id="ADI68835.1"
FT   gene            545824..546636
FT                   /gene="folK"
FT                   /locus_tag="HMPREF0837_10608"
FT   CDS_pept        545824..546636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="HMPREF0837_10608"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   diphosphokinase"
FT                   /EC_number=""
FT                   /note="COG: COG0801; Pfam: PF02152,PF01288; InterPro:
FT                   IPR000550"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10608"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68836"
FT                   /db_xref="GOA:D6ZQE7"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQE7"
FT                   /protein_id="ADI68836.1"
FT   gene            complement(546681..547028)
FT                   /locus_tag="HMPREF0837_10609"
FT   CDS_pept        complement(546681..547028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10609"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10609"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68837"
FT                   /db_xref="InterPro:IPR009303"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQE8"
FT                   /protein_id="ADI68837.1"
FT                   TILLPEENDLF"
FT   misc_feature    547248..547331
FT                   /note="ribosomal protein L13 leader; HMPREF0837_nc10007"
FT   gene            547355..547801
FT                   /gene="rplM"
FT                   /locus_tag="HMPREF0837_10610"
FT   CDS_pept        547355..547801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="HMPREF0837_10610"
FT                   /product="ribosomal protein L13"
FT                   /note="COG: COG0102; Pfam: PF00572; InterPro: IPR005823"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10610"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68838"
FT                   /db_xref="GOA:D6ZQE9"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQE9"
FT                   /protein_id="ADI68838.1"
FT   gene            547821..548213
FT                   /gene="rpsI"
FT                   /locus_tag="HMPREF0837_10611"
FT   CDS_pept        547821..548213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="HMPREF0837_10611"
FT                   /product="ribosomal protein S9"
FT                   /note="COG: COG0103; Pfam: PF00380; InterPro: IPR000754"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10611"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68839"
FT                   /db_xref="GOA:D6ZQF0"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQF0"
FT                   /protein_id="ADI68839.1"
FT   gene            complement(548475..548897)
FT                   /locus_tag="HMPREF0837_10612"
FT   CDS_pept        complement(548475..548897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10612"
FT                   /product="site-specific recombinase, phage integrase
FT                   family"
FT                   /note="Pfam: PF00589; InterPro: IPR013762"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10612"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68840"
FT                   /db_xref="GOA:D6ZQF1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQF1"
FT                   /protein_id="ADI68840.1"
FT   gene            549044..549220
FT                   /locus_tag="HMPREF0837_10613"
FT   CDS_pept        549044..549220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10613"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10613"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68841"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQF2"
FT                   /protein_id="ADI68841.1"
FT                   EKLRDEALALGMT"
FT   gene            549621..551834
FT                   /locus_tag="HMPREF0837_10614"
FT   CDS_pept        549621..551834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10614"
FT                   /product="glycosyl hydrolase, family 31"
FT                   /EC_number="3.2.1.-"
FT                   /note="COG: COG1501; Pfam: PF01055; InterPro: IPR000322"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10614"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68842"
FT                   /db_xref="GOA:D6ZQF3"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQF3"
FT                   /protein_id="ADI68842.1"
FT   gene            complement(552056..552532)
FT                   /locus_tag="HMPREF0837_10615"
FT   CDS_pept        complement(552056..552532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10615"
FT                   /product="glutathione peroxidase"
FT                   /EC_number=""
FT                   /note="COG: COG0386; Pfam: PF00255; InterPro: IPR012335"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10615"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68843"
FT                   /db_xref="GOA:D6ZQF4"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR029760"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQF4"
FT                   /protein_id="ADI68843.1"
FT   gene            552755..553213
FT                   /locus_tag="HMPREF0837_10616"
FT   CDS_pept        552755..553213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10616"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10616"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68844"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQF5"
FT                   /protein_id="ADI68844.1"
FT   gene            553197..555959
FT                   /locus_tag="HMPREF0837_10617"
FT   CDS_pept        553197..555959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10617"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="Pfam: PF08124,PF02278,PF02884,PF00746; InterPro:
FT                   IPR012329"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10617"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68845"
FT                   /db_xref="GOA:D6ZQF6"
FT                   /db_xref="InterPro:IPR003159"
FT                   /db_xref="InterPro:IPR004103"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011071"
FT                   /db_xref="InterPro:IPR012970"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR023295"
FT                   /db_xref="InterPro:IPR038970"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQF6"
FT                   /protein_id="ADI68845.1"
FT   gene            556462..556695
FT                   /locus_tag="HMPREF0837_10618"
FT   CDS_pept        556462..556695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10618"
FT                   /product="transposase-like protein"
FT                   /note="COG: COG1943; Pfam: PF01797; InterPro: IPR002686"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10618"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68846"
FT                   /db_xref="GOA:D6ZQF7"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQF7"
FT                   /protein_id="ADI68846.1"
FT   gene            complement(556940..557047)
FT                   /locus_tag="HMPREF0837_10619"
FT   CDS_pept        complement(556940..557047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10619"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10619"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68847"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQF8"
FT                   /protein_id="ADI68847.1"
FT   gene            complement(557071..557700)
FT                   /gene="eda"
FT                   /locus_tag="HMPREF0837_10620"
FT   CDS_pept        complement(557071..557700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eda"
FT                   /locus_tag="HMPREF0837_10620"
FT                   /product="2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="COG: COG0800; Pfam: PF01081; InterPro: IPR000887"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10620"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68848"
FT                   /db_xref="GOA:D6ZQF9"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQF9"
FT                   /protein_id="ADI68848.1"
FT   gene            complement(557710..558711)
FT                   /locus_tag="HMPREF0837_10621"
FT   CDS_pept        complement(557710..558711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10621"
FT                   /product="kinase, PfkB family"
FT                   /note="COG: COG0524; Pfam: PF00294; InterPro: IPR011611"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10621"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68849"
FT                   /db_xref="GOA:D6ZQG0"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQG0"
FT                   /protein_id="ADI68849.1"
FT   gene            complement(558742..559383)
FT                   /locus_tag="HMPREF0837_10622"
FT   CDS_pept        complement(558742..559383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10622"
FT                   /product="Ribose/Galactose Isomerase"
FT                   /note="COG: COG0698; Pfam: PF02502; InterPro: IPR003500"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10622"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68850"
FT                   /db_xref="GOA:D6ZQG1"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR022133"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQG1"
FT                   /protein_id="ADI68850.1"
FT   gene            complement(559402..560217)
FT                   /locus_tag="HMPREF0837_10623"
FT   CDS_pept        complement(559402..560217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10623"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family protein"
FT                   /note="COG: COG1028; Pfam: PF00106; InterPro: IPR016040"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10623"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68851"
FT                   /db_xref="GOA:D6ZQG2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQG2"
FT                   /protein_id="ADI68851.1"
FT   gene            560488..560922
FT                   /locus_tag="HMPREF0837_10624"
FT   CDS_pept        560488..560922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10624"
FT                   /product="PTS system fructose IIA component"
FT                   /note="COG: COG2893; Pfam: PF03610; InterPro: IPR004701"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10624"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68852"
FT                   /db_xref="GOA:D6ZQG3"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQG3"
FT                   /protein_id="ADI68852.1"
FT   gene            560934..562124
FT                   /locus_tag="HMPREF0837_10625"
FT   CDS_pept        560934..562124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10625"
FT                   /product="glycosyl hydrolase, family 88"
FT                   /EC_number="3.2.1.-"
FT                   /note="Pfam: PF07470; InterPro: IPR012341"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10625"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68853"
FT                   /db_xref="GOA:D6ZQG4"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010905"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQG4"
FT                   /protein_id="ADI68853.1"
FT   gene            562135..562626
FT                   /locus_tag="HMPREF0837_10626"
FT   CDS_pept        562135..562626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10626"
FT                   /product="PTS system, mannose/fructose/sorbose family, IIB
FT                   component"
FT                   /EC_number=""
FT                   /note="COG: COG3444; Pfam: PF03830; InterPro: IPR004720"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10626"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68854"
FT                   /db_xref="GOA:D6ZQG5"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQG5"
FT                   /protein_id="ADI68854.1"
FT                   "
FT   gene            562641..563420
FT                   /locus_tag="HMPREF0837_10627"
FT   CDS_pept        562641..563420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10627"
FT                   /product="PTS system sorbose-specific iic component"
FT                   /note="COG: COG3715; Pfam: PF03609; InterPro: IPR004700"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10627"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68855"
FT                   /db_xref="GOA:D6ZQG6"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQG6"
FT                   /protein_id="ADI68855.1"
FT   gene            563407..564225
FT                   /locus_tag="HMPREF0837_10628"
FT   CDS_pept        563407..564225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10628"
FT                   /product="PTS system mannose/fructose/sorbose family IID
FT                   component"
FT                   /note="COG: COG3716; Pfam: PF03613; InterPro: IPR004704"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10628"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68856"
FT                   /db_xref="GOA:D6ZQG7"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQG7"
FT                   /protein_id="ADI68856.1"
FT   gene            564225..564518
FT                   /gene="yajC"
FT                   /locus_tag="HMPREF0837_10629"
FT   CDS_pept        564225..564518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajC"
FT                   /locus_tag="HMPREF0837_10629"
FT                   /product="preprotein translocase, YajC subunit"
FT                   /note="COG: COG1862; Pfam: PF02699; InterPro: IPR003849"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10629"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68857"
FT                   /db_xref="GOA:D6ZQG8"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQG8"
FT                   /protein_id="ADI68857.1"
FT   gene            564540..566441
FT                   /locus_tag="HMPREF0837_10630"
FT   CDS_pept        564540..566441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10630"
FT                   /product="heparinase II/III-like protein"
FT                   /note="Pfam: PF07940; InterPro: IPR012480"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10630"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68858"
FT                   /db_xref="GOA:D6ZQG9"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="InterPro:IPR031680"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQG9"
FT                   /protein_id="ADI68858.1"
FT   gene            566435..567502
FT                   /locus_tag="HMPREF0837_10631"
FT   CDS_pept        566435..567502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10631"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="COG: COG1609; Pfam: PF00356,PF00532; InterPro:
FT                   IPR000843"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10631"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68859"
FT                   /db_xref="GOA:D6ZQH0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQH0"
FT                   /protein_id="ADI68859.1"
FT                   QQVLDCSVNWKESTF"
FT   gene            complement(567612..567947)
FT                   /locus_tag="HMPREF0837_10632"
FT   CDS_pept        complement(567612..567947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10632"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10632"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68860"
FT                   /db_xref="GOA:D6ZQH1"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQH1"
FT                   /protein_id="ADI68860.1"
FT                   VDQKQLI"
FT   gene            complement(567958..568221)
FT                   /locus_tag="HMPREF0837_10633"
FT   CDS_pept        complement(567958..568221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10633"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10633"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68861"
FT                   /db_xref="GOA:D6ZQH2"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQH2"
FT                   /protein_id="ADI68861.1"
FT   gene            complement(568211..568570)
FT                   /locus_tag="HMPREF0837_10634"
FT   CDS_pept        complement(568211..568570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10634"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10634"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68862"
FT                   /db_xref="GOA:D6ZQH3"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQH3"
FT                   /protein_id="ADI68862.1"
FT                   ISRRIAKTKKNQDED"
FT   gene            complement(568769..568963)
FT                   /locus_tag="HMPREF0837_10635"
FT   CDS_pept        complement(568769..568963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10635"
FT                   /product="DNA-binding helix-turn-helix protein"
FT                   /note="COG: COG1476; Pfam: PF01381; InterPro: IPR001387"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10635"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68863"
FT                   /db_xref="GOA:D6ZQH4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQH4"
FT                   /protein_id="ADI68863.1"
FT   gene            569129..570079
FT                   /gene="mraW"
FT                   /locus_tag="HMPREF0837_10636"
FT   CDS_pept        569129..570079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="HMPREF0837_10636"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /EC_number="2.1.1.-"
FT                   /note="COG: COG0275; Pfam: PF01795; InterPro: IPR002903"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10636"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68864"
FT                   /db_xref="GOA:D6ZQH5"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQH5"
FT                   /protein_id="ADI68864.1"
FT   gene            570091..570408
FT                   /gene="ftsL"
FT                   /locus_tag="HMPREF0837_10637"
FT   CDS_pept        570091..570408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="HMPREF0837_10637"
FT                   /product="cell division protein FtsL"
FT                   /note="COG: COG4839; InterPro: IPR011922"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10637"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68865"
FT                   /db_xref="GOA:D6ZQH6"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQH6"
FT                   /protein_id="ADI68865.1"
FT                   E"
FT   gene            570412..572664
FT                   /locus_tag="HMPREF0837_10638"
FT   CDS_pept        570412..572664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10638"
FT                   /product="penicillin-binding protein, transpeptidase domain
FT                   protein"
FT                   /note="COG: COG0768; Pfam: PF03717,PF00905,PF03793;
FT                   InterPro: IPR001460"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10638"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68866"
FT                   /db_xref="GOA:D6ZQH7"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQH7"
FT                   /protein_id="ADI68866.1"
FT   gene            572666..573646
FT                   /gene="mraY"
FT                   /locus_tag="HMPREF0837_10639"
FT   CDS_pept        572666..573646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="HMPREF0837_10639"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number=""
FT                   /note="COG: COG0472; Pfam: PF00953; InterPro: IPR003524"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10639"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68867"
FT                   /db_xref="GOA:D6ZQH8"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQH8"
FT                   /protein_id="ADI68867.1"
FT   gene            573858..573974
FT                   /locus_tag="HMPREF0837_10640"
FT   CDS_pept        573858..573974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10640"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68868"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQH9"
FT                   /protein_id="ADI68868.1"
FT   gene            574255..576360
FT                   /locus_tag="HMPREF0837_10641"
FT   CDS_pept        574255..576360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10641"
FT                   /product="ATPase family associated with various cellular
FT                   activities (AAA)"
FT                   /note="COG: COG0542; Pfam: PF00004,PF07724; InterPro:
FT                   IPR013093"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10641"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68869"
FT                   /db_xref="GOA:D6ZQI0"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQI0"
FT                   /protein_id="ADI68869.1"
FT                   LVIREKV"
FT   gene            complement(576656..577138)
FT                   /gene="luxS"
FT                   /locus_tag="HMPREF0837_10642"
FT   CDS_pept        complement(576656..577138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="luxS"
FT                   /locus_tag="HMPREF0837_10642"
FT                   /product="S-ribosylhomocysteinase LuxS"
FT                   /EC_number=""
FT                   /note="COG: COG1854; Pfam: PF02664; InterPro: IPR003815"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10642"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68870"
FT                   /db_xref="GOA:D6ZQI1"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR037005"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQI1"
FT                   /protein_id="ADI68870.1"
FT   gene            complement(577233..578717)
FT                   /locus_tag="HMPREF0837_10643"
FT   CDS_pept        complement(577233..578717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10643"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4868; Pfam: PF08903; InterPro: IPR014999"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10643"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68871"
FT                   /db_xref="InterPro:IPR014999"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQI2"
FT                   /protein_id="ADI68871.1"
FT   gene            578870..580477
FT                   /locus_tag="HMPREF0837_10644"
FT   CDS_pept        578870..580477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10644"
FT                   /product="alpha amylase, catalytic domain protein"
FT                   /note="COG: COG0366; Pfam: PF00128; InterPro: IPR013781"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10644"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68872"
FT                   /db_xref="GOA:D6ZQI3"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQI3"
FT                   /protein_id="ADI68872.1"
FT                   VFEKQILVPWDAFCVELL"
FT   gene            complement(580802..581140)
FT                   /locus_tag="HMPREF0837_10645"
FT   CDS_pept        complement(580802..581140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10645"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG3335"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10645"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68873"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQI4"
FT                   /protein_id="ADI68873.1"
FT                   LLSFSCFN"
FT   gene            581546..582991
FT                   /locus_tag="HMPREF0837_10646"
FT   CDS_pept        581546..582991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10646"
FT                   /product="cell envelope-like function transcriptional
FT                   attenuator common domain protein"
FT                   /note="COG: COG1316; Pfam: PF02916,PF03816; InterPro:
FT                   IPR004474"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10646"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68874"
FT                   /db_xref="GOA:D6ZQI5"
FT                   /db_xref="InterPro:IPR004190"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQI5"
FT                   /protein_id="ADI68874.1"
FT   gene            582993..583724
FT                   /locus_tag="HMPREF0837_10647"
FT   CDS_pept        582993..583724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10647"
FT                   /product="PHP domain protein"
FT                   /EC_number="3.1.3.-"
FT                   /note="COG: COG4464; Pfam: PF02811; InterPro: IPR004013"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10647"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68875"
FT                   /db_xref="GOA:D6ZQI6"
FT                   /db_xref="InterPro:IPR016667"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQI6"
FT                   /protein_id="ADI68875.1"
FT   gene            583730..584425
FT                   /locus_tag="HMPREF0837_10648"
FT   CDS_pept        583730..584425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10648"
FT                   /product="polysaccharide export protein, MPA1 family"
FT                   /note="COG: COG3944; Pfam: PF02706; InterPro: IPR005701"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10648"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68876"
FT                   /db_xref="GOA:D6ZQI7"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005701"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQI7"
FT                   /protein_id="ADI68876.1"
FT                   VVPDFDKMK"
FT   gene            584435..585124
FT                   /locus_tag="HMPREF0837_10649"
FT   CDS_pept        584435..585124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10649"
FT                   /product="capsular exopolysaccharide family"
FT                   /note="COG: COG0489; InterPro: IPR005702"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10649"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68877"
FT                   /db_xref="GOA:D6ZQI8"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQI8"
FT                   /protein_id="ADI68877.1"
FT                   NYRKQKK"
FT   gene            585139..586500
FT                   /locus_tag="HMPREF0837_10650"
FT   CDS_pept        585139..586500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10650"
FT                   /product="exopolysaccharide biosynthesis polyprenyl
FT                   glycosylphosphotransferase"
FT                   /note="COG: COG2148; Pfam: PF02397; InterPro: IPR003362"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10650"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68878"
FT                   /db_xref="GOA:D6ZQI9"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQI9"
FT                   /protein_id="ADI68878.1"
FT   gene            586506..587249
FT                   /locus_tag="HMPREF0837_10651"
FT   CDS_pept        586506..587249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10651"
FT                   /product="glycosyltransferase, WecB/TagA/CpsF family"
FT                   /EC_number="2.4.1.-"
FT                   /note="COG: COG1922; Pfam: PF03808; InterPro: IPR004629"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10651"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68879"
FT                   /db_xref="GOA:D6ZQJ0"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQJ0"
FT                   /protein_id="ADI68879.1"
FT   gene            587246..588070
FT                   /locus_tag="HMPREF0837_10652"
FT   CDS_pept        587246..588070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10652"
FT                   /product="LICD family protein"
FT                   /note="COG: COG3475; Pfam: PF04991; InterPro: IPR007074"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10652"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68880"
FT                   /db_xref="InterPro:IPR007074"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQJ1"
FT                   /protein_id="ADI68880.1"
FT   gene            588090..588950
FT                   /locus_tag="HMPREF0837_10653"
FT   CDS_pept        588090..588950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10653"
FT                   /product="hypothetical protein"
FT                   /note="Pfam: PF00535; InterPro: IPR001173"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10653"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68881"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQJ2"
FT                   /protein_id="ADI68881.1"
FT                   ENEGV"
FT   gene            588951..590285
FT                   /locus_tag="HMPREF0837_10654"
FT                   /note="cps19aI"
FT   CDS_pept        588951..590285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10654"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10654"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68882"
FT                   /db_xref="GOA:D6ZQJ3"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQJ3"
FT                   /protein_id="ADI68882.1"
FT   gene            590421..591737
FT                   /locus_tag="HMPREF0837_10655"
FT   CDS_pept        590421..591737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10655"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10655"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68883"
FT                   /db_xref="GOA:D6ZQJ4"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQJ4"
FT                   /protein_id="ADI68883.1"
FT   gene            591799..592890
FT                   /locus_tag="HMPREF0837_10656"
FT   CDS_pept        591799..592890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10656"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number=""
FT                   /note="COG: COG0381; Pfam: PF02350; InterPro: IPR003331"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10656"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68884"
FT                   /db_xref="GOA:D6ZQJ5"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQJ5"
FT                   /protein_id="ADI68884.1"
FT   gene            593053..593922
FT                   /gene="rfbA"
FT                   /locus_tag="HMPREF0837_10657"
FT   CDS_pept        593053..593922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbA"
FT                   /locus_tag="HMPREF0837_10657"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number=""
FT                   /note="COG: COG1209; Pfam: PF00483; InterPro: IPR005907"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10657"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68885"
FT                   /db_xref="GOA:D6ZQJ6"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQJ6"
FT                   /protein_id="ADI68885.1"
FT                   LLRLIGEA"
FT   gene            593923..594516
FT                   /locus_tag="HMPREF0837_10658"
FT   CDS_pept        593923..594516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10658"
FT                   /product="putative dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /note="COG: COG1898; Pfam: PF00908; InterPro: IPR014710"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10658"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68886"
FT                   /db_xref="GOA:D6ZQJ7"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQJ7"
FT                   /protein_id="ADI68886.1"
FT   gene            594528..595577
FT                   /gene="rfbB"
FT                   /locus_tag="HMPREF0837_10659"
FT   CDS_pept        594528..595577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbB"
FT                   /locus_tag="HMPREF0837_10659"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number=""
FT                   /note="COG: COG1088; Pfam: PF01370; InterPro: IPR005888"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10659"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68887"
FT                   /db_xref="GOA:D6ZQJ8"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQJ8"
FT                   /protein_id="ADI68887.1"
FT                   AKTQEIITV"
FT   gene            595643..596494
FT                   /gene="rfbD"
FT                   /locus_tag="HMPREF0837_10660"
FT   CDS_pept        595643..596494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbD"
FT                   /locus_tag="HMPREF0837_10660"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number=""
FT                   /note="COG: COG1091; Pfam: PF04321; InterPro: IPR005913"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10660"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68888"
FT                   /db_xref="GOA:D6ZQJ9"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQJ9"
FT                   /protein_id="ADI68888.1"
FT                   VR"
FT   gene            596664..597182
FT                   /locus_tag="HMPREF0837_10661"
FT   CDS_pept        596664..597182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10661"
FT                   /product="UDP-galactopyranose mutase"
FT                   /note="COG: COG0562; Pfam: PF03275; InterPro: IPR016040"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10661"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68889"
FT                   /db_xref="GOA:D6ZQK0"
FT                   /db_xref="InterPro:IPR015899"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQK0"
FT                   /protein_id="ADI68889.1"
FT                   KCWIMKILM"
FT   gene            597155..597463
FT                   /locus_tag="HMPREF0837_10662"
FT   CDS_pept        597155..597463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10662"
FT                   /product="UDP-galactopyranose mutase"
FT                   /note="COG: COG0562; Pfam: PF03275; InterPro: IPR015899"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10662"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68890"
FT                   /db_xref="GOA:D6ZQK1"
FT                   /db_xref="InterPro:IPR015899"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQK1"
FT                   /protein_id="ADI68890.1"
FT   gene            597522..597743
FT                   /locus_tag="HMPREF0837_10663"
FT   CDS_pept        597522..597743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10663"
FT                   /product="hypothetical protein"
FT                   /note="Pfam: PF03275; InterPro: IPR016040"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10663"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68891"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQK2"
FT                   /protein_id="ADI68891.1"
FT   gene            597977..599962
FT                   /locus_tag="HMPREF0837_10664"
FT   CDS_pept        597977..599962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10664"
FT                   /product="ABC transporter, substrate-binding protein,
FT                   family 5"
FT                   /note="COG: COG4166; Pfam: PF00496; InterPro: IPR000914"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10664"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68892"
FT                   /db_xref="GOA:D6ZQK3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQK3"
FT                   /protein_id="ADI68892.1"
FT   gene            600263..605566
FT                   /locus_tag="HMPREF0837_10665"
FT   CDS_pept        600263..605566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10665"
FT                   /product="Gram-positive signal peptide protein, YSIRK
FT                   family"
FT                   /note="Pfam: PF04650,PF00754,PF00746; InterPro: IPR000421"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10665"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68893"
FT                   /db_xref="GOA:D6ZQK4"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR005877"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR025706"
FT                   /db_xref="InterPro:IPR035364"
FT                   /db_xref="InterPro:IPR040502"
FT                   /db_xref="InterPro:IPR040575"
FT                   /db_xref="InterPro:IPR040633"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQK4"
FT                   /protein_id="ADI68893.1"
FT                   SALFVVKTKKD"
FT   gene            complement(605732..607891)
FT                   /locus_tag="HMPREF0837_10666"
FT   CDS_pept        complement(605732..607891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10666"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /note="COG: COG0744; Pfam: PF00912,PF00905; InterPro:
FT                   IPR011816"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10666"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68894"
FT                   /db_xref="GOA:D6ZQK5"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQK5"
FT                   /protein_id="ADI68894.1"
FT   gene            complement(607888..608403)
FT                   /gene="recU"
FT                   /locus_tag="HMPREF0837_10667"
FT   CDS_pept        complement(607888..608403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recU"
FT                   /locus_tag="HMPREF0837_10667"
FT                   /product="recombination protein U"
FT                   /note="COG: COG3331; Pfam: PF03838; InterPro: IPR004612"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10667"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68895"
FT                   /db_xref="GOA:D6ZQK6"
FT                   /db_xref="InterPro:IPR004612"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQK6"
FT                   /protein_id="ADI68895.1"
FT                   HLLGGKTR"
FT   gene            608467..609078
FT                   /locus_tag="HMPREF0837_10668"
FT   CDS_pept        608467..609078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10668"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG4474; Pfam: PF06908; InterPro: IPR010697"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10668"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68896"
FT                   /db_xref="InterPro:IPR010697"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQK7"
FT                   /protein_id="ADI68896.1"
FT   gene            609136..609489
FT                   /locus_tag="HMPREF0837_10669"
FT   CDS_pept        609136..609489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10669"
FT                   /product="DivIVA domain protein"
FT                   /note="COG: COG3599; Pfam: PF05103; InterPro: IPR007793"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10669"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68897"
FT                   /db_xref="GOA:D6ZQK8"
FT                   /db_xref="InterPro:IPR007793"
FT                   /db_xref="InterPro:IPR011229"
FT                   /db_xref="InterPro:IPR019933"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQK8"
FT                   /protein_id="ADI68897.1"
FT                   EVFGKQILDNTDL"
FT   gene            609508..609893
FT                   /locus_tag="HMPREF0837_nc10008"
FT   ncRNA           609508..609893
FT                   /locus_tag="HMPREF0837_nc10008"
FT                   /product="bacterial RNase P class B"
FT                   /ncRNA_class="RNase_P_RNA"
FT   gene            609975..611132
FT                   /locus_tag="HMPREF0837_10670"
FT   CDS_pept        609975..611132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10670"
FT                   /product="hypothetical protein"
FT                   /note="COG: COG0116; Pfam: PF01170; InterPro: IPR000241;
FT                   2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10670"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68898"
FT                   /db_xref="GOA:D6ZQK9"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQK9"
FT                   /protein_id="ADI68898.1"
FT   gene            611145..612539
FT                   /locus_tag="HMPREF0837_10671"
FT   CDS_pept        611145..612539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HMPREF0837_10671"
FT                   /product="hypothetical protein"
FT                   /note=""
FT                   /db_xref="EnsemblGenomes-Gn:HMPREF0837_10671"
FT                   /db_xref="EnsemblGenomes-Tr:ADI68899"
FT                   /db_xref="GOA:D6ZQL0"
FT                   /db_xref="InterPro:IPR030858"
FT                   /db_xref="InterPro:IPR040532"
FT                   /db_xref="InterPro:IPR041295"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZQL0"
FT                   /protein_id="