(data stored in SCRATCH3701 zone)

EMBL: CP001994

ID   CP001994; SV 1; circular; genomic DNA; STD; PRO; 2012424 BP.
XX
AC   CP001994;
XX
PR   Project:PRJNA30711;
XX
DT   07-APR-2010 (Rel. 104, Created)
DT   23-JUN-2016 (Rel. 129, Last updated, Version 7)
XX
DE   Methanohalophilus mahii DSM 5219, complete genome.
XX
KW   .
XX
OS   Methanohalophilus mahii DSM 5219
OC   Archaea; Euryarchaeota; Stenosarchaea group; Methanomicrobia;
OC   Methanosarcinales; Methanosarcinaceae; Methanohalophilus.
XX
RN   [1]
RP   1-2012424
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Lykidis A., Saunders E., Brettin T., Detter J.C., Han C., Land M.,
RA   Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T., Wu D.,
RA   Spring S., Schneider S., Schroeder M., Klenk H.-P., Eisen J.A.;
RT   "The complete genome of Methanohalophilus mahii DSM 5219";
RL   Unpublished.
XX
RN   [2]
RP   1-2012424
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Lykidis A., Saunders E., Brettin T., Detter J.C., Han C., Land M.,
RA   Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T., Wu D.,
RA   Spring S., Schneider S., Schroeder M., Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (26-MAR-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 3bac79de03e93122ab190c8cab6c6c59.
DR   BioSample; SAMN02598474.
DR   CABRI; DSM 5219.
DR   EnsemblGenomes-Gn; EBG00001457569.
DR   EnsemblGenomes-Gn; EBG00001457570.
DR   EnsemblGenomes-Gn; EBG00001457571.
DR   EnsemblGenomes-Gn; EBG00001457572.
DR   EnsemblGenomes-Gn; EBG00001457573.
DR   EnsemblGenomes-Gn; EBG00001457574.
DR   EnsemblGenomes-Gn; EBG00001457575.
DR   EnsemblGenomes-Gn; EBG00001457577.
DR   EnsemblGenomes-Gn; EBG00001457578.
DR   EnsemblGenomes-Gn; EBG00001457579.
DR   EnsemblGenomes-Gn; EBG00001457580.
DR   EnsemblGenomes-Gn; EBG00001457581.
DR   EnsemblGenomes-Gn; EBG00001457582.
DR   EnsemblGenomes-Gn; EBG00001457583.
DR   EnsemblGenomes-Gn; EBG00001457584.
DR   EnsemblGenomes-Gn; EBG00001457585.
DR   EnsemblGenomes-Gn; EBG00001457586.
DR   EnsemblGenomes-Gn; EBG00001457587.
DR   EnsemblGenomes-Gn; EBG00001457588.
DR   EnsemblGenomes-Gn; EBG00001457589.
DR   EnsemblGenomes-Gn; EBG00001457590.
DR   EnsemblGenomes-Gn; EBG00001457591.
DR   EnsemblGenomes-Gn; EBG00001457592.
DR   EnsemblGenomes-Gn; EBG00001457593.
DR   EnsemblGenomes-Gn; EBG00001457594.
DR   EnsemblGenomes-Gn; EBG00001457595.
DR   EnsemblGenomes-Gn; EBG00001457596.
DR   EnsemblGenomes-Gn; EBG00001457597.
DR   EnsemblGenomes-Gn; EBG00001457598.
DR   EnsemblGenomes-Gn; EBG00001457599.
DR   EnsemblGenomes-Gn; EBG00001457600.
DR   EnsemblGenomes-Gn; EBG00001457601.
DR   EnsemblGenomes-Gn; EBG00001457602.
DR   EnsemblGenomes-Gn; EBG00001457603.
DR   EnsemblGenomes-Gn; EBG00001457604.
DR   EnsemblGenomes-Gn; EBG00001457605.
DR   EnsemblGenomes-Gn; EBG00001457606.
DR   EnsemblGenomes-Gn; EBG00001457607.
DR   EnsemblGenomes-Gn; EBG00001457609.
DR   EnsemblGenomes-Gn; EBG00001457610.
DR   EnsemblGenomes-Gn; EBG00001457611.
DR   EnsemblGenomes-Gn; EBG00001457612.
DR   EnsemblGenomes-Gn; EBG00001457613.
DR   EnsemblGenomes-Gn; EBG00001457614.
DR   EnsemblGenomes-Gn; EBG00001457615.
DR   EnsemblGenomes-Gn; EBG00001457616.
DR   EnsemblGenomes-Gn; EBG00001457617.
DR   EnsemblGenomes-Gn; EBG00001457618.
DR   EnsemblGenomes-Gn; EBG00001457619.
DR   EnsemblGenomes-Gn; EBG00001457620.
DR   EnsemblGenomes-Gn; EBG00001457621.
DR   EnsemblGenomes-Gn; EBG00001457622.
DR   EnsemblGenomes-Gn; EBG00001457623.
DR   EnsemblGenomes-Gn; EBG00001457624.
DR   EnsemblGenomes-Gn; EBG00001457625.
DR   EnsemblGenomes-Gn; EBG00001457626.
DR   EnsemblGenomes-Gn; EBG00001457627.
DR   EnsemblGenomes-Gn; EBG00001457628.
DR   EnsemblGenomes-Gn; EBG00001457629.
DR   EnsemblGenomes-Gn; EBG00001457630.
DR   EnsemblGenomes-Gn; EBG00001457631.
DR   EnsemblGenomes-Gn; EBG00001457632.
DR   EnsemblGenomes-Gn; EBG00001457633.
DR   EnsemblGenomes-Gn; EBG00001457634.
DR   EnsemblGenomes-Gn; EBG00001457635.
DR   EnsemblGenomes-Gn; EBG00001457636.
DR   EnsemblGenomes-Gn; EBG00001457637.
DR   EnsemblGenomes-Gn; Mmah_R0001.
DR   EnsemblGenomes-Gn; Mmah_R0002.
DR   EnsemblGenomes-Gn; Mmah_R0003.
DR   EnsemblGenomes-Gn; Mmah_R0004.
DR   EnsemblGenomes-Gn; Mmah_R0005.
DR   EnsemblGenomes-Gn; Mmah_R0006.
DR   EnsemblGenomes-Gn; Mmah_R0007.
DR   EnsemblGenomes-Gn; Mmah_R0008.
DR   EnsemblGenomes-Gn; Mmah_R0009.
DR   EnsemblGenomes-Gn; Mmah_R0010.
DR   EnsemblGenomes-Gn; Mmah_R0011.
DR   EnsemblGenomes-Gn; Mmah_R0012.
DR   EnsemblGenomes-Gn; Mmah_R0013.
DR   EnsemblGenomes-Gn; Mmah_R0014.
DR   EnsemblGenomes-Gn; Mmah_R0015.
DR   EnsemblGenomes-Gn; Mmah_R0016.
DR   EnsemblGenomes-Gn; Mmah_R0017.
DR   EnsemblGenomes-Gn; Mmah_R0018.
DR   EnsemblGenomes-Gn; Mmah_R0019.
DR   EnsemblGenomes-Gn; Mmah_R0020.
DR   EnsemblGenomes-Gn; Mmah_R0021.
DR   EnsemblGenomes-Gn; Mmah_R0022.
DR   EnsemblGenomes-Gn; Mmah_R0023.
DR   EnsemblGenomes-Gn; Mmah_R0024.
DR   EnsemblGenomes-Gn; Mmah_R0025.
DR   EnsemblGenomes-Gn; Mmah_R0026.
DR   EnsemblGenomes-Gn; Mmah_R0027.
DR   EnsemblGenomes-Gn; Mmah_R0028.
DR   EnsemblGenomes-Gn; Mmah_R0029.
DR   EnsemblGenomes-Gn; Mmah_R0030.
DR   EnsemblGenomes-Gn; Mmah_R0031.
DR   EnsemblGenomes-Gn; Mmah_R0032.
DR   EnsemblGenomes-Gn; Mmah_R0033.
DR   EnsemblGenomes-Gn; Mmah_R0034.
DR   EnsemblGenomes-Gn; Mmah_R0035.
DR   EnsemblGenomes-Gn; Mmah_R0036.
DR   EnsemblGenomes-Gn; Mmah_R0037.
DR   EnsemblGenomes-Gn; Mmah_R0038.
DR   EnsemblGenomes-Gn; Mmah_R0039.
DR   EnsemblGenomes-Gn; Mmah_R0040.
DR   EnsemblGenomes-Gn; Mmah_R0041.
DR   EnsemblGenomes-Gn; Mmah_R0042.
DR   EnsemblGenomes-Gn; Mmah_R0043.
DR   EnsemblGenomes-Gn; Mmah_R0044.
DR   EnsemblGenomes-Gn; Mmah_R0045.
DR   EnsemblGenomes-Gn; Mmah_R0046.
DR   EnsemblGenomes-Gn; Mmah_R0047.
DR   EnsemblGenomes-Gn; Mmah_R0048.
DR   EnsemblGenomes-Gn; Mmah_R0049.
DR   EnsemblGenomes-Gn; Mmah_R0050.
DR   EnsemblGenomes-Gn; Mmah_R0051.
DR   EnsemblGenomes-Gn; Mmah_R0052.
DR   EnsemblGenomes-Gn; Mmah_R0053.
DR   EnsemblGenomes-Gn; Mmah_R0055.
DR   EnsemblGenomes-Gn; Mmah_R0056.
DR   EnsemblGenomes-Gn; Mmah_R0057.
DR   EnsemblGenomes-Gn; Mmah_R0058.
DR   EnsemblGenomes-Gn; Mmah_R0059.
DR   EnsemblGenomes-Gn; Mmah_R0060.
DR   EnsemblGenomes-Gn; Mmah_R0061.
DR   EnsemblGenomes-Gn; Mmah_R0062.
DR   EnsemblGenomes-Gn; Mmah_R0063.
DR   EnsemblGenomes-Gn; Mmah_R0064.
DR   EnsemblGenomes-Tr; EBT00001611365.
DR   EnsemblGenomes-Tr; EBT00001611366.
DR   EnsemblGenomes-Tr; EBT00001611367.
DR   EnsemblGenomes-Tr; EBT00001611368.
DR   EnsemblGenomes-Tr; EBT00001611370.
DR   EnsemblGenomes-Tr; EBT00001611371.
DR   EnsemblGenomes-Tr; EBT00001611372.
DR   EnsemblGenomes-Tr; EBT00001611373.
DR   EnsemblGenomes-Tr; EBT00001611374.
DR   EnsemblGenomes-Tr; EBT00001611375.
DR   EnsemblGenomes-Tr; EBT00001611376.
DR   EnsemblGenomes-Tr; EBT00001611377.
DR   EnsemblGenomes-Tr; EBT00001611378.
DR   EnsemblGenomes-Tr; EBT00001611379.
DR   EnsemblGenomes-Tr; EBT00001611380.
DR   EnsemblGenomes-Tr; EBT00001611381.
DR   EnsemblGenomes-Tr; EBT00001611382.
DR   EnsemblGenomes-Tr; EBT00001611383.
DR   EnsemblGenomes-Tr; EBT00001611384.
DR   EnsemblGenomes-Tr; EBT00001611385.
DR   EnsemblGenomes-Tr; EBT00001611386.
DR   EnsemblGenomes-Tr; EBT00001611387.
DR   EnsemblGenomes-Tr; EBT00001611388.
DR   EnsemblGenomes-Tr; EBT00001611389.
DR   EnsemblGenomes-Tr; EBT00001611390.
DR   EnsemblGenomes-Tr; EBT00001611391.
DR   EnsemblGenomes-Tr; EBT00001611392.
DR   EnsemblGenomes-Tr; EBT00001611393.
DR   EnsemblGenomes-Tr; EBT00001611394.
DR   EnsemblGenomes-Tr; EBT00001611395.
DR   EnsemblGenomes-Tr; EBT00001611396.
DR   EnsemblGenomes-Tr; EBT00001611397.
DR   EnsemblGenomes-Tr; EBT00001611398.
DR   EnsemblGenomes-Tr; EBT00001611399.
DR   EnsemblGenomes-Tr; EBT00001611401.
DR   EnsemblGenomes-Tr; EBT00001611402.
DR   EnsemblGenomes-Tr; EBT00001611403.
DR   EnsemblGenomes-Tr; EBT00001611404.
DR   EnsemblGenomes-Tr; EBT00001611405.
DR   EnsemblGenomes-Tr; EBT00001611406.
DR   EnsemblGenomes-Tr; EBT00001611407.
DR   EnsemblGenomes-Tr; EBT00001611408.
DR   EnsemblGenomes-Tr; EBT00001611409.
DR   EnsemblGenomes-Tr; EBT00001611411.
DR   EnsemblGenomes-Tr; EBT00001611412.
DR   EnsemblGenomes-Tr; EBT00001611413.
DR   EnsemblGenomes-Tr; EBT00001611414.
DR   EnsemblGenomes-Tr; EBT00001611415.
DR   EnsemblGenomes-Tr; EBT00001611416.
DR   EnsemblGenomes-Tr; EBT00001611417.
DR   EnsemblGenomes-Tr; EBT00001611418.
DR   EnsemblGenomes-Tr; EBT00001611419.
DR   EnsemblGenomes-Tr; EBT00001611420.
DR   EnsemblGenomes-Tr; EBT00001611421.
DR   EnsemblGenomes-Tr; EBT00001611422.
DR   EnsemblGenomes-Tr; EBT00001611423.
DR   EnsemblGenomes-Tr; EBT00001611424.
DR   EnsemblGenomes-Tr; EBT00001611425.
DR   EnsemblGenomes-Tr; EBT00001611426.
DR   EnsemblGenomes-Tr; EBT00001611427.
DR   EnsemblGenomes-Tr; EBT00001611428.
DR   EnsemblGenomes-Tr; EBT00001611429.
DR   EnsemblGenomes-Tr; EBT00001611430.
DR   EnsemblGenomes-Tr; EBT00001611431.
DR   EnsemblGenomes-Tr; EBT00001611432.
DR   EnsemblGenomes-Tr; EBT00001611433.
DR   EnsemblGenomes-Tr; EBT00001611434.
DR   EnsemblGenomes-Tr; Mmah_R0001-1.
DR   EnsemblGenomes-Tr; Mmah_R0002-1.
DR   EnsemblGenomes-Tr; Mmah_R0003-1.
DR   EnsemblGenomes-Tr; Mmah_R0004-1.
DR   EnsemblGenomes-Tr; Mmah_R0005-1.
DR   EnsemblGenomes-Tr; Mmah_R0006-1.
DR   EnsemblGenomes-Tr; Mmah_R0007-1.
DR   EnsemblGenomes-Tr; Mmah_R0008-1.
DR   EnsemblGenomes-Tr; Mmah_R0009-1.
DR   EnsemblGenomes-Tr; Mmah_R0010-1.
DR   EnsemblGenomes-Tr; Mmah_R0011-1.
DR   EnsemblGenomes-Tr; Mmah_R0012-1.
DR   EnsemblGenomes-Tr; Mmah_R0013-1.
DR   EnsemblGenomes-Tr; Mmah_R0014-1.
DR   EnsemblGenomes-Tr; Mmah_R0015-1.
DR   EnsemblGenomes-Tr; Mmah_R0016-1.
DR   EnsemblGenomes-Tr; Mmah_R0017-1.
DR   EnsemblGenomes-Tr; Mmah_R0018-1.
DR   EnsemblGenomes-Tr; Mmah_R0019-1.
DR   EnsemblGenomes-Tr; Mmah_R0020-1.
DR   EnsemblGenomes-Tr; Mmah_R0021-1.
DR   EnsemblGenomes-Tr; Mmah_R0022-1.
DR   EnsemblGenomes-Tr; Mmah_R0023-1.
DR   EnsemblGenomes-Tr; Mmah_R0024-1.
DR   EnsemblGenomes-Tr; Mmah_R0025-1.
DR   EnsemblGenomes-Tr; Mmah_R0026-1.
DR   EnsemblGenomes-Tr; Mmah_R0027-1.
DR   EnsemblGenomes-Tr; Mmah_R0028-1.
DR   EnsemblGenomes-Tr; Mmah_R0029-1.
DR   EnsemblGenomes-Tr; Mmah_R0030-1.
DR   EnsemblGenomes-Tr; Mmah_R0031-1.
DR   EnsemblGenomes-Tr; Mmah_R0032-1.
DR   EnsemblGenomes-Tr; Mmah_R0033-1.
DR   EnsemblGenomes-Tr; Mmah_R0034-1.
DR   EnsemblGenomes-Tr; Mmah_R0035-1.
DR   EnsemblGenomes-Tr; Mmah_R0036-1.
DR   EnsemblGenomes-Tr; Mmah_R0037-1.
DR   EnsemblGenomes-Tr; Mmah_R0038-1.
DR   EnsemblGenomes-Tr; Mmah_R0039-1.
DR   EnsemblGenomes-Tr; Mmah_R0040-1.
DR   EnsemblGenomes-Tr; Mmah_R0041-1.
DR   EnsemblGenomes-Tr; Mmah_R0042-1.
DR   EnsemblGenomes-Tr; Mmah_R0043-1.
DR   EnsemblGenomes-Tr; Mmah_R0044-1.
DR   EnsemblGenomes-Tr; Mmah_R0045-1.
DR   EnsemblGenomes-Tr; Mmah_R0046-1.
DR   EnsemblGenomes-Tr; Mmah_R0047-1.
DR   EnsemblGenomes-Tr; Mmah_R0048-1.
DR   EnsemblGenomes-Tr; Mmah_R0049-1.
DR   EnsemblGenomes-Tr; Mmah_R0050-1.
DR   EnsemblGenomes-Tr; Mmah_R0051-1.
DR   EnsemblGenomes-Tr; Mmah_R0052-1.
DR   EnsemblGenomes-Tr; Mmah_R0053-1.
DR   EnsemblGenomes-Tr; Mmah_R0055-1.
DR   EnsemblGenomes-Tr; Mmah_R0056-1.
DR   EnsemblGenomes-Tr; Mmah_R0057-1.
DR   EnsemblGenomes-Tr; Mmah_R0058-1.
DR   EnsemblGenomes-Tr; Mmah_R0059-1.
DR   EnsemblGenomes-Tr; Mmah_R0060-1.
DR   EnsemblGenomes-Tr; Mmah_R0061-1.
DR   EnsemblGenomes-Tr; Mmah_R0062-1.
DR   EnsemblGenomes-Tr; Mmah_R0063-1.
DR   EnsemblGenomes-Tr; Mmah_R0064-1.
DR   EuropePMC; PMC3017947; 21234345.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00373; RNaseP_arch.
DR   RFAM; RF01133; sR3.
DR   RFAM; RF01320; CRISPR-DR7.
DR   RFAM; RF01857; Archaea_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01982; PYLIS_1.
DR   SILVA-LSU; CP001994.
DR   SILVA-SSU; CP001994.
DR   StrainInfo; 159112; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4085042
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Methanohalophilus mahii DSM 5219
CC   Culture Collection ID :: DSM 5219, ATCC 35705, OCM 68
CC   GOLD Stamp ID         :: Gi02918
CC   Funding Program       :: DOE-GEBA 2007
CC   Gene Calling Method   :: Prodigal, GenePRIMP
CC   Isolation Site        :: "Anaerobic sediment from Great Salt Lake,
CC                            USA"
CC   Isolation Country     :: USA
CC   Latitude              :: 41.177
CC   Longitude             :: -112.502
CC   Oxygen Requirement    :: Anaerobe
CC   Cell Shape            :: Coccus-shaped
CC   Motility              :: Nonmotile
CC   Temperature Range     :: Mesophile
CC   Temperature Optimum   :: 37C
CC   Salinity              :: Halophile
CC   pH                    :: 6.5 - 7.5
CC   Gram Staining         :: gram-
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Fresh water, Sediment
CC   Energy Source         :: Methylotroph
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2012424
FT                   /organism="Methanohalophilus mahii DSM 5219"
FT                   /strain="DSM 5219"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:547558"
FT                   /culture_collection="DSM:DSM 5219"
FT   gene            167..1402
FT                   /locus_tag="Mmah_0001"
FT   CDS_pept        167..1402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0001"
FT                   /product="ORC complex protein Cdc6/Orc1"
FT                   /note="COGs: COG1474 Cdc6-related protein AAA superfamily
FT                   ATPase; InterPro IPR003959:IPR015163:IPR003593:IPR014277;
FT                   KEGG: cdc6; cdc6 protein; K02213 cell division control
FT                   protein 6; PFAM: CDC6 domain protein; AAA ATPase central
FT                   domain protein; SMART: AAA ATPase; SPTR: Q12VA1 ORC complex
FT                   protein Cdc6/Orc1; TIGRFAM: orc1/cdc6 family replication
FT                   initiation protein; PFAM: ATPase family associated with
FT                   various cellular activities (AAA); CDC6, C terminal;
FT                   TIGRFAM: orc1/cdc6 family replication initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35539"
FT                   /db_xref="GOA:D5E8N0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014277"
FT                   /db_xref="InterPro:IPR015163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8N0"
FT                   /protein_id="ADE35539.1"
FT                   /translation="MDNSSLDGLFEELLETESLFKNKEVLRPAYTPENLPHRSDQINNI
FT                   ATVLVSALRGHTPSNVLIYGKTGTGKTAVARYVGIELERKSDHLNVQCNVLYINCEVID
FT                   TQYRLLANLAKQFGEDVPMTGWPTDQVFFRFKEAVDSRKQVIIIILDEIDKLIKKGDDV
FT                   LYNLSRMNTDLQNARVSMIGISNDLKFTEFLDPRVKSSLGEEEIIFPPYDAEQISDILR
FT                   QRAAIAYKENSMDDMVIPLCSAFAAQEHGDARRALDLMRVAGEIAEREKKNIIEEEHVR
FT                   QAQEKIEVDRIVEVIRTLPTQSKLALYSVMLLRNNGHRNVTTGEVYNVYRQLCRNVDTD
FT                   ILTQRRVTDLISELDMLGILNAIVVSKGRYGRTKEIVLSVPVESTKKVLLEDYRLNMLA
FT                   DFKPVLTAQMHL"
FT   gene            complement(1457..2011)
FT                   /locus_tag="Mmah_0002"
FT   CDS_pept        complement(1457..2011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0002"
FT                   /product="peptidase S26B, signal peptidase"
FT                   /note="InterPro IPR001733; KEGG: hypothetical protein;
FT                   K03100 signal peptidase I; SPTR: Q12VA0 Peptidase S26B,
FT                   signal peptidase; TIGRFAM: peptidase S26B, signal
FT                   peptidase; PFAM: Peptidase S24-like; TIGRFAM: signal
FT                   peptidase I, archaeal type"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35540"
FT                   /db_xref="GOA:D5E8N1"
FT                   /db_xref="InterPro:IPR001733"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8N1"
FT                   /protein_id="ADE35540.1"
FT                   /translation="MEIGEIIHTFKNSDNFWVGIARDALSVLAILAVIGILSQLFFGMW
FT                   TPMVAVESGSMEPHMYRGDIIFIEDLDRTRIETLRDAPEDYISFEKKGDVILYRPYGQK
FT                   GVTPVIHRAMYFVEEGEQMWEGGPDAPHEGYITKGDNKKTNSYYDQQGQISYLAPVKEE
FT                   WIIGVARYKVPYIGHIRLLLS"
FT   gene            2151..3611
FT                   /locus_tag="Mmah_0003"
FT   CDS_pept        2151..3611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0003"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="COGs: COG1311 DNA polymerase II small subunit/DNA
FT                   polymerase delta subunit B; InterPro
FT                   IPR004843:IPR007185:IPR004365; KEGG: hypothetical protein;
FT                   K02328 DNA polymerase delta subunit 2; PFAM:
FT                   metallophosphoesterase; DNA polymerase epsilon subunit B;
FT                   nucleic acid binding OB-fold tRNA/helicase-type; PRIAM:
FT                   DNA-directed DNA polymerase; SPTR: Q8TUM9 DNA-directed DNA
FT                   polymerase, subunit 1; PFAM: DNA polymerase alpha/epsilon
FT                   subunit B; OB-fold nucleic acid binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35541"
FT                   /db_xref="GOA:D5E8N2"
FT                   /db_xref="InterPro:IPR007185"
FT                   /db_xref="InterPro:IPR011149"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR024826"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8N2"
FT                   /protein_id="ADE35541.1"
FT                   /translation="MQEMSFLSDLLEAGYQVSPQAAELITSHNNPRALINHILGSVDDS
FT                   VFVIDVDDIDFTGFEEVKDVEVPCKQEPVANTTSANPISVLCDITDCSTCVGEYMEFVQ
FT                   YFRNRYSRLSEMIRGRVNARPMESLKGNRRVPGDEISIIGMVSEIKNTSNGHRLVRFED
FT                   PTGSFQVLFSMNDKDIYEQSNKLVLDDVVGVSGNLTNDGKLLIAKKLVFPDLPNMGLSK
FT                   NGSQGKALFISDVHIGSNTFLQGQWDDFMTFVKRESDNPELNKLAQQLRYIVVAGDIVD
FT                   GVGIYPGQEEELTIPDIYDQYEEVAHYFNQIPSDITVVIGPGNHDAVRQAEPQPTFPER
FT                   IRKMFDPRIKFVGNPALVDLDGVLVLMYHGRSIDDFVSSIQGISYSEPEKAMLEMVKRR
FT                   HLSPTYGSRVSIAPEKTDHFVIDHIPDILHCGHVHTVGVKQYRGTLLINSGTWQDQTEF
FT                   QKRVNVVPEPARVPVVDLATFQPTMLQF"
FT   gene            3651..4583
FT                   /locus_tag="Mmah_0004"
FT   CDS_pept        3651..4583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0004"
FT                   /product="Wyosine base formation domain protein"
FT                   /note="COGs: COG0731 Fe-S oxidoreductase; InterPro
FT                   IPR013917:IPR007197; KEGG: Os03g0775300; hypothetical
FT                   protein; PFAM: Wyosine base formation domain protein;
FT                   Radical SAM domain protein; SPTR: Q12V99 Fe-S protein,
FT                   radical SAM family; PFAM: Wyosine base formation; Radical
FT                   SAM superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35542"
FT                   /db_xref="GOA:D5E8N3"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013917"
FT                   /db_xref="InterPro:IPR023993"
FT                   /db_xref="InterPro:IPR034556"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8N3"
FT                   /protein_id="ADE35542.1"
FT                   /translation="MASDLLPDIGTLIKKQGYRLAGSHSAVKTCLWMRRAVREEGECYK
FT                   ARFYGISSHRCLQMTPTLCCNQRCLHCWRPVELDVPTPQKWDSPVEIMGSSIECQRNLI
FT                   SGFGGSASRELWQQANEPAHVAISLSGEPTLYPYLDELIEEFRSRGVSTFVVTNGTVPE
FT                   TIKRIKPSQLYMSLDAPERQTYMEVCSPKDPCLWDNINESLSILKNKECRTAIRITLIK
FT                   GVNMFDVKGYADLIRKAQPDIIEVKAYMHLGFSRNRLERDAMPGHEEVLDFANQLGCEL
FT                   GYEVGDQVEISRVVMLFRDGKFVASKLPV"
FT   gene            4690..5937
FT                   /locus_tag="Mmah_0005"
FT   CDS_pept        4690..5937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0005"
FT                   /product="peptide chain release factor subunit 1 (aeRF-1)"
FT                   /note="COGs: COG1503 Peptide chain release factor 1 (eRF1);
FT                   InterPro IPR005140:IPR005142:IPR005141; KEGG: hypothetical
FT                   protein; K03265 peptide chain release factor eRF subunit 1;
FT                   PFAM: eRF1 domain 1 protein; eRF1 domain 3 protein; eRF1
FT                   domain 2 protein; SPTR: Q12V98 Peptide chain release factor
FT                   subunit 1; PFAM: eRF1 domain 3; eRF1 domain 2; eRF1 domain
FT                   1; TIGRFAM: peptide chain release factor eRF/aRF, subunit
FT                   1; peptide chain release factor 1, archaeal and eukaryotic
FT                   forms"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35543"
FT                   /db_xref="GOA:D5E8N4"
FT                   /db_xref="InterPro:IPR004403"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005141"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="InterPro:IPR020918"
FT                   /db_xref="InterPro:IPR024049"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR042226"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8N4"
FT                   /protein_id="ADE35543.1"
FT                   /translation="MAEQSAHEKYEFKKKLESLRNKKGRGTELISLYIPPDKQLSDVTS
FT                   QLKTEHSQASNIKSKVTRTNVQSAIDSLLSRLKYLKIPENGIVYFTGAVDIGADKTNME
FT                   TTTIIPPQPLTIYKYHCDSAFFLEPLEGMLKDAKTYGLLVLDRREATIGLLTGKHIEPY
FT                   RNLTSTVPGKQRKGGQSAQRFQQLRLIAIHDFYKRIGDAASEIFLTVDMKDFEGILLGG
FT                   PSPTKEEFQSGEFLHHELQRKILGLFDVAYTDESGLQELVNAASERLQDLDLMVEKNLM
FT                   QKFFKELVSDSGKAAYGEEVVRQNLMIGAVEILLISEDLRSERIKVRCTDGDYEDNITR
FT                   ENQPDQKSVDDFGNCPKCGSPLEVVERVDIVDELSDLSDQMGSEVAFISTDFEEGGQLL
FT                   NAFGGIVAILRYNTGM"
FT   gene            5947..7650
FT                   /locus_tag="Mmah_0006"
FT   CDS_pept        5947..7650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0006"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="COGs: COG0018 Arginyl-tRNA synthetase;
FT                   InterProIPR015945:IPR005148:IPR008909:IPR001412:IPR 001278;
FT                   KEGG: dvl:Dvul_1814 arginyl-tRNA synthetase; PFAM:
FT                   Arginyl-tRNA synthetase, class Ic, core; arginyl tRNA
FT                   synthetase domain protein; DALR anticodon binding domain
FT                   protein; PRIAM: Arginine--tRNA ligase; SPTR: Q12V97
FT                   Arginyl-tRNA synthetase; TIGRFAM: arginyl-tRNA synthetase;
FT                   PFAM: DALR anticodon binding domain; Arginyl tRNA
FT                   synthetase N terminal domain; tRNA synthetases class I (R);
FT                   TIGRFAM: arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35544"
FT                   /db_xref="GOA:D5E8N5"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8N5"
FT                   /protein_id="ADE35544.1"
FT                   /translation="MYLEFVNQVVSVLENAVQRAGFEPVEIAPEPSQHADLSTRVAFKL
FT                   AAVARKSPVEVANQIVENIQLRENCLIESIGTTGPYINIKANRTYIDRTFETVRSKKED
FT                   FGGNFYSGKILLEHTSANPNGPLHVGHIRNSIIGDTLTRILRKAGYDVDAQYYVNDMGR
FT                   QIAIVSWALEHFEMDPDLKSDHAIANVYIKANARLEEDSQKVEYIDNLMQRVESGDEEV
FT                   IKRFDDAVDLAVKGIRSTLLRMNVHHDSFVNESGFVRSGAVSDIVDKIRKTGRVDVDDG
FT                   ALVVDLSDYGFEKTLVVQRRDGTSLYTTRDLAYHEWKTMQADRIIDILGADHKLISGQL
FT                   KATLNAVGLKEPEIVIFEFVSLPEGSMSTRRGQFITADELLDKVQARAFEEVEKRRPEM
FT                   SPEFMEKVAGMVGIGAVRYDIIKVSPEKSTVFDWKAALDFEKQGGPFIQYSHARASSIL
FT                   KKAGEEGIWDPASKPNPSVLTDESEITLIKQIALFDKVLKQAADDLKPHIIAIYGRELA
FT                   DAFNQFYRFSPVLGAETEELRNARLGLVDCARIVLANVLETLGMGAPESM"
FT   gene            7656..7925
FT                   /locus_tag="Mmah_0007"
FT   CDS_pept        7656..7925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0007"
FT                   /product="protein of unknown function DUF1294"
FT                   /note="COGs: COG3326 membrane protein; InterPro IPR010718;
FT                   KEGG: hps:HPSH_01780 hypothetical protein; PFAM: protein of
FT                   unknown function DUF1294; SPTR: Q12V96 Putative
FT                   uncharacterized protein; PFAM: Protein of unknown function
FT                   (DUF1294)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35545"
FT                   /db_xref="GOA:D5E8N6"
FT                   /db_xref="InterPro:IPR010718"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8N6"
FT                   /protein_id="ADE35545.1"
FT                   /translation="MFSLEQLVLAYIGLASLFSFVIMGIDKKKAVKGAYRISEKFLFIC
FT                   AFAGGSVGILAGMYIFRHKIRRWKFKLGIPLILVLEMYLYVKFI"
FT   sig_peptide     7656..7727
FT                   /locus_tag="Mmah_0007"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(7929..8957)
FT                   /locus_tag="Mmah_0008"
FT   CDS_pept        complement(7929..8957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0008"
FT                   /product="methyltransferase MtaA/CmuA family"
FT                   /note="COGs: COG0407 Uroporphyrinogen-III decarboxylase;
FT                   InterPro IPR000257:IPR006360; KEGG: geo:Geob_2543
FT                   uroporphyrinogen decarboxylase (URO-D); PFAM:
FT                   Uroporphyrinogen decarboxylase (URO-D); SPTR: Q8TSE3
FT                   Methylcobamide:CoM methyltransferase isozyme M; TIGRFAM:
FT                   methyltransferase MtaA/CmuA family; PFAM: Uroporphyrinogen
FT                   decarboxylase (URO-D); TIGRFAM: methyltransferase,
FT                   MtaA/CmuA family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35546"
FT                   /db_xref="GOA:D5E8N7"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006360"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8N7"
FT                   /protein_id="ADE35546.1"
FT                   /translation="MQSGLRENLLNVLAGKEEGLIPVLSVTQTATNGLMETTGAFWPQA
FT                   HSSAFQMAELSLAAHTVGGLEAISYPFCLTVLAEAAGCEIDLGTINRPPEVISHPFAEK
FT                   VENPDIPADVYDRARVPVVLETTRRLRNFAPDVPLIAGMEGPATLVYHLIGAQDYLKWA
FT                   LFKPETFKMYIREATCICEGYAKLLFEAGADVICLDDTVAGPETLDCLLFETLIKPSYQ
FT                   HLTHSIEGPVVMHMCGNTTSILSSLANCGFEGISIEESVSVAEAKSQIGSRTILIGNIS
FT                   TTNTLLYSTPEEVEEEAFKCLEEGVDILAPGSGLAPETPVVNIRAMEQARDKYLNEFAE
FT                   WS"
FT   gene            9026..10048
FT                   /locus_tag="Mmah_0009"
FT   CDS_pept        9026..10048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0009"
FT                   /product="Methionine synthase II (cobalamin-independent)"
FT                   /note="COGs: COG0620 Methionine synthase II
FT                   (cobalamin-independent); KEGG: hypothetical protein
FT                   LOC760986; K00549
FT                   5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   methyltransferase; SPTR: Q12V82
FT                   5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35547"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8N8"
FT                   /protein_id="ADE35547.1"
FT                   /translation="MTELIFDDIGSFPLQGGISAEWLREAIPAHEPAAFDVIRSTFRQK
FT                   LDAGVDVATYPQFQDMNKQFLSILNDPECIEGPFDVKTSCAKIVELEAIEKAAEEYQTE
FT                   TGIKPNVRVCVTGPLELYLQEFGGTSYDDILELFGQSIDKFVTNAIDNASNFNVHTVSI
FT                   DEPSIGINPQVMFDDDEIINALEKASATASRKGVDVEIHLHSPLYYELPCRTSGINVIG
FT                   VESAANPTYLELIDKNVLEETDSFLRAGVARTDIFNLVAILNEKYSTNAWQKPEMLQEL
FT                   VTDMETPSTILKRLEHAYGIFGDRVKYVGPDCGLGSWPTPEIASTLLGNVAEALDTFRN
FT                   "
FT   gene            complement(10038..11039)
FT                   /locus_tag="Mmah_0010"
FT   CDS_pept        complement(10038..11039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0010"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: B9ZBL4 Putative uncharacterized protein; PFAM:
FT                   Integral membrane protein DUF95"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35548"
FT                   /db_xref="GOA:D5E8N9"
FT                   /db_xref="InterPro:IPR002798"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8N9"
FT                   /protein_id="ADE35548.1"
FT                   /translation="MSSKPNFLIKWSAFLWCLKIFTYSATLTALLALATYAIMTALAEP
FT                   VIINETIERTTSAATSKVQRGAGYVGIAWSIFLFNSLAALTASAGTALFVYFNRFLLKD
FT                   ITSRRHHHNYAKISIAMEKALYPIYRVLEWPAERFFGFKSINTQKAENLVWNYTGYSRY
FT                   HFQLLTAIVPFSVPLLVAAANGAILGMLFAFHLFNGAFTGYHLAGINGIVGGIIYNITF
FT                   FISAILPHGIIEIPVILLSTSIGYAIADSNCRLVRDKNLFVSDNIADLQADIATEERNT
FT                   GTILFSPLFWKIYLFFVLLLLITAFIETEITPSIITWALSIVEPFVSSLLNS"
FT   sig_peptide     complement(10911..11039)
FT                   /locus_tag="Mmah_0010"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            11175..11912
FT                   /locus_tag="Mmah_0011"
FT   CDS_pept        11175..11912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0011"
FT                   /product="RecA-superfamily ATPase implicated in signal
FT                   transduction"
FT                   /note="COGs: COG0467 RecA-superfamily ATPase implicated in
FT                   signal transduction; InterPro IPR010624; KEGG:
FT                   bxe:Bxe_B2609 hypothetical protein; SPTR: Q12V81 ATPase,
FT                   RecA superfamily; PFAM: KaiC"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35549"
FT                   /db_xref="GOA:D5E8P0"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8P0"
FT                   /protein_id="ADE35549.1"
FT                   /translation="MKAETGIEGLDELIGGGLPQGRVYLLNGSPGSGKTTFGMQYLIHG
FT                   VSFGDAGLYVTLMQNSEHIIADISTYSLNLSALMKMKKIFFADLGPEMEYGYMDELKEV
FT                   INPESNMNPYPVEGEPPSASTVFKEIAAHVAVNDIKRVVVDPLSSIRFSNQDKCLEKME
FT                   MARFLRNLQALGCTTLLIDDQPIPVSVSSEHFAADGVILFHNPASDDEDRSLQIIKMRG
FT                   VPHPVSRQAFRFGEKGIEVLGRR"
FT   gene            complement(11913..12953)
FT                   /locus_tag="Mmah_0012"
FT   CDS_pept        complement(11913..12953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0012"
FT                   /product="elongation factor Tu domain 2 protein"
FT                   /note="COGs: COG3276 Selenocysteine-specific translation
FT                   elongation factor; InterPro IPR004161; KEGG: dar:Daro_1810
FT                   selenocysteine-specific translation elongation factor SelB;
FT                   PFAM: elongation factor Tu domain 2 protein; SPTR: Q12V79
FT                   Elongation factor Tu, domain 2; PFAM: Elongation factor Tu
FT                   domain 2; Elongation factor Tu GTP binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35550"
FT                   /db_xref="GOA:D5E8P1"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8P1"
FT                   /protein_id="ADE35550.1"
FT                   /translation="MTKIAIIGSEGSGRTSLAAKLGKKSTAADITMYDYAKNDVVMTTI
FT                   DANGYPKSVKPLVTALQLSDIALLCIPPEGPDAFAGECIMALDLMQYKHGIVVLTKADT
FT                   SYPYAQEELQKNLQKILSPTTLANWEFVNLSTESFEGLDEIKEKIFELDEQVNSEYEEL
FT                   NDKPVRIIVDQSFNVTGIGCVVLGIVKQGTVNAKEKLTAYPADKPLEVRSIQMHDEDVK
FT                   SAPAGARVGLALKGVQSKDIERGFIISEKEEVAESLVLECTLSSFASPLKLSDVPHIFT
FT                   GLQSSPMRIEKIEIDGKEAEQVNASQQCTLHLNGSHEIAYRQQDRFIITNLDAKQRFTG
FT                   YGFVKE"
FT   gene            complement(13001..14167)
FT                   /locus_tag="Mmah_0013"
FT   CDS_pept        complement(13001..14167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0013"
FT                   /product="ATP dependent DNA ligase"
FT                   /note="COGs: COG1423 ATP-dependent DNA ligase homolog of
FT                   eukaryotic ligase III; InterPro IPR001072:IPR012310; KEGG:
FT                   aeh:Mlg_2553 ATP dependent DNA ligase; PFAM: ATP dependent
FT                   DNA ligase; SPTR: Q46DV0 Putative uncharacterized protein;
FT                   PFAM: ATP dependent DNA ligase domain; TIGRFAM: conserved
FT                   hypothetical protein TIGR01209"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35551"
FT                   /db_xref="GOA:D5E8P2"
FT                   /db_xref="InterPro:IPR001072"
FT                   /db_xref="InterPro:IPR021122"
FT                   /db_xref="InterPro:IPR041596"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8P2"
FT                   /protein_id="ADE35551.1"
FT                   /translation="MKGSEKPELDMEKTARFLGLSVSRLERLLEKRLLSRNWGKYKNLF
FT                   RFETSVSGIERGSVLLQKRDGELDLILGFPKIQRAMLLEPSINNHFSEIDKLIVEEKMN
FT                   GYNVRVIENAGKLIAFTRSGHVCPYSTEKVNYLLDPSFFRQYPDLVVHGEMAGPENPYV
FT                   SKKVYDTQTLDFFVFDIRHKKTGQPLPVIQRRKLAASFGFKQVPFLGEFARKEAAEKIM
FT                   SIIKKLGDMGHEGVVIKDLDMDLSPIKYTCSESNCADLEHAFKFYNEVGRDYLYSRVVR
FT                   EGFQTVEWDEDEDTMEKRCLRLGKSILSPMADSVRRVGNGEKLYDEVTLRFQNPQTLQE
FT                   FEEYFRRLGIDAIFDRVGYSGGELMVNLQKLNQSTTDKTESMWEGNLW"
FT   gene            complement(14177..14953)
FT                   /locus_tag="Mmah_0014"
FT   CDS_pept        complement(14177..14953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0014"
FT                   /product="CBS domain containing membrane protein"
FT                   /note="COGs: COG3448 CBS-domain-containing membrane
FT                   protein; InterPro IPR000644; KEGG: bja:blr4646 hypothetical
FT                   protein; PFAM: CBS domain containing protein; SMART: CBS
FT                   domain containing protein; SPTR: Q12V77 CBS domain protein;
FT                   PFAM: CBS domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35552"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8P3"
FT                   /protein_id="ADE35552.1"
FT                   /translation="MQVKDIMIQPISVDKADTISHALDIMEKNDTRRLLVTHSGQLVGV
FT                   LTMRNLTKELGTRKKGAKPASSLHVATAVSDNFVKILPDTDIDDAITLMKKKGGVLIVT
FT                   DNEDIMGWVTPQEILQNLYFDGFAGEMMIKDPVVVNPADRVSHVRHIILENNMGRFPVM
FT                   DSGELQGIITEQDIAKAMKAFRELVSGNQQDARIKNLIVEDIMKMGTKTAYTNTPVAEV
FT                   VDMMLENNIGGVPVLNLEEEFTGFITRRTLVDTLAK"
FT   gene            complement(14982..15821)
FT                   /locus_tag="Mmah_0015"
FT   CDS_pept        complement(14982..15821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0015"
FT                   /product="CBS domain containing membrane protein"
FT                   /note="COGs: COG3448 CBS-domain-containing membrane
FT                   protein; InterPro IPR000644; KEGG: sme:SMc00815
FT                   inositol-5-monophosphate dehydrogenase; PFAM: CBS domain
FT                   containing protein; SMART: CBS domain containing protein;
FT                   SPTR: Q12V76 CBS domain protein; PFAM: CBS domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35553"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8P4"
FT                   /protein_id="ADE35553.1"
FT                   /translation="MNVSDIMSAPVYVIGTEEPVSHARKLMFRHKISTLIVVEEDEIKG
FT                   IVTKSDISSRLAQAEPMWRRRPIDKIPAKMVMTAEPIITIYPDASVSQAINLMLENQIN
FT                   NLPVFKNKLQGIVTIGDIVRYVADRALTTKISEVLTDDAVEVHRHHTINHVIDEMEKHR
FT                   VSKVIVINDMGDTVGMISTRDIALSAMEDNEGKMQSKNIKMARKPTQGGEKTYRYVKDV
FT                   PLVAEDIMVELDGVVNIEDNLSDAAKVMVENNRTGLPVEKEGKIVGILSRIDIIRAA"
FT   gene            complement(15845..16813)
FT                   /locus_tag="Mmah_0016"
FT   CDS_pept        complement(15845..16813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0016"
FT                   /product="CBS domain containing membrane protein"
FT                   /note="COGs: COG3448 CBS-domain-containing membrane
FT                   protein; InterPro IPR000644; KEGG: dde:Dde_0765 CBS; PFAM:
FT                   CBS domain containing protein; SMART: CBS domain containing
FT                   protein; SPTR: Q12V75 CBS domain protein; PFAM: CBS domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35554"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8P5"
FT                   /protein_id="ADE35554.1"
FT                   /translation="MSSRQKNTGNPGGTDISKDPKAYSMESIMDRGNVNFKARIAEHEG
FT                   SMMAVATKDVISANPTTPIIDVIKKMSKMHFKHMPIVNAGTSKLEGIITSVDIMDLLGG
FT                   GERSLFVEKKFKGNLLSAINAQVRYIMEHEVHSLRNDAHIEKAFELMIDKQIGCIPVVD
FT                   NDGHLEAICTERDFLTFIRGVLTGKKVEKWQTRNVKTADAATSIWDVARTMIENKFKRV
FT                   PIVRDNILVGVVTSSDILSYLGTGEAFEKLTTGNVHEAFDSPISSLLHNDLIWTIPDAD
FT                   LGEAAEIMLEKSIGCLPIIKDGNLEGILTERDILLALADKQ"
FT   gene            complement(16902..17654)
FT                   /locus_tag="Mmah_0017"
FT   CDS_pept        complement(16902..17654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0017"
FT                   /product="CBS domain containing membrane protein"
FT                   /note="COGs: COG3448 CBS-domain-containing membrane
FT                   protein; InterPro IPR000644; KEGG: rpa:RPA4246
FT                   CBS/transport-associated domain-containing protein; PFAM:
FT                   CBS domain containing protein; SMART: CBS domain containing
FT                   protein; SPTR: Q12V74 CBS domain protein; PFAM: CBS domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35555"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8P6"
FT                   /protein_id="ADE35555.1"
FT                   /translation="MSGDAVYLHESDTVTHARQLMRDHFLRGIPVVNDNGKVSGMITDK
FT                   DILKVASTKSNVTVAGFVNSVPQITPETDIYKAASLLLEAKLERCPVVKSSIEQNLVGI
FT                   VSNTDLLGKMVNRDLSKPVREIMTSPPTTCKPTDNIGEIWSAMLENDYTGLPVVSKKGK
FT                   LMGMITRRDLIKSGFARIGVREKDGSTHNQPVEKVMSTPAYSIKQDTSVKECTEKVLHY
FT                   DVGRLTVDVEDKPVGIVDRSDLLRAYTE"
FT   gene            complement(17715..18317)
FT                   /locus_tag="Mmah_0018"
FT   CDS_pept        complement(17715..18317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0018"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="COGs: COG2905 signal-transduction protein containing
FT                   cAMP-binding and CBS domains; InterPro IPR000644; KEGG:
FT                   bph:Bphy_7033 signal-transduction protein; PFAM: CBS domain
FT                   containing protein; SMART: CBS domain containing protein;
FT                   SPTR: Q12V73 CBS domain protein; PFAM: CBS domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35556"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8P7"
FT                   /protein_id="ADE35556.1"
FT                   /translation="MVVQEHNSEDSSYGGIESQIPVGDLMSRNVVSLDATCNVFEVARE
FT                   MMAKGTGSVIISRESKPIGIITERDIVGKVVKQDLTPSSVPATETMSSPIIMVEASTNV
FT                   IEASRLMVKSNIRRLAVNKGEDIVGIITDRDILTISPGLNTILENLIEMNRETGIPEES
FT                   YLERGICQRCGSYVDELTSVNGLALCEDCREEEGYYD"
FT   gene            complement(18487..19899)
FT                   /locus_tag="Mmah_0019"
FT   CDS_pept        complement(18487..19899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0019"
FT                   /product="histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterPro IPR004358:IPR003594:IPR005467; KEGG:
FT                   afw:Anae109_3161 PAS/PAC sensor signal transduction
FT                   histidine kinase; PFAM: ATP-binding region ATPase domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   SPTR: Q12XC6 ATP-binding region, ATPase-like protein; PFAM:
FT                   Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35557"
FT                   /db_xref="GOA:D5E8P8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8P8"
FT                   /protein_id="ADE35557.1"
FT                   /translation="MESKPPIILLSNDLYYHGTGLTSNKERLKDASILNIQDFENRDPE
FT                   SQQEVLESHGTLYIITSANEGSLPQVLNTCDNEIYRIKAEECRDTEKYACPYILNAKLM
FT                   ELLLEQREAEIRKLNEQMSSYLIAMDSIYTLSSYDRKEDIINHTKEFFAMMCLPENLCY
FT                   FEAHNTKAQSGIHLTDFQKKDIVAFLKSNKYYKIAPSEKSFCFRLTLQDGDEGIFVLEN
FT                   IAYQSRLHEFLNLTLSIRSVLTVVLENISKQNELEKSHNLLADANDMLKVINKILRHDL
FT                   ANNLGAIKMSLEMNETRPNPKYIQISKKAVDRSFQKINDMKGLENLIGTGKDLDCYEVK
FT                   EIIEKTAGTDIEMDISIEGQCKVLADNALSSVFENIIKNAIAHGKANKMRIKMEPSGKY
FT                   CHISIVDNGTGIPDEIKPKIFKEGFTEGGDSNSGLGLYISKKVIERYGGQIEVKDNTPH
FT                   GAKFVLDIPSTK"
FT   gene            complement(19909..20949)
FT                   /locus_tag="Mmah_0020"
FT   CDS_pept        complement(19909..20949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0020"
FT                   /product="Uroporphyrinogen decarboxylase (URO-D)"
FT                   /note="COGs: COG0407 Uroporphyrinogen-III decarboxylase;
FT                   InterPro IPR000257; KEGG: ppd:Ppro_1430 uroporphyrinogen
FT                   decarboxylase; PFAM: Uroporphyrinogen decarboxylase
FT                   (URO-D); SPTR: Q12XC7 Uroporphyrinogen decarboxylase
FT                   (URO-D); PFAM: Uroporphyrinogen decarboxylase (URO-D);
FT                   TIGRFAM: methyltransferase, MtaA/CmuA family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35558"
FT                   /db_xref="GOA:D5E8P9"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8P9"
FT                   /protein_id="ADE35558.1"
FT                   /translation="MKDAMTPMERVLTTLGHEEPDRVPYFLLLTGHGAQLLNMHPKEYF
FT                   SNGENVAQAQLKMQETYGHDCFYPFFYASLETQAWGGSTVFYDDGPPNAGKPIIESFEQ
FT                   IDELEVPDVMGHKGFDEVRKAINILYSQKGEEIPIIAVVMSPFSLPVMQMGFDRYFDLM
FT                   YEDRKKFWTLMDLNKQFCTEWANSQLEAGATAICYFDPVSSPTIVPRETFLETGYKVAK
FT                   DTIGDINGAVATHLASGRSIPIIEDLQDTGAAALGVSAMEDLTELKDRCRGKISLLGNL
FT                   NAIEMRHWTAGQAENKVRQAIEKAGPGGGYILSDNHGEMVWDVSHETLLNIANAVKKYG
FT                   NYPLQK"
FT   gene            complement(20946..21593)
FT                   /locus_tag="Mmah_0021"
FT   CDS_pept        complement(20946..21593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0021"
FT                   /product="cobalamin B12-binding domain protein"
FT                   /note="COGs: COG5012 cobalamin binding protein; InterPro
FT                   IPR006158; KEGG: ppd:Ppro_1431 cobalamin B12-binding
FT                   domain-containing protein; PFAM: cobalamin B12-binding
FT                   domain protein; SPTR: Q12XC8 Cobalamin B12-binding protein;
FT                   PFAM: B12 binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35559"
FT                   /db_xref="GOA:D5E8Q0"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8Q0"
FT                   /protein_id="ADE35559.1"
FT                   /translation="MDRLNKNKALDFENALLEFDRVHAEQILEDALSENNTFQVIDEIV
FT                   SPALTRIGTAWDTGEIALSQNYMAGKIAEQLMDEILPAESPERIAYPKIAITTLGDYHM
FT                   LGKKVVTSMLRTTGHSIKEYDSMNLDQLVEKLNEDGIDLLLTSTLMLNIALKIRELKKH
FT                   MDKKGLKTKVIAGGAPFLFDDMLYREVGADYMARTSSDVYKLIDQYKEEVHK"
FT   gene            complement(21730..22854)
FT                   /locus_tag="Mmah_0022"
FT   CDS_pept        complement(21730..22854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0022"
FT                   /product="nucleic acid binding OB-fold tRNA/helicase-type"
FT                   /note="COGs: COG1599 Single-stranded DNA-binding
FT                   replication protein A (RPA) large (70 kD) subunit and
FT                   related ssDNA-binding protein; InterPro IPR004365; KEGG:
FT                   hypothetical protein; K07466 replication factor A1; PFAM:
FT                   nucleic acid binding OB-fold tRNA/helicase-type; SPTR:
FT                   Q12V72 Single-stranded DNA-binding replication protein A
FT                   (RPA) large (70 kD) subunit and related ssDNA-binding
FT                   proteins; PFAM: OB-fold nucleic acid binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35560"
FT                   /db_xref="GOA:D5E8Q1"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8Q1"
FT                   /protein_id="ADE35560.1"
FT                   /translation="MDDIDTVYEKLEGIISREEFEAKVEEKIEEMHNLCDVQTAALLVA
FT                   HNLGATDAGVETTKIADINESSSNVNFTGKAVSIFEPKEFSRDDGTTGRVGNIIVADET
FT                   GSIRVTLWDDLADLLKTGDISTGKSYNISGYAKEGYSGIEVNIGRGGGISESEENVKAN
FT                   INLSGISDIKDGDSDVNVVGMVLDVSDVRTFQKRDGSQGRVRNITIGDETGKIRITLWD
FT                   GRTELADKLENGDSVEIINGYARLNNYSQEVEIQVGNHSSLRKTDREVEFEEDYTPIAD
FT                   IIPGQPYSIKGAVSGMGDLKEFTRSNGSEGKVSNIYVSDETGRIRIALWDEKAELVDKV
FT                   DIDTPIKIIDAFAKSGFNEEVELNAGGRSKVVVD"
FT   gene            22983..23606
FT                   /locus_tag="Mmah_0023"
FT   CDS_pept        22983..23606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0023"
FT                   /product="phosphotransferase KptA/Tpt1"
FT                   /note="COGs: COG1859 RNA:NAD 2'-phosphotransferase;
FT                   InterPro IPR002745; KEGG: rlt:Rleg2_1928 phosphotransferase
FT                   KptA/Tpt1; PFAM: phosphotransferase KptA/Tpt1; SPTR: Q12V71
FT                   Phosphotransferase KptA/Tpt1; PFAM: RNA
FT                   2'-phosphotransferase, Tpt1 / KptA family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35561"
FT                   /db_xref="GOA:D5E8Q2"
FT                   /db_xref="InterPro:IPR002745"
FT                   /db_xref="InterPro:IPR022928"
FT                   /db_xref="InterPro:IPR042080"
FT                   /db_xref="InterPro:IPR042081"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8Q2"
FT                   /protein_id="ADE35561.1"
FT                   /translation="MIRKCEEHGYFRGEECLKCGERGKFMLDDEHEMRLGRFVSGVLRH
FT                   FPDDVGLDMDAQGWIELDAFCEAMKKRYKWAGKMRLVSLVESDPKQRYEIDNSFIRARY
FT                   GHSIDVDLDYPLYDSDVLYYGVSQEEVDMLLENGIKPYRQTYIHLSNSSQRARQAASVH
FT                   TDNPVILEIDAASAAKDGYEFLCANEEIVLSKEILPEYIEIADD"
FT   gene            24183..25502
FT                   /locus_tag="Mmah_0024"
FT   CDS_pept        24183..25502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0024"
FT                   /product="DNA primase"
FT                   /EC_number="2.7.7.-"
FT                   /note="COGs: COG0358 DNA primase; InterPro
FT                   IPR006171:IPR006154; KEGG: spe:Spro_4299 DNA primase; PFAM:
FT                   TOPRIM domain protein; SMART: Toprim sub domain protein;
FT                   SPTR: Q12V67 UPF0095 protein Mbur_1769; PFAM: Toprim
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35562"
FT                   /db_xref="GOA:D5E8Q3"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR020607"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8Q3"
FT                   /protein_id="ADE35562.1"
FT                   /translation="MQSTDTTKYIIHSKINADGVIERPDIVGAIFGQTEGLLGSDLDLR
FT                   DLQKTGRIGRIEVIVSTKGGKTKGNIHIPSSLDRIETSILAASLETIDRVGPCSANIEV
FT                   SNIEDVRATKRKHIVERAKFILTGMFDANLPESQEIADEVRQSVRVEEMQFFGKNKNIP
FT                   CGPNVLDSDAIVVVEGRADVLNLLRYGIKNAICVGGTNVPPEVAELTRKKTVTAFTDGD
FT                   RGGKLIIKELLQVADIDYVARAPDGKTVEDLVQREIIRALRQKVPVEQAMEAYSIDKPA
FT                   EKTTTPSSSGPKKGGRIARVPKREKRVKPDRARNPAAKMKKIAEPPIKKEKPKPSSTKP
FT                   ATSQHPVLKRLSSHSESLAGTLGARLLDQDDKVVNETPVRDLVNTLKNSEDNVKSVVFD
FT                   GVVTQRILDIASNKGIDTLIGVKKGNITKSPANVKVYTSA"
FT   gene            25560..26024
FT                   /locus_tag="Mmah_0025"
FT   CDS_pept        25560..26024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0025"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q12VJ5 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35563"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8Q4"
FT                   /protein_id="ADE35563.1"
FT                   /translation="MQRRGLLFLLLILILFSSGCSDIGDTVKDVNETVTQSKEDVEYLK
FT                   WMKASIDIIHSDYVDIKQALEDRDVATLEKAAGNLTSHCSKAKGTMQSFNPSPSLQPVT
FT                   DRYSQILNQSCSLGTFLEENAATLNFTNETTLQKVEKNMGLVNNSLILNN"
FT   sig_peptide     25560..25622
FT                   /locus_tag="Mmah_0025"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(26335..27402)
FT                   /locus_tag="Mmah_0026"
FT   CDS_pept        complement(26335..27402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0026"
FT                   /product="IMP biosynthesis enzyme PurP domain protein"
FT                   /note="COGs: COG1759 ATP-utilizing protein of ATP-grasp
FT                   superfamily (probably carboligase); InterPro
FT                   IPR010672:IPR009720:IPR011761; PFAM: IMP biosynthesis
FT                   enzyme PurP domain protein; IMP biosynthesis enzyme PurP;
FT                   SPTR: Q12VJ6 5-formaminoimidazole-4-carboxamide-1-(beta)-D-
FT                   ribofuranosyl 5'-monophosphate synthetase; PFAM: Domain of
FT                   unknown function (DUF1297); Protein of unknown function
FT                   (DUF1246)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35564"
FT                   /db_xref="GOA:D5E8Q5"
FT                   /db_xref="InterPro:IPR009720"
FT                   /db_xref="InterPro:IPR010672"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR023656"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8Q5"
FT                   /protein_id="ADE35564.1"
FT                   /translation="MITKKQISDILKDYNADDLAIATVCSHSSLQIFHGARKEGLKTIG
FT                   ICIGEPPRFYNAYPLAKPDEFISVDSYKDIPNIAPLLRQKNAIIIPHGSFVEYMGADKF
FT                   LDLEVPTFGNRAVLNWESDRTKEREWLEGAGIHMPRLVEPEDIHGPVMVKYHGAKGGRG
FT                   FFIAKNYEEFLENIDESEKYTVQEFIVGTRYYLHYFYSPLKQEGYRLSNGTLEMLSMDR
FT                   RVESNADEIFRLGSPKELEESNVQPTYVVTGNIPLVARESLMPKIFSLGEQVVEESLKL
FT                   FGGMIGSFCLETVFTDQLEIKVFEISARIVAGTNIYTNGSPYSDFIEEGLSTGKRISQE
FT                   VKLAAEQEKLEVILS"
FT   gene            27521..28213
FT                   /locus_tag="Mmah_0027"
FT   CDS_pept        27521..28213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0027"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="InterPro IPR001845; PFAM: regulatory protein ArsR;
FT                   SPTR: Q12WV3 Transcriptional regulator, ArsR family; PFAM:
FT                   Bacterial regulatory protein, arsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35565"
FT                   /db_xref="GOA:D5E8Q6"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8Q6"
FT                   /protein_id="ADE35565.1"
FT                   /translation="MENDDNTEKVLVLPLNEDSRKITQTLSNEKSLKILELLAKQPMSA
FT                   TSIAEELDMPLTTIKYNLDGLLECELIQVKETKWSRKGREIKIYEPMQKMIVVIPGSNK
FT                   TDRSSILGMLRKYVAMAGAALFAALGIEYLRNFEPLGQTMPPATPAVMSEMPDSNASND
FT                   TTLFAAEAPANATTEAARAAGESAGAGEASSLIPADFLSHIGVWFFFGCLFIIAVLALW
FT                   EIYNRKKV"
FT   gene            28234..29055
FT                   /locus_tag="Mmah_0028"
FT   CDS_pept        28234..29055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0028"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /note="COGs: COG0101 Pseudouridylate synthase; InterPro
FT                   IPR020097:IPR001406; KEGG: pap:PSPA7_2019 tRNA
FT                   pseudouridine synthase A; PFAM: Pseudouridine synthase I,
FT                   TruA, alpha/beta domain; PRIAM: tRNA-pseudouridine synthase
FT                   I; SPTR: Q12VJ7 tRNA pseudouridine synthase A; TIGRFAM:
FT                   tRNA pseudouridine synthase A; PFAM: tRNA pseudouridine
FT                   synthase; TIGRFAM: pseudouridylate synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35566"
FT                   /db_xref="GOA:D5E8Q7"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8Q7"
FT                   /protein_id="ADE35566.1"
FT                   /translation="MRVALKIAYIGSSYRGSQVQPGVSTIEGKIFEALQSLEIIEDPSS
FT                   ARFVSSGRTDTGVHAMGQVVAFDTDKPKLAIPRVINSKLPGDIWAWSRAEVDSDFHPRR
FT                   YAINRTYRYITPSMDADISKLRAACSILEGSHDFANFCFRDTGRSTIRRIEKIDVRLAG
FT                   NLLRIDITANSFLWKMIRKIVTVLLLVGSGARDLDWLENMLDPASYEEGIKPAKPYGLI
FT                   LTNVNYGDSVQWVDDGYSMRRSRERIEEYLVYHQVLAEVMDQFLPKEPKAE"
FT   gene            29055..29612
FT                   /locus_tag="Mmah_0029"
FT   CDS_pept        29055..29612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0029"
FT                   /product="protein of unknown function DUF45"
FT                   /note="COGs: COG1451 metal-dependent hydrolase; InterPro
FT                   IPR002725:IPR006025; KEGG: sun:SUN_2463 hypothetical
FT                   protein; PFAM: protein of unknown function DUF45; SPTR:
FT                   Q12VJ8 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function DUF45"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35567"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8Q8"
FT                   /protein_id="ADE35567.1"
FT                   /translation="MQLRIRDAVIDYDIVHRPVKYARLEFKDGMLRVIVPKGYGNAAAF
FT                   IEKNTDWIYDKHLHLQRVIALAGEKRLEKKLAEPHFHSLVESIVQRLQRELEVEVRDLT
FT                   FRKMKRKWASCSSNKKLVFNRHMIYLPDNLIEYIVYHELLHLIEFKHNKRFWGLVENKY
FT                   PQRQKYDLELAAYWHLIKKTFY"
FT   gene            complement(29606..30643)
FT                   /locus_tag="Mmah_0030"
FT   CDS_pept        complement(29606..30643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0030"
FT                   /product="N2-methylguanosine tRNA methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="COGs: COG1041 DNA modification methylase; InterPro
FT                   IPR013216:IPR000241:IPR004114:IPR002052; KEGG: bja:bll7234
FT                   hypothetical protein; PFAM: putative RNA methylase;
FT                   Methyltransferase type 11; SPTR: Q12VJ9 Putative RNA
FT                   methylase; PFAM: Putative RNA methylase family UPF0020;
FT                   THUMP domain; TIGRFAM: conserved hypothetical protein
FT                   TIGR01177"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35568"
FT                   /db_xref="GOA:D5E8Q9"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8Q9"
FT                   /protein_id="ADE35568.1"
FT                   /translation="MRYAFELSGDHEAIAADEALACLATEGLKPLYTQHYDHCLVVELE
FT                   EPDAESRLEKIAGKLAMCHHILRVAFICNNEPETIISSAENCDIKPHISAGQTFVVRAR
FT                   KVNHHTSVEGAYLEQRVGGTVFRKGYRANLNQPDVTLRLILTEKCVCGSVIASIDRKAF
FT                   HARAPHKKPFFYPGVLMPITARALVNLAGVNKDTRLLDTFCGTAGILVEAAMLGSRVIG
FT                   LEARNEIIQGAKLNLEYFGGDYNLLQGDACKLPLKKGCIDSVITDPPYGRSAMIKAESI
FT                   RHLYEESFGEMYRVLKPGSKAVIVSEMEINKIALDAGFTILKQYSQRIHRSLTRNITIL
FT                   QKNNQ"
FT   gene            complement(30645..30932)
FT                   /locus_tag="Mmah_0031"
FT   CDS_pept        complement(30645..30932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0031"
FT                   /product="Domain of unknown function DUF1805"
FT                   /note="COGs: COG3377 conserved hypothetical protein;
FT                   InterPro IPR014931; KEGG: ajs:Ajs_4190 hypothetical
FT                   protein; PFAM: Domain of unknown function DUF1805; SPTR:
FT                   Q8PWS9 Conserved protein; PFAM: Domain of unknown function
FT                   (DUF1805)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35569"
FT                   /db_xref="InterPro:IPR014931"
FT                   /db_xref="InterPro:IPR036493"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8R0"
FT                   /protein_id="ADE35569.1"
FT                   /translation="MIIEQIKMENGTAQGLKWELENASLLMIKADMGYVMCGYLNMETA
FT                   DKLGDIAAVVSGVDSFEDVLQASLKSVSMKALDIGIEEGMTGRQALEKMF"
FT   gene            31293..32801
FT                   /locus_tag="Mmah_0032"
FT   CDS_pept        31293..32801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0032"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gem:GM21_2435 cycloartenol synthase-like
FT                   protein; SPTR: Q6LZX2 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35570"
FT                   /db_xref="GOA:D5E8R1"
FT                   /db_xref="InterPro:IPR001330"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8R1"
FT                   /protein_id="ADE35570.1"
FT                   /translation="MLLALLVSIPSGMAATEEEINDSITAGVAWLAEQQNPDGSWGIDE
FT                   KVAHTGFAVLKLTDRAKELGYESPFDPEYEYSDNVTDGVAYMESQMQIVDITGDPADKN
FT                   GNNESIKFSSSWGMHQSYNTAIALMAFANLHNSTYEEKVQDMTDWFIFTQNPDGGWRYT
FT                   GVQEPSDNSNTGYVVLGLAYAEDAGADVGDVRVGLNDWINTIQDPVNGDADDGGSWYTA
FT                   SWQWVNSLKTGNLIFEMGFVGDDTDSQRMQDAVDYLERHWNDVGTGSIDDVGWKPNHYQ
FT                   AMYAIMKGLEYNGIETLEVDGSEVGWFDNFSDVIVDTQNPDGSWPSDPWDYGSKPILST
FT                   EWALLTLEKTTPIRVIDVSLDVKPSSCPNPINVDSKGIIPIAIAGSEDFDVTQIDPATV
FT                   EIGIMDEDGNLIGVSPLRWSYEDVTCPYFPADDDPCCIENQPDGITDLTMKFKTQELVG
FT                   TAGLENYAGQTLNLTVTGMTVDDLPIMGQDCVRIQKAIKKGNNK"
FT   sig_peptide     31293..31334
FT                   /locus_tag="Mmah_0032"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(32854..33465)
FT                   /locus_tag="Mmah_0033"
FT   CDS_pept        complement(32854..33465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0033"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q12VK1 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35571"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8R2"
FT                   /protein_id="ADE35571.1"
FT                   /translation="MRKLVVAIHILLVLFILIMPASGQMTWSNHIILKNDIMEWNYNET
FT                   YRNSSAILYRDYIDSQLGDDSGLVNAWEVLKMDVKVRNYLKGELEEEMDVQINGSSENI
FT                   QVTDIAAQLDFETLGDINKTDRIENRYSVHYIFDTPVLDSGTNFTFMGQNHSEVVIEIP
FT                   ETVNINSTAGMENVTVSEGENTTFVRGSIGNTSYFSLYIE"
FT   sig_peptide     complement(33397..33465)
FT                   /locus_tag="Mmah_0033"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(33476..34366)
FT                   /locus_tag="Mmah_0034"
FT   CDS_pept        complement(33476..34366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0034"
FT                   /product="methionine aminopeptidase, type II"
FT                   /EC_number="3.4.11.18"
FT                   /note="COGs: COG0024 Methionine aminopeptidase; InterPro
FT                   IPR001714:IPR000994:IPR018349:IPR002468; KEGG: methionine
FT                   aminopeptidase (EC:3.4.11.18); K01265 methionyl
FT                   aminopeptidase; PFAM: peptidase M24; PRIAM: Methionyl
FT                   aminopeptidase; SPTR: Q12VK2 Methionine aminopeptidase;
FT                   TIGRFAM: methionine aminopeptidase, type II; PFAM:
FT                   Metallopeptidase family M24; TIGRFAM: methionine
FT                   aminopeptidase, type II"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35572"
FT                   /db_xref="GOA:D5E8R3"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002468"
FT                   /db_xref="InterPro:IPR018349"
FT                   /db_xref="InterPro:IPR028595"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8R3"
FT                   /protein_id="ADE35572.1"
FT                   /translation="MQDKFQEVEDILDKYLTAGKILSQVRGEAADKIRVGAKLLDVAEF
FT                   VEQRTMELGGKPAFPCNLSRNDEAAHATPTAGDTTVFGKDIVKLDMGVHVDGYIADAAL
FT                   TVDLSGNKDLVDASRQALEAAIDTVKGGVNTAEIGAVIEDTIRDKGFKPVANLTGHGLA
FT                   RYQAHTPPSIPNRHIGEGMELQAGDIIAIEPFATDGAGKISDGSFTEIYQFIQKKPIRM
FT                   PAARKLLKELKEYSTLPFAKRWLTSPKIDLALMQLEKAEIITSFPVLKEVGGGMVSQAE
FT                   HTLIVTEDGCEITTR"
FT   gene            complement(34400..35572)
FT                   /locus_tag="Mmah_0035"
FT   CDS_pept        complement(34400..35572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0035"
FT                   /product="peptidase M24"
FT                   /note="COGs: COG0006 Xaa-Pro aminopeptidase; InterPro
FT                   IPR000994:IPR001131; KEGG: Xaa-Pro dipeptidase; PFAM:
FT                   peptidase M24; SPTR: Q12VK3 Peptidase M24; PFAM:
FT                   Metallopeptidase family M24"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35573"
FT                   /db_xref="GOA:D5E8R4"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8R4"
FT                   /protein_id="ADE35573.1"
FT                   /translation="MKQTNNFPDVTAALAKNRCEAYLIVADSSNADMYFATKFLAGDPF
FT                   CYIQTRNARDMMLISDMEKSRAQKESRIEEIVPLRFCDYKKRLKETADPGRAYGECIGQ
FT                   LLQNEGVRHVAVPRDFPVYTAQVLKEMGFTVNPIQSPLRKLREVKEKGEVNLIRQVQQA
FT                   NEEAMQAAIAAIKTAEIDDNKLFLDGQPLTASRVRRIIEHCLLDHDCRAHGTIVACGKG
FT                   AADPHWHGEGPLLANEPIVIDIFPQHKLHHYCGDMTRTVTRGETTEQLQQMYDAVLAAQ
FT                   ETALGMLKPGVAANDVHQAVCDVFEEKGYSTDAEKGEGYIHSTGHGVGLEVHEAPSIGL
FT                   REIPLQPGNIVTIEPGLYYPQIGGIRLEDLVLITEHSYENLNTFEKEFVL"
FT   gene            35746..41247
FT                   /locus_tag="Mmah_0036"
FT   CDS_pept        35746..41247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0036"
FT                   /product="periplasmic copper-binding protein"
FT                   /note="COGs: COG3420 Nitrous oxidase accessory protein;
FT                   InterPro IPR007742:IPR006626:IPR006633; KEGG: GK15899 gene
FT                   product from transcript GK15899-RA; PFAM: periplasmic
FT                   copper-binding; SMART: Carbohydrate-binding and sugar
FT                   hydrolysis; Parallel beta-helix repeat; SPTR: Q648U6 Cell
FT                   surface protein; PFAM: Periplasmic copper-binding protein
FT                   (NosD); TIGRFAM: conserved repeat domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35574"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR006633"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR022441"
FT                   /db_xref="InterPro:IPR026453"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8R5"
FT                   /protein_id="ADE35574.1"
FT                   /translation="MKNNSKLSNKKQAVKLPILIISIVTILMALSGIVTALPDYGTDTY
FT                   PGNYTPDNQQVLLINNNSDVIAGLWEGNNTGVYYYNTSSTSWEKESGASDKTKAIQRAI
FT                   DKSTIDNQTIIVGDGTYNGTLNINNDNVKEVIGYENKPTIDAEVGGTPITIDVDDVIVK
FT                   ELNITKSGGKEAGIKINSDNVTITNNTITKNGQVGVYLYSSSNNTISSNEITNNKYYGI
FT                   YLYSSSVNSIYLNNFLNHYQAHVYTGRYSSWGSSNLMNYTYDGEEYTNKLGNYYDDFTD
FT                   SDADDDGVWDNTKGNDKYPLVDKAGHYSNLTPIEEIVEVDGVIGTKYEENPPGNQEVYL
FT                   VNTTGHITGAWEGNIDTAEVIQRANDEATSDNHIIIVGNGTYKGNLDINNPDVRKVIGY
FT                   ENKPTIDAENSGSPITINANDITVKELNITGSGSRDNAGIKINLDNATITNNTINNNRN
FT                   GIYLYSSNNTVTTNEITTNNKYGVYLSSSNNNTVTSNNIINNNLEYGEAGIYLTQSSDN
FT                   TFISNNVTDNYRGIYLEQGNNNVFTDNNITDNIGDYVYRSKNFHGVHLVGSSDNSFTGN
FT                   NIKNITGYSETPNGVYFGESSDNNTFAGNEITNCATNGILLSGIDNTITNNKITNNKNG
FT                   IHISGTGSEANNNSITNNEITNNTKKGISFYLADDNTVANNNITTNENGIEIVESSSYN
FT                   TVANNNITSNDNGIYLYGSSDNSIYLNNFIDNGNHIYFDVDVNPDYDSDNSWVSPELTY
FT                   IYNEGTNTSRLGNYWDDYKGNDEDGDGIGETTYTIQEDAGNDTRPLVNTTNQYSIPKTY
FT                   SVSLGTVSESESVGVNENASYTLTVKNTGNLDDSYNLVISSPRADAFLDKSSLNLAPGE
FT                   SKSVNLNVSSDSGGNFDVDVSAISTNTGQKEIVTTTTKVEQYGLTMSADSTSSTIKPGN
FT                   ETNYSLTVKNTGNREDTYNLEVTAPSLSPGLTTGSLTIAPGNTQLFNVTLSNSTTGSYT
FT                   ATVNASSTNDTDEWTEKTLELNVEKGDNPDVSLSLNPTTKRVERNGEAAYTIKVKNTGN
FT                   VEDTYSLINGSDASSSLGTSNMNLGPGESSSTILTVSNTSEIKTYATDITVESDNFDVS
FT                   SSGTVYTKAVKSVDIIASPGSQTTTPGNNSTYTISILNTGIQTHNYTVSIPSKTSNTDS
FT                   TLSKSTINVLETGQTAEIKLSLNNTKSLAGGESRGIEAAITASVTESPDKSDTTTVSSL
FT                   YTEEEVYGVSISSDVVEQAVKPGNNATYLLTIQNLGNSDETINLSKSVQKGNLEKSSVY
FT                   LSSSGDLGGEKVVKFNQPSSEAGEVVITANSSGITDSLILNTRVAEIDQEYVVNSDVDD
FT                   ASTVTNSEVESSTIVNSEVINDSVVNSSRVIDSSINNTKVIDSDLSNVMIKNGVVENNL
FT                   IKKGVVTVDGTEYELTEEDEAVTAEELVSSQEFDSNIVGFSGEITQITSQNSNVTLNMT
FT                   SDENYVGGSMKLQRSSTPPTDVDAENTKTSQYVRIKPTVNVEESTKYYVIKLSYTDEWL
FT                   KQENIIEDTVSIYRYDENTGEWVKLVEEGDPSFCNGVERNLENNYVKANVTKFSTYEIN
FT                   GQRMNDREDGDRVEEVSGTDDDSVRVSVGESMPAESVRSTNSKQKVVSAGESVEYNFSE
FT                   SSGPVKGISFESKENMGRVIAKVQTLDKLPDDVKSPTETGDSDSTESGEKDQTASKTYS
FT                   TMSITVGKSGTVSESNSDNTLIEFDVTKEWVEDNNIDPETIRMERYHNGEWHDLPTNKV
FT                   AEDDNLLHFTAFTPGFSIFAVVGDEIDTGIEEQETENDPEVDETVEPEPETESTPGFTS
FT                   LLILGVIGTAYMVLRRKN"
FT   sig_peptide     35746..35853
FT                   /locus_tag="Mmah_0036"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            41475..41610
FT                   /pseudo
FT                   /locus_tag="Mmah_0037"
FT   gene            complement(41681..41824)
FT                   /locus_tag="Mmah_0038"
FT   CDS_pept        complement(41681..41824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35575"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8R6"
FT                   /protein_id="ADE35575.1"
FT                   /translation="MIEKVVLYKQGKNIDPAIVFSAILDNNGKVRRNRMYRLYSGHGYN
FT                   RG"
FT   gene            complement(42076..42387)
FT                   /locus_tag="Mmah_0039"
FT   CDS_pept        complement(42076..42387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0039"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nis:NIS_0088 hypothetical protein; SPTR:
FT                   A9A735 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35576"
FT                   /db_xref="GOA:D5E8R7"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8R7"
FT                   /protein_id="ADE35576.1"
FT                   /translation="MNHIVKSAKKTLNALNQSLPVVVGVIMAISLLKAAVPESLYSTIF
FT                   TGNILIDPFIGSLIGSIAAGNPITSYIIGGELIKQGVSLFAVTAFLLSWVTVGIMGEL"
FT   sig_peptide     complement(42286..42387)
FT                   /locus_tag="Mmah_0039"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            42516..43451
FT                   /locus_tag="Mmah_0040"
FT   CDS_pept        42516..43451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0040"
FT                   /product="SCP-like extracellular"
FT                   /note="COGs: COG2340 Uncharacterized protein with SCP/PR1
FT                   domains; InterPro IPR014044; KEGG: eba:ebA7184 hypothetical
FT                   protein; PFAM: SCP-like extracellular; SPTR: A1HPV1
FT                   Allergen V5/Tpx-1 family protein; PFAM: Cysteine-rich
FT                   secretory protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35577"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8R8"
FT                   /protein_id="ADE35577.1"
FT                   /translation="MEKLKFLLILFLAIAFLIFPAGAENLYSAEEKQMLDLINEERAEQ
FT                   GVSPLQFNSLLNEVSSEHSRDMIENNYFAHDSYDGTSYWQRLQDFNYQSSTTAENIAMN
FT                   VPFDLQKAHANLMASPGHRTNILNPDYNEIGIGIWVGDYTCNGVTYSNAAMFTQDFGWN
FT                   TSADEKDLLSIESYSPQDNFSSDPESTQEFAVTTNRPCNIRWLMDGGEVREINNEMTSS
FT                   YTTSKPSTGTYEVKVIVDDGVSTDIREWSWTVVEDDIDSSYHAYDFNQNCLMDTSEVSK
FT                   AIDDYYAGKLDVAEISQIIDYWYLGSDGYC"
FT   sig_peptide     42516..42584
FT                   /locus_tag="Mmah_0040"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(43601..44392)
FT                   /locus_tag="Mmah_0041"
FT   CDS_pept        complement(43601..44392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0041"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR010916; SPTR: Q8PXM7 Conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35578"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8R9"
FT                   /protein_id="ADE35578.1"
FT                   /translation="MNTIKSKGKSHRSGARVFTTILYALLMIAVAIPLSSAAVTELSVY
FT                   PDYPVVGEDIKINGTAQPDEVLDITVSFNQTVNVSDGTYKYRIDDVEIPDGSNTFQVRG
FT                   EKVKDLNVRVKILFWITKSADADSGVATVSQSNVPSGTYDIIIDGHAEDGESTVNLTIN
FT                   ASSSIKADTEGYFEDNYTTNSIPPGIFELSAGKINETITLYEEPVVIQPEYDVYDANQN
FT                   CIIEMGELSAGIDDFFTGHLSINKLSQLIGYFLSGDTYCQN"
FT   sig_peptide     complement(44279..44392)
FT                   /locus_tag="Mmah_0041"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(44373..45653)
FT                   /locus_tag="Mmah_0042"
FT   CDS_pept        complement(44373..45653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0042"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q12UI7 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35579"
FT                   /db_xref="InterPro:IPR026595"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8S0"
FT                   /protein_id="ADE35579.1"
FT                   /translation="MKSKGLKSLCYIFIVTLLLIGLGSIAVADSYEVNVTINDASIGFA
FT                   NHTSSETEGNWIAVKGGEEFQLPHPISFTYKGINATDFNYGSAPINITMDADDDYTVTY
FT                   PFANHSMFTDIHGQNDVSLEFYGSDMFAYDDVELYIINVNRGVISDINQNLKEANLASI
FT                   HDLTENAYKKYPNEQLDGNGDLEITCNGLEAGDYMALMLLNTSQMQDYDAFILSATGFE
FT                   VLEYDSVITASSAVDLNENINVDISMLNAANDTSYTYGAVLVKDSVYKADIEMECNGSK
FT                   DSTNLTVNEIPLIQGYDLLGIDSSNIERNDVQNKIMELIGPDNGTIIMKTVEANQTSLS
FT                   ITTTDLPEDKYILLTGVYKAGEGLVAFGQQDVFIAPYNPYDFNENYTIEIEELSACIDD
FT                   FFVGDMSIVEISKFVTYYLSGDEYYQI"
FT   sig_peptide     complement(45570..45653)
FT                   /locus_tag="Mmah_0042"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            46126..47712
FT                   /locus_tag="Mmah_0043"
FT   CDS_pept        46126..47712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0043"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="COGs: COG0747 ABC-type dipeptide transport system
FT                   periplasmic component; InterPro IPR000914; KEGG:
FT                   pca:Pcar_1870 dipeptide transport protein; PFAM:
FT                   extracellular solute-binding protein family 5; SPTR: Q8TIA8
FT                   Dipeptide ABC transporter, solute-binding protein; PFAM:
FT                   Bacterial extracellular solute-binding proteins, family 5
FT                   Middle"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35580"
FT                   /db_xref="GOA:D5E8S1"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8S1"
FT                   /protein_id="ADE35580.1"
FT                   /translation="MMNLRKSSTYLIILLCTISILIAGCADQQQNEDNNINENDTQAKI
FT                   VEIAQTFGPSDSLDPSSRWVGWYVREAGLYETLFSYDENMEMIPELATGYEAINDTAWQ
FT                   IILRENVTFHDGTPMTSEAVVYSINRVRDPDNTRSSQYDFIENIEALDDYTVLITTEKP
FT                   YAPAIASLTDPIVSIVNPEATDLAVSPSGTGPYAFESFEPGIELVVKKNNNYWSGKPQL
FT                   DAAVFNYVSDPVTRSLKLEGGDVQIADGIPPAEVARLDAKDDIKIHNEETMRTGFMYVN
FT                   TRKAPLDDIHVRQAINHAINREQVIDAALEGVGGSPAVGVFPSLFSWSANEQLDPYEHN
FT                   PEKALEMFRQAGIEDVDGDGTLDYGGEAFSLNIKTYASRPEMKPAAEAMAAQFQEIGIE
FT                   SEAIILESGALSADMSDGNYDLGLYAWGVAPTGDPDYFLSQHFASDSKYAGWTGYSNED
FT                   VDEWLKMGRTTMDNDKRLEYYNNVQREVFEECPEIFVFYYRKTVGTSDEVQGFTIYPNE
FT                   ITFLTEDVRLE"
FT   sig_peptide     46126..46209
FT                   /locus_tag="Mmah_0043"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            47723..48499
FT                   /locus_tag="Mmah_0044"
FT   CDS_pept        47723..48499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0044"
FT                   /product="Methyltransferase type 11"
FT                   /note="COGs: COG2226 Methylase involved in
FT                   ubiquinone/menaquinone biosynthesis; InterPro
FT                   IPR013216:IPR004033:IPR013217; KEGG: sme:SM_b20059
FT                   SAM-dependent methyltransferase; PFAM: Methyltransferase
FT                   type 11; UbiE/COQ5 methyltransferase; Methyltransferase
FT                   type 12; SPTR: Q8TIA7 Phosphatidylethanolamine
FT                   N-methyltransferase; PFAM: Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35581"
FT                   /db_xref="GOA:D5E8S2"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8S2"
FT                   /protein_id="ADE35581.1"
FT                   /translation="MTVKQQIEEYWDWRSTSYTNGATSLGEEERELWKQSLFPYLGQGP
FT                   LKVLDIGTGRGFLALLLADMGHEVTAIDISQSMLEKAQREAIKLNLDIKFEKGDAENLA
FT                   FADSSFDVVVSKYLLWTLPEPENTLKEWRRVLLPEGKIIAIDGNWFDPSPVKKFKRRIR
FT                   KILQGITHRDPTTGVLRQGKFNQYYSPLHASLPLYSNVKPESIRPLFEKAGFEDMQIDS
FT                   LPLIHKYNLKNMHPLLRPLNTDTFFLISGTSSKQDK"
FT   gene            48502..49452
FT                   /locus_tag="Mmah_0045"
FT   CDS_pept        48502..49452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0045"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG0601 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems permease components; InterPro IPR000515;
FT                   KEGG: efe:EFER_0972 putative peptide transporter permease
FT                   subunit: membrane component of ABC superfamily; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: Q8TIA5 Oligopeptide ABC transporter,
FT                   permease protein; PFAM: Binding-protein-dependent transport
FT                   system inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35582"
FT                   /db_xref="GOA:D5E8S3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8S3"
FT                   /protein_id="ADE35582.1"
FT                   /translation="MFAYVMRRVIFLIPTLLLVSIISFSIIHIAPGDPAELLLTGPDGV
FT                   ADPQVVEEFREKMGFDQPFHIQYGTWLMQILSGNLGYSYMTDQPVGKAILHKFGATFKL
FT                   ALVSMIFTLLIAIPGGIIAALAKDTWKDDLSRFFSLFGVSIPNFWQGYLMILVFALFLD
FT                   ILPVGGYGDGGDFTHMILPAFTLGTSSAAVLMRLMRSSLLDVLDHDYILAARARGLPEY
FT                   IVIGKHALKNAFIPVITMMGLSFGYLLNGSVIIETVFAWPGIGSLMVNSIYDRDYPMIQ
FT                   GTLLFVAGIFVLINLLVDISYAYLDPRLRYDKGNI"
FT   gene            49433..50266
FT                   /locus_tag="Mmah_0046"
FT   CDS_pept        49433..50266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0046"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG1173 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems permease components; InterPro IPR000515;
FT                   KEGG: dde:Dde_2594 oligopeptide ABC transporter, permease
FT                   protein; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: Q8TIA4 Oligopeptide ABC
FT                   transporter, permease protein; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35583"
FT                   /db_xref="GOA:D5E8S4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8S4"
FT                   /protein_id="ADE35583.1"
FT                   /translation="MIKGIFNRSMLIGLILIGAVVFLALAAPWLAPQDPQKTNFDQRLL
FT                   SPSSEYPFGTDHLGRCILSRVLFAARISLFIGASVIAISFIAGTLIGSVSAYAGGIVDE
FT                   TVMRFVDGFLAFPSMFIALAIAGIFGGNMTGLIIALSIVEWTAYARVSRGSVLTVKNVD
FT                   YIAVSRMMGGRAPYILRHHILPNITSPLLVISTLGMGNVILAAAGLSFLGLGVSSAPEW
FT                   GMMVNEGRLFLQSAPHVMFFPGIFIVITVLGFNFLGDGLRDIFDPRDTKQRWRLF"
FT   sig_peptide     49433..49510
FT                   /locus_tag="Mmah_0046"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            50267..51187
FT                   /locus_tag="Mmah_0047"
FT   CDS_pept        50267..51187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0047"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="COGs: COG0444 ABC-type dipeptide/oligopeptide/nickel
FT                   transport system ATPase component;
FT                   InterProIPR013563:IPR003439:IPR003593:IPR017871:IPR 010066;
FT                   KEGG: dde:Dde_1182 oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein-like; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; SPTR: Q8TIA3 Oligopeptide ABC
FT                   transporter, ATP-binding protein; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter; Oligopeptide/dipeptide transporter,
FT                   C-terminal region; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATP-binding protein, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35584"
FT                   /db_xref="GOA:D5E8S5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8S5"
FT                   /protein_id="ADE35584.1"
FT                   /translation="MLSIRDLKVAFESHQGPIVPVDSVDMDILDKETFTIIGESGCGKS
FT                   LLANSLLGLLPRDAQVCGKVYMDGEEILSLKEKEWRKIRGNKIGLVFQNPSASLNPVFT
FT                   MHKQLYETLKYSNKPSSRDKMVSLLKKTGIKNPLRRLPQYPHQLSGGMKQRFAIALGIA
FT                   TNPELLIADEPTNGLDVTVKLKIVEMLSKLHAERSILLITHDLNVAYNLSDKIAVMYAG
FT                   ELLEIAPAKSFFEKPIHPYSSQLLASHPEKEMIPIPGFTPQLTQRPQGCRFHPRCALAC
FT                   RKCKTEHPQLEKIDEKRYVRCFACA"
FT   gene            51180..51971
FT                   /locus_tag="Mmah_0048"
FT   CDS_pept        51180..51971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0048"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1123 ATPase components of various ABC-type
FT                   transport systems contain duplicated ATPase; InterPro
FT                   IPR003439:IPR003593; KEGG: pin:Ping_0561 ABC transporter
FT                   for peptide ATP-binding protein; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase; SPTR: Q8TIA2 Oligopeptide ABC
FT                   transporter, ATP-binding protein; PFAM: ABC transporter;
FT                   Oligopeptide/dipeptide transporter, C-terminal region"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35585"
FT                   /db_xref="GOA:D5E8S6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8S6"
FT                   /protein_id="ADE35585.1"
FT                   /translation="MLEVKALDKSYSFSTIPFRKKRIKVLDNISFRINKHETLCIVGES
FT                   GCGKTTLAKCIVNLENPDNGKIILEGRDVTFPDRKTLYYLHTKVQMIFQNADTSLNPRH
FT                   HIYDSMAEPLRLQGQNEEKVRKRVFQLLDHVGLSEEHLHRHPHQLSGGQNQRIAIARAI
FT                   ALHPDLLIADEITAALDVSVQAQILQLLKTLKKEMDMTLLFISHDLALVKRIADRVAVM
FT                   QDGRLVEINDTNEIFHNPQCPYTKELISSMSQLSLDKQILK"
FT   gene            52012..52704
FT                   /locus_tag="Mmah_0049"
FT   CDS_pept        52012..52704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0049"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="COGs: COG1600 Uncharacterized Fe-S protein; InterPro
FT                   IPR001450:IPR017900; KEGG: dal:Dalk_1124 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; PFAM: 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; SPTR: Q8TIA6 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35586"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8S7"
FT                   /protein_id="ADE35586.1"
FT                   /translation="MQTIESIIRNLLSENVSIWGIANMENTPSHPYPELKRAIVFGLAL
FT                   NREVIRNLDSGPHQAYIDECNMANEKLTSIGMELEKKLQQMDYRAISMTASTSDINEKK
FT                   LEAEFPHKTTATKSGLGWVGKCDLLVTKEFGSALRLNTVFTDAHLKAGNPMEKSLCGTC
FT                   SNCIDNCPVNAPTGKQWDPSVHRDEIIDIQRCYGECQRASKKINFDHPLCGRCIIACPW
FT                   TQKYVCEV"
FT   gene            52995..54719
FT                   /locus_tag="Mmah_0050"
FT   CDS_pept        52995..54719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0050"
FT                   /product="Cna B domain protein"
FT                   /note="InterPro IPR008454; KEGG: gme:Gmet_2043 hypothetical
FT                   protein; PFAM: Cna B domain protein; SPTR: Q2Y4X4 Putative
FT                   uncharacterized protein C5_0029"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35587"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR026428"
FT                   /db_xref="InterPro:IPR033764"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8S8"
FT                   /protein_id="ADE35587.1"
FT                   /translation="MKSKIKLIVLVAIIFAIISIATAENAEAEECCPVDIPSAIITIEA
FT                   GTVPGSNGNYFDVQLSNVPAGYDISNGTWTGWCADSEVFITPETLYDTNVYCSESSSMP
FT                   GYTNDDEQWDKVNYVINRYRNGAYDSQLNSTSKADWQEVQAAIWNLTDANPNYQGYFTT
FT                   ASQYIIDDAHANGTGFCPGDNDIAIVVIDPYETPDDRKQLIFIEVGAMIDIEKSTNGED
FT                   ADNKTGPLVLNGNNVEWTYNVTNTGYYNLTDVSVTDDKLGHIGTISLLQAGQSQEFTVN
FT                   GIANPGQYGNNATVVGTPPSGPNVSDSDPSHYFGVNATIGDFLWDDTANNNGIQEPGES
FT                   GIAGVNVSLYNFSDDSLLQTTKTNESGYYNFSVTAGQYYIKFDLLNGYLFSPENQGTDN
FT                   EHDSDVDPSTAKTGKIDVQTTDFNMSFDAGMFKAIPGIDIEKSTNGEDADNETGPYIRL
FT                   NYEVSWVYNVTNTGNVNLTSIDVTDDELGLIGTIPLLQPGQSHVLTENATASLGQYENT
FT                   ATAVGVPPIGPNVTDSDMSHYFGHDSQPGFDVPTANPLLIIGMLGLAGAMVLRREQE"
FT   sig_peptide     52995..53063
FT                   /locus_tag="Mmah_0050"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            54876..56186
FT                   /locus_tag="Mmah_0051"
FT   CDS_pept        54876..56186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0051"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="COGs: COG2252 Permease; InterPro
FT                   IPR011547:IPR006043; KEGG: gsu:GSU1019 xanthine/uracil
FT                   permease family protein; PFAM: Xanthine/uracil/vitamin C
FT                   permease; sulphate transporter; SPTR: A8TED9
FT                   Xanthine/uracil/vitamin C permease; PFAM: Permease family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35588"
FT                   /db_xref="GOA:D5E8S9"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8S9"
FT                   /protein_id="ADE35588.1"
FT                   /translation="MTGVLENFFHLKEHGTDIKTEVMAGLVTFMTVAYIIVVNPAILEA
FT                   AGIPFGPSLVATILSAVFGTLIMGVYAKKPIAIAPYMGENAFVAYTVVGVLGYPWQTAL
FT                   GAVFISGVLFTILTISGFRDKMIDAVPNNLKYSFVAGLGLFITFIGLVNAGIVSLGVEG
FT                   SPLHVGALDTMPVALAVLGFLLISILMIKNVKGSILIGIIATALLGFVTGISQTPDSIV
FT                   SMPPSLTPIFLQLDIFGALSWGFFAVILTMFTMDLMDTMGTLVGVSMEAGYMDEQGNLP
FT                   DMEKPFLADSLATVFAAIAGTTTTGAYIESATGIKEGGRTGLTAVVVALLFMLGLFFYP
FT                   LFSAIPAAATAPALIIVGFQMMASIKKIDMNDLTEMVPAMAVIILMSFTYNLGIGLCAG
FT                   FVLFPLFKVVSGKSSEVKPIAWGLFVLCTLFFVFYPY"
FT   gene            56386..57606
FT                   /locus_tag="Mmah_0052"
FT   CDS_pept        56386..57606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0052"
FT                   /product="Nucleotidyl transferase"
FT                   /note="COGs: COG1208 Nucleoside-diphosphate-sugar
FT                   pyrophosphorylase involved in lipopolysaccharide
FT                   biosynthesis/translation initiation factor 2B gamma/epsilon
FT                   subunits (eIF-2Bgamma/eIF-2Bepsilon); InterPro
FT                   IPR001451:IPR005835; KEGG: similar to mannose-1-phosphate
FT                   guanylyltransferase; PFAM: Nucleotidyl transferase;
FT                   transferase hexapeptide repeat containing protein; SPTR:
FT                   Q12TM8 Nucleotidyl transferase; PFAM: Nucleotidyl
FT                   transferase; TIGRFAM: glucose-1-phosphate
FT                   thymidylylransferase, long form"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35589"
FT                   /db_xref="GOA:D5E8T0"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR023915"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8T0"
FT                   /protein_id="ADE35589.1"
FT                   /translation="MKAIVLAAGEGVRCAPLTNTRSKVMLPVANRPILEYVISALVDNG
FT                   IEDVVLVVGYEKEKVMNYFGDGNDFGARITYVDQTSQLGTAHAISQAIPALGNDNESFL
FT                   VLNGDNIIEKETINKLITNHAGDATVLTTPREKVCGYGVVMSAAGKVKGIFEKPTRQIS
FT                   HMVNTGIYAFNRDIIAEIDKTEISERGEYEITHTLQNMVKKDRDVRVIVTKNLWMDSVY
FT                   AWDLLDINARLLANCESNISDTSVVYESVTLVGDVEIGDDTVIRPGSYIVGPIKIGSNC
FT                   DIGPQVTVLPCTSIGDNVSLGPYTYIQNSILMDNVRVESHSHVSESIIGFYCNFGPYSI
FT                   CEADNDVNIEIENELVPVEKSGVVIGDDCKFGSRTLTEAGTLVGNNCTVRSGTNVDRHL
FT                   PANSTVL"
FT   gene            57616..59436
FT                   /locus_tag="Mmah_0053"
FT   CDS_pept        57616..59436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0053"
FT                   /product="glutamine--fructose-6-phosphate transaminase"
FT                   /EC_number="2.6.1.16"
FT                   /note="COGs: COG0449 Glucosamine 6-phosphate synthetase
FT                   contains amidotransferase and phosphosugar isomerase
FT                   domains; InterPro IPR001347:IPR000583:IPR005855; KEGG:
FT                   gbm:Gbem_0090 glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: sugar isomerase (SIS);
FT                   glutamine amidotransferase class-II; SPTR: Q12TM9
FT                   Glutamine--fructose-6-phosphate transaminase; TIGRFAM:
FT                   glucosamine/fructose-6-phosphate aminotransferase,
FT                   isomerizing; PFAM: SIS domain; Glutamine amidotransferases
FT                   class-II; TIGRFAM: glucosamine--fructose-6-phosphate
FT                   aminotransferase (isomerizing)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35590"
FT                   /db_xref="GOA:D5E8T1"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8T1"
FT                   /protein_id="ADE35590.1"
FT                   /translation="MCGIVGYVGKTGASSVIMDCLRRLEYRGYDSAGLSVLNGDLQTYK
FT                   AAGSISELDKVLPAEIKGNIGIGHTRWATHGMPNDVNAHPHCSSDIVVVHNGIIENYLK
FT                   LKEWLEDEGYEFVSDTDTEVIAHLVHFNSNSLDLFEAVHKSMAVLEGSYAIAVMSKNNP
FT                   DTLIASRKDSPLIVGLGENEFFTSSDATAFVAHTRDVIFVDDREIVKLTPEKVEFYDME
FT                   GQLLEKQISTIDWDVEAAEKSGYAHFMLKEIHEQTRSLQKTFAGKLAELEGNVRLTELK
FT                   LTDEQIRNINRVEIIACGTSWNAGLFGKYLLETLAGMHTDVSAASEFRYRDPVMDENVL
FT                   TIAITQSGETADTLAAIRNVVQYESSTIAITNVVGSTITREAENVVYTHAGPEIGVAAT
FT                   KTFTAQLIALYLLAIYMGRKRNYLLPDEAKDVIKALKELPGHVQQVLNQRDQIRKNAAQ
FT                   YADCRDYYFIGRGLNYPAALEAALKLKEISYIHAEGYAAGELKHGPLALLEKGTPVVAI
FT                   VTKNRTYAKMLSNIKEVKARGAEVIAVADERDREIGKYADLVIFVPATNPLLSPVLSSV
FT                   ALQLLAYYTALEKGCEIDKPRNLAKSVTVE"
FT   gene            59450..60745
FT                   /locus_tag="Mmah_0054"
FT   CDS_pept        59450..60745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0054"
FT                   /product="Phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="COGs: COG1109 Phosphomannomutase;
FT                   InterProIPR005841:IPR005844:IPR005846:IPR005843:IPR
FT                   005845:IPR016066; KEGG: cla:Cla_1567
FT                   phosphoglucomutase/phosphomannomutase family protein; PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III;
FT                   phosphoglucomutase/phosphomannomutase;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; PRIAM: Phosphoglucosamine mutase; SPTR: Q46AY7
FT                   Probable phosphoglucosamine mutase; PFAM:
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain II; Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain III;
FT                   Phosphoglucomutase/phosphomannomutase, C-terminal domain;
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain I"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35591"
FT                   /db_xref="GOA:D5E8T2"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR024086"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8T2"
FT                   /protein_id="ADE35591.1"
FT                   /translation="MKLFGSSGIRGLANKVIGPELALNVGMAVGTMADSVVIGKDPRIA
FT                   ADMIEQALIAGLSATGCEVTLGGLMSTPTLAFATVDYDCGIMITASHNPAEDVGIKLWN
FT                   PDGMAFDSQQQKRIEHIIENNEYATVTWNEVGNVKYEEGFVKRHCNAILSRMQPSHKRV
FT                   VVDCGCGAGCTITPYLLRQLGCEVISLNCQPDGYFPARNCEPAEKNLGQLIKAVRAFEA
FT                   DIGIAHDGDADRMMVVDEQGNFVSGDELLALFALQQKQDKVVVPVDTSMIVDDALGDTK
FT                   VLRCRVGDVYVAEQIKASGAYFGGEPSGSWIFPDVSYCPDGIYAAARIVGMIENSSLSK
FT                   MVVDLPHYTTLRDTIECAEDRKEAAMQRIKQSLEMMGNVTTIDGIRVDMENGWVLVRPS
FT                   GTEPKIRITAEAREDVDELFDKVMRIARGAIQ"
FT   gene            60742..61932
FT                   /locus_tag="Mmah_0055"
FT   CDS_pept        60742..61932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0055"
FT                   /product="Nucleotidyl transferase"
FT                   /note="COGs: COG1208 Nucleoside-diphosphate-sugar
FT                   pyrophosphorylase involved in lipopolysaccharide
FT                   biosynthesis/translation initiation factor 2B gamma/epsilon
FT                   subunits (eIF-2Bgamma/eIF-2Bepsilon); InterPro
FT                   IPR001451:IPR005835; KEGG: tgr:Tgr7_3303
FT                   UDP-N-acetylglucosamine pyrophosphorylase / diamine
FT                   N-acetyltransferase; PFAM: Nucleotidyl transferase;
FT                   transferase hexapeptide repeat containing protein; SPTR:
FT                   Q46AY8 Glucose-1-phosphate thymidylyltransferase; PFAM:
FT                   Nucleotidyl transferase; Bacterial transferase hexapeptide
FT                   (three repeats); TIGRFAM: glucose-1-phosphate
FT                   thymidylylransferase, long form"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35592"
FT                   /db_xref="GOA:D5E8T3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR023915"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8T3"
FT                   /protein_id="ADE35592.1"
FT                   /translation="MKAFILAAGEGTRMRPLTDRRPKVMLPIGNKPILEHIIDEAVDAG
FT                   IRQFVIVTGYMENSIREYFGDGLQKDVSIEYVFQKEQNGTGHAIGCAEDYVDDRFIVLN
FT                   GDMLISSVQIKNLITRAEDAVLTVKEVEDPCNFGVICTAGEKVTQIVEKPEKPPTNLAN
FT                   AGIYLFPQSIFDYIRKTPESPRGEIEITDSIQMLIDSGASVGYEVFRDTWIDIGRPWDM
FT                   LTANKHVLSGLEGNIMGEVEPNATLKGEIVVGAGTVIRSGAYIIGPVVIGKDCDIGPNC
FT                   FIRPSTAIGDNVRIGNAVEIKNCVVMDETNIGHLSYVGDSVIGHDCNFGAGTKVANLRH
FT                   DGRTIRVMIKGEKVDSGQRKLGVIMGDGVHTGINTCINVGSVLKTGRCTGLGEVVK"
FT   gene            complement(62203..63648)
FT                   /locus_tag="Mmah_0056"
FT   CDS_pept        complement(62203..63648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0056"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /note="COGs: COG0168 Trk-type K+ transport systems membrane
FT                   components; InterPro IPR003445:IPR004772; KEGG:
FT                   sat:SYN_02617 trk system potassium uptake protein; PFAM:
FT                   cation transporter; SPTR: Q12X31 K+ transporter Trk;
FT                   TIGRFAM: potassium uptake protein, TrkH family; PFAM:
FT                   Cation transport protein; TIGRFAM: potassium uptake
FT                   protein, TrkH family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35593"
FT                   /db_xref="GOA:D5E8T4"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8T4"
FT                   /protein_id="ADE35593.1"
FT                   /translation="MSGLRINIVLGAIGSILWIIGGLMIIPFMVAVYYGESLFPFSLSL
FT                   TITLLIAFIFSLMLTEERGEWNMREGFMIVALGWLTAAIFSSMPYIFEGTPPINALFEA
FT                   MSGVTATGATALADIESYSKSLLFWRAMTQWVGGMGIILLFIVVLPKLGVAGRQMFRAE
FT                   VPGLKEEQLRPRIRETATLLWFVYVGLSIVEFILLYFAGLNAYDAITHTFTSISCAGFS
FT                   TYSDSIAAFNNTTVEGIFLIFMILGGANIALHYKTIFSDKTSLIKDEEFKFYLLIILIA
FT                   TLVLAYTLTRGEVYAIADSFRYSLFHVVSILTTTGYATTDFNMWPDSSRFILFLLMFIG
FT                   GCAGSTSGGIKVVRVLLLMKYADNVLFRTIHTKAIRPIRFNHRRIPEEIMHAIVSFLII
FT                   YFMIFIASATLLSLMGVDFVTTLSASIATLGNVGPGLGLVGPMANYGTLPDLGMLVLTA
FT                   NMWIGRLEVFTVMVLLTPAFWRH"
FT   gene            63816..64058
FT                   /locus_tag="Mmah_0057"
FT   CDS_pept        63816..64058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0057"
FT                   /product="protein of unknown function DUF433"
FT                   /note="COGs: COG2442 conserved hypothetical protein;
FT                   InterPro IPR007367; KEGG: afr:AFE_1367 hypothetical
FT                   protein; PFAM: protein of unknown function DUF433; SPTR:
FT                   Q64C65 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF433)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35594"
FT                   /db_xref="GOA:D5E8T5"
FT                   /db_xref="InterPro:IPR007367"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8T5"
FT                   /protein_id="ADE35594.1"
FT                   /translation="MTFNDRITISHEICEGKPVIKGTRISVDFIIELLGNNWTHDDILE
FT                   NYPQLDKEDILAALKYASGILKSEHVYSIPPKATS"
FT   gene            64097..64381
FT                   /locus_tag="Mmah_0058"
FT   CDS_pept        64097..64381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35595"
FT                   /db_xref="InterPro:IPR041049"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8T6"
FT                   /protein_id="ADE35595.1"
FT                   /translation="MKCIRKLREKGCNVISITEQAKGCDDKTVLDIAKQRNAILITFDK
FT                   QFGYVIPLLSPDFIFDTLKWVIFDSGILLQGKYIVVNESKVRSFPISNA"
FT   gene            complement(64488..65117)
FT                   /locus_tag="Mmah_0059"
FT   CDS_pept        complement(64488..65117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0059"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="COGs: COG1280 Putative threonine efflux protein;
FT                   InterPro IPR001123; KEGG: gem:GM21_3051 lysine exporter
FT                   protein (LysE/YggA); PFAM: Lysine exporter protein
FT                   (LYSE/YGGA); SPTR: Q8TP18 LysE type translocator; PFAM:
FT                   LysE type translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35596"
FT                   /db_xref="GOA:D5E8T7"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8T7"
FT                   /protein_id="ADE35596.1"
FT                   /translation="MYEITEFLVTGILLGFAAGISPGPLMAITISESLQHGSKEGFKVA
FT                   ISPLITDFLIVSAVIYILMHFQQQNSVIALISLAGALYLMQLGIASLRTKNISIEITNQ
FT                   KKESLKKGILANFLNPHPYLFWIAIGGPILFRASEVDRLAQIMFVIGFYVLLVGSKVVI
FT                   ALFVGKSKDFLKSKYYLHLFRSLGILYLIFALVFIEQGLELLGLHV"
FT   sig_peptide     complement(65037..65117)
FT                   /locus_tag="Mmah_0059"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(65314..65745)
FT                   /locus_tag="Mmah_0060"
FT   CDS_pept        complement(65314..65745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0060"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q46G91 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35597"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8T8"
FT                   /protein_id="ADE35597.1"
FT                   /translation="MIIRFYKSQSERHIKDYQAFLITMEAPENNGFEIIPPEPRAGDNV
FT                   TIRGTSSAESVEIAMTFIRTVPVAGGKYKCRMPDTEVPERPNQLTVRAENVKDLKVRVK
FT                   ILLWMTRRARASDGVAEICESNVPSGKYDIRIEGNAADG"
FT   gene            complement(66089..66376)
FT                   /locus_tag="Mmah_0061"
FT   CDS_pept        complement(66089..66376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0061"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q8TI75 Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35598"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8T9"
FT                   /protein_id="ADE35598.1"
FT                   /translation="MATLTIPIDDEFYQKIQELSWIRWSRVVQEGIRKRKILEIYIRNN
FT                   TISESDASFCESIDWHPVDELPVKEEVVDKIKSEDKSSLVKVKDVADIFR"
FT   gene            complement(66376..66531)
FT                   /locus_tag="Mmah_0062"
FT   CDS_pept        complement(66376..66531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35599"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8U0"
FT                   /protein_id="ADE35599.1"
FT                   /translation="MKRYTVAIPDELKKEIDDLPDINWTQVAKESIEKKIHLLEEFEKY
FT                   ERSRGN"
FT   gene            66831..67970
FT                   /locus_tag="Mmah_0063"
FT   CDS_pept        66831..67970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0063"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="COGs: COG0675 Transposase and inactivated
FT                   derivatives; InterPro IPR010095:IPR001959; KEGG:
FT                   dno:DNO_0387 IS605 family transposase; PFAM: putative
FT                   transposase IS891/IS1136/IS1341 family; transposase IS605
FT                   OrfB; SPTR: Q466U3 Transposase; TIGRFAM: transposase, IS605
FT                   OrfB family; PFAM: Helix-turn-helix domain; Putative
FT                   transposase DNA-binding domain; Probable transposase;
FT                   TIGRFAM: transposase, IS605 OrfB family, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35600"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8U1"
FT                   /protein_id="ADE35600.1"
FT                   /translation="MILKLIYFLMLRAYKYRMYPDENQIEMFHKHFGACRYIYNWALEN
FT                   KIKSYEQEGKSISRFELNGKIRMLKREFEWLKEVNSQSLQGATLNLDNAFTRFFREKKG
FT                   FPKFKSRKNPVQSFSVPQHYQVDFEKNKVKLPKIGWIKTKLHRNFEGVCKTATVSKTST
FT                   DKYFISILVDGGKELPVKQEFDIDTTIGVDVGIKDFAIMSNGDKIENPKHLKNTIERLK
FT                   VLQQRLSGKEKGSANRQKAKLAVAKLHEKIANQRNDFQHKLSHKLISENQAIALETLNV
FT                   NGMLKNHCLAQSISDASWSSFVSKLEYKAEWCGKTVLRIGQFEPSTKICNVCGFHNKNI
FT                   TLSNRNWQCPDCGTKHDRDVNAAINIKKFALNKQNLIGI"
FT   gene            68139..69143
FT                   /locus_tag="Mmah_0064"
FT   CDS_pept        68139..69143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0064"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q8TSD7 Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35601"
FT                   /db_xref="GOA:D5E8U2"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8U2"
FT                   /protein_id="ADE35601.1"
FT                   /translation="MLGIFELIAVALCIVFVLVLTVKVWKNRTYSGTKKIFLSLAVLLF
FT                   MTVLVYGLFFFVLVDSDQASYYTTGGKNFENINDERILENAKEAGYQIQGPFFVNVRAQ
FT                   DSTGIYPDDLPELENHLGTEYILKFSTYYYNADTIMEIMFIDEDVTTITFFNYSRPDPY
FT                   FSPFKVEHLPDDRWIIDRMVAVFGFDEQTARGHLQEMKAEIENENRPKMELSRSIAPSS
FT                   LYADLQNMSTSSKFSLTYGEGNTALLFYEDERLAGKINCVVPNHRIVHVTDEATYTIKV
FT                   DKLGGVDLHVELPVGERIPEETYTAGFKKMFKDIGLPEAAVDEYEFNYSSSVW"
FT   gene            69279..69461
FT                   /locus_tag="Mmah_0065"
FT   CDS_pept        69279..69461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0065"
FT                   /product="NDP-glucose dehydratase epimerase protein"
FT                   /note="KEGG: ret:RHE_PB00052 NDP-glucose dehydratase
FT                   epimerase protein; SPTR: Q0W4H9 Putative UDP-glucose
FT                   4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35602"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8U3"
FT                   /protein_id="ADE35602.1"
FT                   /translation="METVKARQLPAIFRDGKQTCDFISVHDIVYLAQLLVEKEAAIGKI
FT                   FNAGTSKQISFNRLA"
FT   gene            69754..70338
FT                   /locus_tag="Mmah_0066"
FT   CDS_pept        69754..70338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0066"
FT                   /product="Rubrerythrin"
FT                   /note="COGs: COG1592 Rubrerythrin; InterPro
FT                   IPR003251:IPR004039:IPR009040; KEGG: hypothetical protein;
FT                   PFAM: Rubrerythrin; SPTR: O26850 Rubrerythrin; PFAM:
FT                   Rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35603"
FT                   /db_xref="GOA:D5E8U4"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8U4"
FT                   /protein_id="ADE35603.1"
FT                   /translation="MKKTVENLSKAFVGESQARNRYTIYSKIAKKEGFEQIADIFLLTA
FT                   ENEREHAKWSFQLINELKKQSGKSFDDIEIEADVPNDYGTTAENLKAAINGEDYETTTM
FT                   YPEFAQAAEDEDLPEVAARLRAIGKAEMHHKERFEKLLREVENGTVFKKEKEVEWVCRK
FT                   CGYVHKGPEPPEECPSCDHPYNYFEIKCEEY"
FT   gene            complement(70496..71242)
FT                   /locus_tag="Mmah_0067"
FT   CDS_pept        complement(70496..71242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0067"
FT                   /product="protein of unknown function DUF541"
FT                   /note="COGs: COG2968 conserved hypothetical protein;
FT                   InterPro IPR007497; KEGG: mes:Meso_2073 hypothetical
FT                   protein; PFAM: protein of unknown function DUF541; SPTR:
FT                   Q8TTW4 Outer membrane protein; PFAM: Protein of unknown
FT                   function (DUF541)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35604"
FT                   /db_xref="GOA:D5E8U5"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8U5"
FT                   /protein_id="ADE35604.1"
FT                   /translation="MAQENNKDKSYYIIIALSVVLVLMAATLYAGSVGGSDSNSENTLQ
FT                   MNGNAEMMVVPDTATLNIGAEVMAPTAEEASQENAVIMNAVIEELKGLGLEDEDIRTSY
FT                   VSVRPEYNYGEKTRTIEGYSASNSVQVTTTNLDNLGEMIDRSASAGANQIGGISFAVSD
FT                   EKQKELHEDLITEAVADASSKAEILAENLGVEIVGVKSSSISDGTPPRTYYEESVAMDA
FT                   AEKPATPIEPGESRVSMSVRVTYIIQ"
FT   sig_peptide     complement(71153..71242)
FT                   /locus_tag="Mmah_0067"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            71529..72827
FT                   /locus_tag="Mmah_0068"
FT   CDS_pept        71529..72827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0068"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mca:MCA2881 hypothetical protein; SPTR: B9ZHY8
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35605"
FT                   /db_xref="GOA:D5E8U6"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8U6"
FT                   /protein_id="ADE35605.1"
FT                   /translation="MMDNRDDLVHILHDTRLNTVLSWIIVLVFIFLATVNFFEGRYTWT
FT                   ILIIFIVVVVLLPGLFFCKPSVMPSWLLLLLVLIPIAGNTTAYYFFLTRIPVYISVATL
FT                   SLLIVAEINWFTSVRMNPKFAIYLVIVTTLAVTGMWHFMRWVLDVMIGTTFLLDGRSVD
FT                   VINTAVMYEFIYALIAGIVAGVLFGWYFKTMMKKGTSDIIFPERIMDVSQEYTYSEPPK
FT                   VIRKLLGLSARKQKNITRFLQAFLVILFIFGVLSRDLHILLRAFLALIITFVPAFMKQR
FT                   HNLYLDPSLTLWITIAVFLDAIGTFWLYDNIARWDNLTHAVSSSTIAAAGYVIVRTIDI
FT                   YDSEINIPPRTMFVFIPLFILSVGVMWEILEFITDELALIIGIDAFLAQHGIHDTMGDM
FT                   LFNLIGAIVVALWGTFYLNNLSYKIAEMFETNK"
FT   gene            complement(73474..73827)
FT                   /locus_tag="Mmah_0069"
FT   CDS_pept        complement(73474..73827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0069"
FT                   /product="protein of unknown function UPF0132"
FT                   /note="COGs: COG4818 membrane protein; InterPro IPR005348;
FT                   KEGG: hypothetical protein; PFAM: protein of unknown
FT                   function UPF0132; SPTR: Q58838 UPF0132 membrane protein
FT                   MJ1443; PFAM: Chloroplast import component protein (Tic20)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35606"
FT                   /db_xref="GOA:D5E8U7"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8U7"
FT                   /protein_id="ADE35606.1"
FT                   /translation="MSETSTGLEENIAGVLTYLLGLITGIIFLIIEKKNKSVRFNAAQS
FT                   IVVFGGLFVLNIILSMVPVLGGVISTLIGLISLILWVYLMYMTYTGNLVRLPVASEYAD
FT                   KIIAGDTELDRSE"
FT   gene            complement(73829..74617)
FT                   /locus_tag="Mmah_0070"
FT   CDS_pept        complement(73829..74617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35607"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8U8"
FT                   /protein_id="ADE35607.1"
FT                   /translation="MASNKIYLLVLVIIIGAMALSGCSNGDSGVDDIPSDYEETRSINL
FT                   GDDISLTQYEIETQDSSQVLNDLQQTAESEGWEVIADWEGDFAGYEIGVALEKDDRVMA
FT                   INTAVNDGTTTATIITGPRDAANIADMSNDETTPSVDEEESNAPPTTDVDGQDFADVPR
FT                   YPDSVRIDYRSLTVDSDIDREQVEYLTGDNPEDIKEFYENELEAQGWDIIESLILTEKD
FT                   DVGVYVRASKDTKTLELGTQPSSDYDDMTEIIIYVETRAD"
FT   sig_peptide     complement(74540..74617)
FT                   /locus_tag="Mmah_0070"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(74998..75186)
FT                   /locus_tag="Mmah_0071"
FT   CDS_pept        complement(74998..75186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0071"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q46FB7 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35608"
FT                   /db_xref="InterPro:IPR022453"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8U9"
FT                   /protein_id="ADE35608.1"
FT                   /translation="MIPDSCSFCQGKLVWKNTDVAIQKADSERVVVEVAAYVCDTCREV
FT                   YYTPEVSRQLDRIAYSK"
FT   gene            75343..75489
FT                   /pseudo
FT                   /locus_tag="Mmah_0072"
FT   gene            complement(75625..76140)
FT                   /locus_tag="Mmah_0073"
FT   CDS_pept        complement(75625..76140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0073"
FT                   /product="membrane-bound metal-dependent hydrolase"
FT                   /note="InterPro IPR007404; PFAM: membrane-bound
FT                   metal-dependent hydrolase; SPTR: Q8THS5 Predicted protein;
FT                   PFAM: Predicted membrane-bound metal-dependent hydrolase
FT                   (DUF457)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35609"
FT                   /db_xref="GOA:D5E8V0"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8V0"
FT                   /protein_id="ADE35609.1"
FT                   /translation="MFVFGHIGLTILAFYLTEQWYPKLQGKVNYRFVAIAALLPDLIDK
FT                   PLGRFLLADSLASGRIFAHTLLFWVLVGLIIVLIWQKWRADFLLILPVAAVLHLLEDSM
FT                   WQTPEVLFWPLLGWSFPADEIAGGFPDYLMHVFSNCYEPAMSVVFVSEVLGIVVCMVGA
FT                   MRWYSRVR"
FT   gene            76674..79355
FT                   /locus_tag="Mmah_0074"
FT   CDS_pept        76674..79355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0074"
FT                   /product="peptidase C1A papain"
FT                   /note="COGs: COG4870 Cysteine protease; InterPro
FT                   IPR003961:IPR000668:IPR000169; KEGG: sfu:Sfum_0903
FT                   peptidase C1A, papain; PFAM: peptidase C1A papain;
FT                   Fibronectin type III domain protein; SMART: peptidase C1A
FT                   papain; Fibronectin type III domain protein; SPTR: Q8PSK6
FT                   Surface layer protein B; PFAM: Papain family cysteine
FT                   protease"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35610"
FT                   /db_xref="GOA:D5E8V1"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR000668"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR025660"
FT                   /db_xref="InterPro:IPR026453"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR040528"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8V1"
FT                   /protein_id="ADE35610.1"
FT                   /translation="MNDTMIKKIILYSVITILLLNTALASENNPEITSAPLNPDFIDYQ
FT                   SSMQKSDENTIMSSSANTPSLGLIPSPVDLSHLDHPGPGNNRFSTAQSLPASYDLREQN
FT                   RVTPVKNQGEAGSCWTFATYASLESCTYDKGPYDFSENHMKNTLSNESPTGFDFEEGGT
FT                   LNMATAYLARWSGPVNETDDPYSDNSSYNDYTNPDKPVAKHVQEVIYLPGRESVSGNDY
FT                   LKKAVMEHGALFTIFKVNHSAFADNSTTYYNNGSEYGNRHGVALIGWNDSFPKEEFVNE
FT                   PPEDGAFIVKNSWGTESGDSGYLYISYYEETFNVQETAIFSSAANVTNYDNIYQYDPLG
FT                   YINSYGFSNSTTAHGANVFQSSSEEYLEAVSFYTTDTNAICNVSIYTNLSSTGPVGDNL
FT                   VAQTNETFAHAGYHTVPLDIPVNLAEGQNFSVIAKISNPRFKYPLAIEYPMANYSSRAS
FT                   ANPNESFMSPDGSNWMDVGELNDVNICIKAFTSLPPSTVSNLTATTGPSWINWTWSNPD
FT                   DKDFNHTEIYVNNTLIFNTSDTYYNLTGLVDGTNHSIGLKTVDTDGYVNSTWINNTSQT
FT                   LDIAPATITDLHVTSSTSDFLAWGWTNPANHDFDHVEIYLDNVFQANTSESVYRVSDLK
FT                   SGHAYKIGLKTVDKAGNINNTTINDIASTKSKPSGNVIKGMTTSLESRENIVSKSSQIQ
FT                   KVVADENVRYDFKDDSISSIEFKGTDNFGYVKVLVENLDDTSSLVDQEPPGKIYRNLNI
FT                   WVGDNRFDGEGMTDTVIGFKVSKDWLSANDTNPDSVVLLHYTNAWQILETVQTEEDADY
FT                   FYFEAHADGFSPFAISAVDSTTGTDEISRPDDSEQSASGSAEPVTDSLPENTTEPAETT
FT                   PGPGVLAGMGIICILYVMRKRL"
FT   sig_peptide     76674..76748
FT                   /locus_tag="Mmah_0074"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(79480..79764)
FT                   /locus_tag="Mmah_0075"
FT   CDS_pept        complement(79480..79764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0075"
FT                   /product="plasmid stabilization system"
FT                   /note="InterPro IPR007712; KEGG: tdn:Suden_1955
FT                   hypothetical protein; PFAM: plasmid stabilization system;
FT                   SPTR: Q8PTV6 Conserved protein; PFAM: Plasmid stabilisation
FT                   system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35611"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8V2"
FT                   /protein_id="ADE35611.1"
FT                   /translation="MKYNVNIHKEAVKYLNSLDPHTKEKIVEGLKVLGNLPVEGDIKKL
FT                   KGTKGKRDLYRLRIGEYRAIYHVENNNVYVLEIMLRGKGYGWLDRLLVL"
FT   gene            complement(79777..79980)
FT                   /locus_tag="Mmah_0076"
FT   CDS_pept        complement(79777..79980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0076"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q8PTV7 Conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35612"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8V3"
FT                   /protein_id="ADE35612.1"
FT                   /translation="MSTHFNQATTIPTTKSIRDRLKNYGHKGETYSEILTRMMDSIDRE
FT                   EFMDRMYKRLEEKDQFVSIDEI"
FT   gene            80299..80529
FT                   /locus_tag="Mmah_0077"
FT   CDS_pept        80299..80529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0077"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q64BL8 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35613"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8V4"
FT                   /protein_id="ADE35613.1"
FT                   /translation="MSTTICVDLQTKEKLRSLKKYPKESFNSVLERLTRMAIDEDELSD
FT                   EAIQNIEEALEDIKMGRTYSEYEVKKELGLL"
FT   gene            80526..80798
FT                   /locus_tag="Mmah_0078"
FT   CDS_pept        80526..80798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0078"
FT                   /product="plasmid stabilization system"
FT                   /note="InterPro IPR007712; KEGG: sbl:Sbal_4390 addiction
FT                   module antitoxin; PFAM: plasmid stabilization system; SPTR:
FT                   Q64BL9 Putative uncharacterized protein; PFAM: Plasmid
FT                   stabilisation system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35614"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8V5"
FT                   /protein_id="ADE35614.1"
FT                   /translation="MSYDVIYTNKSLKQLKKLSKTVSESVISSIDKIKDDPYCNIKKLK
FT                   GIGKQPLYSHRVGEYRVILTIENNRMLIFIVEVGDRKTIYRKYQS"
FT   gene            complement(80967..84569)
FT                   /locus_tag="Mmah_0079"
FT   CDS_pept        complement(80967..84569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0079"
FT                   /product="PKD domain containing protein"
FT                   /note="COGs: COG4870 Cysteine protease;
FT                   InterProIPR000601:IPR000668:IPR007742:IPR006626:IPR 000169;
FT                   KEGG: sfu:Sfum_0222 peptidase C1A, papain; PFAM: PKD domain
FT                   containing protein; peptidase C1A papain; periplasmic
FT                   copper-binding; SMART: PKD domain containing protein;
FT                   peptidase C1A papain; Parallel beta-helix repeat; SPTR:
FT                   Q8PSK6 Surface layer protein B; PFAM: Periplasmic
FT                   copper-binding protein (NosD); PKD domain; Papain family
FT                   cysteine protease"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35615"
FT                   /db_xref="GOA:D5E8V6"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR000668"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR022441"
FT                   /db_xref="InterPro:IPR025660"
FT                   /db_xref="InterPro:IPR026453"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="InterPro:IPR040528"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8V6"
FT                   /protein_id="ADE35615.1"
FT                   /translation="MQKPILLIILILFLAAIPAHADNDTLDPQIAPLNPDFVQYQEEME
FT                   QNRNHVSVNTISPSEDGLKSILEQDRSIESSLHPPGLVPSPIDFSYLSPVNTKTNGYGI
FT                   LSSYPSRYDLREENGVTPVRDQALAGSCWVFGTYGPLESYLMHTESEEWDFSEQHVKNT
FT                   LLSSYTHGFDRNGHADGGYMLMTLAYLAGWSGPVTESDDPYDSLSPVSSADTVVAKHVQ
FT                   DAFIFPEINHTNNLFKQMIMDYGAISVAIHDNQSAYFNAENNTYYCYDEDKMMTHGVTL
FT                   AGWDDDFNRTKFSPAAPADGAYIIKNSWGDQWADDGYYYVSYYDTSIGNNGEINGSEHS
FT                   PYTTNTVITAENVSNYDQIYQYDFLGWCSNAGYNNTTALGANVFTATTNQTLEAVSFYT
FT                   VDSNSYYNISVYLDPDNGPVNTSSAVSVKNGSIALPGYHTIDLDHNVSLRGGQNFSIVI
FT                   KFTTPEYTYPVAIEKAIDRYSNNADAEPGQSYLSSNGSNWTDVSASDINVCIKAFTTES
FT                   RQPETDFVADKRYVHVNQSVQFHDASLYSPDSWKWDFGDDNTSTQQNPIYSYTSPGIYN
FT                   VSLNTSNEFGNNITVRDTFIHVLNSTIYVNSSGGADFKTIQGAVDAASQGDTIIIEPGN
FT                   YTERVSFRKDNLTVRSSTGNPQDVRITSPHSYLEMQSVYNNAVFIWADNITLQDVEVTG
FT                   GFYGFFTLYANNCNIINCTFTDNGLGMVLDTSNNNQIVNCTFEKNRAGLQLSNSVDNYL
FT                   ANNSINDNSFYTFGMDSNPNYVDTSNTVNGKPIYSLVGKSDTVIDSDSNAALVHLVDCT
FT                   NITIKDFESRGQKHGIYLYNTTDTRIRNYTSVQNHYGIYLDRSRDNILSNSTINDSRKI
FT                   GIYLTESGDNLIYNNYFNNSNNIHILAGSSNRWNITQTAGRNIINESYLGGNFWANPDG
FT                   TGCSQVENSTGNGFCQPYNLTEDGNNTDYLPLTGNAEKPQEPAETQTSRDNNVRIQTPT
FT                   STVSSSNIISRDTDTQIVGRDAQVRYTFAANQTPVTGIAFNTQQNQGYVMTTVSLLHEL
FT                   PADIDAPAGKAYRTMEIATGSQNPLSDNITIEFSVSRDWIEENNIDIATIRLAHYNEGE
FT                   WEELPGDQVDEDDENIYFTAETAGFSIFSIVGDEYRNIAGEPVAEVEEINEQPSDKEKP
FT                   AQPEENAQMPGFTAIFAVALIAGVAMITRQKSNR"
FT   sig_peptide     complement(84507..84569)
FT                   /locus_tag="Mmah_0079"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            84802..85749
FT                   /locus_tag="Mmah_0080"
FT   CDS_pept        84802..85749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0080"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="COGs: COG0451 Nucleoside-diphosphate-sugar
FT                   epimerase;
FT                   InterProIPR013120:IPR002225:IPR003869:IPR005913:IPR 001509;
FT                   KEGG: scl:sce3691 hypothetical protein; PFAM: NAD-dependent
FT                   epimerase/dehydratase; Male sterility domain; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; SPTR: Q8PXT2 UDP-glucose 4-epimerase; PFAM: NAD
FT                   dependent epimerase/dehydratase family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35616"
FT                   /db_xref="GOA:D5E8V7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8V7"
FT                   /protein_id="ADE35616.1"
FT                   /translation="MAQKDIQKILVTGGAGFIGSHLVDRLVTDGYEVTVFDNLSSGNKK
FT                   YIESNLDKSDFTFLEGDLLDEPALNKACNGMDMVYHVAANPDVRLGAENTKVHFDQNIR
FT                   ATYNLLEAMRKNEVNNLAFTSTSTVYGEATVMPTPEDYGPLVPISLYGASKLACEALIT
FT                   SYSHTFDMNCWLFRFANIIGSRSNHGIIFDFINKLRANPQSLEILGDGKQSKSYLHVSE
FT                   CVNAILFAVEDSRDTVNIFNIGSEDTISATRIGEIVAEEMGLQDVEFTYTGGSRGWKGD
FT                   VPKMQLGVDKLINLGWKPEIDSGGSVRQTVRELL"
FT   gene            85866..87248
FT                   /locus_tag="Mmah_0081"
FT   CDS_pept        85866..87248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0081"
FT                   /product="mannose-1-phosphate guanylyltransferase (GDP);
FT                   mannose-6-phosphate isomerase, type 2"
FT                   /EC_number="2.7.7.22"
FT                   /EC_number="2.7.7.13"
FT                   /EC_number="5.3.1.8"
FT                   /note="COGs: COG0836 Mannose-1-phosphate
FT                   guanylyltransferase; InterPro
FT                   IPR013096:IPR005835:IPR001538:IPR006375; KEGG: tcx:Tcr_1678
FT                   mannose-1-phosphate guanylyltransferase/mannose-6-phosphate
FT                   isomerase; PFAM: mannose-6-phosphate isomerase type II;
FT                   Nucleotidyl transferase; Cupin 2 conserved barrel domain
FT                   protein; PRIAM: Mannose-1-phosphate guanylyltransferase;
FT                   SPTR: Q46FX9 Mannose-1-phosphate guanylyltransferase (GDP);
FT                   TIGRFAM: mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase; PFAM:
FT                   Nucleotidyl transferase; Mannose-6-phosphate isomerase;
FT                   TIGRFAM: mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35617"
FT                   /db_xref="GOA:D5E8V8"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8V8"
FT                   /protein_id="ADE35617.1"
FT                   /translation="MVNNMKSIILAGGSGTRLWPLSREHYPKQFLKIGEYSLFQQTFLR
FT                   CSEVSDVSEIFVVTNEDQKFYVIGQIQELGYDYPKENVLIEPEGKNTLPAICFGMKEIQ
FT                   ERFGESNAGIFSSDHVLDSRAMQTISEAKSLASRGYLLTFGIKPTSPNTGYGYIKPAEN
FT                   LGIGQKVSEFREKPDEETARRYIEESCLWNSGMFLFNTETFFSELAQCAPDIYESFEQN
FT                   EDINQIYAELPSISVDYGVMEKSQKVAVVPLQYKWSDLGNFAALYDELDKDSDENVVYD
FT                   CELLPLDSRQNLVHSRNGKLVSLIDVNDMIVVDTPDALLISPKESSQKVKQIVNQLKEK
FT                   NDPRAKIGQTVYRPWGSYTVLESSDNHVIKKIVVMPEQKLSLQLHYHRSEHWVVVTGMA
FT                   EVHVNGDDYFVRPGESTFIRAGERHRLGNPSKIPLEIIEVQLGEYVAEDDIVRFDDVYG
FT                   RQ"
FT   gene            87308..88345
FT                   /locus_tag="Mmah_0082"
FT   CDS_pept        87308..88345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0082"
FT                   /product="GDP-mannose 4,6-dehydratase"
FT                   /EC_number="4.2.1.47"
FT                   /note="COGs: COG1089 GDP-D-mannose dehydratase; InterPro
FT                   IPR001509:IPR002198:IPR006368; KEGG: rlg:Rleg_6237
FT                   GDP-mannose 4,6-dehydratase; PFAM: NAD-dependent
FT                   epimerase/dehydratase; SPTR: Q8PZ35 GDP-mannose 4,6
FT                   dehydratase; TIGRFAM: GDP-mannose 4,6-dehydratase; PFAM:
FT                   NAD dependent epimerase/dehydratase family; TIGRFAM:
FT                   GDP-mannose 4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35618"
FT                   /db_xref="GOA:D5E8V9"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8V9"
FT                   /protein_id="ADE35618.1"
FT                   /translation="MPKVALVTGITGQDGAYLAEFLLDKGYIVHGIKRRSSSFNTARID
FT                   HLYKDPHERNVNFFMHYGDLTDSTNLIRIIQETQPDEIYNLAAQSHVQVSFETPEYTAN
FT                   SDAIGSLRLLEAIRILGMEKKVKFYQASTSELYGKVQEIPQSETTPFYPRSPYAAAKLY
FT                   AYWITINYREAYGMYACNGILFNHESPIRGETFVTRKITMAVANIKKGLQERLYLGNLD
FT                   AKRDWGFAGDYVKAMWLMLQQDEPEDFVIATGETHSVREFVELAFREVGIDIEWKGEGV
FT                   DEVGVDSETGNVLVEIDPAYYRPTEVELLLGNPSKAREKLGWNSNVGFEELVKMMVKGD
FT                   MGKLL"
FT   gene            88421..89740
FT                   /locus_tag="Mmah_0083"
FT   CDS_pept        88421..89740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0083"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="COGs: COG2244 Membrane protein involved in the
FT                   export of O-antigen and teichoic acid; InterPro IPR002797;
FT                   KEGG: pna:Pnap_3189 polysaccharide biosynthesis protein;
FT                   PFAM: polysaccharide biosynthesis protein; SPTR: Q8PV73
FT                   Heteropolysaccharide repeat unit export protein; PFAM:
FT                   Polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35619"
FT                   /db_xref="GOA:D5E8W0"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8W0"
FT                   /protein_id="ADE35619.1"
FT                   /translation="MLKSEGFKKYFFNTSWLFFEHIVRLVVALFVSVYVARYLGPDQYG
FT                   LLNYSISFVALFSAIATLGLDQIVIRELVKDRNKRDSLLGTAFVLKVSGAVLAIAILAV
FT                   GVQFTSNDLFTNLLIFIIAAGTLFQSMNVVDFYYQSKVQSKFSVQVKFWTIMGISLLKV
FT                   YSIYIGAPLLWFAFLVLLENIILASGFFLIYNLKGLSIFSWHFDLDMAKSLLKSSWPLI
FT                   FSGIFIGIYMKIDQVMLKEMVDTQAVGLYAAAVKLSEAWYFVPTVIMTSFYPAIIEGKK
FT                   ISDEIYYQRLELLYGTVVWLAILIALPITFLGDWVIQILYGIDYVGAASVLKIHIWAAV
FT                   FVFIGVANSKWLIIENLEKFALYRTMIGALCNVVLNLMLIPKYGIEGAATATVISYFIA
FT                   AYLSMLFIGPTQKNFWLSTKSFNLYILFKNLLRFLNERKI"
FT   gene            89724..90464
FT                   /locus_tag="Mmah_0084"
FT   CDS_pept        89724..90464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0084"
FT                   /product="putative SAM-dependent methyltransferase"
FT                   /note="KEGG: pub:SAR11_0393 putative SAM-dependent
FT                   methyltransferase; SPTR: A0ZDI8 Glycosyl transferase, group
FT                   1; TIGRFAM: methyltransferase, FkbM family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35620"
FT                   /db_xref="GOA:D5E8W1"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8W1"
FT                   /protein_id="ADE35620.1"
FT                   /translation="MKEKFNELIPSTIRKKVIKIYNYYWAHYSNDSYSQEGEDLILKKI
FT                   FGDKKNGFYIDVGAHHPQRFSNTYYFYRQGWRGINIDAMPGSMYAFNRIRPDDLNLEIP
FT                   ISNKRDVLTYYSFEEPALNGFSVNLNVERAKKNKIISKTNMETKTLEEVLDLWFNSSEI
FT                   DFLSIDVEGLDFQVLNSNNWTKYRPKVVLVESLKKSIENCYNDEMACYMKKNGYIIFAK
FT                   TFNTVFFMETNFFNRRLNVDNEGE"
FT   gene            90984..91775
FT                   /locus_tag="Mmah_0085"
FT   CDS_pept        90984..91775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0085"
FT                   /product="sulfotransferase"
FT                   /note="InterPro IPR000863; KEGG: sult5a1; sulfotransferase
FT                   family 5A, member 1; PFAM: sulfotransferase; SPTR: Q2KIG7
FT                   Sulfotransferase family, cytosolic, 2A,
FT                   dehydroepiandrosterone (DHEA)-preferring, member 1; PFAM:
FT                   Sulfotransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35621"
FT                   /db_xref="GOA:D5E8W2"
FT                   /db_xref="InterPro:IPR000863"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8W2"
FT                   /protein_id="ADE35621.1"
FT                   /translation="MTFYDISPIVIISHRRSGTHWSIDTIRNNLVGVGSEYYNLDRIQK
FT                   KNKYHLSIDEFMGNVEKCNGIPVLKSHMASDFTPFSGDEKQFVQDLLANSKIIYIYRDG
FT                   RDVLTSLYYYMAKFEPNLPSFSQFLKMKENFNSTYVNLNRVEYWNEHVSGWTKNDDFDV
FT                   CTISYEDLFYRYNKTVHILADFLNIPIAPDGVRKVDLQKPNLIEKIMNKMNVYSLPSSA
FT                   IAPRKGVVGDWMNCFSEEDLDFFNSIATELMVELNYYKQNR"
FT   gene            complement(91776..92351)
FT                   /locus_tag="Mmah_0086"
FT   CDS_pept        complement(91776..92351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0086"
FT                   /product="methyltransferase FkbM family"
FT                   /note="InterPro IPR006342; KEGG: acp:A2cp1_0643
FT                   methyltransferase FkbM family; SPTR: C1EI90 Predicted
FT                   protein; TIGRFAM: methyltransferase FkbM family; TIGRFAM:
FT                   methyltransferase, FkbM family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35622"
FT                   /db_xref="GOA:D5E8W3"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR026913"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8W3"
FT                   /protein_id="ADE35622.1"
FT                   /translation="MGFCPENIDSQSVIYSMGIGEDVSWDEALIARKNVTIHGFDPTPR
FT                   AIEYAKNRKLENFIVHPIGVSSKNGYMDFFTPINPSHVSHSLIKKNNTKYSIKVKIKSI
FT                   DSIMDELNHKKIDILKMDIEGSEYEVIPDMLEKKIFPHQLLIEFHHRFDSFTIKNTTDI
FT                   IDELIYYSYKISYISKNKQEFAFIRTTE"
FT   gene            complement(92474..93403)
FT                   /locus_tag="Mmah_0087"
FT   CDS_pept        complement(92474..93403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0087"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: efe:EFER_2124 hypothetical protein; SPTR:
FT                   A1ZCK8 Sugar transferase; PFAM: GNT-I family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35623"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8W4"
FT                   /protein_id="ADE35623.1"
FT                   /translation="MASNLAPVILFVYNRPLHTKRTIENLQKNLFAENTELFIYSDEAK
FT                   SKNDVLEVQKVRQYIKTISGFRKITIVERQQNFGLSKNIINGVTDVISSYGKAIILEDD
FT                   LLTSPYFLKYMNKALDFYKNKEEIMSISAYNHPPSIMKIPADYNEQIYFNYRNSSWGWG
FT                   TWKNRWDMVDWNVEDFNEFKKDKFAQKKFNRGGEDLSDMLIAQMEGKIDSWAIRFTYAH
FT                   FKYDKLSVCPCHSYVQNIGHDGSGQHCGKSKRYQNDLTKAPEKIKFPEEIKVNQCIMDE
FT                   FSQIYKNNVLKKLKHIFINKLCLLHNIW"
FT   gene            93529..94752
FT                   /locus_tag="Mmah_0088"
FT   CDS_pept        93529..94752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0088"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: gur:Gura_3782 glycosyl transferase, group
FT                   1; PFAM: glycosyl transferase group 1; SPTR: A0ZLT0
FT                   Glycosyl transferase, group 1; PFAM: Glycosyl transferases
FT                   group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35624"
FT                   /db_xref="GOA:D5E8W5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8W5"
FT                   /protein_id="ADE35624.1"
FT                   /translation="MNPLLINTSDIHGGAARAAYRLHQGMQQIGMNSKMLVQKKSSADN
FT                   SVIGPKFNFWNKLSGVRNLADRFPLQMYRGFQNTPWSPQWLPNNIDKKIDRIEPDIVHL
FT                   HWICGGFVPISQVAKIKQPIVWTLHDMWAFTGGCHYNGTCDKYKQECGGCQQLGSNRED
FT                   DLSRWVWRRKKKYWEDLDFTVVTPSNWLADCARSSSLFEDKRIEVIPNGLDLQKYKPVD
FT                   KEEAREALNLPQDKNLVLFGAMNSTKDKRKGFQYLKAAINMLSEDLEFEAIVFGNSGSD
FT                   DQLDIPVNYLGRIPDNMLTSVYSAADMFVAPSLQDNLPNTVMEALACGTPSVAFDIGGM
FT                   SDMIVHKENGYLAKPFDTEDMAKGMEWVVASDQRKQKLSEGSRKYVENKFELEHIARKY
FT                   TNLYSEIC"
FT   gene            94772..95704
FT                   /locus_tag="Mmah_0089"
FT   CDS_pept        94772..95704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0089"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="COGs: COG0451 Nucleoside-diphosphate-sugar
FT                   epimerase; InterPro IPR001509; KEGG: gsu:GSU0627 GDP-fucose
FT                   synthetase; PFAM: NAD-dependent epimerase/dehydratase;
FT                   SPTR: Q46GG6 GDP-fucose synthetase; PFAM: NAD dependent
FT                   epimerase/dehydratase family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35625"
FT                   /db_xref="GOA:D5E8W6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR028614"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8W6"
FT                   /protein_id="ADE35625.1"
FT                   /translation="MEKTEKIYIAGHRGMVGSAIKRNLESKGYTNLICLTHSELDLTDQ
FT                   QAVNEFFESEKPEYVFLAAAKVGGILANSTYPAEFIYDNLMIEANIIHAAHIYGVKKLL
FT                   FLGSSCIYPKFAPQPMKEEYLLTGELESTNEAYAVAKIAGIRLCKHYNQQYGTNFISVM
FT                   PTNLYGPNDNFDLETSHVMPALIRKFHEAKINNESKVTIWGSGSPKREFLHVDDMADAC
FT                   IYLMENYDYADIGEFVNIGVGKDLSIKELAELIKDVVGYEGDIVYDSSKPDGTPRKLLD
FT                   VSKLNGLGWTSSIGLKEGIKATYRWYVGN"
FT   gene            95715..96542
FT                   /locus_tag="Mmah_0090"
FT   CDS_pept        95715..96542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0090"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG0463 Glycosyltransferase involved in cell
FT                   wall biogenesis; InterPro IPR001173; KEGG: fph:Fphi_1478
FT                   glycosyl transferase family protein; PFAM: glycosyl
FT                   transferase family 2; SPTR: A0ZLT1 Putative uncharacterized
FT                   protein; PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35626"
FT                   /db_xref="GOA:D5E8W7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8W7"
FT                   /protein_id="ADE35626.1"
FT                   /translation="MGYNPLVSIITVCYNSEKNIRDTIESVLNQSYDNIEYVIVDGGST
FT                   DNTINIIKEYEPSFKEKMRWVSEPDEGIYDAMNKGIDLANGEIIGIINSDDWYEICAVE
FT                   KVVDKFKESDADVVYGDLYKVIPETSERYIRTGDLSHKKISKIRLNHPTLFVKKGIYDK
FT                   LGVFNTNYPVSADLDLIIRFLYHDVSFVRVPAALANFRLGGISSEKSIIFQLHRLSRKY
FT                   KILRNNKVPYHETIYLISTTLMSSLRDYFILKVFGRNFFNRLRNIRYNIFNPP"
FT   gene            complement(96572..97885)
FT                   /locus_tag="Mmah_0091"
FT   CDS_pept        complement(96572..97885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0091"
FT                   /product="glycosyl transferase group 1"
FT                   /note="COGs: COG0438 Glycosyltransferase; InterPro
FT                   IPR001296; KEGG: dat:HRM2_19980 glycosyl transferase (group
FT                   1 family protein); PFAM: glycosyl transferase group 1;
FT                   SPTR: A3CU40 Glycosyl transferase, group 1; PFAM: Glycosyl
FT                   transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35627"
FT                   /db_xref="GOA:D5E8W8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8W8"
FT                   /protein_id="ADE35627.1"
FT                   /translation="MLRMTFAGIFKTYISIGKPQGIMIRKLDTYLKKLFITLRFSIQYP
FT                   VICLEKSDILFIAHSYSNFQKESINSTSKYFNKCSVLVEYNPITKISEYINISYLKQFN
FT                   LNYKIDLVDAPPNVNVWPTPILYAPLDSQYKKIGEKHLKAVENKIHKNNINFNLVHAHF
FT                   TWSAGYVGAKLKERYGVPFVVTAHGYDIYLLPFKDNEWKNKIEYVLNSADHIITVSNSN
FT                   ADCIKKLNTNVPVTVIPNGYRSNLFYPIDTLKCRKFLRLPLDKKIILAVGNLVEVKGHK
FT                   YLIESIKRIIGSRKDIQCYIIGWGKLQRKLKKQIAAAGIQDYVKLLGGKPHNEIPLWMN
FT                   ACDVFVLPSLRESFGVVQIEALATGKPVVATFNGGSEEIIVSEDYGLLVNPGNSYELAR
FT                   NIEVALNKEWDTEKILTYAQKYQWENISKQIQEIYQKI"
FT   gene            97987..98421
FT                   /locus_tag="Mmah_0092"
FT   CDS_pept        97987..98421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0092"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppg:PputGB1_4825 transposase IS4 family
FT                   protein; SPTR: A3CV58 Transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35628"
FT                   /db_xref="GOA:D5E8W9"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8W9"
FT                   /protein_id="ADE35628.1"
FT                   /translation="MQGCFSSCNLHGNWIHVCVSCEGFPLTIQIALGKEHDRNHFVEVM
FT                   ENIKIKTDRRPRTRPSEILADSAYDEITIRKYLRRRAIKSNIPINIRNRKYPKRGRPTR
FT                   LGYELYRKIASRYERLNVVFKGLIEMACFLMCWKRFQEKF"
FT   gene            complement(98441..99220)
FT                   /locus_tag="Mmah_0093"
FT   CDS_pept        complement(98441..99220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0093"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG0463 Glycosyltransferase involved in cell
FT                   wall biogenesis; InterPro IPR001173; KEGG: hps:HPSH_00510
FT                   hypothetical protein; PFAM: glycosyl transferase family 2;
FT                   SPTR: Q8PZ41 Glycosyltransferase involved in cell wall
FT                   biogenesis; PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35629"
FT                   /db_xref="GOA:D5E8X0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8X0"
FT                   /protein_id="ADE35629.1"
FT                   /translation="MQIKNNRTICERLPLISIVTVCLNSETYLKRTIESILNQSYTNIE
FT                   YIIIDGGSTDGTIATIKKYEDSITKWVSEPDDGIYDAMNKGIAMSKGEIIYFLNSGDYL
FT                   YDKSVLYRVATHFLNPRVMGVYGNVEIKDDRGNKRIRGSEVNYNNLLYKRICHQALFVR
FT                   KKLFNELGEFSTYLKLSSDHEFIVKCIKQYKENFVYFNETIAFYMSGGATHIEMKKAKI
FT                   EDLKILSSNYDPLRFFIGTAICLAVIVKYNLPRIYKP"
FT   gene            complement(99258..101273)
FT                   /locus_tag="Mmah_0094"
FT   CDS_pept        complement(99258..101273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0094"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: Q8PXU3 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35630"
FT                   /db_xref="GOA:D5E8X1"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8X1"
FT                   /protein_id="ADE35630.1"
FT                   /translation="MVNMNTTNLKLYCREIGRNFVANLDNIFSIITIFTGLIIIYLSLF
FT                   AGIGQYGLGLAFLVSPFGYYVLKKRLDIPIEKSENNDENKYSTFFLANNIIYFTLFCLS
FT                   IIILWNTVYYRPAIYFYIITIAYFTLFVEILYRPNDRMFTSFIMIKTLLLSLSYRFGRY
FT                   YIFPTIPGNDTHAHISTTKYIIADGNINGLLTEFYAPRYFYTPLWHIYESISRIIMDIG
FT                   FKEVLFFTIVFLFLIITSLFIYLIAKKIFNEEIALIAFILANIVDMLFVRGVTNINTGS
FT                   FVHIFIVITLYCLIQYKNKPIYSFFSLLFMVCSILTHQLSTAAFLIIIFSLYMGKILYT
FT                   YLYTNINLQNHISIKLNTVVFFFIVILFYWSTMGYVQKTTFFAGMVSRLETTISDMINE
FT                   YLSSGQAVSTNYGEMFSQFSFLSNLLYNFGYSMLIGLAILGILILLNRRFISEIYLSYI
FT                   CVALILFLLIYPGTFIGLNYLFIPHRFISHLEIFLVMFASLSIYYIYTLSNTNKEIFYN
FT                   ANKILAALIVVVLIFFMITTPYVNRADPLYEADRVQRTEYTHSELKSIEWNNYHQADKE
FT                   LMVDPLVEKRPISTVERINTSGIQLIKYPKNVYIQDISSNILIRQYARNNPYLISRGTF
FT                   GTTKIYEMEFLLNIVPEECNNIYSNNLASVYRSKYI"
FT   gene            complement(101298..102332)
FT                   /locus_tag="Mmah_0095"
FT   CDS_pept        complement(101298..102332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0095"
FT                   /product="protein of unknown function DUF354"
FT                   /note="COGs: COG1817 conserved hypothetical protein;
FT                   InterPro IPR007152:IPR002073; KEGG: gbm:Gbem_1073 protein
FT                   of unknown function DUF354; PFAM: protein of unknown
FT                   function DUF354; SPTR: A3CU42 Putative uncharacterized
FT                   protein; PFAM: Protein of unknown function (DUF354)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35631"
FT                   /db_xref="InterPro:IPR007152"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8X2"
FT                   /protein_id="ADE35631.1"
FT                   /translation="MNIVVDIIHPAHVHFFKNFIHIMEERGHNVLVTSRNKDVAKNLLD
FT                   AYDIEYCTLSTCKSGLLNMGYELIYRDIKLYLKSQSFSPDIFIGEGNPFITHVATLMRK
FT                   TSILFTNTEHAKLINNSSFPFASVICTPSCFNKNLGKKHIRYNGYLAIAYLHPNYFTPN
FT                   PTVLEELDLKEDEPFIILRFVSWEASHDVGHHGIQNKIEFVKELEKYGRVLITSEGDLG
FT                   PEFEKYKITVSPEKLHDLLYYATLYIGEGATTASECAILGTHAIYVNTLRLGYLDEQEE
FT                   KYNLTYTFSDPKNCEKDALDKAISLLKRDNLWEEGKKKRKLLLSDKVDVTDFMVNFIGK
FT                   YKIK"
FT   gene            complement(102337..103275)
FT                   /locus_tag="Mmah_0096"
FT   CDS_pept        complement(102337..103275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0096"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG0463 Glycosyltransferase involved in cell
FT                   wall biogenesis; InterPro IPR001173; KEGG: amc:MADE_02590
FT                   glycosyl transferase, family 2; PFAM: glycosyl transferase
FT                   family 2; SPTR: A0YU19 Glycosyltransferase involved in cell
FT                   wall biogenesis-like protein; PFAM: Glycosyl transferase
FT                   family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35632"
FT                   /db_xref="GOA:D5E8X3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8X3"
FT                   /protein_id="ADE35632.1"
FT                   /translation="MKLVVMIPAYNEEDSIASVIKEIPRDCCDEVEVLVVSDGSTDNTA
FT                   EEAKKAGADRIVISKKNRGLAPTFKIGLQTALEMGADIIVNTDGDGQYNGNEIPKLIQP
FT                   VLDNKADLVLGSRTKGEIEYMPLHKKIGNRMATFITRHVSGLPVSDGQSGFRAFSRDCA
FT                   LRLNVMADYTYVQETLIQASYYDMAYTEVPIEFRKREGSSRLISNIFNYARRAGTTIAR
FT                   GYRDFHPLKTFSAIAGIFLLAGFVTGGRVLVNYFNTGAVGPYLPSAILTVLLFVIAILV
FT                   FIVALVADMLKTHRKIQDEMLYRLKKIELEE"
FT   gene            103986..104261
FT                   /locus_tag="Mmah_0097"
FT   CDS_pept        103986..104261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0097"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="InterPro IPR006339; SPTR: Q12TS3 Transcriptional
FT                   regulator, AbrB family; TIGRFAM: transcriptional regulator,
FT                   AbrB family; TIGRFAM: looped-hinge helix DNA binding
FT                   domain, AbrB family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35633"
FT                   /db_xref="GOA:D5E8X4"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8X4"
FT                   /protein_id="ADE35633.1"
FT                   /translation="MGYVMTLIDVKSVTVSKKGQITIPGAYRNSGMKIGEKAAVFVYDD
FT                   HIEIRPLSFLEEGLSCAIASQKSLSKGWDTPEEDAAWDHLKDYLGK"
FT   gene            104265..104588
FT                   /locus_tag="Mmah_0098"
FT   CDS_pept        104265..104588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0098"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dvu:DVU1509 hypothetical protein; SPTR: Q12TS1
FT                   Transcriptional modulator of MazE/toxin, MazF; PFAM:
FT                   PemK-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35634"
FT                   /db_xref="GOA:D5E8X5"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8X5"
FT                   /protein_id="ADE35634.1"
FT                   /translation="MVHKGNIVIIPFPFTDNNNTKLRPAIAVSDQMRQDVILCQVTFRK
FT                   PADNCAVWFSDSDLSEGALRQGSWIRVNKIFTMDSSNILKIIGTVHIKKQKEIQDKLLK
FT                   LFL"
FT   gene            104835..105752
FT                   /locus_tag="Mmah_0099"
FT   CDS_pept        104835..105752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0099"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR001845; SPTR: Q8TN72 Putative
FT                   uncharacterized protein; PFAM: Sugar-specific
FT                   transcriptional regulator TrmB"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35635"
FT                   /db_xref="GOA:D5E8X6"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8X6"
FT                   /protein_id="ADE35635.1"
FT                   /translation="MLNLTTIEIFKHLTHPKTVSEISTLLKLDHSTISKSINSLVESGL
FT                   VVRRKQGRYTYVTRSESLHSRSLKDILIEYPRLPLNNILTSSALTILAVLNNSCSISDI
FT                   ATKTGLNRKTVAYTIGQLAKYGIVLQENKKYFFSKRHSLIRSFVDNYWKYRTNKTLKEI
FT                   SPNAVLLWQRGPEILFKIDNDFIDSDKPVKKESIHPTAMNIFPKYGLKVISDLGYYFYS
FT                   KRDLKAEDYVIHTLLIDPYSPIYNSYALALYSKTGSTELVKFGKLYDMEDHTKTLQEYL
FT                   RIKEKNSSFLLPWNEFIDLIKDIQ"
FT   gene            105767..106606
FT                   /locus_tag="Mmah_0100"
FT   CDS_pept        105767..106606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0100"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR006025; SPTR: Q8TN74 Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35636"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8X7"
FT                   /protein_id="ADE35636.1"
FT                   /translation="MVSKSFDKQYLQKEFEKLNETLNEHVTLYLIGGGSMSFQKYKAAT
FT                   KDIDVVVGSTHELGHVVTALRSINYVIPVVRGPYKKMEANSILENTDGFRWDIFVNVIC
FT                   GGLRLSDGMIERSIQLFKMEHVSVYMICPEDIFVFKSITTRERDQEDMYSLFSKGLNFD
FT                   IIEKEFFWQNNHKQNDYAWMAFFFDGVEEFFDKYHITHPIIARLHDIAEEDMLIGFVKE
FT                   RLRTGPRQISEISDGLDQNDVEVILDKLIKQGVVLKDKYGKISLKSDDDCNQNTGYR"
FT   gene            106789..107808
FT                   /locus_tag="Mmah_0101"
FT   CDS_pept        106789..107808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0101"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q12UI5 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35637"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8X8"
FT                   /protein_id="ADE35637.1"
FT                   /translation="MGAKTTDWNNVQSHIRKYLDISPQSLHTDINTLSESIPLDFPISP
FT                   DLTIEENNAIYFIEIKSKATVDAIAKLNLLRDFCLKTKFPKEIQLVIAAKSFPEREKLL
FT                   MDQLDISMVKLPWSIKLTTEKQSKSSNHRITSAKSWKIVSRLLKEKKTSIRQLAILEDI
FT                   SYGWAHKTIQALIQQNIAKKDYNHVSISNIDKLLNGVAWERPLTNLKICEIQIPFIESM
FT                   DTARKITRAFSMQHNIPVGFTSYTAAALYTGYGVRNDAVYLYLDDDYIDYFRELFESSS
FT                   PDSIKAIIYRPDRDIFQDTLEKEGVRIVSASQTLLDLAGMGYSAMDITKEMVAKYEFL"
FT   gene            107795..108541
FT                   /locus_tag="Mmah_0102"
FT   CDS_pept        107795..108541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0102"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q12UI6 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35638"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8X9"
FT                   /protein_id="ADE35638.1"
FT                   /translation="MSSYEKMSEIINFSLDELYAITRYLHEKEDVDNPTTVLIGGWAVD
FT                   SYNSWYGSVDIDLITNNSTRNSLNYYLRKERNFVPYRLPGQPRSVRKETRAGSVIIDFA
FT                   TREKPFPFEGTDEYLDFSILDGNTESRAIRGNIEMAVPNRATLIVLKLKAIWDRNNRIS
FT                   HGNSHDIEWESGKLVKDYADILALIDPNSGGKDVEISILGKLMNTYPFLKESLASVGES
FT                   DDGIEKYGRMSESTAKRIIGQMLSLI"
FT   gene            complement(108491..108643)
FT                   /locus_tag="Mmah_0103"
FT   CDS_pept        complement(108491..108643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0103"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35639"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8Y0"
FT                   /protein_id="ADE35639.1"
FT                   /translation="MPGGGTSGMLFFIGVRCDVSRAMGFVCPALLKNRSDQRQHLSNNP
FT                   FSSAF"
FT   gene            complement(108647..109591)
FT                   /locus_tag="Mmah_0104"
FT   CDS_pept        complement(108647..109591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0104"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slo:Shew_2209 peptidase S8 and S53,
FT                   subtilisin, kexin, sedolisin; SPTR: Q12TZ1 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35640"
FT                   /db_xref="GOA:D5E8Y1"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8Y1"
FT                   /protein_id="ADE35640.1"
FT                   /translation="MQMIFNREGVLRAARLLLLTSFILIFLTPSFSLASDDTYFSGDNI
FT                   TVDLEIDANQETPAQLQLMIYNPHNKLVGNATHEFGLEKGENLVNYTMPFVTDTEGLHY
FT                   LRYDIFADLDGGWTLVQSSTQYFDGQINDPPLIEIISPTEDGVYALDEDILFSANVSDP
FT                   ESHSFSVAWRSNVSGIIGNGTSLYASLAEGMHLINVTAEDERGAASNRSILIQVVESAD
FT                   DQEDGVTAGTGGGGTGSATIVTDTSLEDDTAAAGDGDATVSPGDREQTDVPDGDTDETP
FT                   VGPEQEEESSFLPGFGAVFVVIGLLLAARFKRK"
FT   sig_peptide     complement(109490..109591)
FT                   /locus_tag="Mmah_0104"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(109595..120376)
FT                   /locus_tag="Mmah_0105"
FT   CDS_pept        complement(109595..120376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0105"
FT                   /product="conserved repeat domain protein"
FT                   /note="InterPro IPR002931:IPR016160:IPR001434; KEGG:
FT                   geo:Geob_3466 transglutaminase domain protein; PFAM:
FT                   transglutaminase domain protein; SMART: transglutaminase
FT                   domain protein; SPTR: B6KF59 Putative uncharacterized
FT                   protein; TIGRFAM: conserved repeat domain protein; PFAM:
FT                   Transglutaminase-like superfamily; TIGRFAM: conserved
FT                   repeat domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35641"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8Y2"
FT                   /protein_id="ADE35641.1"
FT                   /translation="MKDTTKIISIILICIMITASFAGAAPSVVDNETHFDPLEKTDENP
FT                   KLKLMHRSIDYDAAPLSSSYITPSYESQNNPPSESDLDLRFAADASIDILDSAEKNQYD
FT                   PGLIYSFVHNYFEYIPYFGSLKGAHLTYQDREGNDADLASLTISLLRASDIPARYVYGT
FT                   IELDNNQAMNYFGVENESVIVDMLRKNGISAQAVSGGIQFDHVWVEAYVDGQWVEFDPS
FT                   FKQYNYTPGVDLMALARDSENYNSMLDDNIETSGDEVTSINVSGIDSSFTLMSNNFSTL
FT                   LNEEYANKSNSEIFGAKEIIPHTDYYTLPEQLPYKVVGVHGEYPNLPDSFNHKLDIKLA
FT                   GINVTLNTTELAGKRISVFYEPSTEKDSDLLNSSDNLSEVNALDINMSALLQVDGALIA
FT                   AGQPSTLGSEQELEIGFIAPGGQIDAYTRTLQTGAYFVIGLALQPVSTAHMSERVERYE
FT                   VTSELLDLEYFDVTKDELYGELLNLQALTFWGKYRLYNSIAAASTDVTYTRHPSVMLVG
FT                   TQFNVTETNDTRSVHMNGVYTDIVRDIINPTAKDGDSAKSYAFLFSRGMTASSMEKSML
FT                   SLSYNVTAYSTSEIIKIAGENGIPILTLNSSNWDNAGSNLNISKNDKTIVENAVDSGYT
FT                   VIIPRDEVVAGNFTGSVFIVFDPQTGASSYYGPNGKGWGWLDTLKTGLEAGVSAVGSVA
FT                   KGTAKVIADTGGKVAGVATGVISTVGEAVTGTGSTVARVAKTAVTGAVNAAGYVVTTVV
FT                   PTAAAGVTAATTAGLVVVTAFTADRVTELGKTVIDVYDAKADYEKSVKEYRQTQEEIKE
FT                   KKEQIKKEELEQKREELKEKKKELEEKKEKVEEEEEIDLDKEKEEKEDKEDEVDEEEKE
FT                   DEDDFPGDEEKPDEIELEDEIELDDLPEPEDDPIEPSSPGGDHPDDTFSVASSKLRNTD
FT                   VTSLQIRNAYKKGYTNPVYLNEYRLGQLERANVSNYTDTAELNKLYELSNSQADVYSTI
FT                   VNNYTAIKEELELAPDVLMLQKGFYASAQAMVENRGIPVKLTRVQDFAVADTQQLVHDT
FT                   PILFLPSGSLYGLDSSTQIQNKLEEYAATGGTVFVMAQQHGYEYSILPHNGTRALGGAG
FT                   WQEDQSCLYNAASIGTYHPAVSGQPKPTLTVNIDGYFTSYPENTTIILKRNKNSMPAML
FT                   AYDYYNGTVIATSVYDDWAYFDGASTLQGELLVRDVLAWAENPANVEAMLETDSIDTPV
FT                   NITNKGDFAATQVIFKFTDPLGNTEVENTIDLDPELEPGASKQINFSYKPKTGSTLGVW
FT                   NLDYILVNESDTAYTEYDARKMAIGKYVASDQGYSTTPDITYSIRSTNDRFAYGSDAVF
FT                   TVTVWNNGDTDQNVTLNYCFPHHGWIEYDLAYGIAKDRSWYNLEKTLEVPAQGSTSFNH
FT                   KLENVRTFDRLWSRLYDTDGNKIGSATLGLYCFSPKLDIEFDSGDIFKTKSNNTLNYTI
FT                   MRSTGDIPNASIDVKIYDSKSNLVKRETTTSNITATSVYNGSIEFSPQNKGSYNFVVEV
FT                   TNNGKLIGTNSQYILAKDRVLNLIVAQEPDFSFYETNNFSIDIENMEITNFSDLVLETS
FT                   YINPDGDINYSDTTTFDIESETTKNLNVSIPFDRVATGVHKTTFKLLEDAEVVDKKESS
FT                   FVYSPTLWTHLSSTTLVRDTEETLTVYVNNGDAAAELIVDISSDMGFQNQSSILFEAGE
FT                   RKNIEYTIPVESDVSAGSIMVELRANGSSKQNSPLKTSSISYTGGDSKLMPTLQANIVA
FT                   GNNLTFSITNEGPADTSMSYSYYFLGHSDKDEIDIAANETLSHEIPVPMISSGDYNFRL
FT                   NLQNLGTDRTTRQLIPVHVQGLDLDMSMEEEELEADMYIPVKLNNSGIEITVNLEAQLT
FT                   RGYEKTVLTAENVTIGAGEVKVVELPLDPSLSSGAYSLHLSYENSSYNVRSDKYYNPKI
FT                   EGLGLDFDVAKKEYAAGDTLDLTIDNTGAIDTRSNVTVRLGNNDLGTQQAAVDVGEQSV
FT                   LTYTLPENLPTATFGLFVNCEEANSGGVLTFSKSIPVSGLEYSLELQPQTVKPGQNLTA
FT                   SVSNTGTIALSGNYDLSIYDGYTLIEGSSGQVSAIAPGETELLELEVPSTIDSGTYTFI
FT                   FELTDQLDSTDSKTVSVYIPDASFEMTLDDAEYLQGGSIGVTANISNIENGSFTMSLFD
FT                   GQDNTIATSPPEEHNASSGSVNLTFSIPEGIMSGPYVLFVEVKDQASGLSNSTSQSLAI
FT                   EGINIEPHIETANTKYLEGDTIDYEVRLNHSGTLPQGDAYIKAYLQEDMGSSGEFTLES
FT                   KYPATGFERFGDTLFIGTSGGLYTETGFAEMQPVENSELAAMEISGLDVDGNLLWILSD
FT                   NTVYNYDPVSDMLDEVLVVEKQEDEGHQEGGSSLFAVDSSEQVIYMPNGWEGLAAYGFD
FT                   GSVTYYTSENSPLGEVTDILVLPDEVLFVDYDYTNDSSSCHSLSDGIWSTYDSSDGLLS
FT                   DNVYSAVSDGNNVYFITDAGISSRDVSGGAIGTEYEFGTGESVSGVDAAGVFDGIVYFV
FT                   SYSDLYRYDSSESTLNVSTIFDNWLQMSDLGVGNSALWFCDYWNGLFTSDKTASEIGDV
FT                   SEVPIPDTFSPDGTITGDSDVIVSADGKSVYIYDIASQVWNRMEVPVELGVSDVTFMAD
FT                   HIWIASDADLIGIDKNTGDISIFNESNSDYNESSVSLIENHKGDIWVLGGGGVSVYSIS
FT                   DGLSTASINSPDISDPEDITAFEEIVAVINSSGTIHEYNYMSDNVRTYETGITDWNGLE
FT                   LEYNQDIYWVLKTGGSELYSYNPATEETSGPEESTGSTYGLATAGEKLYAVADWLYIFD
FT                   GQTWNEYTGDLIPEDSDIGIESAGENVLLYAEYGDGWITSLSGQGRQLVMDRTVQFADF
FT                   STEGTWQNTYIPDRSGQLTFEVEAVTDLKQITDQAKLSVDVYERDVSVALSTAKEYYRP
FT                   DEPINATVRVSNNAPATFESELVSSINKDEIGREDLVIESGDSLKFEIPVSNLPVGDHT
FT                   LRVRVGDAGVSRDIVVANPEIEVSMNVPEVVSSNPFTVELFANNPGNVTAKTGVTVTNL
FT                   SIEEEFDLILAPGTSQYLALNTTIANNTTVVAEFTGDIDTRLTEDMEFGERAHIDTQCQ
FT                   TIYRPGTVEIPVNVTNTGQYKTDFNVSFSVNDTTSLHKSYILGINQSVDDVLAFDLAAG
FT                   DYNLSADATGQIPVEFEKVAFQVGQTTGFELGKAEVVSGNLSFMVNLSNKQPGIAFNGT
FT                   VEIITDFYESTEQVNLSALENTSIGHNISLPELTPGNYTLQAQLLESQEVIQIANSTFT
FT                   IQAPEFTVAPSLNKQNVQPGEILKYNFTVSNTGSIGAMADMYLDVPGVYEDTLTSWIAS
FT                   EDSHNFSFSFKAPDDLAEGYYPLYYGLEEDNLTESRFYLEGANVTVNSWLDKRAYLPGE
FT                   NATLTMQVENNGNYPLELYSRVKYFDFDDVHEFTVDKNSTTTFTVDIPTPQTDNKVFIS
FT                   VYLDSPEGDEDSGRSLYINSDYIHDRRDVNGLRISTERQAYETGETVVMNVNVTRADNL
FT                   TVVGPGLDYNGYIAVNTTIDFEVPNVLSGVYRYEITYGDATGQYLLDIHGFDLIVKAAQ
FT                   VGPGRGGE"
FT   sig_peptide     complement(120305..120376)
FT                   /locus_tag="Mmah_0105"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            121184..122335
FT                   /locus_tag="Mmah_0106"
FT   CDS_pept        121184..122335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0106"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="COGs: COG0675 Transposase and inactivated
FT                   derivatives; InterPro IPR010095; KEGG: noc:Noc_2902
FT                   transposase; PFAM: transposase IS605 OrfB; SPTR: Q12TW2
FT                   Transposase; TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   Putative transposase DNA-binding domain; Probable
FT                   transposase; TIGRFAM: transposase, IS605 OrfB family,
FT                   central region; transposase, putative, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35642"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8Y3"
FT                   /protein_id="ADE35642.1"
FT                   /translation="MFLTKTVILKIANPDNDLVETMKKYSDGMNYASEVLFDKGKPIPA
FT                   MKLQQEVYPYLRETLKLKSQMSCNIPRQVAGCYKTLKKQKKAKWQKVEFSPSSMTFSYK
FT                   RDFVIDEDTVKITTINGRKAYSILNYDYAKQYFEGSWKYQASKVVKHKDGDYYFHLSLE
FT                   KEAPDKEITDASTFMGIDVGMNYLAVASTTDRKCSFFAGGEIKNLRNQYKSMRKRLQSK
FT                   GTLSAKRMLKYISGKEKRLMRDVNHTISKEIVKFAVKNKVSVIGLEDLTGIRDSTLSKV
FT                   SKKRRHNHSSWAFRQLQTFIEYKAKEVGIITHYVDPSYTSQTCIRCNHISKNNRNRLSF
FT                   RCEKCDYANNADLIGAMNIEHKTRDYRYILESQGCLSATQTNA"
FT   gene            complement(122773..127926)
FT                   /locus_tag="Mmah_0107"
FT   CDS_pept        complement(122773..127926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0107"
FT                   /product="PKD domain containing protein"
FT                   /note="InterPro IPR000601; KEGG: gem:GM21_2451 fibronectin
FT                   type III domain protein; PFAM: PKD domain containing
FT                   protein; SMART: PKD domain containing protein; SPTR: Q12XJ3
FT                   KP-43 peptidase. Serine peptidase. MEROPS family S08A;
FT                   TIGRFAM: LPXTG-motif cell wall anchor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35643"
FT                   /db_xref="GOA:D5E8Y4"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8Y4"
FT                   /protein_id="ADE35643.1"
FT                   /translation="MEYKLNQIRKIILLSFLITISLIIGILSFSVMAMADSGEDSSIGG
FT                   VRAAEKDGCMFLGSDFIEVGILPNGGFGADTNAPESFFGSERSGGIGLYADLDGFYNDT
FT                   YDYRYDYFLPGSPEERWSVGFMKDGTKYSDSNGRNAGYNIPTTITNITNSKTGHITVDS
FT                   IYEDKLVINQTYELKPTERFLKVNVTLTNAGPDMMENVRYQRSFDPDNGVDVGCNYATK
FT                   NTIVSQQGTSNKAIVKAELKDGDLSTDIGQISSIPIFYYTQDEDARVSYGSSGLIPNNP
FT                   PYGDLDWDSAPSEGDSVEADSYIALTFNKSSLAPGQSVDYTFYIGLTKNIDETISDVEE
FT                   DAGNTDSSPSIFNSTPEAFFINNDGTNRDVNTNFTFAYSGENVSLMTQLNNSSVTAVTA
FT                   NFSTIPGEPAGQIPFEYHGEGIFTLLNHTLPDSEPGIYYITILANSSGQMNSTICPVML
FT                   NFNPKTDISGLANPNTTDWTTIDDLTNVSNLTFEANDGNGNVIGSMEFTETVNLCDIEF
FT                   AQKLQQFGEYVNFATAQTTLDSENLSRLNVSSNLTMRGLESFDSQPGILLNDQPILQTG
FT                   QTSNGSVSGLQWDAENGTLSFSTEHWSTYTADGEAPEVNPNSPVAEIIGPGSLLELNVS
FT                   VSDTSTVSSVVVNVSSINNTIDEAILSNNNDYWTNNSVIADVTIDGQYDLNINATDAVG
FT                   NSNSSVNCSVIMDSLPPEIEISGNFTQWQNSSALIDVSLNDDNEIAKVKWDSGDYEASH
FT                   FATNGNEISSPYDFTVTSNGSYTVYAQDAAGNENISVVHVSKIDTTDAIVIFGTNGNNT
FT                   YSNIHSTTVSASDALSGIEKLEYSWTQTEESAGSWQGFTNDAILSKEDVDGDWYLHIRA
FT                   TDNASNINHSVSNVFKFDSNSPEINAVEHPVNVNTGDTIEIGFNVTDNIGITSTEFNIS
FT                   TNDTAELTKNDNWYNYTLNVPVDSVEDIVFNATFYDDAGNLNASGDKTINVSDNIPPVI
FT                   QYIVYEEDVNTGQTTVISFNVTDNIEITSTEFNISTNDTAELNENGNWYNYTLNVPIDS
FT                   VEDIVFNATFYDDAGNYNASGDKTINVSDNIAPVIQYIVYEEDVNTGQTTVIGFNVSDN
FT                   IGITSTEFNISTNDTSELTKNDNWYNYTLNVPMDSVEDIVFNATFYDDAGNYNTSGDKT
FT                   INVSDNIKPSYNWSDKVQSANTGDNITIKINATDNIGVEMYNITVDGEEYQMKEDSGNY
FT                   THNISIPASDSGTLVSSITYNCTFGDAAGNMNSTGDVVIDVSILPIADFSANVTRGTQP
FT                   LSVEFTDNSSGLVDTWNWDFGDGNTSTNQGPSHVFGAGNFTVNLTVNNTNGTSTKYLNI
FT                   RAAYEPAYTVSPNKTELLTTYGEERNFNINSTLYSSYEWFIDGTPLNGTGVTLYNNNTD
FT                   DSAHMSYCNVNTSQYINQDDFFMDVYNVSAHVSNESLGRTDVFSWQWTVTKSSANDADD
FT                   IDQIINTIPQVNTSGNESHVRFNTSNQTSKKTGVECSIDFVSFNTSNETDDIQIKIEVL
FT                   NTSALNESEIDFSKGSVYQYMDISFNNESLVNDGSKNRSIEFKVMNNVDGGSLLIDTVY
FT                   LKHKSTSGWQSYEPELLRNDGTYSYFIVRDIPGFSPFAVTADYKYDSGSKSDDGIPAYL
FT                   KLQMLQNGSVTMDDEEIVTPEPESDSGTVQEDTTSDSSEQTTDDVPKSDEEDSSQSLFI
FT                   GIGVLALIAILVLVFKKREN"
FT   sig_peptide     complement(127822..127926)
FT                   /locus_tag="Mmah_0107"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            128856..132728
FT                   /locus_tag="Mmah_0108"
FT   CDS_pept        128856..132728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0108"
FT                   /product="periplasmic copper-binding protein"
FT                   /note="InterPro IPR007742:IPR006626:IPR006633; KEGG:
FT                   asu:Asuc_1158 YadA domain-containing protein; PFAM:
FT                   periplasmic copper-binding; SMART: Carbohydrate-binding and
FT                   sugar hydrolysis; Parallel beta-helix repeat; SPTR: Q8PRX0
FT                   Conserved protein; PFAM: Periplasmic copper-binding protein
FT                   (NosD)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35644"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR006633"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR022441"
FT                   /db_xref="InterPro:IPR026453"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8Y5"
FT                   /protein_id="ADE35644.1"
FT                   /translation="MRIPLILLILTIMMVGTAGANTLNVTDESTTNNYTTIQYAVDNAT
FT                   SGDTIHVYPGTYSENVVVNKELNIISVDGASATHVMAAASSDHVFNISANNVTIDGFNV
FT                   SGADESDFGKMSAGIYLRNVTKCTIFNNILSNNRYGIYLAASNNNNLTGNNVSENSVAG
FT                   IHLDSSHGNYLVNNNISDNIDRGINIDLSNYNNLTNNEITKNSLQGISLYKSTENSMVS
FT                   NTISGNGYTNYGAEAGIYLGSSTDNNIYNNWFNNSVNFKVMSGCDYNNWNTTSTTGPNI
FT                   IGGPHIGGNYWATPDGDGFSQVNTDSNGDGFCDTPEDTYVIHEVQNNYDYLPLAGDNKE
FT                   PSVVPITPPADKRIGPGHLLELNVSVTDTSEISSVVINVSSINNTINEIPLTNVSGYWV
FT                   NNITVDTIADGVYNLSINATDVYGNSNTSVDISVERDSFVTVGAEGKDDTTIQNAINNT
FT                   YDGDTIQVFPGTYEENLVVDKGLTIHAASDDPSETVIKAATSSQVIRINPEYGSQSNFT
FT                   ITGFTIDGNDTSYEGLSLYSNLKEVSPANYNFTFTDNVITNVSSTALTVNGLNEVHILN
FT                   NNITDIGYAGIIARNINGLEINNNSLTNISSRSPESYSPDSVDVASRVMSAGISVSGVY
FT                   EINIKDNVIQKCGSDGIHISPINDIYVQGQETYHEYAQSISVSGNEIHGVEYNGISIEG
FT                   DRIVSKDISENVDYTLIINDNVIKSRYSGIYVEDTKSIECIDITNNDINSSSSSIDTIL
FT                   SSINLPSGILIVGEMVGVDVSEESTPDTSIKEVSINNNSINRSFIGIFVLGTSSPQIQD
FT                   NIISSSKIGIAYGFNSEIGQHPVIAKNHIYNTSYGIDIFGITNLSISDNTINEFTEVGI
FT                   GCEFTQNTSLNGNIINAGTEGEKGTGIQVSQSENATIRDNSIESARYGLYFEDSANRYN
FT                   SIAMATDAEISITRPPSFSTQNSTVSGNTISNNGAGGIYLEYAENNTFYNNYLNNINNT
FT                   VFGEGVANNTWNTTVTAGPNIIGGPRIGGNFWATPQGDGFGQVNVDSTSNGFCDNPRGS
FT                   YNISGSGQYDYLPLAATTESKKVSSSGGRVYVGPSMPAENVQNTDSGIKRVLAGSNVKY
FT                   DFSENAGSVFGISFDAKDDKGNVVAKVQVLKDKPDDVDTPSGNSYQMMSITVGNQDTIS
FT                   ENNADNILIEFKVSKEWTEQNNIDPTTIRMTRFHDGDWQDLPSNEVGEDDEYFYFTAET
FT                   SGFSVFSIVGDEYKEVIEELVAEESEVEDVEEPASENQNAQTPGFTGMFAVALIAGAAL
FT                   VMQKKD"
FT   sig_peptide     128856..128915
FT                   /locus_tag="Mmah_0108"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            132735..136460
FT                   /locus_tag="Mmah_0109"
FT   CDS_pept        132735..136460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0109"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="COGs: COG3291 FOG: PKD repeat; InterPro
FT                   IPR000209:IPR000601; KEGG: geo:Geob_2986 peptidase S8 and
FT                   S53 subtilisin kexin sedolisin; PFAM: peptidase S8 and S53
FT                   subtilisin kexin sedolisin; PKD domain containing protein;
FT                   SMART: PKD domain containing protein; SPTR: Q12XJ3 KP-43
FT                   peptidase. Serine peptidase. MEROPS family S08A; PFAM: PKD
FT                   domain; Subtilase family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35645"
FT                   /db_xref="GOA:D5E8Y6"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR026453"
FT                   /db_xref="InterPro:IPR034058"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8Y6"
FT                   /protein_id="ADE35645.1"
FT                   /translation="MGIPHSFLAFSIKEVIYIINQMKMMDYRVVSVTILFLLLCSFFTC
FT                   SAALAKNSDTPFDHIFLKNATINPGQTPLVGTNTVTISNDGSKGYYLVQFQNPILPDWK
FT                   VQIEKISEISGYVPENTYILHLNGSQINRIKSLPYFKWMGEYKPEYKVDPDLYGLDGET
FT                   IIVISTFKSNSAELKNSLLEMDASLVAENGNQIRVKINGSVIPLIAQCANVVWIEPYNP
FT                   PVILNDKAGEIIGVDRVASPHNLTGANQTIAIADTGLDTGNLSTLHPDIGGRVDALYDW
FT                   SDGNPADNNGHGTHVAGSALGNGYLSAGQYKGMAPEAHLFFQACGDGSKTLNIPPLNQL
FT                   FIEAYNNGSRIHSNSWGSSSSYATDAKALDNFTWHHPDMLILFAAGNDGPSTGTINSPG
FT                   IAKNALTVGASENYRPERGGDSDNPSDIADFSSRGPTFDGRIKPDIVTPGTSIYSTASS
FT                   LVYPEDYVYMSGTSMATPVTAGSAALIRQYFMNNIPIHPSAALLKATLINGAVDLNHSY
FT                   YSQGWGRLDLTKSIDPVFPAHIRLHDNINLSTNTSWTAKYYVDNTQTPLKATLVWTDYP
FT                   ATASASKALVNNLDLVITSPNYSKYYGNGAPDNVNNVEQIQIDSPEAGWYSFSVNGTKV
FT                   PQGSEQPFAFVISGGSLNNETVVKKATVEPESIGASGPENAILKVELNEHLVNSAVYAD
FT                   LSQLGLPSQQNLTNNSGIWEYELNSKSEGTYYFGINVTYNESSYDNSTFVKLNIIDNIP
FT                   PANVTDLYPVNTGYSWINWSWTNPNDSDFSNSLVYIDGIQEATLNRTHYNATGLFPNTS
FT                   HTISIRTVDNNGNINQNWTNNTSGTQTDVIYPQIHDIMVNNSENLTAGELLEITVNSTD
FT                   DYMLSEVLANGKQLSNLEGTLWRGNLVILPGMQYINISAMDTSGNKVWNNSTCYSGLIM
FT                   PQAHFTSNVTSGKVPLSVQFNDTSHNATEWNWDIDGDSSIDYAIQNPSHVYNKTGAYSV
FT                   TLTVNNTNGTDTYSFENYIEVEPRNPATNGGGSGGGGGSTTAEDYSNIIFKDFSIRSIT
FT                   VDEPVTYEFKEPKNPVRQIDLISARNAGQVKFTVELLKNTSSLVNKPSAGLVYHNLNIW
FT                   AENSAFSENIQNSSVIFRIDQDWFDQENVDVKDIVLEVFENGTWIALPTEYINKSTNYL
FT                   YFKADTDRYLNAPFVIMGTEYIKEIEEPIAEKPELEPQSEKESQSENQDAQTPGFTGMF
FT                   VVALIAGAALVMRKRI"
FT   sig_peptide     132735..132884
FT                   /locus_tag="Mmah_0109"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(136476..138275)
FT                   /locus_tag="Mmah_0110"
FT   CDS_pept        complement(136476..138275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0110"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterProIPR004358:IPR013655:IPR003594:IPR003661:IPR
FT                   001610:IPR000014:IPR000700:IPR005467; KEGG: dat:HRM2_p00340
FT                   predicted sensory/regulatory protein RpfC; PFAM:
FT                   ATP-binding region ATPase domain protein; PAS fold-3 domain
FT                   protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; PAC repeat-containing protein; PAS domain
FT                   containing protein; SPTR: Q12ZM3 Sensor protein; TIGRFAM:
FT                   PAS sensor protein; PFAM: Histidine kinase-, DNA gyrase B-,
FT                   and HSP90-like ATPase; His Kinase A (phosphoacceptor)
FT                   domain; PAS fold; TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35646"
FT                   /db_xref="GOA:D5E8Z5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8Z5"
FT                   /protein_id="ADE35646.1"
FT                   /translation="MRGGEALRCLHHLDDPKGCGYGPYCGECIVRNTVLDTFETGNPHY
FT                   MMETTLPFSVDGNEKEMTLLVSTELLSIEEEEPHVLVSILDITERKDMEKELKISEKRF
FT                   REIYSESPIPIEIYDSEGHLANANTSCLKLFGISDVAEVKDFNLFDDPNLPADTRAQLL
FT                   AGQTVEYETVFDFELVKKLDLYKTNRSGSIHVNVKISALCTDCIDGYLVHVQDITKRKQ
FT                   AEEKVRQSEERLELALKGTRAGIWDWDVQTGKTYFDERWAEIVGYNPDELKPDIQTWID
FT                   LTHPKDYKRAEELLNKHFAGETENYECQLRMKHKNGHWVWIEDRGRVVEWSRDGKPKRM
FT                   TGTHIDITDRKMAENAIIQSKVLAEQANRTKSEFLANMSHELRTPLNSIIGYSQILNQN
FT                   PSGNLDEKELKYSHNILNSGEHLLELINSILDISKVEAGKMEYEPERVNLPETIDDIIG
FT                   LVKPLAMKKSIDIRFINNSAIAKVWVDRVKFKQILHNLLSNAIKFTPEKGEVKIYLSTD
FT                   DGTAQISVADTGIGIPAEKIEDIFDPFKQVNSSSSREYEGTGLGLALVKKYVEMHDGEI
FT                   WVESEVGAGSTFTFTLSVKEVKG"
FT   gene            complement(138345..139157)
FT                   /locus_tag="Mmah_0111"
FT   CDS_pept        complement(138345..139157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0111"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="InterProIPR013655:IPR013767:IPR013656:IPR001610:IPR
FT                   000014:IPR000700; KEGG: lch:Lcho_2590 multi-sensor hybrid
FT                   histidine kinase; PFAM: PAS fold-4 domain protein; PAS fold
FT                   domain protein; PAS fold-3 domain protein; SMART: PAS
FT                   domain containing protein; PAC repeat-containing protein;
FT                   SPTR: Q12XC9 Sensor protein; TIGRFAM: PAS sensor protein;
FT                   PFAM: PAS fold; TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35647"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8Z6"
FT                   /protein_id="ADE35647.1"
FT                   /translation="MFDLWEDNIAIISPAGIISYANKSWKQFAIDNDLDPQECSEGINY
FT                   LKVCQEATGEYSNEARIALEGIQDVIHGRKRTFKLEYPCHSPEKQRWFLLKATPLSKTV
FT                   PTSVLLQHIDITERKLAEEDVKRKAHMLKSVGEAVIATDPQGYIDYMNKAAEELYGCRL
FT                   EEVRGSNIVNVTPATATREQAREIMTELSKGRRWEGEFGVYRTDGTEFSAHVTDTPIVD
FT                   DNGEMTGIIGISYDITERRLAEENLRRSKDELAAIYKNAPMIMMLLDK"
FT   gene            139602..142274
FT                   /locus_tag="Mmah_0112"
FT   CDS_pept        139602..142274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0112"
FT                   /product="peptidase C1A papain"
FT                   /note="COGs: COG4870 Cysteine protease; InterPro
FT                   IPR003961:IPR000668:IPR000169; KEGG: sfu:Sfum_0903
FT                   peptidase C1A, papain; PFAM: peptidase C1A papain;
FT                   Fibronectin type III domain protein; SMART: peptidase C1A
FT                   papain; Fibronectin type III domain protein; SPTR: Q8PSK6
FT                   Surface layer protein B; PFAM: Fibronectin type III domain;
FT                   Papain family cysteine protease"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35648"
FT                   /db_xref="GOA:D5E8Z7"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR000668"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR025660"
FT                   /db_xref="InterPro:IPR026453"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR040528"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8Z7"
FT                   /protein_id="ADE35648.1"
FT                   /translation="MLKRILLLTIITLLLLNTAALASENNPEITSAPLNPDFIDYQSSL
FT                   QKSDEKTMLASSAQTPSYSLGLVPSPVDLSHLQPKKPGNNRLFTAQSLPGSYDLREHNR
FT                   LTPVKDQGDTGSCWTFATYASLESCTYDEGPYNFSENHMKNILSNESPTGFDFEQGGSL
FT                   DMATAYLARWSGPVNETDDPYSDNSSYNDYTNPDKPVTRHVQEVIYLPPRNNVSANDHL
FT                   KEAVREYGALYTSFKVNRSAFADNATTYYYNGSEYEGGHAVALVGWNDSFPKEEFIYEP
FT                   PGDGAFIVKNSWGTELGDSGYLYISYYEETFNAWAAAIFLSAANVDNHDNIYQYDPLGY
FT                   TDSRGFSNSTTVHGANVFQSSSEEYLEAVSFYTTDTNAVYNVSIYTNLSSSTPVGQTLV
FT                   AQTNGTFAHAGYHTVTLDTPVNLAEGQKFSVTNKISNPEHEYPLAAEYPESNYSSRASA
FT                   NPNESFMSFDGSNWTDVGKLNNTSICIKAFTSAPPSNVSNLTAVVGSYWINWTWSNPDD
FT                   KDFNHTEIYVNDTLISNTSDTYYNLTGLLDATNHSIGLRTVDTDGYVNSTWINNTSQTL
FT                   DIAPAAVTDLHVTSSTSDSITWGWTNPANHDFDHVEIYLDNVFQANTSESVYRVSDLKS
FT                   GHAYKIGLKTVDKAGNINNTTINDIASTKSKSSGNAVKGITTSREGRENIVSKSSQIQK
FT                   VVADENVYYDFEDGSISFIEFKGTSNAGQIKILIENLKDTSSLVDQQPPGKVYSNFNVW
FT                   VGDNRFDTNNLEDSMIGFKVSKTWLNDINPDSVVLLHYTNAWQVLDTVQTEEDADYFYF
FT                   EAQADGFSPFAISAVDSTTGTDEISRPDDSEQSASGSAEPTAGNPSENTTEPAETIPGP
FT                   GVLAVLGIICILYVIRTRL"
FT   sig_peptide     139602..139667
FT                   /locus_tag="Mmah_0112"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            142528..143439
FT                   /locus_tag="Mmah_0113"
FT   CDS_pept        142528..143439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0113"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="COGs: COG0451 Nucleoside-diphosphate-sugar
FT                   epimerase;
FT                   InterProIPR013120:IPR002225:IPR003869:IPR002198:IPR
FT                   005913:IPR001509; KEGG: mxa:MXAN_3507 UDP-glucose
FT                   4-epimerase; PFAM: NAD-dependent epimerase/dehydratase;
FT                   Male sterility domain; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; polysaccharide biosynthesis
FT                   protein CapD; short-chain dehydrogenase/reductase SDR;
FT                   dTDP-4-dehydrorhamnose reductase; SPTR: Q12UG3
FT                   NAD-dependent epimerase/dehydratase; PFAM: NAD dependent
FT                   epimerase/dehydratase family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35649"
FT                   /db_xref="GOA:D5E8Z8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8Z8"
FT                   /protein_id="ADE35649.1"
FT                   /translation="MQTILITGGLGQVGSYLTDRFCRENKVIVLDNTFSPCRHEVPAGV
FT                   QLVIGDIQGPEAVRLVGQADVVIHTAAQIDVNRSMEQPMFDCENNILGTLNLLEAARQT
FT                   NLKRFIYFSSAAIYGETLQMPVSENHPTQPLSPYGVSKLTGEQYALMYHRAFNLPISVL
FT                   RPFNIYSPRQDPSNPYSGVITKFIERTKAGQSPVIFGDGEQTRDFISVHDIVDLVQLLV
FT                   EKEDAIGKVFNAGTGKQTSVNRLAGIVQHVFDSDLPLEYRQARIGDIRHSVADISAAKT
FT                   LGFVPKVSLEDGLAEFVKKCEF"
FT   gene            143732..144616
FT                   /locus_tag="Mmah_0114"
FT   CDS_pept        143732..144616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0114"
FT                   /product="Protein of unknown function DUF1616"
FT                   /note="COGs: COG4743 membrane protein; InterPro IPR011674;
FT                   PFAM: Protein of unknown function DUF1616; SPTR: Q12UJ0
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF1616)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35650"
FT                   /db_xref="GOA:D5E8Z9"
FT                   /db_xref="InterPro:IPR011674"
FT                   /db_xref="InterPro:IPR014495"
FT                   /db_xref="UniProtKB/TrEMBL:D5E8Z9"
FT                   /protein_id="ADE35650.1"
FT                   /translation="MADIKKIPVDIRIVVGLVLLTGVFILIPPLSDSAIRTVLGLPMVL
FT                   FLPGYALIAALFPKNDDLDGIERVALSFGLSIAVVPLIGLGLNYTPWGIRLMPILISLS
FT                   IFTIGMCIIAVIRRSNLAEEEAFYVPFRQSYESLKNEFHSESRSRLDRALTIILIISIL
FT                   ASVVTLVYVVVTPKQGEQFTEFYILGAGGMADDYPVNYTLGDSGKVIIGVVNHEYENVN
FT                   YTVDIQLENQSLQTIQQVNLEHNQTWQQPVTVTPPFNGTDMKLQFLLYKNGNYTESYRD
FT                   LHLWINVSEDTNE"
FT   gene            144609..145445
FT                   /locus_tag="Mmah_0115"
FT   CDS_pept        144609..145445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0115"
FT                   /product="Abortive infection protein"
FT                   /note="InterPro IPR003675; KEGG: pag:PLES_55221
FT                   hypothetical protein; PFAM: Abortive infection protein;
FT                   SPTR: Q12UI9 Abortive infection protein; PFAM: CAAX amino
FT                   terminal protease family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35651"
FT                   /db_xref="GOA:D5E900"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D5E900"
FT                   /protein_id="ADE35651.1"
FT                   /translation="MSESHPFKSMDLPGLSGVQLNRNSAVILVPVLLIMLAEMLLFVEM
FT                   DYLSICIHVALLLGLPLAAIFFDNREITMAFQALMLLPLLRLVNISMPIFFETTLYVFV
FT                   FIYAPLIIPVYLVAKEQDFTLSLRGFRDVNRMWLVYIFLAILVAILIAQGEYAILASNY
FT                   LIPDLSFISLLKISLVMVFFVGFIEELIFRFILQTRLADTFGVWPGLIIASLLFGVMHS
FT                   GYGAPLEVLMTAFAGLILGYMFLRTKSISFVSFTHGFVNVFLFGVIPHLGPGLGLF"
FT   gene            complement(145538..145795)
FT                   /locus_tag="Mmah_0116"
FT   CDS_pept        complement(145538..145795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0116"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q12UI8 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35652"
FT                   /db_xref="GOA:D5E901"
FT                   /db_xref="UniProtKB/TrEMBL:D5E901"
FT                   /protein_id="ADE35652.1"
FT                   /translation="MLTSVISTTSAISSAAGAISMTTGIGLPEYGVLAVIGLILLLSAK
FT                   EILSASSKWNKTLNTSLNMGIMPLLVAFVAIVVFKVAEIV"
FT   sig_peptide     complement(145742..145795)
FT                   /locus_tag="Mmah_0116"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(146017..146274)
FT                   /locus_tag="Mmah_0117"
FT   CDS_pept        complement(146017..146274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0117"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q12UI8 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35653"
FT                   /db_xref="GOA:D5E902"
FT                   /db_xref="UniProtKB/TrEMBL:D5E902"
FT                   /protein_id="ADE35653.1"
FT                   /translation="MLTSVISTTSAISSAAGAISMTTGIGLPEYGVLAVIGLILLLSAK
FT                   EILSASSKWNRTLNTSLNMGIMPLLVAFVAIVVFKVAEIV"
FT   sig_peptide     complement(146221..146274)
FT                   /locus_tag="Mmah_0117"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(146380..148383)
FT                   /locus_tag="Mmah_0118"
FT   CDS_pept        complement(146380..148383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0118"
FT                   /product="PKD domain containing protein"
FT                   /note="COGs: COG3291 FOG: PKD repeat; InterPro
FT                   IPR000601:IPR013838; KEGG: sfu:Sfum_0807 hypothetical
FT                   protein; PFAM: PKD domain containing protein; SMART: PKD
FT                   domain containing protein; SPTR: Q12UI7 Putative
FT                   uncharacterized protein; PFAM: PKD domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35654"
FT                   /db_xref="GOA:D5E903"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR026371"
FT                   /db_xref="InterPro:IPR026453"
FT                   /db_xref="InterPro:IPR026595"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:D5E903"
FT                   /protein_id="ADE35654.1"
FT                   /translation="MRELKHSIFVLLLLIASTALIISGSAGAATNDDVIMEMTVDDSTF
FT                   NFANHESDIDGNWIQLQGGEAFQLPSPMSFTYNGVNNTSFTKKGINISIDLNVDEYSDH
FT                   KIIYPYETHPMYVTGDDVSFTFDGSESFADKDVEVSLIKTNASGLYSAIDKLMDGEKDD
FT                   IANLMNSDKNPKNRTLDEKGDCFVNYGSLDPADYIIVIIEDDPTNPLLSATAFTVLDHD
FT                   STTEVKDTENGKEVTVSMPNANKSDYIYEAIYIEESEYIEESEYRAEGYMQYNGSRDGL
FT                   NASVNGVPLLEGLSLTGIDFSNPASSDFKDKITASAGDNKVVIENVSTSETSAILNLNT
FT                   TGLDEGDYILFTMVRSGGDLLAFNQYPPVSAEEEEDDSVGGSSGGGNSGAAVSAEPYRN
FT                   VEQREAHGQFIAMNTRAEYNFAQGSTPVDSIIITPLINAGYTSVLVEVLKDTSTRVDTQ
FT                   PPGLIYSNLNILIGSRITEEGIEQATISFGVDKTWLDENDLDPSNIRLLRYTTQWTPLS
FT                   TTMTGEDEDKVYYTAETPGFSSFAIVADTDSAPVTEPADTEADFTATPVEGQSPLEVTF
FT                   TAEADNIDSWQWDFGDGNTSTQQNPTHTYEEPGTYTVVLTVEGEGGVDVVEKTDLIEVT
FT                   EPGKEEGIPGFEAVFAIAGLLAVAGLLRRRKL"
FT   sig_peptide     complement(148300..148383)
FT                   /locus_tag="Mmah_0118"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(148597..149880)
FT                   /locus_tag="Mmah_0119"
FT   CDS_pept        complement(148597..149880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0119"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR010916; KEGG: GH12110 gene product from
FT                   transcript GH12110-RA; SPTR: Q12UJ2 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35655"
FT                   /db_xref="GOA:D5E904"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR026453"
FT                   /db_xref="UniProtKB/TrEMBL:D5E904"
FT                   /protein_id="ADE35655.1"
FT                   /translation="MKRLSILLLISILIFGVSAAGAFEVTPENPTVGDRITINGTSSAD
FT                   SVKANVEFTKTVSVEDGEYEYRIDDVEIPKGSNTFTVKAEGAEDLNVRVKILFWITKSA
FT                   DASSSGVATVSQSNVPSGDYNIQIDGKAASGANDVDLTITASQNIDVENGEFEGEYNTN
FT                   GIPPGQFKVTVAGETKTITLKSSGSSSGGSGSSGGGGGGSTPDNSNNNVDAEELITQRV
FT                   FSDTPVNFQFSDPEVPVKSINLTSAITVMDVPVRIEVLKDVSVMVKKEPSGNVYKHINM
FT                   WVGNRGFAIAENIKSAKIHFQVENDWIDNNNINPESVVLMHYEEDADQWTRLPTDMISG
FT                   NEQYTLYKASATHFSPFAIAGETRQTTNTDNQTDSNQTNTTVENVQQNSSETPADSKPG
FT                   LNAEWILIAGVMAGLVAMVIWKMKNNRQ"
FT   sig_peptide     complement(149815..149880)
FT                   /locus_tag="Mmah_0119"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            150044..150919
FT                   /locus_tag="Mmah_0120"
FT   CDS_pept        150044..150919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0120"
FT                   /product="UDP-glucose pyrophosphorylase"
FT                   /EC_number="2.7.7.9"
FT                   /note="COGs: COG1210 UDP-glucose pyrophosphorylase;
FT                   InterPro IPR005835:IPR005771; KEGG: gsu:GSU0859
FT                   UTP-glucose-1-phosphate uridylyltransferase; PFAM:
FT                   Nucleotidyl transferase; SPTR: Q12VL0 UDP-glucose
FT                   pyrophosphorylase; TIGRFAM: UTP-glucose-1-phosphate
FT                   uridylyltransferase; PFAM: Nucleotidyl transferase;
FT                   TIGRFAM: UTP-glucose-1-phosphate uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35656"
FT                   /db_xref="GOA:D5E905"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5E905"
FT                   /protein_id="ADE35656.1"
FT                   /translation="MDVKKAVIPVAGLGTRFLPVTKSMPKEMLPIIDTPVIHYVVQEAI
FT                   ESGIDDIIFVTGRNKRAIEDYFDGCPELEMHLKNRGKYDMLEMVQEISSMVDIHYIRQK
FT                   EPNGLGDAIMTARKHVSGDPFAVLLGDDIIVNEKPCTRQLIDVFRKYGRSTIAVEEVPQ
FT                   DKVSSYGIISGSPVDEYLYALDDIVEKPSVEEAPSNIGAIGRYVFTPEIFDCIEQTSKG
FT                   VGGEIQLTDGIRLLNDSQKVYAHQFTGRRYDSGNKVEYVKAVLDFAMKDDGMREEIQQH
FT                   LQNLGPITHD"
FT   gene            complement(150950..151744)
FT                   /locus_tag="Mmah_0121"
FT   CDS_pept        complement(150950..151744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0121"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: A2TY32 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35657"
FT                   /db_xref="GOA:D5E906"
FT                   /db_xref="UniProtKB/TrEMBL:D5E906"
FT                   /protein_id="ADE35657.1"
FT                   /translation="MERNQRFTTVKIATAITFSIMVIVNALANILPINGITTGQISDSY
FT                   PNLFAPAGWAFAIWGLIYLLLAGYTLYQLGVFQGTATSVKTGLLSKIGIIFSISSIANA
FT                   AWIFAWHYQIIPLSLILIVVILVCLILINQRINREQLSATEKLFIGLPFSVYFGWITVA
FT                   TIANATILLVSWNWQGFGLAEPIWTVIIIVLGFLIGALTMLKNRDIAYGLVIVWAYAAI
FT                   LSKHISPEGFAGQYPVIINTTIICIGLLLLAEGYLLISQKRM"
FT   sig_peptide     complement(151661..151744)
FT                   /locus_tag="Mmah_0121"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(151824..152951)
FT                   /locus_tag="Mmah_0122"
FT   CDS_pept        complement(151824..152951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0122"
FT                   /product="glycosyl transferase family 2"
FT                   /note="COGs: COG1215 Glycosyltransferase probably involved
FT                   in cell wall biogenesis; InterPro IPR001173; KEGG:
FT                   cps:CPS_5020 glycosyl transferase, group 2 family protein;
FT                   PFAM: glycosyl transferase family 2; SPTR: Q12VL4 Glycosyl
FT                   transferase, family 2; PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35658"
FT                   /db_xref="GOA:D5E907"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5E907"
FT                   /protein_id="ADE35658.1"
FT                   /translation="MNYLLIAAVLFTLIPVITYLIYILAILKPSSSKIHTPDTQPPITV
FT                   VIPTYNESEVIEHRIKNLKDIDYPTENIHVIVVDDQSTDNTVGLAAEAFKKYDLSGEVI
FT                   VKEKRTGTNASVNMGVGEATTDFVVTTDADVTFEPDAVNNALGRLLSDEKIGAVCGELE
FT                   PIARQDSFTTHSEKAYRDVYGRMCSWESCLHSTYCFNGPLIVMRKKAFSPIPETKGASD
FT                   AGMALRIIRNGYRCLYESSARFYEYITSDMDQQRRQKLRRSARLQEATLHNLGLVSPEY
FT                   GKFGLFVLPLRFVMFFIAPVSFFLAVILWSVVLGSINLIWGIGVLVLFGLALLSGQWKS
FT                   NLISSFIWHQIYLLVSLVYMSRGVHVWQAIERKKV"
FT   gene            153144..155615
FT                   /locus_tag="Mmah_0123"
FT   CDS_pept        153144..155615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0123"
FT                   /product="Oligosaccharyl transferase STT3 subunit"
FT                   /note="COGs: COG1287 membrane protein required for N-linked
FT                   glycosylation; InterPro IPR003674; KEGG: geo:Geob_1424
FT                   oligosaccharyl transferase STT3 subunit; PFAM:
FT                   Oligosaccharyl transferase STT3 subunit; SPTR: Q12VP3
FT                   Transmembrane oligosaccharyl transferase; PFAM:
FT                   Oligosaccharyl transferase STT3 subunit; TIGRFAM: ATP
FT                   synthase subunit 6 (eukaryotes),also subunit A
FT                   (prokaryotes)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35659"
FT                   /db_xref="GOA:D5E908"
FT                   /db_xref="InterPro:IPR003674"
FT                   /db_xref="InterPro:IPR026410"
FT                   /db_xref="InterPro:IPR041154"
FT                   /db_xref="UniProtKB/TrEMBL:D5E908"
FT                   /protein_id="ADE35659.1"
FT                   /translation="MTIDYKDKLKSSFLPFTGILLCFLIALYIRTIPAESVFIGENFVR
FT                   FGGNDPWYHLRNVESILHNFPSMLWFDAYTQYPYGTDQVFAPLFDMFLATIIWIIGMGN
FT                   PSTELTHTICAYYPSLLGAVIVIPVYFAAKWIFGDRRIGLLAAFLVAIAPGQFLSRSII
FT                   GFNDHHVAEALLSTVVAMFLIFGLKRSEEHDLSLASLKENGLAQIKPILPYFLLSGFFL
FT                   GAYTLTWKGALFFSFIIGVYITAQHIIDHMHGRSSEYLAIGGMAIFGVALIMVLLAPEI
FT                   GGTKSRQIFGLAAGLVAFPLLSVLSYYMKEKQLSRYYYPLSVAALFGGGILLARMFSES
FT                   AYALVSSVFSYFMRTGGGLTIAEASPLLMRSGEFTLQPLWYNFGITAIVSFFALLILAY
FT                   IAIYRRNNREQTFLIVWTVMIIWAMLQQNRFAYYYSVNAAILSAYIGIKVLDLAGWKDI
FT                   RSPFAETTSNISGWFKQIKPVHALALVLVVLVLAYPSYDLSMQQNQGTGGPNGYWIEAT
FT                   QWMKYNTPDPGLDYYESYEKPPEGQLFSYPDEAYGVMSWWDYGHWLEVIGHRIPNANPF
FT                   QQGIGGRRNSMDEENRPGASTFFTASSEAEATAVLEAVHPDPEKAGARYVVSDVEMATG
FT                   KFYAMAAWTLDTDNYYVQAQTNQGTQTVPGERYFNTMEARLHLFDGDGLTQYRMVHETP
FT                   AANTAEAGYKQVYNALFDGNIEVVNTGYVKIFEYVDGATITGQAPEGEKVTITNTIRTT
FT                   TGRTFEYSRSTTATDGTYEFVVPYSTEGPVQGQTQFDTAPTGSYEVSFGDTTESVRVSE
FT                   SAVLNGGEIEV"
FT   gene            155708..156013
FT                   /locus_tag="Mmah_0124"
FT   CDS_pept        155708..156013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0124"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="COGs: COG1669 nucleotidyltransferase; InterPro
FT                   IPR002934; KEGG: gem:GM21_3743 DNA polymerase beta domain
FT                   protein region; PFAM: DNA polymerase beta domain protein
FT                   region; SPTR: Q8TNZ6 Nucleotidyltransferase; PFAM:
FT                   Nucleotidyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35660"
FT                   /db_xref="GOA:D5E909"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:D5E909"
FT                   /protein_id="ADE35660.1"
FT                   /translation="MASHNNAIDIYKHQLHKMLPELKEKYKVASLAVFGSFVRGEQTNS
FT                   SDLDVLVEFSETPGLLEFVELENYLSDTLGIKVDLVHKKALKPNIGKNILNEATPL"
FT   gene            156146..156340
FT                   /locus_tag="Mmah_0125"
FT   CDS_pept        156146..156340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0125"
FT                   /product="Protein of unknown function DUF2196"
FT                   /note="COGs: COG4895 conserved hypothetical protein;
FT                   InterPro IPR019240; KEGG: ppr:PBPRB1930 hypothetical
FT                   protein; PFAM: Protein of unknown function DUF2196; SPTR:
FT                   Q8PUK4 Putative uncharacterized protein; PFAM:
FT                   Uncharacterized conserved protein (DUF2196)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35661"
FT                   /db_xref="InterPro:IPR019240"
FT                   /db_xref="UniProtKB/TrEMBL:D5E910"
FT                   /protein_id="ADE35661.1"
FT                   /translation="MNAGTNRSNIRTGLNVGIVLKKDQKSGKITKGIVKRILTKSSSHP
FT                   HGIKVQLEDGSVGRVKEIY"
FT   gene            156494..156772
FT                   /locus_tag="Mmah_0126"
FT   CDS_pept        156494..156772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0126"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q8TTC0 Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35662"
FT                   /db_xref="GOA:D5E911"
FT                   /db_xref="InterPro:IPR013950"
FT                   /db_xref="UniProtKB/TrEMBL:D5E911"
FT                   /protein_id="ADE35662.1"
FT                   /translation="MNTTPPLNKKGRSPTLNTIKMVENTLQNMDESIISVADLKRNLPK
FT                   QVNHNTLTTILEYLEESNKIAVTIKGITWIHNDNNVLNKAISRGIEI"
FT   gene            157101..157583
FT                   /locus_tag="Mmah_0127"
FT   CDS_pept        157101..157583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0127"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="COGs: COG0066 3-isopropylmalate dehydratase small
FT                   subunit; InterPro IPR000573:IPR011827; KEGG: wsu:WS1812
FT                   3-isopropylmalate dehydratase small subunit; PFAM:
FT                   aconitate hydratase domain protein; SPTR: Q12VP4
FT                   3-isopropylmalate dehydratase, small subunit; TIGRFAM:
FT                   3-isopropylmalate dehydratase, small subunit; PFAM:
FT                   Aconitase C-terminal domain; TIGRFAM: 3-isopropylmalate
FT                   dehydratase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35663"
FT                   /db_xref="GOA:D5E912"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR011827"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:D5E912"
FT                   /protein_id="ADE35663.1"
FT                   /translation="MIKGKAWIFGDDVDTDVIIPGKYLRTTDMQVFADHAMEGIDPDFS
FT                   SKVSPGDIIVGGNNFGCGSSREQAPLALKHAGVGCVVARSFGRIFFRNSINVGLPLIEA
FT                   DVECEEGDEVEVNLSEGTVKVAGRTYTGQQIPDFLLEILSDGGLVEHRKKQQRLNS"
FT   gene            157580..158428
FT                   /locus_tag="Mmah_0128"
FT   CDS_pept        157580..158428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0128"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q8PZ50 Conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35664"
FT                   /db_xref="UniProtKB/TrEMBL:D5E913"
FT                   /protein_id="ADE35664.1"
FT                   /translation="MIFPLEYKHVGVTHIHPDEDPEEPIYFLTHYMLVEICNGNKWLYQ
FT                   VEHSGEDLLRKAESVELLAKPEKIVRFPEILNIKNRSLLIQKAAALCKNGITTVIFTGI
FT                   DNHVTFVHEPDPSVILELEILDIAPPYPSWLTDVVRRLESSGIFGDLTITFKENTIDLT
FT                   RFSGPDTVFPCSSSGLEGKCLDNDIIEKPGSLLVGCEISRSLFESRFPGMEYDFISLCP
FT                   FTSDIVKPSGPFIARCCRAENAGQVTINGFPGATVHWGAAEFDVATTIRELVDRLRKDC
FT                   A"
FT   gene            158425..159420
FT                   /locus_tag="Mmah_0129"
FT   CDS_pept        158425..159420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0129"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="COGs: COG0473 Isocitrate/isopropylmalate
FT                   dehydrogenase; InterPro IPR001804:IPR019818:IPR011828;
FT                   KEGG: LYS12; homo- isocitrate dehydrogenase; K05824
FT                   homoisocitrate dehydrogenase; PFAM:
FT                   isocitrate/isopropylmalate dehydrogenase; PRIAM:
FT                   3-isopropylmalate dehydrogenase; SPTR: Q46FW0
FT                   3-isopropylmalate dehydrogenase; TIGRFAM:
FT                   isopropylmalate/isohomocitrate dehydrogenase; PFAM:
FT                   Isocitrate/isopropylmalate dehydrogenase; TIGRFAM:
FT                   isopropylmalate/isohomocitrate dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35665"
FT                   /db_xref="GOA:D5E914"
FT                   /db_xref="InterPro:IPR011828"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:D5E914"
FT                   /protein_id="ADE35665.1"
FT                   /translation="MKLAVIEGDGVGKEVIPAALRVLDCFDLPLEIIPLELGYGKWEKT
FT                   GQAITDADLEILKNCDCILFGAVTTPADPNYKSVLLTIRRELDLYANIRPLKPIKGIEG
FT                   ATGNTDFDILVVRENTEGLYSSIEEVGENEAWSKRIITRRASERIAQIACEYAAKRHNH
FT                   LTIVHKSNVIKADSLFLNTCRNVAQAHNVIHDTMLVDAMAYDMVRSPEKYDVVVAPNLY
FT                   GDILSDLGGALVGSLGLLPSANIGEKQAFFEPVHGSAPDIAGKGIANPIAAVLSVAMLL
FT                   DWLDRPEQARIVREAVEASINEDIKTADLGGNFTTEQVTGFLVRYVQSHS"
FT   gene            complement(159424..159648)
FT                   /pseudo
FT                   /locus_tag="Mmah_0130"
FT   gene            complement(159782..160486)
FT                   /locus_tag="Mmah_0131"
FT   CDS_pept        complement(159782..160486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0131"
FT                   /product="uridylate kinase"
FT                   /note="COGs: COG0528 Uridylate kinase; InterPro
FT                   IPR001048:IPR011818; KEGG: sfu:Sfum_1780 uridylate kinase;
FT                   PFAM: aspartate/glutamate/uridylate kinase; SPTR: Q12VQ2
FT                   Uridylate kinase; TIGRFAM: uridylate kinase; PFAM: Amino
FT                   acid kinase family; TIGRFAM: uridylate kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35666"
FT                   /db_xref="GOA:D5E915"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR011818"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:D5E915"
FT                   /protein_id="ADE35666.1"
FT                   /translation="MLVVISIGGSILARDLDPERFAKYADMLEELSKEHSVVVVTGGGV
FT                   AARQYIEAARQVGANEVTCDFIGIDVTRLNAQLLIAALGKNAYPEPPQSYRDAELALSS
FT                   GKIIVMGGVIPGQTTDTVSAVLAEYLGAELMVIATSVDGVYSKDPTTSNDAEKFDVMSP
FT                   KELLDVVMSTEMKAGSKSPVDPLAAKIIERCNIETIVMDGSSEGDIYKVVMQEKIKSEP
FT                   VEGERVGTRIKS"
FT   gene            complement(160767..160943)
FT                   /locus_tag="Mmah_0132"
FT   CDS_pept        complement(160767..160943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0132"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="InterPro IPR000813:IPR001080:IPR001450:IPR017900;
FT                   KEGG: dol:Dole_2064 4Fe-4S ferredoxin iron-sulfur binding
FT                   domain-containing protein; PFAM: 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; SPTR: Q12VQ3 4Fe-4S
FT                   ferredoxin, iron-sulfur binding; PFAM: 4Fe-4S binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35667"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D5E916"
FT                   /protein_id="ADE35667.1"
FT                   /translation="MVAVINVDECVGCGACVDECPSEAISMNDENIAVVDAEECVDCGV
FT                   CVDVCPTEAITME"
FT   gene            161171..161716
FT                   /locus_tag="Mmah_0133"
FT   CDS_pept        161171..161716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0133"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR013373; SPTR: B0R6S7 Putative
FT                   uncharacterized protein; PFAM: Protein of unknown function
FT                   (DUF1628); TIGRFAM: archaeal flagellin N-terminal-like
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35668"
FT                   /db_xref="GOA:D5E917"
FT                   /db_xref="InterPro:IPR012859"
FT                   /db_xref="InterPro:IPR013373"
FT                   /db_xref="UniProtKB/TrEMBL:D5E917"
FT                   /protein_id="ADE35668.1"
FT                   /translation="MKDENGISPVVGILLMIAITIVLGVSLAFFAIGFEMQEPAPFVAH
FT                   SSGELVRKGDTDVDFGDQRVYIYHEGGDAVKMSEVETMVDATEVSGMKARIVNLPVSKT
FT                   ESLGNHILGDDGLIDKSAPNFEKCGGAITKEYFSVGEKLWFRINSGECPLEKGDQITVK
FT                   IIHTPTNTIVIEETLTAS"
FT   gene            161773..163974
FT                   /locus_tag="Mmah_0134"
FT   CDS_pept        161773..163974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0134"
FT                   /product="DEAD_2 domain protein"
FT                   /note="COGs: COG1199 Rad3-related DNA helicase; InterPro
FT                   IPR010614:IPR006554:IPR006555:IPR014013; KEGG: hypothetical
FT                   protein; K10844 DNA excision repair protein ERCC-2; PFAM:
FT                   DEAD_2 domain protein; SMART: helicase c2; Helicase-like,
FT                   DEXD box c2 type; SPTR: Q12VQ5 Rad3-related DNA helicases;
FT                   PFAM: DEAD_2"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35669"
FT                   /db_xref="GOA:D5E918"
FT                   /db_xref="InterPro:IPR006554"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR010614"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5E918"
FT                   /protein_id="ADE35669.1"
FT                   /translation="MSTPDNYIQYFPLEQCYPNQKDAMEKIHRSLLEENLVLFEGACGT
FT                   GKTLSALVPSLHVGKQLGKTVFIATNVHQQMLQFIDEARQIKRTHDIKVLVFKGKMSMC
FT                   PLKQGYDECEAKRDNTYDLMEIEKEIILKKQESKAAWDEYKSSGEAAHASLRDAIDEER
FT                   EKLEEKASSLRKRSCDPLYEVLRVEDEKFQKWLFQDVRDPEEVNDYAAENGMCGYELLK
FT                   RELKNADLVIANFHHILNDMIFSTMLRWMDKEPEDIIAIFDEAHNIENAARSHSSITLT
FT                   EHTIESALAELNANEKSDLFTSMPVEDVEAVLSILLEVVRDTYDNRFKFGERQRVGRNW
FT                   YDIRISDPYERNDVVHARFMRRMKETGYGEEKQVQELLGIAAEVGGLLDNAYHEQYKQG
FT                   QIPILKRSHLKPTAEFFSQYLKLSNNENYYPVLNVRRDQGGEIYGRLELFTCIPKNVTG
FT                   PLLDSIYSAILMSATLRPFDMIKSTLGITRQTCDLAYGLTFPEERRLTIAVSVPPQYSR
FT                   IRDDPQNLQILEQVLQDTIENAGGNVIIFFPNAFEAKRYFRKFDGVLDVELFLDETGIS
FT                   AQDIRKSFFQTGEQGGKAVLFTYLWGTLSEGVDYRNGRGRVVVVVGVGYSALNDRMHAV
FT                   ESAYDHEFGYGAGWEYAVQVPTIRKIRQAMGRVVRSPTDYGVRILLDGRFMTDSVTRLG
FT                   KYSVYSSFPEDERKEFLDVEPAKVKYSLLNFFSDMEELS"
FT   gene            164015..164974
FT                   /locus_tag="Mmah_0135"
FT   CDS_pept        164015..164974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0135"
FT                   /product="beta-ribofuranosylaminobenzene 5'-phosphate
FT                   synthase"
FT                   /note="COGs: COG1907 sugar kinase; InterPro
FT                   IPR013750:IPR006204:IPR004422; KEGG: mmb:Mmol_1347
FT                   beta-ribofuranosylaminobenzene 5'-phosphate synthase
FT                   family; PFAM: GHMP kinase; GHMP kinase domain protein;
FT                   SPTR: Q12VQ8 Beta-ribofuranosylaminobenzene 5'-phosphate
FT                   synthase; TIGRFAM: beta-ribofuranosylaminobenzene
FT                   5'-phosphate synthase family; PFAM: GHMP kinases C
FT                   terminal; GHMP kinases N terminal domain; TIGRFAM:
FT                   beta-RFAP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35670"
FT                   /db_xref="GOA:D5E919"
FT                   /db_xref="InterPro:IPR004422"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D5E919"
FT                   /protein_id="ADE35670.1"
FT                   /translation="MIEITSPSRLHLSLIDLNASLGRVDGGIGVSLQYPHIHLTAEKSD
FT                   HLEITGNSLLYDKVQSAISALLPEGEGISIYLDEDMPAHVGLGSGTQVALCTAAAINEL
FT                   FELGFSIRQLAQKVGRGGTSGIGVAAFEKGGFLVDGGHRFSDKGTFSPSSASPAPPAPI
FT                   VFRHDFPDWPIVLALPDRQGAHDAQEVDIFRQVCPVPLEDVQAISHIVLMQMIPAVIEN
FT                   DIENFGIALDSLQTLGFKKQEISLQSQQVQDVIEQMRLAGTHGVGMSSFGPAICGFVEN
FT                   ETKGKRIVREIQKFLDESIGGKVLLTTPNNTGADIRMD"
FT   gene            164977..165930
FT                   /locus_tag="Mmah_0136"
FT   CDS_pept        164977..165930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0136"
FT                   /product="Pre-mRNA processing ribonucleoprotein, binding
FT                   domain protein"
FT                   /note="COGs: COG1498 Protein implicated in ribosomal
FT                   biogenesis Nop56p homolog; InterPro IPR002687; KEGG:
FT                   Hypothetical protein CBG14983; PFAM: Pre-mRNA processing
FT                   ribonucleoprotein, binding domain protein; SPTR: Q12VQ9
FT                   rRNA biogenesis protein Nop56/Nop58; PFAM: Putative snoRNA
FT                   binding domain; NOSIC (NUC001) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35671"
FT                   /db_xref="InterPro:IPR002687"
FT                   /db_xref="InterPro:IPR012976"
FT                   /db_xref="InterPro:IPR029012"
FT                   /db_xref="InterPro:IPR036070"
FT                   /db_xref="InterPro:IPR042239"
FT                   /db_xref="UniProtKB/TrEMBL:D5E920"
FT                   /protein_id="ADE35671.1"
FT                   /translation="MNVKTWFADIEINEDGSVAECSPCTQDVQQLAKRLLVFQADPKQI
FT                   PLASFDPVKKAIECGFVSGKTEYYSLLQQTCIAATRLKIKNSYSPDLRIIHAVEALDDI
FT                   DEAANLLAERLGIWYGEHFPEAGMLTENLAKFVAENGLRQDLPQDSQFRETALSSVGME
FT                   MDAEDGAIIKAFAADLSSLYERRHVIESYIRKNMEQLAPNLEKVAGANLGARLISMAGG
FT                   LQSLSRMPSSTIQVMGANQALFKHLRGKATSPKHGIIFNHPLIKNSHPKIRGKMARALA
FT                   SSLSIASRVDAFSGRLNPVIKEKLDRKVLSIKEGDK"
FT   gene            165927..166610
FT                   /locus_tag="Mmah_0137"
FT   CDS_pept        165927..166610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0137"
FT                   /product="rRNA 2'-O-methyltransferase fibrillarin"
FT                   /EC_number="2.1.1.-"
FT                   /note="COGs: COG1889 Fibrillarin-like rRNA methylase;
FT                   InterPro IPR000692; KEGG: GA24481 gene product from
FT                   transcript GA24481-RA; PFAM: fibrillarin; SPTR: Q12VR0 rRNA
FT                   2'-O-methyltransferase fibrillarin; PFAM: Fibrillarin"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35672"
FT                   /db_xref="GOA:D5E921"
FT                   /db_xref="InterPro:IPR000692"
FT                   /db_xref="InterPro:IPR020813"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5E921"
FT                   /protein_id="ADE35672.1"
FT                   /translation="MKVKIFHENIFTLQQGKKRFLATRNLTPGLEVYGERLVQVDEAEY
FT                   RIWEPKRSKLAAMLLKKLPSPFTTTSKVLYLGSATGTTVSHVSDIVQQGVVYAVEFSPR
FT                   TMRDMLPVCEERANIIPLLADASKPQSYANVVEPVDVIFQDVAQPNQASIALSNVQHFL
FT                   KPGGYLLMSIKARSVDSTAKPDTVFKQQLKTLLEQDNSKLELVKKQKLAPFHIDHLGVV
FT                   VKKTE"
FT   gene            166620..166856
FT                   /locus_tag="Mmah_0138"
FT   CDS_pept        166620..166856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0138"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q12VR1 Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function (DUF2769)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35673"
FT                   /db_xref="InterPro:IPR020075"
FT                   /db_xref="UniProtKB/TrEMBL:D5E922"
FT                   /protein_id="ADE35673.1"
FT                   /translation="MADQDELRQGLGKYFGVCPSYHHSKACLCKNCPSYPGEGYMFCAR
FT                   GPVSGEISQECMCNDCYVYHQFALEGDYFCREE"
FT   gene            166860..167279
FT                   /locus_tag="Mmah_0139"
FT   CDS_pept        166860..167279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0139"
FT                   /product="Rhodanese domain protein"
FT                   /note="COGs: COG0607 Rhodanese-related sulfurtransferase;
FT                   InterPro IPR001763; KEGG: gem:GM21_3931 rhodanese domain
FT                   protein; PFAM: Rhodanese domain protein; SMART: Rhodanese
FT                   domain protein; SPTR: Q12VR2 Rhodanese-like protein; PFAM:
FT                   Rhodanese-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35674"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D5E923"
FT                   /protein_id="ADE35674.1"
FT                   /translation="MSKNTIVVLICVLGTLALGGCVQQEDDNTASQLENCEYSDVSAEE
FT                   ALNLIEEQDVFILDVRTRSEYDAGHLEDSYLIPVSELKNRLDEVPRDTAILVYCRSGRR
FT                   SVTASNILLDAGYCDVYNMEAGFNEWRSAGYPYMG"
FT   sig_peptide     166860..166931
FT                   /locus_tag="Mmah_0139"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            167397..169130
FT                   /locus_tag="Mmah_0140"
FT   CDS_pept        167397..169130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0140"
FT                   /product="periplasmic copper-binding protein"
FT                   /note="InterPro IPR007742:IPR006626:IPR006633; KEGG:
FT                   hypothetical protein; PFAM: periplasmic copper-binding;
FT                   SMART: Carbohydrate-binding and sugar hydrolysis; Parallel
FT                   beta-helix repeat; SPTR: Q8TLD5 Cell surface protein; PFAM:
FT                   Periplasmic copper-binding protein (NosD)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35675"
FT                   /db_xref="GOA:D5E924"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR006633"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022441"
FT                   /db_xref="InterPro:IPR026428"
FT                   /db_xref="UniProtKB/TrEMBL:D5E924"
FT                   /protein_id="ADE35675.1"
FT                   /translation="MRENVDSHRFWILLASSVVLVLLSSVSLAAEITVDDDGTEDYTTI
FT                   QAAVNAAVDDDTILVYPGTYSENVDVGKELNITSVGGVSVTHVYADNTDKDVFHITADS
FT                   VTINGFNMSRATGTSCSGIRIEGNHSTIINNIVSNNKLGITLFISDNNNITGNTASGNN
FT                   YAGIYLQLSDNNDLNDNIVSENNQYGIYLASAGGISRSNNFINNTVSKNNKGIFLQSPQ
FT                   DSTLTDNTVFNNTNDGITLDSFGDLFYVENNTLIGNTVLNNKNGIYIKKINGNALIGNI
FT                   ALDNNNGIKIDYSYYNNLTQNNISNNTDNGVHFVSSHENRLVNNTILNNKIGLRLGGYY
FT                   GSSNNFVGNNYFNNSNNAYFDADSDNHWNTTKTTGPNIIGGPYIGGNFWAKSDGSGWSQ
FT                   EKADNDGDGFCDSIYELSDGNIDYLPLAGDSTGPSVVPISPMEQTVGPGELLELNVSVT
FT                   DDSEISSVVVNVSSVNDTINEAVLSNVNGYWVNNSITLDVNPHGMYNLSINATDEFGNS
FT                   NTSMNLSVIGESTTPGDGNEEDGGNFVYHPQPLFDVPTGNPLLLVGVLGLVVMFFVRRR
FT                   E"
FT   sig_peptide     167397..167483
FT                   /locus_tag="Mmah_0140"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            169171..170007
FT                   /locus_tag="Mmah_0141"
FT   CDS_pept        169171..170007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0141"
FT                   /product="Methyltransferase type 11"
FT                   /note="COGs: COG2226 Methylase involved in
FT                   ubiquinone/menaquinone biosynthesis; InterPro
FT                   IPR013216:IPR013217; KEGG: dal:Dalk_0866 methyltransferase
FT                   type 12; PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; SPTR: Q12US1 Methyltransferase type 12; PFAM:
FT                   Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35676"
FT                   /db_xref="GOA:D5E925"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D5E925"
FT                   /protein_id="ADE35676.1"
FT                   /translation="MLYYEIDWGNIWIEQMKLHNEADEQVQQPDRWGTYANAKRFWQSS
FT                   RKSGKRLEKALQDIKHDSDSRILDIGAGPGSMAIPLAQRVSHVTAVEPADGMTEVLKEN
FT                   IADYNLDNVTCIQKNWEDVAVEELDGMYDVIIASYSLHVPDIREALEKIQQVSNGRVYI
FT                   YWFAGPTSWDKNYSRIWPQLHGRQYYPSPKCDVLYNVLYSMGIYPDMENFELTHYTRFS
FT                   SLDEAVEHYKPHYKIANKQQEQILRSHLEEILEKEGDELVQVGRSSRVKISWDNSH"
FT   gene            complement(170014..171630)
FT                   /locus_tag="Mmah_0142"
FT   CDS_pept        complement(170014..171630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0142"
FT                   /product="IMP cyclohydrolase;
FT                   phosphoribosylaminoimidazolecarboxamide formyltransferase"
FT                   /EC_number="3.5.4.10"
FT                   /EC_number="2.1.2.3"
FT                   /note="COGs: COG0138 AICAR transformylase/IMP
FT                   cyclohydrolase PurH (only IMP cyclohydrolase domain in
FT                   Aful); InterPro IPR011607:IPR013982:IPR002695; KEGG:
FT                   gsu:GSU0609 bifunctional
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; PFAM:
FT                   AICARFT/IMPCHase bienzyme formylation region; MGS domain
FT                   protein; PRIAM: IMP cyclohydrolase; SMART: AICARFT/IMPCHase
FT                   bienzyme formylation region; SPTR: Q12UR7
FT                   Phosphoribosylaminoimidazolecarboxamide formyltransferase /
FT                   IMP cyclohydrolase; TIGRFAM:
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; PFAM:
FT                   AICARFT/IMPCHase bienzyme; MGS-like domain; TIGRFAM:
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35677"
FT                   /db_xref="GOA:D5E926"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:D5E926"
FT                   /protein_id="ADE35677.1"
FT                   /translation="MVKRALLSVSDKTGIVDFARGLKQLDVEIISTGGTARMLRDAGIE
FT                   TIDVSEITGFPEMMGGRVKTLHPKIHGGLLCLRENPEHVSDAEDLSIELIDMVVVNLYP
FT                   FEITISREGVNLEEAIENIDIGGPSMLRSAAKNYKSVTVLSDPEDYGHILKELRSSGVV
FT                   SRETREKMAVKAFRHTANYDSTIDTYLSRTLLGEDILRLNFTGGRELRYGENWHQEALF
FT                   FSQPEIEGPSLANCRQLHGKELSYNNYVDGDNALQTVKELGQEKPAVCIVKHNNPCGLA
FT                   TGNTLLQALQSAWDGDPISAFGSIICTNVPMDLESAKFLKGKFVEIIIAPEFEHDALDF
FT                   LKNKSKNLRLLELPQLNESFDAEFTYKYIAGGMLKQSRNIGLYDKWECVTETPYPEEKK
FT                   GLSEFCIAACKCTKSNAVNLSWEYDEGCYMMLAMGAGQPNRVDSIRKLCATKARENLKE
FT                   IYEREQPDIAFEEYCNSIFEQCVLASDAFFPFDDSIIHAAENNIKYVVSPGGSIRDNEV
FT                   IDTANRLGVSLVFTGMRHFLH"
FT   gene            complement(171986..172558)
FT                   /locus_tag="Mmah_0143"
FT   CDS_pept        complement(171986..172558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0143"
FT                   /product="Methyltransferase type 11"
FT                   /note="COGs: COG2226 Methylase involved in
FT                   ubiquinone/menaquinone biosynthesis; InterPro
FT                   IPR013216:IPR013217; KEGG: gem:GM21_4072 methyltransferase
FT                   type 11; PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; SPTR: Q3IPP8 Homolog 1 to
FT                   S-adenosylmethionine-dependent methyltransferase 3; PFAM:
FT                   Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35678"
FT                   /db_xref="GOA:D5E927"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5E927"
FT                   /protein_id="ADE35678.1"
FT                   /translation="MKIRESGMPDENVWEGFFGVDEILKKLGLNDKIAYVADFGCGYGT
FT                   FTIPAAKIIKGKVYAIDIESEMIEIAEQKAKVENLGNIELLLRDFISKGSGLEGESVDY
FT                   IILANILHVEEPEKLLRETYRVLRQEGKIVIIHWNYDPTTPRGPPMEIRPTPEKCIEWA
FT                   ISSGFKNPLTYDLKPYHYGIVLSKGKN"
FT   gene            complement(172602..173012)
FT                   /locus_tag="Mmah_0144"
FT   CDS_pept        complement(172602..173012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0144"
FT                   /product="Threonyl-tRNA synthetase editing domain protein"
FT                   /note="InterPro IPR015011; KEGG: sfu:Sfum_0182 hypothetical
FT                   protein; PFAM: Threonyl-tRNA synthetase editing domain
FT                   protein; SPTR: A7I9Y6 Putative uncharacterized protein;
FT                   PFAM: Archaea-specific editing domain of threonyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35679"
FT                   /db_xref="GOA:D5E928"
FT                   /db_xref="InterPro:IPR015011"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/TrEMBL:D5E928"
FT                   /protein_id="ADE35679.1"
FT                   /translation="MKMLLFDTEYFWFDTFSKTLENVEDIKKEEKIENTAVVFIHVELE
FT                   DEERKNKVVKNAVKTFKWYLNKVDKEKIVLHSFAHLSSSTSSPEFAAEIISEIKEKLIN
FT                   KGIEVHTTPFGYFSEFSIHVRGESLAKIFKEI"
FT   gene            173464..175185
FT                   /locus_tag="Mmah_0145"
FT   CDS_pept        173464..175185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0145"
FT                   /product="acetolactate synthase, large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="COGs: COG0028 Thiamine pyrophosphate-requiring
FT                   protein; InterPro IPR012000:IPR011766:IPR012001:IPR000399;
FT                   KEGG: ppd:Ppro_2814 thiamine pyrophosphate binding
FT                   domain-containing protein; PFAM: thiamine pyrophosphate
FT                   protein TPP binding domain protein; thiamine pyrophosphate
FT                   protein domain protein TPP-binding; thiamine pyrophosphate
FT                   protein central region; SPTR: Q8PT77 Acetolactate synthase;
FT                   PFAM: Thiamine pyrophosphate enzyme, central domain;
FT                   Thiamine pyrophosphate enzyme, N-terminal TPP binding
FT                   domain; Thiamine pyrophosphate enzyme, C-terminal TPP
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35680"
FT                   /db_xref="GOA:D5E929"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D5E929"
FT                   /protein_id="ADE35680.1"
FT                   /translation="MEKMNGAQVLVKCLEDLGVKHVFGYTGAAILPVFHALHDSDIGIT
FT                   ISSNEQSAAFSAAGYSRSGDEIGVAMVTSGPAITNTLTGVADAYGDSIPMLVFAGQVPE
FT                   HKIGTDSFQHINVSGIFEDAAKKVIQLSNNDDIESIVKDAYYFACSGKPGPVVIDFPLD
FT                   KQQKRHEYRARDVSIFEQSYHDDRHLSDRQCAGFYELLLNSEKPLLYLGGGLNSRRGRQ
FT                   AIHAFNDYFKIPSVNTLMAKGIVDERDELNLGMLGMFGTPYANMIIQENDFFFAIGVRW
FT                   DDRIAEKVGFGIEAEIAYIDINPEKMHQIKIERFPKFTFIGDAATALGDLLAYAKRYNI
FT                   KLDIGRWQKHAAKLKQSWPLDYNRSSDRIQAAETMGMLAGFIDETMKITTGVGNHQMLA
FT                   AQYLPMQQEQSFMSSGSFGTMGFAVPTAIGVHYANPNSKVIAIDGDGSLKMNLGELHTI
FT                   ASLDLPVKILLLNNMSDGMVLNLQDVAYGGIRTGTRRTKDILFAEIARSFGFNYSKRVN
FT                   KRKELRQSLEYFLDAEGPSFLEVLTDREEILYPKVPAGCSYSDMIIGPYIKKVSSD"
FT   gene            175255..176358
FT                   /locus_tag="Mmah_0146"
FT   CDS_pept        175255..176358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0146"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="COGs: COG0247 Fe-S oxidoreductase; InterPro
FT                   IPR001450:IPR004017:IPR017900; KEGG: gur:Gura_3039
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF224 cysteine-rich region domain protein; 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein; SPTR: Q12YM1
FT                   Putative uncharacterized protein; PFAM: Cysteine-rich
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35681"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:D5E930"
FT                   /protein_id="ADE35681.1"
FT                   /translation="MYRFQEKIDSCIDCKKCWEVCPANMVTEGNLFTPQRKIGSLAKIV
FT                   AGEELTQDEMDNIYLSTRCGACDDVCPVDIPITDIIQYERELLAQQGREPAKTTAISKN
FT                   ILEHNSPGAMDPSKRFDWVTHDLEIAEESEIAYMAGCWVAYSQPDIARSTIRLLNHAGI
FT                   KPMLLKEEKCCGLFLIDNGHLEEAAEHAKKFVDYIESLGVKKVIASCPGCYLVLSREYP
FT                   DLYRELNFEVEHSLNIFKAMINDGTLKPEKLDYTVSVRDACPVRKSKDVPRDILSSMGV
FT                   EIKELFDGKQVCCGGPAGLKPNFPGISSDIAMLSVNDYKENADMLVSYCPFCMHHIGGV
FT                   CNSKDEDLDMKDISVLLAESVFGSMGE"
FT   gene            176362..176694
FT                   /locus_tag="Mmah_0147"
FT   CDS_pept        176362..176694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0147"
FT                   /product="Protein of unknown function CGGC region"
FT                   /note="InterPro IPR014925; KEGG: dds:Ddes_0610 protein of
FT                   unknown function CGGC region; PFAM: Protein of unknown
FT                   function CGGC region; SPTR: Q12Z01 Putative uncharacterized
FT                   protein; PFAM: CGGC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35682"
FT                   /db_xref="InterPro:IPR014925"
FT                   /db_xref="UniProtKB/TrEMBL:D5E931"
FT                   /protein_id="ADE35682.1"
FT                   /translation="MKVGLIRCMQTEDMCPATTDFKVMREKKLAFKDVEGEIEVIGVVS
FT                   CGGCPGKKAATRAAEMVRRGADTIALASCITKGNPIGFACPHAEQMKAAIRKKIGDSIQ
FT                   LIDYTH"
FT   gene            complement(176814..177050)
FT                   /locus_tag="Mmah_0148"
FT   CDS_pept        complement(176814..177050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35683"
FT                   /db_xref="UniProtKB/TrEMBL:D5E932"
FT                   /protein_id="ADE35683.1"
FT                   /translation="MVTNIYSKRKCSFLQLQETDFLIHNNVWDMMPCAGNSIKDPITSA
FT                   NAISGSSGKAVSAIASTIGKLRASVVRFNLAVS"
FT   gene            complement(177050..177706)
FT                   /locus_tag="Mmah_0149"
FT   CDS_pept        complement(177050..177706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0149"
FT                   /product="Protein of unknown function DUF2284,
FT                   metal-binding protein"
FT                   /note="COGs: COG5423 metal-binding protein; InterPro
FT                   IPR019271; KEGG: ppd:Ppro_0073 hypothetical protein; PFAM:
FT                   Protein of unknown function DUF2284, metal-binding; SPTR:
FT                   Q467J8 Putative uncharacterized protein; PFAM: Predicted
FT                   metal-binding protein (DUF2284)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35684"
FT                   /db_xref="InterPro:IPR019271"
FT                   /db_xref="UniProtKB/TrEMBL:D5E933"
FT                   /protein_id="ADE35684.1"
FT                   /translation="MTIPEENYRILKQTGGELGAKSVRLIPAENIIIENRTILKCIFGC
FT                   NGYGSQVCPPFIPTVDEFRQMLMEYQWALLVDWKSDNRFSREISENFIKYSVTSPDKEE
FT                   IKHRHEENIKTVMKERKERIQPGSIELEKLAWKLGYNTALATFPGMCTWCANKDYTDVN
FT                   CASSQGECHHPTIRRPCLMGLGVRLDKTLEKLGIPFQKFPMDDTIPSQYTLILLD"
FT   gene            178074..178298
FT                   /locus_tag="Mmah_0150"
FT   CDS_pept        178074..178298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0150"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q8TT27 Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35685"
FT                   /db_xref="GOA:D5E934"
FT                   /db_xref="UniProtKB/TrEMBL:D5E934"
FT                   /protein_id="ADE35685.1"
FT                   /translation="MAYSAYLSIIGTGSIPPLVLAHGSLGIIALVLGALFVTNRWSWKT
FT                   KKYMRIELVLWLAVLLGGTYLYLAINGAI"
FT   sig_peptide     178074..178136
FT                   /locus_tag="Mmah_0150"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            178913..181066
FT                   /locus_tag="Mmah_0151"
FT   CDS_pept        178913..181066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0151"
FT                   /product="efflux transporter, hydrophobe/amphiphile
FT                   efflux-3 (HAE3) family"
FT                   /note="COGs: COG1033 exporter of the RND superfamily
FT                   protein; InterPro IPR000731:IPR004767; KEGG: vei:Veis_2986
FT                   RND efflux transporter; SPTR: Q46D10 Transporter, RND
FT                   superfamily; TIGRFAM: efflux transporter,
FT                   hydrophobe/amphiphile efflux-3 (HAE3) family; PFAM: MMPL
FT                   family; TIGRFAM: The (Largely Archaeal Putative)
FT                   Hydrophobe/Amphiphile Efflux-3 (HAE3) Family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35686"
FT                   /db_xref="GOA:D5E935"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004767"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:D5E935"
FT                   /protein_id="ADE35686.1"
FT                   /translation="MSTGTETYVDKDTKVYQDYENIYLRYLGAHSIVIMISDEDIKSPE
FT                   VLKAIDRLDQQVSDIPGVVETLHIADAVKTANYMQTGKMQVPENRNDIVVPENGETDLL
FT                   LPDNTHTLFLIQTSGNTPDVRLEKILGETEKSVLYADFPPATSVVVTGEEAFSIEMQNA
FT                   IRQAMPPLIGASALLIIIALYLTFRGVRWRVLPIFIVGIGIIYTFGAMGYIGIPMTMVS
FT                   MAAFPILIGLGIDYMIQFHNRLEEEFSSQDSEKAAVVETVKHTAPAILTAYSISALGFV
FT                   SLLTSSVPMIRDFGKMLFIGTFLCYIAAQFIGVPAIYLLARKHKKRLSGASEGNDTNSN
FT                   SGKPTVIERLLDKTTVFTVNHPVPILIIAGMLCIFGLYADQSVPVQTDEKEFVPQDMDA
FT                   LIHIDNFYKITERGESVYLVIQTGDNTDPGLIRWMDSFSEYIVDSHSNVYGSTSIVSAV
FT                   KSLNSGSIPDTNSEIAKIYDTIPQNQKASYLHGNNLLMMELSVNNDLDGEGLGNLIDYI
FT                   QEDIAWYQSPPDTEITITGSNVVFTAIIGALTTGRLLMTLLGVIMIFIGLLFVYRDWLK
FT                   ALVPVVTMFMVIGWAGGVMYYSGLSYSPMTATLGAMILGIGTEYAIHIMERYYEEKEKG
FT                   ATSIEAMRQASTKIGSAIVTSGLTTIFGFSALIVSPFLINQNFGLITVMIVFLALISSF
FT                   FVFPATLILLEKIRDRRKGSHDI"
FT   gene            181063..182118
FT                   /locus_tag="Mmah_0152"
FT   CDS_pept        181063..182118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0152"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q8PWN2 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35687"
FT                   /db_xref="GOA:D5E936"
FT                   /db_xref="UniProtKB/TrEMBL:D5E936"
FT                   /protein_id="ADE35687.1"
FT                   /translation="MKKIIYVTLLLMIFSISIGASAGVTSVPPHNTIDYYEVSGMPNIR
FT                   GSFLSNPEFEKGETRVIEVNLANKGVIQALRINVVPQDPPDIELAQNEMEKEKMRTVAQ
FT                   GVKAELGSSTDYIEVRPETSVYTLKALKPGMILEHPLRYTIDIDNNAPAGNYSLNLAVS
FT                   YSYQSQVRTVTNNEILRDVAENPYVSYYKNASTSITFPVEIKESPNFEITDSRGNISAD
FT                   EGSIINITYKNIGENVAEDASVKLVVMDPLEMEHSIATLGDVKPDETVTASFEFSTGRD
FT                   VIPKNYSISSSVKYFDDEGIQYSNVLSSKVEVLPSDKWMSLSTLALLIIMLLIIYLIGD
FT                   TVKNKRNNKGV"
FT   sig_peptide     181063..181128
FT                   /locus_tag="Mmah_0152"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            182120..183265
FT                   /locus_tag="Mmah_0153"
FT   CDS_pept        182120..183265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0153"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q8PWN3 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35688"
FT                   /db_xref="GOA:D5E937"
FT                   /db_xref="UniProtKB/TrEMBL:D5E937"
FT                   /protein_id="ADE35688.1"
FT                   /translation="MIARNTVLLTILCLIFLSSSTAIGTSIDFNVSEIENDDSIYWTVS
FT                   PQRSDNFNFGDNFYTTYGGPDLKAHILGNNEFSSGDIYNLNINLANKGTITGFEIENEA
FT                   DDDLDIKLQAIEKGYETERTTAIGITSVLLSPHSFIDVKSGPQESGTLRSGEQTQSSPK
FT                   FIVDIDDDAPAGTYFLVLRTVYGYQENVQVSGDELTAEGNIKDVEIGMWYEARSQNHTI
FT                   PLIIKKEANFEVVNVTSDLRSGEGGVLKVTYRNTGNLPAKDATAKISVYTPFSTTDDQA
FT                   FLGTLEAGDTAQGVFSLNVDETTISKNHSINSEIRYEDTESKTQLSDTMKISVQTLPAI
FT                   SLKDKILGNTWILVILVILMVASAGMVIYMKLIRKENKIRP"
FT   sig_peptide     182120..182191
FT                   /locus_tag="Mmah_0153"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            183262..183762
FT                   /locus_tag="Mmah_0154"
FT   CDS_pept        183262..183762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0154"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: glo:Glov_0131 hypothetical protein; SPTR:
FT                   B7R091 Putative uncharacterized protein; PFAM: Predicted
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35689"
FT                   /db_xref="GOA:D5E938"
FT                   /db_xref="UniProtKB/TrEMBL:D5E938"
FT                   /protein_id="ADE35689.1"
FT                   /translation="MNAAVLLINGMALAGILIAFMDDRTKAILSINIAFKGFMQILPVT
FT                   LAIIIVIALFLGFVPPEQLSAFIGEQSGISGVLLIGIAGAIMHIPAILSFPLAASLLEK
FT                   GISYTAVAALITTLTMIGTVTLPLEISQLGKKFALLRNGISFVIAIIIALLVGVAMEAT
FT                   LWH"
FT   gene            183753..184286
FT                   /locus_tag="Mmah_0155"
FT   CDS_pept        183753..184286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0155"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: glo:Glov_0132 hypothetical protein; SPTR:
FT                   B7R090 Putative uncharacterized protein; PFAM: Predicted
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35690"
FT                   /db_xref="GOA:D5E939"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:D5E939"
FT                   /protein_id="ADE35690.1"
FT                   /translation="MALISQISNQQNLKDWTFLGIVLLVAFLLLNTYPSKTGSVTEYFW
FT                   QYLVEMALILPAVMLIMGLFSAYVSNSMIEKYLGKYAGKKGIFLSFFLGSLPTGPLYVA
FT                   FPIASHLLEKGARISNVIIFLSAWACLKIPQELMEFQFLGWKFMLLRLFFTAILVVVMA
FT                   RFIEYLFGITNDKV"
FT   gene            184572..185654
FT                   /locus_tag="Mmah_0156"
FT   CDS_pept        184572..185654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0156"
FT                   /product="periplasmic binding protein"
FT                   /note="COGs: COG0614 ABC-type Fe3+-hydroxamate transport
FT                   system periplasmic component; InterPro IPR002491; KEGG:
FT                   sfu:Sfum_3702 periplasmic binding protein; PFAM:
FT                   periplasmic binding protein; SPTR: Q12YJ3 ABC
FT                   Fe3+-siderophore transporter, substrate binding subunit;
FT                   PFAM: Periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35691"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D5E940"
FT                   /protein_id="ADE35691.1"
FT                   /translation="MHKKFRYILLIFIILFAVYTSACVDQKEVSAQSTRSITDMAGRTV
FT                   EIPADVDKAITTSPPATMLIYMLAPEKLAGWNFMPQESETYLKPEYRAVPVIGGWFGKQ
FT                   DGNYETIISMGPDIIFEGYTSCGDVNSTINERQKKFGTIPVVGIEATTDATAYEEPIRF
FT                   MGEILGENERAGLLISFYKETLDTVTTKTSRIPEEEKKRVYYAEGPDGLLTDPKGSAHS
FT                   QLIEVCGGINVAQCPIEQGYGRSEVSIEQVLQWDPEVIITGDRNFYKNVYEDPLWQDIT
FT                   AVKNDEVYLFPDAPFCWFDRPPGVNRIIGIPWTAKVLYPQEFSDLDLRGNVKEFYSEFY
FT                   HYELSEDEIDDLLDPASGAN"
FT   sig_peptide     184572..184637
FT                   /locus_tag="Mmah_0156"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            185694..186347
FT                   /locus_tag="Mmah_0157"
FT   CDS_pept        185694..186347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0157"
FT                   /product="Methyltransferase type 11"
FT                   /note="COGs: COG2226 Methylase involved in
FT                   ubiquinone/menaquinone biosynthesis; InterPro
FT                   IPR013216:IPR004033:IPR013217; KEGG: pca:Pcar_2048
FT                   hypothetical protein; PFAM: Methyltransferase type 11;
FT                   UbiE/COQ5 methyltransferase; Methyltransferase type 12;
FT                   SPTR: Q12YJ4 UbiE/COQ5 methyltransferase; PFAM:
FT                   Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35692"
FT                   /db_xref="GOA:D5E941"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5E941"
FT                   /protein_id="ADE35692.1"
FT                   /translation="MTEELTERVGFHDEYAENFEDVAANIFAPIYPVISQQIINRCQIK
FT                   SGNFIDVGSGPASLAIALGEIVDGKVYAMDFSEKMLAIAKRKIESFDLNENVIPIFGDV
FT                   HDMPFEDCFADLIVSRGSLFFWQNVPEAFREIYRVLKSGGMAYIGGGFGTAELKSKITQ
FT                   AMEKRDPEWSKCVGKRLDRTNLESFKKALHVAGIDPYTIIDDESGFWICLKKVD"
FT   gene            186351..188096
FT                   /locus_tag="Mmah_0158"
FT   CDS_pept        186351..188096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0158"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG1180 Pyruvate-formate lyase-activating
FT                   enzyme; InterPro IPR007197; KEGG: pca:Pcar_2049
FT                   pyruvate-formate lyase-activating enzyme; PFAM: Radical SAM
FT                   domain protein; SPTR: Q12YJ5 Fe-S protein, radical SAM
FT                   family; PFAM: Periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35693"
FT                   /db_xref="GOA:D5E942"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027596"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:D5E942"
FT                   /protein_id="ADE35693.1"
FT                   /translation="MKCNICEIGCDLAEGQSGQCRMYINKDDRIIERFSNNYFTMFPVS
FT                   IETVPLLHYYPRGTFLQVCTVGCNFKCEGCISEILASRLLSTNKKSGISNENVINKALH
FT                   EDCIGIVFCLNDPAVSYFTFCDLANKARENNLLIGCSTNGYFTENALKELIPLIDFVNI
FT                   GIKGYSDERYISCGARGSGPVFRNLKLLKESDVHVEVSTIYIKGSEDEVINTAKFVSSL
FT                   SRDISFQVMRFVPFGDAAPQIEPTIRESEVLCGKLKQYLNHVYLFNSPGTDHLNTVCAQ
FT                   CSNIIFQREFFGPMGSRTLSYLPQGMCECSNPALFRGEVSEVSYHEPGFMGGYRITRAL
FT                   EMIHAILVCLGVKDDHKLAEIWANVMETGYLEEFHASSQDLNSYFDVIEHFAALADRKK
FT                   EGMELVAYMREKLDFIRSVTNDIERPRVYYCMGYPLFALNGERIENNLVEAAGGESVNK
FT                   LINREGKPGVGISHNEFCDMNPEFIFISGFLSTPVSDSYAYCKKYGLSADAIKNRRIYD
FT                   LRPLWDFGSPRWILGLMYIANKLHPEIFNFDIDKEANQFYKRFYGVSFDSSRHNRSFYS
FT                   VSSRQ"
FT   gene            188135..189196
FT                   /locus_tag="Mmah_0159"
FT   CDS_pept        188135..189196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0159"
FT                   /product="transport system permease protein"
FT                   /note="COGs: COG0609 ABC-type Fe3+-siderophore transport
FT                   system permease component; InterPro IPR000522; KEGG:
FT                   avn:Avin_47150 bacterial transport system permease protein;
FT                   PFAM: transport system permease protein; SPTR: Q12YJ6 ABC
FT                   Fe3+-siderophore transporter, inner membrane subunit; PFAM:
FT                   FecCD transport family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35694"
FT                   /db_xref="GOA:D5E943"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D5E943"
FT                   /protein_id="ADE35694.1"
FT                   /translation="MSYGIGRITGLKSGIHKRISEGNTQIFLAFFLMIFLFVLSLFMGR
FT                   YSIPPQTIMTNIIFWLLSLGNVEPSNVGTVIFQIRLPRIIAAMLVGAGLSISGASFQGL
FT                   FRNPLVSPYILGVASGAGFGACLGILISENIFVIQLMAFSFGILAAFLAYSLSKSCKTT
FT                   ATLVLVLSGIIVGAVFTALTSLVKYIADPYDKLPEMVFWLMGSLSSVRVEDLIYVTPAI
FT                   LAGMLVLILIGWRINVISLGEEEARSLGIDTRKMTILVVICATLVTTSAISISGIIGWV
FT                   GLVVPHISRMLVGPSYKKLLPMSVFLGASFLLVVDDLARTLMSIEIPLGILTALIGAPF
FT                   FAYLLQKKKVGWS"
FT   gene            189193..189963
FT                   /locus_tag="Mmah_0160"
FT   CDS_pept        189193..189963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0160"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1120 ABC-type cobalamin/Fe3+-siderophores
FT                   transport systems ATPase components; InterPro
FT                   IPR003439:IPR003593:IPR017871; KEGG: ppd:Ppro_1463 ABC
FT                   transporter related; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase; SPTR: Q12YJ7 ABC Fe3+-siderophore transporter,
FT                   ATPase subunit; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35695"
FT                   /db_xref="GOA:D5E944"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5E944"
FT                   /protein_id="ADE35695.1"
FT                   /translation="MILRVDNASYSYDGKKNVFEDISFFLKKGETLCILGPNGIGKSTL
FT                   LKCLGNVLKLSEGSVLIDGNDISSMSRTEIAQKIGYVPQSDQSVFPFSVLDFVMLGRAP
FT                   HLPFFSSPGEKDLRIAGNAISKVGISHLRDRPVTEVSGGERQLALIARALAQEPEILLL
FT                   DEPTSHLDFGNQVRVLNLIERLTSQGTSVIMSTHFPDHGFIGSKNVAIMLENDFIEQGT
FT                   AEEVITKENMALAYGVDVAIDHVSSIQRNVCLPL"
FT   gene            complement(189980..191881)
FT                   /locus_tag="Mmah_0161"
FT   CDS_pept        complement(189980..191881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0161"
FT                   /product="phosphoadenosine phosphosulfate reductase"
FT                   /note="COGs: COG0175 3'-phosphoadenosine 5'-phosphosulfate
FT                   sulfotransferase (PAPS reductase)/FAD synthetase;
FT                   InterProIPR001450:IPR002478:IPR002500:IPR017900:IPR 004521;
FT                   KEGG: gem:GM21_0790 phosphoadenosine phosphosulfate
FT                   reductase; PFAM: phosphoadenosine phosphosulfate reductase;
FT                   PUA domain containing protein; 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; SMART: PUA domain
FT                   containing protein; SPTR: Q12UR6 Phosphoadenosine
FT                   phosphosulfate reductase; PFAM: PUA domain;
FT                   Phosphoadenosine phosphosulfate reductase family; TIGRFAM:
FT                   uncharacterized domain 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35696"
FT                   /db_xref="GOA:D5E945"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="UniProtKB/TrEMBL:D5E945"
FT                   /protein_id="ADE35696.1"
FT                   /translation="MSQPVFHGDLLLQWCHSCNVAVLGKKCACGAECVKVNVTPPGDIR
FT                   PAFLHDIEHINRISKQQFNNPLLDTDRIVLLNKAPYEDRMDEVIVDGEVIASIRYEIGK
FT                   LEWVLLPRLEAARRIMAGKENLTGYVTIEDDVKIFLHKGANLLAPGVLDADSGIQKNDE
FT                   VIIITTAGEVVATGRARMDGQEMMEAQKGTAVKPRWKEDTTSKVNDRKPSCWDDVIRAN
FT                   RFIMDEAIGQAHDFIQKTIKKEELPISVSYSGGKDSLAVVQLVDECVGDYDIMFADTGL
FT                   EFPETLENIDHVGELYSKDVRSISVGEAFWDSIDAFGPPAVEMRWCCKICKLGPLSQLI
FT                   KENYDKGCLTFVGQRKYESTTRARSNRVWKNPWVGNQTAASPIQDWTALHIWLYIFMNE
FT                   LPYNPLYEKGFDRMGCWLCPSSSLGDLKRLKETHPHYEEKLMKHLYAYADKTGIDKEWA
FT                   DYGFWRWKSLPANIKKIAEELGINTAPTRYDPNKLTFTSSVGHRPCTTGEMTAEGSFST
FT                   VLDMEKIRKSGMLLAIGEVKYTDEMAMITRKKDTAQVFATGSVRVRASSKSDAGKLLRD
FT                   TESSIRRALGCTGCGVCIGKCPHNAIRIENKIAYIGDKCTHCGKCIEVCPVVKFIRD"
FT   gene            complement(191927..192724)
FT                   /locus_tag="Mmah_0162"
FT   CDS_pept        complement(191927..192724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0162"
FT                   /product="CRISPR-associated protein Cas4"
FT                   /note="InterPro IPR013343; KEGG: DNA2; DNA helicase,
FT                   ssDNA-dependent ATPase, and endonuclease; K10742 DNA
FT                   replication ATP-dependent helicase Dna2; PFAM:
FT                   CRISPR-associated protein Cas4; SPTR: Q12UR5 Putative
FT                   uncharacterized protein; TIGRFAM: CRISPR-associated protein
FT                   Cas4; PFAM: Domain of unknown function DUF83; TIGRFAM:
FT                   CRISPR-associated protein Cas4"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35697"
FT                   /db_xref="GOA:D5E946"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR013343"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="UniProtKB/TrEMBL:D5E946"
FT                   /protein_id="ADE35697.1"
FT                   /translation="MCAMFCETNSNVSEVVLYTKCPRKIYFTSRNEVISNEIEKPYIRH
FT                   LLLKELALSCAEIAVSKQEILPLLQKRVEEIVQEIITIYSDELEHIDENQFKDALEDVY
FT                   EVLPAIAGNLKNQFDEEMIELIKPVEIEPLMHSDKLNLSGAPSAIICSDKQKIPMLIKT
FT                   GNAPMQGVWKNDRIPLAAYSILTEERYDQPVNSAVLFYASQGQARSVRIRPAERREVLN
FT                   ILKRIEKIKEGKMPQAKRGKLCGYCPYEQMCQSQGDSLASKFF"
FT   gene            192843..193583
FT                   /locus_tag="Mmah_0163"
FT   CDS_pept        192843..193583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0163"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="COGs: COG1709 transcriptional regulator protein;
FT                   InterPro IPR001387; PFAM: helix-turn-helix domain protein;
FT                   SMART: helix-turn-helix domain protein; SPTR: Q12UR4
FT                   Transcriptional regulator, XRE family; PFAM:
FT                   Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35698"
FT                   /db_xref="GOA:D5E947"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR017271"
FT                   /db_xref="UniProtKB/TrEMBL:D5E947"
FT                   /protein_id="ADE35698.1"
FT                   /translation="MTEDASKENLRHRLAEKMAGEITLSDKPGEALKKWRLNFEIAQTD
FT                   ISSYLGVSPSVISDYESGRRKSPGTLIVSKIVDALINIDSESGGHKIHAYEGMLYSDKA
FT                   SKAVYATYEYTYPMQLAKLATLIEADVANRGVEKPLYGFTVVDSKKAILELSSHEFQKL
FT                   YGWSTERAMIFTKVSTGKSPMVAIRVTNLKPAAVVLHGLSIRDVDPMAKKMAEVDRIPL
FT                   LATTMDLDELIEALKHYSQYQVME"
FT   gene            193616..194665
FT                   /locus_tag="Mmah_0164"
FT   CDS_pept        193616..194665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0164"
FT                   /product="hydroxymethylglutaryl-CoA synthase"
FT                   /note="COGs: COG3425 3-hydroxy-3-methylglutaryl CoA
FT                   synthase; InterPro IPR013747:IPR004656; KEGG: pfl:PFL_5954
FT                   hypothetical protein; PFAM: 3-Oxoacyl-[acyl-carrier-protein
FT                   (ACP)] synthase III domain protein; SPTR: Q12UR3 UPF0219
FT                   protein Mbur_1932; TIGRFAM: hydroxymethylglutaryl-CoA
FT                   synthase; PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)]
FT                   synthase III C terminal; TIGRFAM: hydroxymethylglutaryl-CoA
FT                   synthase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35699"
FT                   /db_xref="GOA:D5E948"
FT                   /db_xref="InterPro:IPR004656"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:D5E948"
FT                   /protein_id="ADE35699.1"
FT                   /translation="MSVGIVSYGTYIPKYRIKVEDIAKVWGDNADILSAGLMVNEKSVP
FT                   DLDEDTVTIAVEASRAAICRSSLDPSRIGAIYTGSESHPYAVKPTSTIVAEAVEATPEM
FT                   TAADLEFACKAGSAGIQACMGLVQSGMADLGLAIGSDVSQGAPGDALEYTAAAGGAAYI
FT                   IGNKEEEMVAIIEDTYSFTTDTPDFWRREGMPYPEHGGRFTGEPGYFKHVLGAAKGLMN
FT                   KLGTSAEDYDYAVFHQPNGKFPSRVAKMLGFSKEKIAPGLLVTRLGNTYSGSCLMGIAA
FT                   TLDQAKPGDRIFATAFGSGAGADAFSFRVTDKIDKIRDKAPRVEELLANPVYMDYAMYA
FT                   KHKGKIKRS"
FT   gene            194676..195848
FT                   /locus_tag="Mmah_0165"
FT   CDS_pept        194676..195848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0165"
FT                   /product="Thiolase"
FT                   /note="COGs: COG0183 Acetyl-CoA acetyltransferase; InterPro
FT                   IPR002155; KEGG: gur:Gura_4354 thiolase; PFAM: Thiolase;
FT                   SPTR: Q46F11 Acetyl-CoA acyltransferase; PFAM: Thiolase,
FT                   C-terminal domain; Thiolase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35700"
FT                   /db_xref="GOA:D5E949"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D5E949"
FT                   /protein_id="ADE35700.1"
FT                   /translation="MRDVAIIGSYTTKFGEMWERSFRDIVVEAGVGALEDAGVGGESID
FT                   SMFVGNMSGGQFVEQEHIGALIADYSGLAAGLHVPSTRVEAACASGGLAFRQGIQSVAS
FT                   GYNDIVVAAGVEKMTDVSSVGASSALAAAADREWEGMMGATFPGLYAMIARMHMQQYGT
FT                   TSEQLAQVAVKNHKNGTNNPIAQYRNNITVDKVLNSIMVADPLHIFDCSPITDGAAALV
FT                   LAPAEDAHKYTDTPIYIKGSGQASDTIALHDRRDITTLDASVYAAKRAYEMAGIGPDDV
FT                   DVAEVHDCFTIAEICAIEDLGFVEKGQGGRFVEEGNTVIGGKIPVNTSGGLKACGHPVG
FT                   ATGIKQAAEIVNQLRGEAGKRQVEGAEIGLAHNVGGSGATALVHVLGRER"
FT   gene            195855..196244
FT                   /locus_tag="Mmah_0166"
FT   CDS_pept        195855..196244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0166"
FT                   /product="protein of unknown function DUF35"
FT                   /note="COGs: COG1545 nucleic-acid-binding protein
FT                   containing a Zn-ribbon; InterPro IPR002878; KEGG:
FT                   vei:Veis_2934 hypothetical protein; PFAM: protein of
FT                   unknown function DUF35; SPTR: Q12UR1 Putative
FT                   uncharacterized protein; PFAM: Rubredoxin-like zinc ribbon
FT                   domain (DUF35_N); DUF35 OB-fold domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35701"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:D5E950"
FT                   /protein_id="ADE35701.1"
FT                   /translation="MSVARFWRQQVQRYNLVGNHCRNCDEYYYPPRTTCPFCRRNGEME
FT                   EYKFSGKGELVTYTIIHSAAEGFEHQTPYVLGIVKLEEGPRLTSQIIAQPEDVNIGMKV
FT                   RPVFRKLGESGDKGMLHYGTKFTPA"
FT   gene            196249..196764
FT                   /locus_tag="Mmah_0167"
FT   CDS_pept        196249..196764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0167"
FT                   /product="adenylyl cyclase CyaB"
FT                   /note="COGs: COG1437 Adenylate cyclase class 2
FT                   (thermophilic); InterPro IPR008172:IPR008173; KEGG:
FT                   vpa:VP1760 putative adenylate cyclase; PFAM: adenylate
FT                   cyclase; SPTR: Q12UR0 Adenylate cyclase; TIGRFAM: adenylyl
FT                   cyclase CyaB; PFAM: CYTH domain; TIGRFAM: adenylyl cyclase
FT                   CyaB, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35702"
FT                   /db_xref="InterPro:IPR008173"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:D5E951"
FT                   /protein_id="ADE35702.1"
FT                   /translation="MLEVEVKSRITLSHAREVLDRLDAKFLETEEHFDIYYNAPHRDFA
FT                   ETDEALRIRSVNDRQVLTYKGKKLDEVTKSREEIQTHVEAEAMIHILERLGFKETARVQ
FT                   KVRDVFKIGDITLCLDEVDSLGQFIEFEIISDADMEESKKRIFAMMENFGLKPEDSIRK
FT                   SYLELVME"
FT   gene            196811..198226
FT                   /locus_tag="Mmah_0168"
FT   CDS_pept        196811..198226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0168"
FT                   /product="sodium/glutamate symporter"
FT                   /note="COGs: COG0786 Na+/glutamate symporter; InterPro
FT                   IPR004445; KEGG: tgr:Tgr7_1728 sodium/glutamate symporter;
FT                   PFAM: sodium/glutamate symporter; SPTR: Q12V53
FT                   Sodium/glutamate symporter; PFAM: Sodium/glutamate
FT                   symporter; TIGRFAM: sodium--glutamate symport carrier
FT                   (gltS)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35703"
FT                   /db_xref="GOA:D5E952"
FT                   /db_xref="InterPro:IPR004445"
FT                   /db_xref="UniProtKB/TrEMBL:D5E952"
FT                   /protein_id="ADE35703.1"
FT                   /translation="MSASTVGLSLIVIGLVLLIGKWIRVVSPPLQKLFIPSSLIGGFLG
FT                   LFLGGEVLGNVVSWAGITGTFLSGGLFPEYMLDVWIALPGLFINIIFATLFLGKKIPSL
FT                   RQMWILAGPQITHGQTIAWGQYVFGILATILILTPFFGIDPMAGALIEISFEGGHGTAA
FT                   GMAATFEELGFEEAGDLSLGLATVGILFGVIFGILMLNYGVRTGKTMVLQNPEEISLDA
FT                   SRQTGIIDFDARESAGKITTRPESIEPLSLHFAYVGVAIGIGYVILQALIQLEKITWGQ
FT                   ATDIYLMTYIPLFPLAMIGGIILQMFLDRYDVHQTLDRGLMMRIQGLSLDILITSAIAT
FT                   LSLTVIGNNLMPFIILATVGIVWNLVAFIYLGPRMMPTYWFERSIGNFGQSMGMTASGL
FT                   LLMRIADPDNRSPAMEGFGYKQLLFEPIVGGGVFTAASVPLIFYFGPIPVLLLAFVVML
FT                   FWMGLGIFYFGKK"
FT   gene            complement(198250..200292)
FT                   /locus_tag="Mmah_0169"
FT   CDS_pept        complement(198250..200292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0169"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /note="COGs: COG0143 Methionyl-tRNA synthetase;
FT                   InterProIPR014758:IPR015413:IPR002547:IPR004495:IPR 002304;
FT                   KEGG: mxa:MXAN_2804 methionyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class I (M); t-RNA-binding domain protein;
FT                   PRIAM: Methionine--tRNA ligase; SPTR: Q12UQ9 Methionyl-tRNA
FT                   synthetase; TIGRFAM: methionyl-tRNA synthetase;
FT                   methionyl-tRNA synthetase, beta subunit; PFAM:
FT                   Anticodon-binding domain; tRNA synthetases class I (M);
FT                   Putative tRNA binding domain; TIGRFAM: methionyl-tRNA
FT                   synthetase C-terminal region/beta chain;
FT                   glutamate--cysteine ligase/gamma-glutamylcysteine
FT                   synthetase, Streptococcus agalactiae type; methionyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35704"
FT                   /db_xref="GOA:D5E953"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023458"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:D5E953"
FT                   /protein_id="ADE35704.1"
FT                   /translation="MSRFSPDKPILVTCGLPYANGMAHIGHLRTYIPADIFVRSLKKMG
FT                   HEVTFVCGSDTHGTPIVFNAEEQNTTPQALIKKYHSHFDETFKSMGIEFDAFGTTDDPT
FT                   NHNRTHDIVNRLIENDYVYPKTIEIAYCAGCNRFLPDRYVEGECPHCAESARGDECDQG
FT                   CGKHLEPGELKNPVCTICGGVAEYKEQEHFFFKLSQFNDYLLEYLDRLDGTSNARNYAL
FT                   GWVKQGLDDWCITRNLEWGVKFPGRDDLVVYVWVDAPIGYIAFTEEWANATGDSWEKYW
FT                   KDDGEIVHFIGGDIIYHHCIFLPAMLKGAGYSPASSVVASGMVKIENKTFSKSRGYVVW
FT                   VGDDYMQQGFHQDLLRYYLASYTSHTKELNFSWKVFQEKTNTELVGVFGNFLYRTLLFA
FT                   YKNFKAIPEGKLDDEVMETIQNTIDEASEAMEKYEFKKYADSVMTLASYGNIYFQSREP
FT                   WNLIKEDKEECGRVLKNCMQIGKALTLLYEPLIPEKAGNAWKQLGMESDVHTALYSQGT
FT                   VPVESGTSLNKPSILFKKIEDETIEKMEAIASQRVKEANEKQNRKKGEQIMTDNEEITF
FT                   EDFGKLDMRVGTIVEAEKVEKADKLLRLEVDIGEETPRQIVAGIALTHSPEEVKGRQVI
FT                   VLANLKPAKLCGVKSFGMVLAGVDEDGGAILLSPEKEAKNGTQIG"
FT   gene            200455..201573
FT                   /locus_tag="Mmah_0170"
FT   CDS_pept        200455..201573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0170"
FT                   /product="signal peptide peptidase A"
FT                   /note="COGs: COG0616 Periplasmic serine protease (ClpP
FT                   class); InterPro IPR002142:IPR004635; KEGG: sfu:Sfum_2119
FT                   signal peptide peptidase SppA, 36K type; PFAM: peptidase
FT                   S49; SPTR: Q12UQ8 Signal peptide peptidase A. Serine
FT                   peptidase. MEROPS family S49; TIGRFAM: signal peptide
FT                   peptidase SppA, 36K type; PFAM: Peptidase family S49;
FT                   TIGRFAM: signal peptide peptidase SppA, 36K type"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35705"
FT                   /db_xref="GOA:D5E954"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D5E954"
FT                   /protein_id="ADE35705.1"
FT                   /translation="MNENDPTNNDEGESFSGNKRFLAGSDKSLYTELEDEPYEEPVQDQ
FT                   PLSGSPPLSPPDETGKGRMDAPEKKSNFGKYAALIAVLLLVIGSSFAIIYYAAGGDFYP
FT                   DNDRVAVIYIQGTMLTGSVPSGLGYATSEDISSSIRKAVDDDSVKAIVLRVNSGGGSGS
FT                   ASEEINTEIRKAQQAGVPVVTSMGDVAASAAYHVSSSTDLIVANRNTMTGSIGVIWTFR
FT                   NMSAYYEEEGIDFHVAKSGEFKDMGGTWRGLSDEEKEYADRVIMESYNLFVQDVAQGRN
FT                   MTVSEVKDIADGRIYTGVSAKRIGLIDEYGNFYDAIDRAAGMGGIEGEPSIYYVNKPSI
FT                   TNLLFGSEVQNDNMVENFVNYYEKSPFGKLAY"
FT   gene            201585..202322
FT                   /locus_tag="Mmah_0171"
FT   CDS_pept        201585..202322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0171"
FT                   /product="SagB-type dehydrogenase domain protein"
FT                   /note="COGs: COG0778 Nitroreductase; InterPro
FT                   IPR000415:IPR020051; KEGG: pca:Pcar_2755 nitroreductase;
FT                   PFAM: nitroreductase; SPTR: A3CSD8 Nitroreductase; TIGRFAM:
FT                   SagB-type dehydrogenase domain; PFAM: Nitroreductase
FT                   family; TIGRFAM: SagB-type dehydrogenase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35706"
FT                   /db_xref="GOA:D5E955"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR020051"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D5E955"
FT                   /protein_id="ADE35706.1"
FT                   /translation="MTGEGKRFMEATRFGELDPSPQMLGRSPPPLEIAPDADRSLISLP
FT                   EVDGLEMDSVDLKRAIEARRSIRNFTGSSLSLQDLAWLLWATQGVKKVMDDVATFRTVP
FT                   SAGARHSFETYLSIGNVEGLEQGLYRYLALEHSIVEEQQDENIMSKVAHACLDQSFVHN
FT                   CGAVFIWVAISERMGWRYGERGYRYLHLDAGHVCQNLYLASQAVKCGVCAVAAFKDDEL
FT                   NSLLGLDGDKHFVVYLAAVGKRD"
FT   gene            complement(202324..203250)
FT                   /locus_tag="Mmah_0172"
FT   CDS_pept        complement(202324..203250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0172"
FT                   /product="ribose 1,5-bisphosphate isomerase"
FT                   /EC_number="5.3.1.23"
FT                   /EC_number="5.3.1.-"
FT                   /note="COGs: COG1184 Translation initiation factor 2B
FT                   subunit eIF-2B alpha/beta/delta family; InterPro
FT                   IPR000649:IPR011559:IPR005250; KEGG: gur:Gura_4322 aIF-2BI
FT                   family translation initiation factor; PFAM: initiation
FT                   factor 2B related; PRIAM: S-methyl-5-thioribose-1-phosphate
FT                   isomerase; SPTR: Q12UQ7 Ribose 1,5-bisphosphate isomerase;
FT                   TIGRFAM: translation initiation factor, aIF-2BII family;
FT                   eIF-2B alpha/beta/delta-related uncharacterized protein;
FT                   PFAM: Initiation factor 2 subunit family; TIGRFAM: eIF-2B
FT                   alpha/beta/delta-related uncharacterized proteins;
FT                   ribose-1,5-bisphosphate isomerase, e2b2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35707"
FT                   /db_xref="GOA:D5E956"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005250"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR027363"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/TrEMBL:D5E956"
FT                   /protein_id="ADE35707.1"
FT                   /translation="MQQLLDTAEKIRSMEIRGAGRIATAAAKALRDYVEMLETSSFEEF
FT                   VAKVEKAKSILIETRPTAVSLPNAVMLAGSYDAETVEEARSQILDNATEFIRNADNALD
FT                   NIGEIGAKRLRDGDTVMTHCNSHAALAIIKTAHKQGKRIKVYATESRPRRQGFITIKEL
FT                   SDAGIDTTLIVDSAVRYTMKNVDTVIVGADSITVNGALVNKIGTSQLALAAHEARVNFI
FT                   SAAETYKFSPSTLFGDLVEIEERDPDEVIPSDKLGDMPDVKISNPAFDVTPSEYIDLIV
FT                   TEAGAFPPEMAYVIIKEHLGWELKKMG"
FT   gene            203369..203539
FT                   /locus_tag="Mmah_0173"
FT   CDS_pept        203369..203539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0173"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35708"
FT                   /db_xref="UniProtKB/TrEMBL:D5E957"
FT                   /protein_id="ADE35708.1"
FT                   /translation="MSDAPDYNNDTEECLSEEEVEELMVRTSRKQVRSDYRRSLGSEAS
FT                   RRYCDLNTGKD"
FT   gene            203640..204950
FT                   /locus_tag="Mmah_0174"
FT   CDS_pept        203640..204950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0174"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="COGs: COG1012 NAD-dependent aldehyde dehydrogenase;
FT                   InterPro IPR015590:IPR016160; KEGG: rhi:NGR_c25860 putative
FT                   NADP+ dependent succinate-semialdehyde dehydrogenase; PFAM:
FT                   Aldehyde Dehydrogenase; SPTR: Q12UQ5 Aldehyde
FT                   dehydrogenase; PFAM: Aldehyde dehydrogenase family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35709"
FT                   /db_xref="GOA:D5E958"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:D5E958"
FT                   /protein_id="ADE35709.1"
FT                   /translation="MHNSEAVSDRLENSYHAFLDWKSLDVDVRCDYLRQVARMLRQCKQ
FT                   ECAELITREMGKPLKQSLGEIAKCALTFDYYADRTPSFMEPRVEDTDATYSSVFFEPMG
FT                   PVLCIKPWNFPFWQVLSAASHILAGGNTILLKHSSSVPACALKIEEIMQQAGLPEGVFQ
FT                   TLLIDGKTASSLISSDEIAAVSFTGGTEAGRRVAVKAASSLKKYVLELGGSDPFVVLEG
FT                   ADVQKAAKAAAAARFINTGQTCIAAKRFVVEESLMEEFKRHFIEQTRRMKVGDPLEEDT
FT                   DIGPLVRAEEMHRLGSQVADSIEKGAKVELDGGLVEGAGFFYSPVVLSGITDNMDVMRQ
FT                   ETFGPVAPLISVKDEAEAIKVANATPYGLGASIWGGDSDHLLEIGKRIQAGVVGINGFF
FT                   KPDACMPFGGMKQSGVGRELSDFGFYEFMHIRSLKSF"
FT   gene            complement(204998..205288)
FT                   /locus_tag="Mmah_0175"
FT   CDS_pept        complement(204998..205288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0175"
FT                   /product="protein of unknown function DUF427"
FT                   /note="COGs: COG2343 conserved hypothetical protein;
FT                   InterPro IPR007361; KEGG: noc:Noc_0837 hypothetical
FT                   protein; PFAM: protein of unknown function DUF427; SPTR:
FT                   Q12TU5 Putative uncharacterized protein; PFAM: Domain of
FT                   unknown function (DUF427)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35710"
FT                   /db_xref="InterPro:IPR007361"
FT                   /db_xref="InterPro:IPR038694"
FT                   /db_xref="UniProtKB/TrEMBL:D5E959"
FT                   /protein_id="ADE35710.1"
FT                   /translation="MPVAKYKGVVLADSKVTEKVEGNHYFPPESVNMEYFRDSDTVTVC
FT                   PWKGKGSYYDIVLEDSTLKDGAWYYPQPKPAASNIKGYLAFDTRGGVEITD"
FT   gene            205366..206187
FT                   /locus_tag="Mmah_0176"
FT   CDS_pept        205366..206187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0176"
FT                   /product="protein of unknown function Met10"
FT                   /note="COGs: COG2520 methyltransferase; InterPro IPR003402;
FT                   KEGG: dps:DP0629 hypothetical protein; PFAM: protein of
FT                   unknown function Met10; SPTR: Q0W4W1 Putative
FT                   uncharacterized protein; PFAM: Met-10+ like-protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35711"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="UniProtKB/TrEMBL:D5E960"
FT                   /protein_id="ADE35711.1"
FT                   /translation="MSKNSLKTLVEKEVPADLIEYIPNRFDVVGDIAIVSIPPELWDYS
FT                   EMIATKVVSMRGNIGTVLNKISRVKGDHRVSDFKILLGGSTVTTHGEFKYRYRLDLSEV
FT                   FFNPRLGYERHRVTSLVLPREDVLVAFCGVGPFAIPAAIRDVRVFCVEKNRYACHWLAE
FT                   NIRLNNFKGHIYPINADARDIPVILDMKFDRLIVPTPYGQDHFFSLLSPLLKEGGMMHF
FT                   YTFQVAEDIAKSKQAFKDAGYEIIGVRRCGNVARGVSRWVFDLKKNRPAKR"
FT   gene            206292..207641
FT                   /locus_tag="Mmah_0177"
FT   CDS_pept        206292..207641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0177"
FT                   /product="Protein of unknown function DUF516"
FT                   /note="COGs: COG1650 conserved hypothetical protein;
FT                   InterPro IPR007508; KEGG: hypothetical protein; PFAM:
FT                   Protein of unknown function DUF516; SPTR: Q12UQ4
FT                   D-tyrosyl-tRNA(Tyr) deacylase; PFAM: D-aminoacyl-tRNA
FT                   deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35712"
FT                   /db_xref="GOA:D5E961"
FT                   /db_xref="InterPro:IPR007508"
FT                   /db_xref="UniProtKB/TrEMBL:D5E961"
FT                   /protein_id="ADE35712.1"
FT                   /translation="MNIMSHLLEMDEWETQSFEPLYEDITSIYESGKFLLVEVSIHHIF
FT                   QDGLDGKLGELGFLPSCFIFASKHKSDDGRKLLTAHFTGNPSEAKFGGHPGKLSIAYSS
FT                   ALKPLLMQIQSYSAGMDYDVSMESTHHGPTDLQIPSIYAEIGSGPVQWDDKGAAEVLAR
FT                   SILSFYPQKLPIALGFGGGHYAARQSEIVLSNNVTFGHNIPSYQLKFVDESFFSQAVDK
FT                   SGADFVYMDRKAISSSDKEHLDDLARKNYLLVLRESDIQQIGNIPWVMFKNIMVRSRDI
FT                   EPTTPPLFTDVLRKDLENSSPDVVPDPVELIIDERLIHYTWKSNPDRFLGMLQEYPLVY
FT                   LQRDNGTYRGSFLLFEKKDAEDLQTHIIDECIKILKEHYEIEYIREDNLLYLTYRKFNP
FT                   IKAESIGVPGGPLFGKLARGIPVEVDGNIIHPDMVHETITKDLVLKNMIR"
FT   gene            207680..208783
FT                   /locus_tag="Mmah_0178"
FT   CDS_pept        207680..208783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0178"
FT                   /product="cell division protein FtsZ"
FT                   /note="COGs: COG0206 Cell division GTPase; InterPro
FT                   IPR000158:IPR018316:IPR003008; KEGG: plastid division
FT                   protein FtsZ (AB032072); K03531 cell division protein FtsZ;
FT                   PFAM: Tubulin/FtsZ GTPase; Tubulin/FtsZ, 2-layer sandwich
FT                   domain; SPTR: Q12UQ3 Cell division protein ftsZ; TIGRFAM:
FT                   cell division protein FtsZ; PFAM: Tubulin/FtsZ family,
FT                   GTPase domain; FtsZ family, C-terminal domain; TIGRFAM:
FT                   cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35713"
FT                   /db_xref="GOA:D5E962"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:D5E962"
FT                   /protein_id="ADE35713.1"
FT                   /translation="MKSIVEEALARSAEERQVSSEPSGPKDVNAEIEAVLKGMHTNIKV
FT                   IGCGGGGSNSIQRMTNEGIKGAQLVALNTDAQHLLNVICDNKILIGKKKTRGLGAGSLP
FT                   QIGEDAALESIDELTEVVDGTDMVFITAGLGGGTGTGSAAVVAEAARDAGALTIAVVTL
FT                   PFAVEGEVRRTNAEAGLERLRDVADTVIVVPNDKLLEVVPRLPLQAAFKVSDEVLMRAV
FT                   KGITELITKPGLVNLDFADVRTVMQNGGVAMIGLGEADGDSKASESVQKALRSPLLDVD
FT                   ISGATSALVNVVGGQDMTVSEAEGVVQEVYSRIDPGARLIWGAQVDPELEHTVRTMIVV
FT                   TGVKSPQIYGPGGAKNVTRRYGIDFVG"
FT   gene            208963..209145
FT                   /locus_tag="Mmah_0179"
FT   CDS_pept        208963..209145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0179"
FT                   /product="protein translocase subunit secE/sec61 gamma"
FT                   /note="COGs: COG2443 Preprotein translocase subunit Sss1;
FT                   InterPro IPR008158; SPTR: Q12UQ2 Preprotein translocase
FT                   subunit secE; TIGRFAM: protein translocase SEC61 complex,
FT                   gamma subunit; TIGRFAM: protein translocase SEC61 complex
FT                   gamma subunit, archaeal and eukaryotic"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35714"
FT                   /db_xref="GOA:D5E963"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR008158"
FT                   /db_xref="InterPro:IPR023391"
FT                   /db_xref="UniProtKB/TrEMBL:D5E963"
FT                   /protein_id="ADE35714.1"
FT                   /translation="MNNRSVSQILKSYYRVLKLARKPARDEFLMISKVAGAGIIVIGIV
FT                   GFVVYILLTELPTWV"
FT   gene            209150..209608
FT                   /locus_tag="Mmah_0180"
FT   CDS_pept        209150..209608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0180"
FT                   /product="LSU ribosomal protein L24A"
FT                   /note="COGs: COG0250 Transcription antiterminator; InterPro
FT                   IPR005824:IPR006645:IPR011590; KEGG: Os02g0772000;
FT                   hypothetical protein; PFAM: KOW domain protein; SMART: NGN
FT                   domain protein; KOW domain protein; SPTR: Q12UQ1 LSU
FT                   ribosomal protein L24A; TIGRFAM: ribosomal protein L24;
FT                   PFAM: Early transcription elongation factor of RNA pol II,
FT                   NGN section; KOW motif; TIGRFAM: ribosomal protein
FT                   L24p/L26e, archaeal"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35715"
FT                   /db_xref="GOA:D5E964"
FT                   /db_xref="InterPro:IPR005100"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011590"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="InterPro:IPR039659"
FT                   /db_xref="UniProtKB/TrEMBL:D5E964"
FT                   /protein_id="ADE35715.1"
FT                   /translation="MSEDSAIFVIKTTANQERSVAGMLAKVAKKENLDIRALLAPDELK
FT                   GYVLAESSNPGEVEQAIQTVPHARALVKGQSSMEEIMHFLTPKPTVTGITEGAIIEVTS
FT                   GPFKGEKARVKRVDEGHEEITVELFDAVVPIPITIRGDTVRILRKEEE"
FT   gene            209657..210145
FT                   /locus_tag="Mmah_0181"
FT   CDS_pept        209657..210145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0181"
FT                   /product="LSU ribosomal protein L11P"
FT                   /note="COGs: COG0080 Ribosomal protein L11; InterPro
FT                   IPR000911; KEGG: dvm:DvMF_1451 50S ribosomal protein L11;
FT                   PFAM: ribosomal protein L11; SMART: ribosomal protein L11;
FT                   SPTR: Q12UQ0 50S ribosomal protein L11P; PFAM: Ribosomal
FT                   protein L11, RNA binding domain; Ribosomal protein L11,
FT                   N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35716"
FT                   /db_xref="GOA:D5E965"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:D5E965"
FT                   /protein_id="ADE35716.1"
FT                   /translation="MSSVVEALVPGGKANPGPPLGPALGPLGVNIKEVVDTINEKTSDY
FT                   NGMQVPVKVIVADDKSVEIEVGTPPTAALVLQEAGVGKGAGEEGSSEIVGNLSITQLAK
FT                   IARMKKDDLLSYEMKAGIKEVLGTCVPMGVTGEGMDPRDCQKAIDEGKFDEALASEAW"
FT   gene            210272..210913
FT                   /locus_tag="Mmah_0182"
FT   CDS_pept        210272..210913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0182"
FT                   /product="LSU ribosomal protein L1P"
FT                   /note="COGs: COG0081 Ribosomal protein L1; InterPro
FT                   IPR002143; KEGG: vvu:VV1_1208 50S ribosomal protein L1;
FT                   PFAM: ribosomal protein L1; SPTR: Q12UP9 50S ribosomal
FT                   protein L1P; PFAM: Ribosomal protein L1p/L10e family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35717"
FT                   /db_xref="GOA:D5E966"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023669"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:D5E966"
FT                   /protein_id="ADE35717.1"
FT                   /translation="MVEESILNTVERLFEESPQRNFAESVDLAINLKNLDMSQPKYRVD
FT                   EEIYLPNGLGKDLKIAVFAKGEVGLQAKEAGCDYVFTEEDINDLADDKSRARSIANECD
FT                   FFIAEVQYMPLIGKTLGAILGPRGKMPVPLTPDKNVADMIRSSKNSIRIRSKDKLTFHV
FT                   AVGRRDMDAERIAENIESIVNRVESVLDKGKQNLKSIYVTTTMGKSLRVI"
FT   gene            210910..211947
FT                   /locus_tag="Mmah_0183"
FT   CDS_pept        210910..211947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0183"
FT                   /product="LSU ribosomal protein L10P"
FT                   /note="COGs: COG0244 Ribosomal protein L10; InterPro
FT                   IPR001790; KEGG: RPP0; Conserved ribosomal protein P0
FT                   similar to rat P0, human P0, and E. coli L10e; shown to be
FT                   phosphorylated on serine 302; K02941 large subunit
FT                   ribosomal protein LP0; PFAM: ribosomal protein L10; SPTR:
FT                   Q12UP8 Acidic ribosomal protein P0 homolog; PFAM: Ribosomal
FT                   protein L10; 60s Acidic ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35718"
FT                   /db_xref="GOA:D5E967"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022909"
FT                   /db_xref="InterPro:IPR040637"
FT                   /db_xref="UniProtKB/TrEMBL:D5E967"
FT                   /protein_id="ADE35718.1"
FT                   /translation="MMEEELHHSEHIPQWKKQEIEDIKALIEKYPLFGIVGVGGIPAKQ
FT                   LQAMRRELKDVAVLKVCRNTLVNRALESSSKDCSEMIDYLNQQCALIFTNENPFKLYKL
FT                   LEQSKTPSPIKAGAIAPQDIKVEKGPTSFPPGPILGDLQSAGIPASIDGGKVVVSENKV
FT                   VTEEGNVVSQNLASMLARLEIFPIEVGLDLHAVFEDGSIFTPDVLAIDNDKYFSDIAAA
FT                   SRQAFNLAVNVAYPTTATISTLISKASSEAMNLGINATVLEPEIMDSLLGKAHSQMISL
FT                   ASAVSANNEDAVDEDLKSVLGAAAQSAAATVEEQPAEEAAEEEVEEEEEDAEEGGMAGL
FT                   GALFG"
FT   gene            211977..212288
FT                   /locus_tag="Mmah_0184"
FT   CDS_pept        211977..212288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0184"
FT                   /product="LSU ribosomal protein L12AE"
FT                   /note="InterPro IPR001813; KEGG: AEL342Wp; K02943 large
FT                   subunit ribosomal protein LP2; PFAM: ribosomal protein 60S;
FT                   SPTR: P05394 50S ribosomal protein L12P; PFAM: 60s Acidic
FT                   ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35719"
FT                   /db_xref="GOA:D5E968"
FT                   /db_xref="InterPro:IPR022295"
FT                   /db_xref="InterPro:IPR027534"
FT                   /db_xref="InterPro:IPR038716"
FT                   /db_xref="UniProtKB/TrEMBL:D5E968"
FT                   /protein_id="ADE35719.1"
FT                   /translation="MEYIYAALLLHNAGKDVTEDAVKAVLEAAGTDVDDARAKALIAAL
FT                   EDVDIEEAMSTAAVAAAPAAAPAAAPAEATEEAAEAEEEEEEDESEESGMAGLGALFG"
FT   gene            212381..213355
FT                   /locus_tag="Mmah_0185"
FT   CDS_pept        212381..213355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0185"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG0535 Fe-S oxidoreductase; InterPro
FT                   IPR007197:IPR000385; KEGG: scl:sce6686 hypothetical
FT                   protein; PFAM: Radical SAM domain protein; SPTR: Q12UP4
FT                   Fe-S protein, radical SAM family; PFAM: Radical SAM
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35720"
FT                   /db_xref="GOA:D5E969"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5E969"
FT                   /protein_id="ADE35720.1"
FT                   /translation="MSSFSIVSTLRAIWQMKMRRRPYVLSHGVNSRCNMQCPFCEYWKE
FT                   EKPDMTFEEIAQMLDGAADFGIGVYNAWTTEPLLREDLPDILEHAHSKGIITSLVTNGM
FT                   LLEKRLPALSNLDFLSISVDGLESYREIRGIDISHILPGIKKSVEIMERPVLLNCVISS
FT                   KNVDELTDLVYFASEIGARISFEPLYEFENIKDDVWGNMEVKDRAAYRRALDSLIGMKS
FT                   QGYPIINSLTYLKMVRDRKPSFKCHAPDIILNVGCDGMVETCRVHRQPLADIRQGVENA
FT                   WKTSKATMAKTVNECDKCLFFGYAENSLLYDYNLETLRHYEWM"
FT   gene            complement(213356..214123)
FT                   /locus_tag="Mmah_0186"
FT   CDS_pept        complement(213356..214123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0186"
FT                   /product="protein of unknown function DUF62"
FT                   /note="COGs: COG1912 conserved hypothetical protein;
FT                   InterPro IPR002747; KEGG: dal:Dalk_3152 protein of unknown
FT                   function DUF62; PFAM: protein of unknown function DUF62;
FT                   SPTR: Q8TI38 Putative uncharacterized protein; PFAM:
FT                   S-adenosyl-l-methionine hydroxide adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35721"
FT                   /db_xref="InterPro:IPR002747"
FT                   /db_xref="InterPro:IPR023227"
FT                   /db_xref="InterPro:IPR023228"
FT                   /db_xref="UniProtKB/TrEMBL:D5E970"
FT                   /protein_id="ADE35721.1"
FT                   /translation="MKIITLTTDFKDLYPASMKAVILDMCEDPTFIDLTHGIKQGDILS
FT                   AAFALYTTTHFFPAGTIHLAVVDPGVGTSRKAIIVRAANHYFIGPDNGLLIPAARRMGE
FT                   IEVFEIGEKAMLDRVSNTFHGRDIFAPTAGLLASGYKAEDIGQPLETFEELSFGEVNAA
FT                   VDKLYGKVLYIDSFGNVITNIPSKMLEAFAKPAEKLLVQGNVASYSPTYGKIKKNELLI
FT                   LTGSHDFLEIAVNGGNAAKRLDITGHPEIRIEK"
FT   gene            214260..216176
FT                   /locus_tag="Mmah_0187"
FT   CDS_pept        214260..216176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0187"
FT                   /product="Na+/solute symporter"
FT                   /note="COGs: COG0591 Na+/proline symporter; InterPro
FT                   IPR001734:IPR018212; KEGG: dat:HRM2_15670 sodium/solute
FT                   symporter family protein; PFAM: Na+/solute symporter; SPTR:
FT                   Q12UP3 Na+/solute symporter; PFAM: Sodium:solute symporter
FT                   family; TIGRFAM: SSS sodium solute transporter superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35722"
FT                   /db_xref="GOA:D5E971"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:D5E971"
FT                   /protein_id="ADE35722.1"
FT                   /translation="MESSQLFLILLAVYLVGLIGIGWYFTKKQNTVTDFWLAGRRIGTV
FT                   GVGFSSAASWLTAGGLLAVIAFFMLQGMGSIWGFVAPNILALLIIAIFVKKIKNLPAIT
FT                   QAELLEQRYSSAIRAPIGIIITIVMILFAVADIKGFALVLETFYGFDPLYAALIVALAV
FT                   SVYVTLGGLSAVVWTDVVQFLFLSVFTIVIAIVSVGAATGGAVDAPANAGELFSNVSSG
FT                   WWNPLSIGIPMVLIFLFAIVPGWITEQDPWQKVWAARDSKSARNGLLLGSLLITIVFAG
FT                   CAVIAIALSSIYPEIPAAGFPMGMAQAEPALLVFVLENFSPFIVALSAIGLAAAAMSCT
FT                   DTFATSGASCVSRDIYQRFIKPDATMKQMLAVNRLSVLFIVLAATVGSFFITSILEAIH
FT                   IATYIASASYFFPLMGGLYWKRATKEGAMAGLIVGAVVQISLIVYDIYMTAPMAPAYLQ
FT                   TVHPVLMNHGVIAGMGLSAVAFFGVSLLTKPSSAVNLAPFFKEEAKNLAAEAAVTVEED
FT                   DPKFQKFLKRIDEQLVGERAHLHVRLESSASVNWHRFVEALRSSYAAWVTPTGVDSVYR
FT                   LVQADMLSCVSITRGTTDKEIWFASEPPASEMGDQKKELFVAYNEVAAALESMGVILTV
FT                   VEE"
FT   gene            216247..217161
FT                   /locus_tag="Mmah_0188"
FT   CDS_pept        216247..217161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0188"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q12UP2 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35723"
FT                   /db_xref="GOA:D5E972"
FT                   /db_xref="UniProtKB/TrEMBL:D5E972"
FT                   /protein_id="ADE35723.1"
FT                   /translation="MRKQAVVLFLILTSAIYFSGCIDDIIPVDDTAETTNASEYTLDPF
FT                   IANNSCECGINTTTFYLYPDSPVKAVYVLENVNRLEVVPLEDITNTGSDVLSNIVILAR
FT                   PGGNNGNPAATVRQLSTSEQTDSIDYTLSEESESGQTKQVISFNQSLTGFVAYTMEVPM
FT                   GQDFMYVPSHLSTVRVVLPEGYTTGNQFIGKVEPGPDSRYVDGQGREVIVWDNLRQDTS
FT                   TSLSSLAKGLLSSEEEEEEEEIKFKTLYLKFYSEDAPRNLLIGTSILGAGVLLVIGNFL
FT                   RNRRKLNETIRMAEEDWKKDKKR"
FT   gene            complement(217164..217910)
FT                   /locus_tag="Mmah_0189"
FT   CDS_pept        complement(217164..217910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0189"
FT                   /product="beta-lactamase domain protein"
FT                   /note="COGs: COG1235 Metal-dependent hydrolase of the
FT                   beta-lactamase superfamily I; InterPro IPR001279; KEGG:
FT                   gem:GM21_0314 beta-lactamase domain protein; PFAM:
FT                   beta-lactamase domain protein; SPTR: Q12UP1
FT                   Beta-lactamase-like protein; PFAM: Metallo-beta-lactamase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35724"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D5E973"
FT                   /protein_id="ADE35724.1"
FT                   /translation="MKVTLLGTGDAPGTPIIGCNCLTCQDGLKGGKSNRLRCSILVESE
FT                   KGTILLDTGPDLRQQLLEHNIKHVDGVIWTHGHYDHFTGFGEFHRVQRKVDVYGLAETL
FT                   DYILEYLAFLRPRRNNVKINETFEIIGLRITLFEVKHRPVSNPVGVIIEENGKKVVFTG
FT                   DCERQIPQKSLEMIDSPDLLIADAIVPDSDVLHIKKHMDAKDALELAQKIKAKEVVFTH
FT                   ISHFFKPHSIAAQEFPMGYDGMQFVI"
FT   gene            complement(217911..219197)
FT                   /locus_tag="Mmah_0190"
FT   CDS_pept        complement(217911..219197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0190"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="COGs: COG0464 ATPase of the AAA+ class; InterPro
FT                   IPR003959:IPR011704:IPR003593:IPR003960; KEGG:
FT                   sfu:Sfum_2326 ATPase central domain-containing protein;
FT                   PFAM: AAA ATPase central domain protein; ATPase associated
FT                   with various cellular activities AAA_5; SMART: AAA ATPase;
FT                   SPTR: Q12UP0 AAA ATPase; PFAM: ATPase family associated
FT                   with various cellular activities (AAA)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35725"
FT                   /db_xref="GOA:D5E974"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D5E974"
FT                   /protein_id="ADE35725.1"
FT                   /translation="MSDNTLDIIELLLTAQIYNQNQVLDVNDLPKPIRKHYWKKEAKGV
FT                   PRPIHVSLTDVNKLYGESETKKALKGLPFVEIDEVGYKIKLTSLDMAISWFEKQDTARR
FT                   IEENPALAYYFEKAEKEGVSYNKARDSTKPKEVDREWIESLKAEVMEEEGGEDMLKLAQ
FT                   LLAPEDIQQGMSELILTKKQESEVDKIVKAIKFRDYLKEIGLYDVGKVLLVGPPGTGKT
FT                   SVARALSEMLSIPFVEVKLSMITDQYLGETAKNIDRVFELAKKLNPCILFVDEFDFIAK
FT                   TRTSDEHAALKRAVNTLLKAIDEISLTRDGVLLIAATNHPHMLDSAAWRRFDEILEFPL
FT                   PDYDMRKNILDIVTRHIKGNFDTAAIAEITEGYTGSDLRVVIREGVLDALLEERRELSN
FT                   KDLIDAVESFNNRSHIKSEKYLQQYDRVS"
FT   gene            complement(219316..219780)
FT                   /locus_tag="Mmah_0191"
FT   CDS_pept        complement(219316..219780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0191"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q46DJ9 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35726"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D5E975"
FT                   /protein_id="ADE35726.1"
FT                   /translation="MVAYAIIVCTKCRLQCQVTEERGQKTIQCQRCGATLQFRKLRKFH
FT                   RTEILDEAIAARTALQAQIQGSDSKKASQILSDASIDQLHPSPPTQKKPANPSKYIINA
FT                   LENQEKIQIRQLFQMAEEAGFEREKIEKTLENLKNTGEIYTPGKGYLKLA"
FT   gene            complement(219793..220479)
FT                   /locus_tag="Mmah_0192"
FT   CDS_pept        complement(219793..220479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0192"
FT                   /product="undecaprenyl diphosphate synthase"
FT                   /note="COGs: COG0020 Undecaprenyl pyrophosphate synthase;
FT                   InterPro IPR001441; KEGG: hypothetical protein; PFAM:
FT                   Di-trans-poly-cis-decaprenylcistransferase; SPTR: Q8THV9
FT                   Undecaprenyl diphosphate synthase; TIGRFAM: undecaprenyl
FT                   diphosphate synthase; PFAM: Putative undecaprenyl
FT                   diphosphate synthase; TIGRFAM: undecaprenyl diphosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35727"
FT                   /db_xref="GOA:D5E976"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:D5E976"
FT                   /protein_id="ADE35727.1"
FT                   /translation="MTSQKEDLGLLHKLYEKRLLKKIKQGQQNPPSSLAIVLPETDLLQ
FT                   KNSSQKTFQFINWCQEFGIKKIYFNVDILDEKPHLKNRMVDKLAQVIERICSKLPPKTG
FT                   YNVYGVEGDVLLTKSGKDPSIIFVLGYGGKKEITSSVRTILCDVEKGNIEPEDIDENTL
FT                   ESHLTIEGEPDLIIRSGGRHLSDFLIWQSVYSELYFTDINWNRFRRIDFLRIIRDFQKR
FT                   KRRYGK"
FT   gene            complement(220476..221660)
FT                   /locus_tag="Mmah_0193"
FT   CDS_pept        complement(220476..221660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0193"
FT                   /product="GTP-binding conserved hypothetical protein
FT                   TIGR00650"
FT                   /note="COGs: COG0012 GTPase probable translation factor;
FT                   InterPro IPR006073:IPR013646:IPR002917:IPR004095; KEGG:
FT                   hypothetical protein; PFAM: GTPase of unknown function
FT                   domain protein; GTP-binding protein HSR1-related; TGS
FT                   domain protein; SPTR: Q12UN7 GTP-binding protein,
FT                   HSR1-related; PFAM: GTPase of unknown function; TGS domain;
FT                   GTPase of unknown function C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35728"
FT                   /db_xref="GOA:D5E977"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013646"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="UniProtKB/TrEMBL:D5E977"
FT                   /protein_id="ADE35728.1"
FT                   /translation="MTMTIGLAGKPNAGKSTFFKAATMAEVDIANYPFTTIDANRGITY
FT                   VRTTCPCIERDKRCGNCEDGIRFVPIEIIDVAGLVPDAHQGRGLGNAFLDELSQAQAII
FT                   HVIDASGATDIEGNPGDIGSHDPLEDIDFLNREITMWMKGILCRNWERLARKIKAENLK
FT                   VEEAIANQLMGAGVCEEHVNVAIDQLGKREYIKWENEDMCQLCEYIRLLSKPVIIAANK
FT                   LDVAPPENVENLEKLEMIVVPTSAAAELAIRSAASTGAIDYKPGDEDFGIEEDDLSEKQ
FT                   IKGLEKLKSFMASRKPHGCGVQECINRAVFDQLNLIVVYPVEDEGHWTDKKGRMLPDAY
FT                   LVKKGSTANELAYKVHTDIGDRFLYAVDGRTRMRLGDKYELKDGDVIKIVSTAK"
FT   gene            221768..221839
FT                   /locus_tag="Mmah_R0001"
FT   tRNA            221768..221839
FT                   /locus_tag="Mmah_R0001"
FT                   /product="tRNA-Arg"
FT   gene            222465..224330
FT                   /locus_tag="Mmah_0194"
FT   CDS_pept        222465..224330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0194"
FT                   /product="GAF sensor signal transduction histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterProIPR004358:IPR003018:IPR003594:IPR003661:IPR 005467;
FT                   KEGG: wsu:WS0975 hybrid histidine kinase; PFAM: ATP-binding
FT                   region ATPase domain protein; GAF domain protein; histidine
FT                   kinase A domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein; SPTR:
FT                   Q12TH2 Sensor protein; PFAM: Histidine kinase-, DNA gyrase
FT                   B-, and HSP90-like ATPase; GAF domain; His Kinase A
FT                   (phosphoacceptor) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35729"
FT                   /db_xref="GOA:D5E978"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5E978"
FT                   /protein_id="ADE35729.1"
FT                   /translation="MAFIENQCSIQAQLDKNINFDLNTQQSQQKAFTREAIKILSSLFT
FT                   ELDNFDERIEKSLLILGTLTQASRAHLFLFNNEEMIMDNTHEWCADGVLPKKDLLQGLS
FT                   MNRLQWLMGKMRKGEIIHINDVNSLSEVAQNEKEILLTENVKSIILFPLVNGNKVVGFV
FT                   SLANTTYNDVGEKNDTEALKTMIDIMGQFFKEREYKKQLNAKIKIQKTVNNVQSILINH
FT                   YDSDEAFVSVLQEVSKLTKATHSYLFQFRNGENIADMTHEWCAESMPSHREKLHNLNSG
FT                   KFHWFTGRLKRNEVIQIVDPNRLPPEAAAEKKLLQTLGIKSLIAFPIWGEKKLAGFLTI
FT                   NNTERIARWDQNDIYMLLVIADSVGAVIKKEKANKAFLRAKSLEEDVKTTKTEFIATMS
FT                   HELRTPLNAIIGFSQLLSSNRYGNMNEKELKYSFSILKGGKHLLNLINDILDFSKIHSN
FT                   KMELNIETINLKEICDEIKTFITPLATKKGITVEYNNKFDIDINLDKLKFIQIMSNLLS
FT                   NAVKFTPDKGKVSVDIDFVAEYVQVSVTDSGIGIPEHKLNMIFDPFIQADSSNTRKYGG
FT                   TGLGLALVKEYVEMHGGTIWVESELGKGSTFTFTIPVNDNDFVND"
FT   gene            224347..224430
FT                   /pseudo
FT                   /locus_tag="Mmah_0195"
FT   gene            224596..224946
FT                   /locus_tag="Mmah_0196"
FT   CDS_pept        224596..224946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0196"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q8TQY1 Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35730"
FT                   /db_xref="UniProtKB/TrEMBL:D5E979"
FT                   /protein_id="ADE35730.1"
FT                   /translation="MAKKWMLVLLLVLTVSFAGCVNKDSLVERTNDSLLEESKDIAEAY
FT                   VLNHEDYMRYSVTEPVFLGSEKLDCSNCWSFTYEFDLISAKDPDVIDTATINVTVKDLE
FT                   VVETVYSQGMKD"
FT   sig_peptide     224596..224664
FT                   /locus_tag="Mmah_0196"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            225093..226631
FT                   /locus_tag="Mmah_0197"
FT   CDS_pept        225093..226631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0197"
FT                   /product="cytochrome c, putative"
FT                   /note="InterPro IPR011031; KEGG: shl:Shal_0614 cytochrome
FT                   c, putative; SPTR: Q64BJ9 Cytochrome c putative; PFAM:
FT                   Cytochrome c bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35731"
FT                   /db_xref="GOA:D5E980"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR024673"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:D5E980"
FT                   /protein_id="ADE35731.1"
FT                   /translation="MYMRGQVILLLFISIVCLSGIACATEMNHSFLEGPYDSGPEVTEE
FT                   CIGCHEPQAKDMLNSTHWLWTSCGDCECGDIESYKDMGKRTVINNFCVAVASNEPRCTS
FT                   CHAGYGWEDDTFDFNNASNIDCLVCHDNTGTYNKIPTGAGAVDTSVDLAEVAQSVGSPT
FT                   RDTCGGNCHFYGGGGDNVKHGDMSSALSDPSPELDVHMGLLDFKCQNCHETSDHNVAGH
FT                   FSGLPGTECRVECSDCHGETPHLGEYKERLDDHVDAIACQSCHIPKYAREVPTKMYWDW
FT                   SQAGQDIDPVPTDEYGKATYNKKKGSFVWEKNVTPAYAWYNGSSDLYKLGDTINADGMT
FT                   VINAPVGSRDDADSQIYPFKIHRAKQISDAEYNYLIVPDLFGGENSYWATYDWDKAAAS
FT                   GMEYVDMPYSGEYEFVETSLYESINHEVPPAEYSLECSDCHLESGMMDFEALGYQGDPM
FT                   LVGERFVEEVEDVRQSVGQDAPESGEESSEGVPGFGIFLGICMLLVVNILWGRR"
FT   sig_peptide     225093..225164
FT                   /locus_tag="Mmah_0197"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            226824..228443
FT                   /locus_tag="Mmah_0198"
FT   CDS_pept        226824..228443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0198"
FT                   /product="thermosome subunit"
FT                   /note="COGs: COG0459 Chaperonin GroEL (HSP60 family);
FT                   InterProIPR017998:IPR001844:IPR002423:IPR002194:IPR 012714;
FT                   KEGG: similar to Chaperonin containing TCP1, subunit 4
FT                   (delta); K09496 T-complex protein 1 subunit delta; PFAM:
FT                   chaperonin Cpn60/TCP-1; SPTR: Q46DJ0 Hsp60; TIGRFAM:
FT                   thermosome; PFAM: TCP-1/cpn60 chaperonin family; TIGRFAM:
FT                   thermosome, various subunits, archaeal"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35732"
FT                   /db_xref="GOA:D5E981"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012714"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:D5E981"
FT                   /protein_id="ADE35732.1"
FT                   /translation="MAGQPIYILADGSQVTRGRDAQSNNIMAGKAVANAVRTTLGPKGM
FT                   DKMLVDSMGDVVITNDGATILKEMDIEHPTAKMIVEVAKTQDDEVGDGTTTAAVLAGEF
FT                   LSKAEELLKKGVHPTIIATGYRQAAKKAVEIVKSISIDISRDDTEALKKVANTAITGKG
FT                   AESHKEMLAELTVEAVSLIGEETDDGYVADVSDIKIEKQAGESVGESKLVKGLVLDKAR
FT                   THPNMPEKIEDAKILVLSVPVEFKKTEMDAEIKISSPDQMQMFLDQEEKMVKQMTDKIL
FT                   NSGANVVFCQKGIDDLAQYYLEKAGIYAAKRLKKSDLDRICEATGATNIQDIDEITAKD
FT                   LGSADLVEERDIKGNKMTYITGCREKKAVSIILHGGTQHVVDSLQHAVDDALHVVAVAL
FT                   EDGKVVAGGGSPEVELSMRLGEYASSLSGREQLAVAKFAEAFEVIPETLAENSGYDPIN
FT                   KLVELRSKHEEGNKRMGLNVYTGEIVDMWESNVIEPLRAKTQAINAGTEAAVMVLRIDD
FT                   VVAASPHSNQASPEMPDMDMDM"
FT   gene            228532..229080
FT                   /locus_tag="Mmah_0199"
FT   CDS_pept        228532..229080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0199"
FT                   /product="BioY protein"
FT                   /note="COGs: COG1268 conserved hypothetical protein;
FT                   InterPro IPR003784; KEGG: sat:SYN_00210 hypothetical
FT                   protein; PFAM: BioY protein; SPTR: Q12UN5 BioY protein;
FT                   PFAM: BioY family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35733"
FT                   /db_xref="GOA:D5E982"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:D5E982"
FT                   /protein_id="ADE35733.1"
FT                   /translation="MVNNTNLSDSPVRKMVYAALFASMTAVGAYISIPVGLVPVTLQTL
FT                   FVILAGAVLGARWGMLSMFIYVLLGIVGLPVFSGGSSGLGVLAGPTGGYIIGFILAALV
FT                   IGYLFEKFQYRSIVSMVAIFLVGMIAIYVPGYFQLMYVASLGMEETFALGVAPFIPGAA
FT                   IKIAAATIIYRYLKTESLV"
FT   sig_peptide     228532..228618
FT                   /locus_tag="Mmah_0199"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            229077..229901
FT                   /locus_tag="Mmah_0200"
FT   CDS_pept        229077..229901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0200"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1122 ABC-type cobalt transport system
FT                   ATPase component; InterPro IPR003439:IPR003593:IPR017871;
FT                   KEGG: sat:SYN_00209 ABC-type cobalt transport system,
FT                   ATPase component; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase; SPTR: Q8TI16 Cobalt import ATP-binding protein
FT                   cbiO; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35734"
FT                   /db_xref="GOA:D5E983"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5E983"
FT                   /protein_id="ADE35734.1"
FT                   /translation="MIEIENLSFGFKENQRVLDGINVSIDSGEFVVLVGGNGSGKSTFV
FT                   RHLNGLLLPDEGMVKVWGMDTCVISNLTAIRRKVGMVFQNPLTQFIGATVEEDVAFGLE
FT                   NLAYPSSIIREKTDHSLAELGISHLAGKSPLELSGGQMQLAALAGVLVMEPECVIFDEV
FT                   TSMLDFFSKQQVLATITRLHEKGKTIIMVTHNLEEVHLAERVIAFEKGSIVYDGNSSLF
FT                   FDSPAVSNPGISIPPLTELALWLRNNGLKEIDVSNPDANALEESIWQSISRI"
FT   gene            229898..230689
FT                   /locus_tag="Mmah_0201"
FT   CDS_pept        229898..230689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0201"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1122 ABC-type cobalt transport system
FT                   ATPase component; InterPro IPR003439:IPR003593:IPR017871;
FT                   KEGG: sat:SYN_00209 ABC-type cobalt transport system,
FT                   ATPase component; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase; SPTR: Q12UN3 ABC transporter, ATPase subunit; PFAM:
FT                   ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35735"
FT                   /db_xref="GOA:D5E984"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5E984"
FT                   /protein_id="ADE35735.1"
FT                   /translation="MNFSYGQNLVLQNVSMYIKPGEIVGLTGPVGAGKSTFMRLLVGLL
FT                   EPDNGIMKIDGYSHSAKRFREMIGVLFQHSSRQLFEKTVYDDIAFGPSNFGLDKRDIEA
FT                   QVQNAVDIVGLDESLLEVSPFGISGGEQKLVALAGIIAQLPRYMLLDEPFAGLDTKGKT
FT                   RLPYIIQALQNMGVGIIVISHHLDKLLEVAPRIIYLRDGRVCFDGQRQQYLLDDTLPLP
FT                   AITNLMKGLHERGLPVNPDTFTVKSAMKQLAKLGLGDVDDA"
FT   gene            230682..231476
FT                   /locus_tag="Mmah_0202"
FT   CDS_pept        230682..231476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0202"
FT                   /product="cobalt transport protein"
FT                   /note="COGs: COG0619 ABC-type cobalt transport system
FT                   permease component CbiQ and related transporter; InterPro
FT                   IPR003339; KEGG: sat:SYN_00208 ABC-type cobalt transport
FT                   system, permease component; PFAM: cobalt transport protein;
FT                   SPTR: Q12UN2 Cobalt ABC transporter, inner membrane
FT                   subunit; PFAM: Cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35736"
FT                   /db_xref="GOA:D5E985"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:D5E985"
FT                   /protein_id="ADE35736.1"
FT                   /translation="MPDYFLSFVPGDSFLHRLDPRTKLIATMLISILIFRLHITGLVLL
FT                   FALFMVLYYLSSVRIAMLRNLHPIAPFLIFIFIFQLFLIPGNSFMDIYGFSATSEGFFE
FT                   GLRIVGRFVLLIQFASLLTATTSPAHMAAGIERLLRPLPGKVLGVTSFDIATMMSLSIH
FT                   LVPVLNRFLKEVYQAQLCRGLGRQKRISGLVSLAIPLLRGAFRMMDDISMGMESRCYQG
FT                   NYRTSLFELKMEKYDWMVLMLVFVLLLAFWDLSITLLPSYQI"
FT   gene            231728..233659
FT                   /locus_tag="Mmah_0203"
FT   CDS_pept        231728..233659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0203"
FT                   /product="Hydantoinase/oxoprolinase"
FT                   /note="COGs: COG0145 N-methylhydantoinase A/acetone
FT                   carboxylase beta subunit; InterPro IPR008040:IPR002821;
FT                   KEGG: sme:SMc02580 hypothetical protein; PFAM:
FT                   Hydantoinase/oxoprolinase; Hydantoinaseoxoprolinase domain
FT                   protein; SPTR: Q12UM9 Hydantoinase/oxoprolinase; PFAM:
FT                   Hydantoinase/oxoprolinase; Hydantoinase/oxoprolinase
FT                   N-terminal region"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35737"
FT                   /db_xref="GOA:D5E986"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:D5E986"
FT                   /protein_id="ADE35737.1"
FT                   /translation="MVYSLGIDAGGTYTDSVLLDDDTDSILDSNKALTTYPDPLDGIKN
FT                   SIDGLDQEKLKKVKIVSVSTTLSTNTILEGTGFPVGLFLIGNYDLKEKLPTPHYVKVAG
FT                   GHTYNGGEKEPLDEEAVRDFAVKIKDKVAAFAISSFFSIRNPDHEIRAKQIIREATGLP
FT                   VVCAHELSQDLGAFERATTAFFNAQLLPITERFMSTVEKDVTSRGISPKIFMLKCDGSV
FT                   IGIKSALEKPIESIFSGPAGSLVGASFLTGNDSCAVIDVGGTSTDISVIKDGVPEMSEM
FT                   GAVVGGWKTRVKAIKMETSAMGGDSHIWVKDGKLNVGPRRVIPLCRAADLYPHFLELLK
FT                   INPIPSKTLIGMNFQPTTFFTRTEYEAMGLNDLEQELLDSISSSPTSLRELRSRMGRYP
FT                   STRILDSLIQKRLVQCIGFTPTDALHVLGDYTARNVEAAEVGAEYLGSLCKRTGDEFAR
FT                   YVKETFAKNMASDLISFFLEGIPREEIRKIFDIDCPTKFKVDIPVVLIGGPVVAYKDIL
FT                   GSIIDAEIIVPKYSDVGNATGALAAKGVRRVDFLIRPASMAAPDWEYYVFSEKGRQSFY
FT                   EYKDAIKYARETGQSMVMQYMEDAGLDPDHVEIDVKKDEIVPEGWDFPMETRIRIIGVG
FT                   TRLIDEEA"
FT   gene            complement(233876..234049)
FT                   /locus_tag="Mmah_0204"
FT   CDS_pept        complement(233876..234049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0204"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q12UM8 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35738"
FT                   /db_xref="UniProtKB/TrEMBL:D5E987"
FT                   /protein_id="ADE35738.1"
FT                   /translation="MEQLLKLKDKLEKMTSAELYEYVKENYPENPDAGLGKKKLVIRRI
FT                   LNLEREKMNKCE"
FT   gene            234189..235334
FT                   /locus_tag="Mmah_0205"
FT   CDS_pept        234189..235334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0205"
FT                   /product="ketose-bisphosphate aldolase class-II"
FT                   /note="COGs: COG0191 Fructose/tagatose bisphosphate
FT                   aldolase; InterPro IPR000771; KEGG: gme:Gmet_1761
FT                   fructose-bisphosphate aldolase; PFAM: ketose-bisphosphate
FT                   aldolase class-II; SPTR: Q12UM7 Fructose-bisphosphate
FT                   aldolase; PFAM: Fructose-bisphosphate aldolase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35739"
FT                   /db_xref="GOA:D5E988"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5E988"
FT                   /protein_id="ADE35739.1"
FT                   /translation="MSESKFEPLPSSYLFNSLLDKDTIILAANPRISLVMRGIMKAAKD
FT                   ADAPLIVELARSESDLEGGYSGMTPAEFSKRCKKTANEVGLDVWSLHADHIGIKKGTPD
FT                   DIESTRQLVSGQIDAGYTSFAIDASHLFNFQGGNLREELSQNIDATTEIAHHIQDKMSG
FT                   RKYGLEVEVGEIGREDENGRVLTKPEEAVTFIKALNENGVYPHVLAIANGSAHGNTYDT
FT                   NGNLIQQVSVDIEQTIAVADALKENGFSVRIAQHGITGTPRELIYEHFPHGDILKGNVA
FT                   TFFQNIVWEVFRIYEPELFSDIRKWTIENFRSKAPEKSDNEIFGKFSKYAVRQFFDRID
FT                   AVGENTRRAIDAKVYAETLMFLGAFKAEGTAQQVRDYIKSL"
FT   gene            complement(235341..235706)
FT                   /locus_tag="Mmah_0206"
FT   CDS_pept        complement(235341..235706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0206"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q8Q004 Putative uncharacterized protein; PFAM:
FT                   DsrE/DsrF-like family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35740"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR032836"
FT                   /db_xref="UniProtKB/TrEMBL:D5E989"
FT                   /protein_id="ADE35740.1"
FT                   /translation="MHKVTNVLILLKSMIYESTGPLETLRFAKHYSEQGLNVNIVLFGP
FT                   MGVMLAKKDKAGALEYDKKVDECMNLGVNFMCCKLGSSLVGLKYEEMIPGIEMVEPEAI
FT                   ADTILEFSQKQQLIITL"
FT   gene            complement(235716..236027)
FT                   /locus_tag="Mmah_0207"
FT   CDS_pept        complement(235716..236027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0207"
FT                   /product="protein of unknown function DUF167"
FT                   /note="COGs: COG1872 conserved hypothetical protein;
FT                   InterPro IPR003746; PFAM: protein of unknown function
FT                   DUF167; SPTR: Q46F75 Putative uncharacterized protein;
FT                   PFAM: Uncharacterised ACR, YggU family COG1872; TIGRFAM:
FT                   conserved hypothetical protein TIGR00251"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35741"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR005228"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/TrEMBL:D5E990"
FT                   /protein_id="ADE35741.1"
FT                   /translation="MPIRDAIHTKGNGCIIDFEINPGSSKLVVPSGYNIWRKRVEGKLT
FT                   ESAQKGKANDQLIQRLSHIFQINSSSITIVAGAKTTKKSVHLENVYPKTAEDVLEQYL"
FT   gene            236306..237043
FT                   /locus_tag="Mmah_0208"
FT   CDS_pept        236306..237043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0208"
FT                   /product="NADPH-dependent F420 reductase"
FT                   /note="COGs: COG2085 dinucleotide-binding protein; InterPro
FT                   IPR004455:IPR010185; KEGG: cps:CPS_4044 NADPH-dependent
FT                   F420 reductase; PFAM: NADP oxidoreductase coenzyme
FT                   F420-dependent; SPTR: Q12UM3 Reduced coenzyme F420:NADP
FT                   oxidoreductase; TIGRFAM: NADPH-dependent F420 reductase;
FT                   PFAM: NADP oxidoreductase coenzyme F420-dependent; TIGRFAM:
FT                   NADPH-dependent F420 reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35742"
FT                   /db_xref="GOA:D5E991"
FT                   /db_xref="InterPro:IPR010185"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5E991"
FT                   /protein_id="ADE35742.1"
FT                   /translation="MRDERFMKIAILGGTGHIGKGFALRWGSLHDIIIGSRNAERASSA
FT                   AKEYRGRLEDLGKKGSFEGVDNKTAAQMADVVLLAIKYRHVSSVIENITPVLKDQIVVS
FT                   VVVPMEKDSCYIIPDARHMEVDVRDSAYNAEYFCYTQPAGGSAAEEIAKFLPQNIRLVS
FT                   GFHNVPAKHLEDLSLALDYDIAICGNDMASKEVVCKLTEDIPNLRPLDAGPLQASSMIE
FT                   SLTPLLINIAARNNMDDVGVKFI"
FT   gene            complement(237114..238706)
FT                   /locus_tag="Mmah_0209"
FT   CDS_pept        complement(237114..238706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0209"
FT                   /product="glutamate synthase (NADPH) GltB2 subunit"
FT                   /EC_number="1.4.1.13"
FT                   /note="COGs: COG0069 Glutamate synthase domain 2; InterPro
FT                   IPR002932; KEGG: sfu:Sfum_4067 ferredoxin-dependent
FT                   glutamate synthase; PFAM: ferredoxin-dependent glutamate
FT                   synthase; SPTR: A0B9A6 Ferredoxin-dependent glutamate
FT                   synthase; PFAM: Conserved region in glutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35743"
FT                   /db_xref="GOA:D5E992"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5E992"
FT                   /protein_id="ADE35743.1"
FT                   /translation="MGNLRQPNANEATRTFNRSKSVAPMSGICTRCVDGCRGNCEIFKS
FT                   SFRGREVLYPGPFGEVTAGADKDYPVDYSHLNIQGYAVGAVGLPDGMEASPETARFPNV
FT                   NTETEYGWNKKVKMRLPAFTGALGSTDIARKNWNEFAVGAAITGITLVCGENVCGIDPE
FT                   LKRDNNGLVTESPEMDRRIAAYNKFHDGYGEMLVQMNVEDTKLGVAEYISSKHEMDTLE
FT                   LKWGQGAKCIGGEIKVRELDRALELKRRGYIVTPDPENAAVQEAYKVGAIREFERHSRL
FT                   GFVDKEGFLEEVDRLRSIGYDRITLKTGAYSMVEAAMALKYSSEAKIDLLTFDGAPGGT
FT                   GMSPWPMMEEWGIPTFYLQSLVYEFAEKLNNKGERVPDLAMAGGFSSEDGIYKALAMGS
FT                   PYFKAVCMGRGLMIPGMVGKNIGKWLDEDNLPKTVSEFGHRPEEIFVYYEDLEERYGED
FT                   VKDIPLGAMGIYSYGEKLKVGLQQLMAGSRRFNINTLSRKDVMALTEEAAEVSGIDYVM
FT                   NAYRDVAEQILDE"
FT   gene            complement(239207..239473)
FT                   /locus_tag="Mmah_0210"
FT   CDS_pept        complement(239207..239473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0210"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pca:Pcar_0398 hypothetical protein; SPTR:
FT                   Q8TIE3 Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35744"
FT                   /db_xref="GOA:D5E993"
FT                   /db_xref="UniProtKB/TrEMBL:D5E993"
FT                   /protein_id="ADE35744.1"
FT                   /translation="MPEFESLSKINPQNVHFEVPRGYGVSVIKLYFWVGLVSAVLLRII
FT                   IIADHYSAFYTKVIWYLGVAGYIWFFMHRYHNSKAQIQCNRRS"
FT   gene            complement(239639..239977)
FT                   /locus_tag="Mmah_0211"
FT   CDS_pept        complement(239639..239977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0211"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="COGs: COG0347 Nitrogen regulatory protein PII;
FT                   InterPro IPR002187:IPR017918; KEGG: tmz:Tmz1t_1760 nitrogen
FT                   regulatory protein P-II; PFAM: nitrogen regulatory protein
FT                   P-II; SPTR: Q8PYA5 Nitrogen regulatory protein P-II; PFAM:
FT                   Nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35745"
FT                   /db_xref="GOA:D5E994"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:D5E994"
FT                   /protein_id="ADE35745.1"
FT                   /translation="MYKVEAIIKPTKLHEVKDSLEEAGFASLTVTEVKGRGQQKGMMQQ
FT                   WRGRKYCVDLLPKTKIELVLAEEKLDEVVELIRKTATTGEIGDGKIFIYPVQSVIRIRT
FT                   GEVDEDAL"
FT   gene            complement(239988..241397)
FT                   /locus_tag="Mmah_0212"
FT   CDS_pept        complement(239988..241397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0212"
FT                   /product="ammonium transporter"
FT                   /note="COGs: COG0004 Ammonia permease; InterPro
FT                   IPR001905:IPR018047; KEGG: dal:Dalk_3033 ammonium
FT                   transporter; PFAM: ammonium transporter; SPTR: Q8TIE5
FT                   Ammonium transporter; TIGRFAM: ammonium transporter; PFAM:
FT                   Ammonium Transporter Family; TIGRFAM: ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35746"
FT                   /db_xref="GOA:D5E995"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:D5E995"
FT                   /protein_id="ADE35746.1"
FT                   /translation="MSINMEKIGKLMILTCVILIVLLSPGAAVTAEENAQAISDMETAL
FT                   TFVWLLIASALVFFMHTGFSLVETGLTRSKNTANILMKNFMTITLGILIYWAVGWGVMY
FT                   GADAAGLIGTDQFFLMGADNATYNGWFFQMVFAATGATIVSGAMAERTDFKAYLVFCIL
FT                   MVAIIYPVYGHWVWSGADLALLTGAESPIVKAIGVAHHDFAGSGVVHSIGGYAALAGVL
FT                   LVGARVGKFKNGKPFAIPGHNLTFAFMGTLILALGWMGFNGGSTLDGNDPYMNLVLVNT
FT                   FLSAAAGAIMVMLITWMKTGKPDPSLTANGLLGGLVAITAPCGSVTNGASILIGIVGGI
FT                   IIYAGVMFNENVLKVDDPVGAVAVHGYCGSWGLLSVGLFSIGIGNGVLVDAVYAAEVPG
FT                   LFYGGGVGLLAIQAVGVILSIVWAFGISYIVFKIIDMVIGLRVSEDIEIMGLDIAEHDI
FT                   RAYPEHQLIED"
FT   sig_peptide     complement(241308..241397)
FT                   /locus_tag="Mmah_0212"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            241439..241672
FT                   /pseudo
FT                   /locus_tag="Mmah_0213"
FT   gene            241713..242099
FT                   /locus_tag="Mmah_0214"
FT   CDS_pept        241713..242099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0214"
FT                   /product="Protein of unknown function DUF2178,
FT                   transmembrane"
FT                   /note="InterPro IPR019235; PFAM: Protein of unknown
FT                   function DUF2178, transmembrane; SPTR: Q12Z30 Putative
FT                   uncharacterized protein; PFAM: Predicted membrane protein
FT                   (DUF2178)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35747"
FT                   /db_xref="GOA:D5E996"
FT                   /db_xref="InterPro:IPR019235"
FT                   /db_xref="UniProtKB/TrEMBL:D5E996"
FT                   /protein_id="ADE35747.1"
FT                   /translation="MQVKEIGMLTIGFILFLIGLGFYILEPAWIINPSGTGGAFIGAGV
FT                   ALFLITLREIRLKSKGNIVEDERVFHIAEKASHKTLVILIVLEGTLMAFLGVTAFDIQA
FT                   YPVVSLLFAITMISYAGFYYWYKK"
FT   gene            242124..242318
FT                   /locus_tag="Mmah_0215"
FT   CDS_pept        242124..242318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0215"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="COGs: COG1476 transcriptional regulator protein;
FT                   InterPro IPR001387; KEGG: shl:Shal_4180 XRE family
FT                   transcriptional regulator; PFAM: helix-turn-helix domain
FT                   protein; SMART: helix-turn-helix domain protein; SPTR:
FT                   Q12Z31 Transcriptional regulator, XRE family; PFAM:
FT                   Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35748"
FT                   /db_xref="GOA:D5E997"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D5E997"
FT                   /protein_id="ADE35748.1"
FT                   /translation="MKNTLKVWRAKKDITQEELAREMEVTRQTINAIERGKYDPSIKLA
FT                   FRMAKFFECSIEDIFIYEE"
FT   gene            242443..243771
FT                   /locus_tag="Mmah_0216"
FT   CDS_pept        242443..243771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0216"
FT                   /product="L-glutamine synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /note="COGs: COG0174 Glutamine synthetase; InterPro
FT                   IPR008146:IPR008147:IPR004809; KEGG: dat:HRM2_45740 GlnA2;
FT                   PFAM: glutamine synthetase catalytic region; glutamine
FT                   synthetase beta-Grasp; PRIAM: Glutamate--ammonia ligase;
FT                   SPTR: Q12UM2 Glutamine synthetase; TIGRFAM: glutamine
FT                   synthetase, type I; PFAM: Glutamine synthetase, catalytic
FT                   domain; Glutamine synthetase, beta-Grasp domain; TIGRFAM:
FT                   glutamine synthetase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35749"
FT                   /db_xref="GOA:D5E998"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:D5E998"
FT                   /protein_id="ADE35749.1"
FT                   /translation="MNIKSKEDVYNEIENNNVKFIRLQFTDIQGVVKDVEIPVTQVKKA
FT                   LETGISFDGSSIEGFVRIDESDMVLRPDVRSFALLPWDQGKGVVARMVCDICKPDGSAF
FT                   EGDPRYVLRRVLKEAHEMGFSFNVGPELEFFLFQVENGKATTKPHDFGRYFEFAPADLA
FT                   EDIRREIVLGLIDLGFNIEAAHHEVAFGQHEIDFKYDDALSTADNVVTFRYVTRTIAKL
FT                   NGLHATFMPKPLTSENGSGMHVNLSLSKDGKNAFYDPQDEGEVDQMAYHFIGGVLEHIK
FT                   GITAISNPLINSYKRLVPGYEAPVYITWSGPNRSSLVRIPAARGQSTRVELRSPDPSCN
FT                   PYITFAAILAAGLKGIKEQIDPGEGTDVNIYDLTPKGLADRNIETLPPTLLDAANHLAK
FT                   DDFLRDALGSHVHENLLRIAYAEWDAYKLQVHEWETKRYLNAM"
FT   gene            243816..246245
FT                   /locus_tag="Mmah_0217"
FT   CDS_pept        243816..246245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0217"
FT                   /product="PKD domain containing protein"
FT                   /note="InterPro IPR000601:IPR012859; KEGG: swp:swp_1488
FT                   collagenase; PFAM: PKD domain containing protein; Protein
FT                   of unknown function DUF1628; SMART: PKD domain containing
FT                   protein; SPTR: C1VHC5 PDK repeat-containing protein; PFAM:
FT                   Protein of unknown function (DUF1628); PKD domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35750"
FT                   /db_xref="GOA:D5E999"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR012859"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:D5E999"
FT                   /protein_id="ADE35750.1"
FT                   /translation="MIKRLRDFARKDDAVIEVFSEILLTGIIVIAIAAAAAFVLSSLDE
FT                   PDNVRVDIDHWADSDSDTLYFRHSGGETVDIEDLELVVYINGSYEKLTSSQFNYDDDEW
FT                   ALGDVIEVNTSSQFNYDITDDTRVPTKLVHTASSLVIYDAYGSMGDSGAGNGEQQSPTA
FT                   DFSYSPANPIPGETVDFTDQSSDPDGTIDEWSWNFGDGNTSTAQNPSHQYSSEGTYTVT
FT                   LTVTDNDGNTDSISNQVTVNNTGLPIIQMRIDDLTHKDTDKPEYIVSYDISNTNSSFKE
FT                   VRINFENQNDSSASADSTKNGYRGNFTYIKNYGATDNYNITFEIIYENGVEYVVNQSTV
FT                   LDVADAINPSGNLNLSIIGSPSFNSVLITDETNVEIDKPKFSISYDISEPSNFSKVEAY
FT                   AISLGSGGKASKEKASTTGVINLNPGYGANTDFKVVALVYDNYGAVVDSYSIIDNADGS
FT                   TLPTGPLTAPELSNPNPASPYTSTVQDDVTFSATSNQSSNNEFLLNGTRVAWSNGTSPS
FT                   YTNTTPSVGTYNLTLIARNQTDPSLTDSISWIWTVEASNESPVAEFSYSPLSPETGQTI
FT                   TFDASASYDPDGSITSYEWNWTNDGTYYSTTSAIATHSYSSPGSYNVKLGVTDDDGNTN
FT                   NTTQNVNVVGLLYNNDAIAKDGPDTPSPDKAGGVEFSIQNFYGSNVTIDSIKIDPDNDN
FT                   IAKLSDDIAPNNKKEYVEVYAESDIDGYSDYYGGVSIPPEGLEVAIGQDGDETSGVIPQ
FT                   VNSSNVMTFYVYEFYEEAGQSGNFKNINMKGEDVEITINYTVEGDQKSKTFTITPQ"
FT   gene            246369..246932
FT                   /locus_tag="Mmah_0218"
FT   CDS_pept        246369..246932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0218"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q12UM0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35751"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9A0"
FT                   /protein_id="ADE35751.1"
FT                   /translation="MTDVMLLWDTPILFEKLFREHGYECLRVDGNSIGTPFLPASKCLM
FT                   VPTGFANPAYTKVAKGIENKGRKIADFVEKGGVLVVFGACVAEYEYDWLPFELSYVEEH
FT                   MQSSLEVVDEEMPCIVAEPQEAVECDGYFSRTDGKVLLKDEQGRAVMVKKEFGEGLIIA
FT                   TTVHEFPSADFLGCAVDKGKSTRL"
FT   gene            complement(246933..247223)
FT                   /locus_tag="Mmah_0219"
FT   CDS_pept        complement(246933..247223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0219"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG4033 conserved hypothetical protein;
FT                   InterPro IPR012031; PFAM: conserved hypothetical protein;
FT                   SPTR: Q12UL9 Putative uncharacterized protein; PFAM: Domain
FT                   of unknown function (DUF1894)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35752"
FT                   /db_xref="InterPro:IPR012031"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9A1"
FT                   /protein_id="ADE35752.1"
FT                   /translation="MINMACISDLPYEILLKGASVKKSEEFIRENCDEVYHVPGGYSLA
FT                   GVMLKGGKTIPIGVKGNSIYFQYVKPCKGLFVLKLDDAQDEIEKLRQGNYQ"
FT   gene            complement(247220..248218)
FT                   /locus_tag="Mmah_0220"
FT   CDS_pept        complement(247220..248218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0220"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="COGs: COG0150 Phosphoribosylaminoimidazole (AIR)
FT                   synthetase; InterPro IPR010918:IPR000728:IPR004733; KEGG:
FT                   phosphoribosylformylglycinamidine cyclo-ligase
FT                   (phosphoribosyl-aminoimidazole synthetase) (AIR synthase);
FT                   K01933 phosphoribosylformylglycinamidine cyclo-ligase;
FT                   PFAM: AIR synthase related protein domain protein; AIR
FT                   synthase related protein; PRIAM:
FT                   Phosphoribosylformylglycinamidine cyclo-ligase; SPTR:
FT                   Q46E56 Phosphoribosylformylglycinamidine cyclo-ligase;
FT                   TIGRFAM: phosphoribosylformylglycinamidine cyclo-ligase;
FT                   PFAM: AIR synthase related protein, N-terminal domain; AIR
FT                   synthase related protein, C-terminal domain; TIGRFAM:
FT                   phosphoribosylaminoimidazole synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35753"
FT                   /db_xref="GOA:D5E9A2"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9A2"
FT                   /protein_id="ADE35753.1"
FT                   /translation="MDKKLTYADSGVDIHQEESTIGNLTGDMTYTREGLGAPMTSIGHY
FT                   AGLMDFGDFALAMATDGVGSKVLIANEMEKWDTMGIDCIAMNVNDLIAIGAEPISFVDY
FT                   LAIEKHSDEFARQIGVGLAKGAEISRMSILGGETATLPEIVKGFDLAGTCLGKVDKDAI
FT                   ITGEKVAEGDVLVGVPSSGVHSNGYTLVRKIIENSKYSYHDPLPYDSSRTIGEELLTPT
FT                   RIYMEVLDTIRKCEVHGLAHITGSGLLKLRRVSELGFDITDPIEPPEIFRFLQKEGNVE
FT                   ELEMYRTFNMGMGFLLIVPPHEAQKVAEIVDGKIVGRITEKDIRVKDLIIE"
FT   gene            complement(248233..249615)
FT                   /locus_tag="Mmah_0221"
FT   CDS_pept        complement(248233..249615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0221"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="COGs: COG0527 Aspartokinase; InterPro
FT                   IPR002912:IPR001048:IPR005260:IPR001341; KEGG: hypothetical
FT                   protein; K00928 aspartate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; amino acid-binding
FT                   ACT domain protein; PRIAM: Aspartate kinase; SPTR: Q12UL7
FT                   Aspartokinase; TIGRFAM: aspartate kinase; aspartate kinase,
FT                   monofunctional class; PFAM: Amino acid kinase family; ACT
FT                   domain; TIGRFAM: aspartate kinase, monofunctional class;
FT                   aspartate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35754"
FT                   /db_xref="GOA:D5E9A3"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9A3"
FT                   /protein_id="ADE35754.1"
FT                   /translation="MKFGGTSIEKGDKIRHVAELLKDYREQGHEIVAVTSALGGVTDGL
FT                   MEIGIDASHKGKVSQVKEFMADLAKKHYDAIEIAIDDAGIADETIRTIDALIDELEKAL
FT                   IGICYLGELSPRSIDYISSYGERLAAPVVSGAVQSQGIDSSSFTGGEAGIVTNSEYGCA
FT                   RPFEKTYESVGNILKKVVATQVPIVTGFIAENEEGIITTLGRSGSDFTASIIGAGIDAD
FT                   EIWLWKEVHGIMTSDPRIVPNARPIPQISYIEAMELSYFGAKVLHPRTIEPAIKHGIPV
FT                   RVKNTFDPEFEGTLIVSDQRLRKDVVKAVTLIRSVAAINISGAGMVGAIGTAARVFSTL
FT                   AKAGVNIIMISQSSSEANMSFVVDEAHLEDAVASLKSEMNRDVIGEVACDRDICVIAVV
FT                   GAGMDGIPGVAGRVFSTLGKEKINVIMISQGSSQHNISFVVSSDEAEEAVRLLNHEFEL
FT                   GT"
FT   gene            complement(249698..250870)
FT                   /locus_tag="Mmah_0222"
FT   CDS_pept        complement(249698..250870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0222"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein similar to erythrocyte
FT                   membrane-associated giant protein antigen 332; SPTR: Q12UL6
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35755"
FT                   /db_xref="GOA:D5E9A4"
FT                   /db_xref="InterPro:IPR006457"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9A4"
FT                   /protein_id="ADE35755.1"
FT                   /translation="MKYIRFAIAVICVFTIFCGFTSAAEETEEQIQYAETIVSIGDEIE
FT                   LEQGYTADIVDVNSDNGELWLKLYLDEEKVKEGFVKENNPFRYVRTIEDEDDEETDYLI
FT                   FNFSLQGTKKENGQTSSKILIKQYRDPAIDLNNYLILDKTVSVGIGSEVELKKDYTIEA
FT                   SNLDENTVTITLRKNGNVVKEEENMGEEDVFAYTRTSGDRIMTIFMGKVGSIFEGEDSD
FT                   VVFLENVVQRTDADIGEGIQIEIDVPAENPGNEQITIYYTLNGDADTVEVYLEGDLIDT
FT                   RQNLDEGTYSADIEKLSRGEYNIEIKAVTSEEGVVTESATLKVGDTLGKGEDEEQGEDI
FT                   IEKAQNISSAAENAADKINETASALEKVPAPGAFFAIFILLGAWMWCRKG"
FT   sig_peptide     complement(250802..250870)
FT                   /locus_tag="Mmah_0222"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            250956..252140
FT                   /locus_tag="Mmah_0223"
FT   CDS_pept        250956..252140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0223"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.1"
FT                   /note="COGs: COG3635 phosphoglycerate mutase AP
FT                   superfamily; InterPro
FT                   IPR019304:IPR006124:IPR004456:IPR013371; KEGG:
FT                   pca:Pcar_1514 cofactor-independent phosphoglycerate mutase;
FT                   PFAM: 2,3-bisphosphoglycerate-independent phosphoglycerate
FT                   mutase; metalloenzyme domain protein; PRIAM:
FT                   Phosphoglycerate mutase; SPTR: Q12UL5
FT                   2,3-bisphosphoglycerate-independent phosphoglycerate
FT                   mutase; TIGRFAM: proposed homoserine kinase;
FT                   phosphonopyruvate decarboxylase-related protein; PFAM:
FT                   Metalloenzyme superfamily;
FT                   2,3-bisphosphoglycerate-independent phosphoglycerate
FT                   mutase; TIGRFAM: 2,3-bisphosphoglycerate-independent
FT                   phosphoglycerate mutase, archaeal form; proposed homoserine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35756"
FT                   /db_xref="GOA:D5E9A5"
FT                   /db_xref="InterPro:IPR004456"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR023665"
FT                   /db_xref="InterPro:IPR042253"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9A5"
FT                   /protein_id="ADE35756.1"
FT                   /translation="MKHIVLIGDGMADYPIKELGDKTVLEAADTPHMDRMALEGINGLA
FT                   TNVPDGMPAGSDVANMSVLGYDPAKHYSGRAPLEAASMGIELDKNDVAFRCNLITIENG
FT                   DILDHSAGHISTEEASQLMQAIEDELGGDVHFYPGISYRHLMVAQFGADAVCTPPHDVV
FT                   EEPALDHMPRGDSAEKLQELIRASWNILSEHPVNKKRIEEGKRPANSIWLWGQGYAPSM
FT                   PSFEEMYGLKAAVISAVDLIKGLGICEGMDVIEVPGATGYLDTNYVGKAEYALESLKDH
FT                   DIVFVHVEAPDEAGHMGSLEAKIQAVEDFDSKVVGTILEGIEKLSEECTVLVLPDHPTP
FT                   IAVRTHTPDPVPFVIYPSFNRDADIVKTYSEDAATDGILSTVRGCDLIRTMLSL"
FT   gene            252221..252685
FT                   /locus_tag="Mmah_0224"
FT   CDS_pept        252221..252685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0224"
FT                   /product="heat shock protein Hsp20"
FT                   /note="COGs: COG0071 Molecular chaperone (small heat shock
FT                   protein); InterPro IPR017447:IPR002068:IPR007052; KEGG:
FT                   glo:Glov_2790 heat shock protein HSP20; PFAM: heat shock
FT                   protein Hsp20; CS; SPTR: Q12UL4 Heat shock protein Hsp20;
FT                   PFAM: Hsp20/alpha crystallin family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35757"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9A6"
FT                   /protein_id="ADE35757.1"
FT                   /translation="MKRGLMRRGNSPSVSRWDPFDEIKQTQDYLNDLFREFLPSVQWKG
FT                   GETMSPLVDVQEKDESVVVTTDLPGVNKEDVDIRVSEGMIEISAACKKEEEKEEEGYFQ
FT                   KERRYSSFSRAVSLPASVTEEGATAKLEEGVLTVTLPKTKEAEKPKVPIE"
FT   gene            252874..253629
FT                   /locus_tag="Mmah_0225"
FT   CDS_pept        252874..253629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0225"
FT                   /product="coenzyme F420-0 gamma-glutamyl ligase"
FT                   /EC_number="6.3.2.-"
FT                   /note="COGs: COG1478 conserved hypothetical protein;
FT                   InterPro IPR002847:IPR000292:IPR008225; KEGG: eba:p2A347
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF129; SPTR: Q8PX01 F420-0:gamma-glutamyl ligase; TIGRFAM:
FT                   F420-dependent oxidoreductase; PFAM: F420-0:Gamma-glutamyl
FT                   ligase; TIGRFAM: F420-0:gamma-glutamyl ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35758"
FT                   /db_xref="GOA:D5E9A7"
FT                   /db_xref="InterPro:IPR002847"
FT                   /db_xref="InterPro:IPR008225"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9A7"
FT                   /protein_id="ADE35758.1"
FT                   /translation="MEAFTVDDIPLIKPGDDIAAIICQRVGLEDGDVLVIASTIIAKAE
FT                   NELFSLDNITPSARAIGIGKKDGKDPRLVQAVLDRCSECFVESPVMLVQSDRAHVCINS
FT                   GVDDSNVENDLLADLPRDADASARIIGERVEEITGCRVAVVVTDTNGRAFRLGQTGVAI
FT                   GLYHATPIYYWRGKKDLFGYEMQISEEAVADEVAAAANLLMGEGSGGNPVVVVRGTSLF
FT                   TGGKTSACQLYRPDNMDIIKKALRIFKES"
FT   gene            complement(253606..254076)
FT                   /locus_tag="Mmah_0226"
FT   CDS_pept        complement(253606..254076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0226"
FT                   /product="CMP/dCMP deaminase zinc-binding protein"
FT                   /note="COGs: COG2131 Deoxycytidylate deaminase; InterPro
FT                   IPR002125:IPR016192; KEGG: gem:GM21_1224 dCMP deaminase;
FT                   PFAM: CMP/dCMP deaminase zinc-binding; SPTR: Q12UL2
FT                   CMP/dCMP deaminase, zinc-binding; PFAM: Cytidine and
FT                   deoxycytidylate deaminase zinc-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35759"
FT                   /db_xref="GOA:D5E9A8"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="InterPro:IPR035105"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9A8"
FT                   /protein_id="ADE35759.1"
FT                   /translation="MPYRPSVDEYFLEIATVIAKRSTCLRNRVGAVIVRDKQILSTGYN
FT                   GAPSNMEHCLDIGCIRQKNNIESGTRHEKCRAVHAEQNAIIQAALHGAGIEGATLYCTH
FT                   QPCILCTKMIINSRIKRVVYLTSYPDTDALDFFNDAGVEIINLPVSRLLENA"
FT   gene            254299..255195
FT                   /locus_tag="Mmah_0227"
FT   CDS_pept        254299..255195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0227"
FT                   /product="protein translocase subunit secF"
FT                   /note="COGs: COG0341 Preprotein translocase subunit SecF;
FT                   InterPro IPR003335; KEGG: cco:CCC13826_0072 preprotein
FT                   translocase subunit SecF; PFAM: SecD/SecF/SecDF export
FT                   membrane protein; SPTR: Q12UL1 Protein translocase subunit
FT                   secF; PFAM: Protein export membrane protein; SecD/SecF GG
FT                   Motif"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35760"
FT                   /db_xref="GOA:D5E9A9"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR024921"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9A9"
FT                   /protein_id="ADE35760.1"
FT                   /translation="MSLIIGKFDNFIKSHTDRQIMAIPIAIFVIALFIMGFTYFTSGAP
FT                   VNLGMEFKGGTMISFQTDESTGELESNYMDYPLVDIRKTGDRAVLQFGPMENNIQTEVE
FT                   KHVTSTYSSVEIQQVGAIYGKDLQLQALQALLLSLLGMSAVIFLIFRNFIPSLAVIISS
FT                   ISDICIAAALMTLAGVELSLGTVAALLMIIGYSVDSDVLLTTRMFKRRGSPNEKISLAM
FT                   HTGLTMTSTTLAAVVAMYLVSTYSYVLIPSLSQMTLLSDISIVLIFGLLADVINTWLLN
FT                   TGIIRWYSKRNPKEMKS"
FT   gene            255192..256880
FT                   /locus_tag="Mmah_0228"
FT   CDS_pept        255192..256880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0228"
FT                   /product="SecD/SecF/SecDF export membrane protein"
FT                   /note="COGs: COG0342 Preprotein translocase subunit SecD;
FT                   InterPro IPR003335; KEGG: wri:WRi_001660 preprotein
FT                   translocase, SecD subunit; PFAM: SecD/SecF/SecDF export
FT                   membrane protein; SPTR: Q12UL0 SecD/SecF/SecDF export
FT                   membrane protein; PFAM: Protein export membrane protein;
FT                   SecD/SecF GG Motif; TIGRFAM: protein-export membrane
FT                   protein SecD"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35761"
FT                   /db_xref="GOA:D5E9B0"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR024912"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9B0"
FT                   /protein_id="ADE35761.1"
FT                   /translation="MSEEKPKGLLSDWRVRIFIIAMLLSLIAIQPWYSSDDGFDSNLNY
FT                   GLDLEGGSWLQLSLQGAVIQADVDEGLTASAIIENLIDSTVKVKNVVPTSDQSRLSIVL
FT                   ETEGEITQSYLNLLGFSDSSITQRGDTYEITIYTTKQQLISTYLSEEFGSEVVPYATPD
FT                   GIEYEIRTKADQQTVESLLADVNGSLLTDEDGNKIYRQGVRTETRDLTVDILSEKFNAL
FT                   GLRDIPVRTVGDDYILIDFAGVDLTTAKEIAQQPGKFEIRMQVEGNNTRHVLYGDSISS
FT                   VGIPSQQDGQWYTPFTLSREGAVALQQVAIETGAVNDPNSHWLYMYLDDEEVYGAPLSP
FT                   SAASSLRTNPIASWQASTGADEDSKAQAEQLQIHLRAGALPVNVELMGSGQVDASLGDQ
FT                   FKMQAIIAGLLSMLAVAGVVFRRYGKKQILVPMVATSVSEVIMILGFAAAVGWQLDLPS
FT                   IAGIIAVIGTGIDHLVIITDEVLYEGKLPPTKVYLSRISRAFSIIFAAAATTIIAMSPL
FT                   VVMGFGALKGFAITTIVGVLIGVLIARPVYGKVIKEALQENGVEQ"
FT   gene            256877..257908
FT                   /locus_tag="Mmah_0229"
FT   CDS_pept        256877..257908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0229"
FT                   /product="Replication factor C"
FT                   /note="COGs: COG2812 DNA polymerase III gamma/tau subunits;
FT                   InterPro IPR013748; KEGG: hypothetical protein; K10756
FT                   replication factor C subunit 3/5; PFAM: Replication factor
FT                   C; SPTR: Q12UK9 Replication factor C small subunit; PFAM:
FT                   ATPase family associated with various cellular activities
FT                   (AAA); Replication factor C"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35762"
FT                   /db_xref="GOA:D5E9B1"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR013748"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9B1"
FT                   /protein_id="ADE35762.1"
FT                   /translation="MKDLWTLKYRPQELGDFVGNEKAVSIMQHLVSAGKLPHLVIHGPA
FT                   GSGKASAVFALARGIYGDNFEHNFTYFNASDFFDQGKRYLVRDKRFVRILGTDDPKKIR
FT                   SSVISIFKDLVNEYASMGSIDADYKIIFVDSAESLNESAQHALRRIMERYSRTCRFIFS
FT                   TTQPSRLISPLRSRGLQLFFTYVSDEELVSFLGSVADSEGLAYDPEALGGLARHCKGNV
FT                   DCALRLLQSAALQHSGKKLSADIIFEVVMEDVPAGISSLQEAISAADFPRARKAIDKML
FT                   IEEGMSGVEIVRHLHRVVSDAGESPAILARILLKIADADLNVRSAANDRIHLERLVTEM
FT                   ANV"
FT   gene            257901..259532
FT                   /locus_tag="Mmah_0230"
FT   CDS_pept        257901..259532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0230"
FT                   /product="histone acetyltransferase, ELP3 family"
FT                   /EC_number="2.3.1.48"
FT                   /note="COGs: COG1243 Histone acetyltransferase; InterPro
FT                   IPR000182:IPR007197:IPR006638:IPR005910; KEGG: elpc-3;
FT                   ELongator complex Protein Component; K07739 elongator
FT                   complex protein 3; PFAM: GCN5-related N-acetyltransferase;
FT                   Radical SAM domain protein; PRIAM: Histone
FT                   acetyltransferase; SMART: Elongator protein 3/MiaB/NifB;
FT                   SPTR: Q12UK8 Histone acetyltransferase, ELP3 family;
FT                   TIGRFAM: histone acetyltransferase, ELP3 family; PFAM:
FT                   Acetyltransferase (GNAT) family; Radical SAM superfamily;
FT                   TIGRFAM: histone acetyltransferase, ELP3 family; radical
FT                   SAM protein, TIGR01212 family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35763"
FT                   /db_xref="GOA:D5E9B2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR034687"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9B2"
FT                   /protein_id="ADE35763.1"
FT                   /translation="MSDESDFAKACRKLVELVLEDSTLDKVQFNREKLNISRQYGLSTL
FT                   PRNSDVIAAASDSEKESVRGLLRRKPVRTISGVAVIAVMTSPAPCPHGVCVPCPGGPAS
FT                   SFVSPQSYMGREPAAMRGIQYEYDPYRIVHARLKQLQEIGHEVDKAELIVMGGTFTSRN
FT                   LDYQEWFTKRCLEAMNDFKGHQWRDSVHNVYGYIPIEDVQEANESSAVRNIGITYETRP
FT                   DWTSPVEVDRLLNFGATKVEIGVQSVYDFVLSRMRRGHSVADTAEANRILRDSGLKVGF
FT                   HMMPRLPGSDNERDMRGFKKLFSDSRFMPDFLKIYPTLVTEGTELEKMWRAGKYDPLYD
FT                   EEAVELLADIKAILPKWVRLQRIQRDIPAQQILAGVKKSNIRQLAGQQLMQKGGKCSCI
FT                   RCREVGHNILKERPPSIEDIEFMVQSYFSCGGQEHFLSFEDVSQDILIGFLRLRFPNKP
FT                   HRPELENSALVRELHVYGSMVAVGGFAKGHDWQHRGYGLRLISEAENMAKDAGFEKLSI
FT                   ISGIGVREYYRKLGYILEGPYMVKYL"
FT   gene            259619..259960
FT                   /locus_tag="Mmah_0231"
FT   CDS_pept        259619..259960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0231"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q12UK7 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35764"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9B3"
FT                   /protein_id="ADE35764.1"
FT                   /translation="MVSEVEMNNILVALNEINDKIDRLLFQQDSSSHASQEDGLDELDV
FT                   MTLLSLPDHLRTTATVLFEMGTATAAQISEKTSKERAVESNYLNQLVRMGHVHKYRNGR
FT                   KVFFTILST"
FT   gene            260170..260913
FT                   /locus_tag="Mmah_0232"
FT   CDS_pept        260170..260913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0232"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="COGs: COG0489 ATPase involved in chromosome
FT                   partitioning; InterPro IPR002586; KEGG: ppd:Ppro_3446
FT                   cobyrinic acid a,c-diamide synthase; PFAM: Cobyrinic acid
FT                   ac-diamide synthase; SPTR: Q12UK5 ATPases involved in
FT                   chromosome partitioning-like protein; PFAM:
FT                   CobQ/CobB/MinD/ParA nucleotide binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35765"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9B4"
FT                   /protein_id="ADE35765.1"
FT                   /translation="MKGTFTIAVHSPRGGTGKTSVAINLACAYAKEGKNVCLLDMDLKS
FT                   PSAFNGMFPSSGKWINDILDHKKNIREVIVDGSKSISSRARFYVGYSNPEISAIREFSS
FT                   KDRKWQSDALKALIQSKKNLRKEGFDVVIMDTSPGVDFTSANVVASSDYVLMVVKPNEY
FT                   CLTNIKQAIDGIYTPLGKKCGIVENMCLNGQSLQMGEKYGVPVLSSIPCMCEVSLQGLS
FT                   KIFTVEEPSHPFSSAIDRLKNSINY"
FT   gene            complement(260915..261721)
FT                   /locus_tag="Mmah_0233"
FT   CDS_pept        complement(260915..261721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0233"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q12UK4 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35766"
FT                   /db_xref="GOA:D5E9B5"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9B5"
FT                   /protein_id="ADE35766.1"
FT                   /translation="MLQKTYAIISGDKKIKKLHLLITFVATYFAIWLPGIQGVLGVENA
FT                   KISSTLIFGTLNGLLLGPIYGAIVSVAAISAYRIVNVDIIFNNSFYLISPLFLASASFV
FT                   AGLAIMGKKNKAVILPSLLIAAWFATSVGREVFYYPWLHILSITFFLNFTRIENKISFI
FT                   SKNKGYMYLFACSLLAVSTDHLAGSLSALFIFDLGSSMYKEVIFIYPLERILVATISAL
FT                   IFYAFIVWINLLKANASVLNEKEEHKVKDVMDYINSEVKDIIEKEK"
FT   sig_peptide     complement(261632..261721)
FT                   /locus_tag="Mmah_0233"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            261829..263007
FT                   /locus_tag="Mmah_0234"
FT   CDS_pept        261829..263007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0234"
FT                   /product="3-hexulose-6-phosphate synthase"
FT                   /EC_number="4.1.2.43"
FT                   /note="COGs: COG1795 conserved hypothetical protein;
FT                   InterPro IPR014826:IPR000056:IPR001754; KEGG: bxe:Bxe_B2436
FT                   formaldehyde-activating protein; PFAM:
FT                   Formaldehyde-activating enzyme (Fae); ribulose-phosphate
FT                   3-epimerase; Orotidine 5'-phosphate decarboxylase; SPTR:
FT                   Q12UK3 Bifunctional enzyme fae/hps; TIGRFAM:
FT                   formaldehyde-activating enzyme; PFAM: Orotidine
FT                   5'-phosphate decarboxylase / HUMPS family;
FT                   Formaldehyde-activating enzyme (Fae); TIGRFAM:
FT                   formaldehyde-activating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35767"
FT                   /db_xref="GOA:D5E9B6"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014826"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020868"
FT                   /db_xref="InterPro:IPR037075"
FT                   /db_xref="InterPro:IPR041710"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9B6"
FT                   /protein_id="ADE35767.1"
FT                   /translation="MMLIGEALIGEEPELAHIDLMIGDKEGPVGQAFATGMTQLSAGHT
FT                   PLLSVIRPNLPTKPSTLIVPKVTVKNMDQASQIFGPAQAAVSKAVADAVEEGIVPKEKA
FT                   DDLVIVASVFIHPQALDYNRIYRYNYGATKLALKRAMENFPAVDTVLDEKDKGSHAVMG
FT                   FKVSRLWDPPYLQVALDNPNLEAVLNVVRQLPKSDHLILEAGTPLIKRYGVDVITKLRE
FT                   VKPDAFIVADLKTLDTGNLEARMVADATADAIVVSALAPIPTLEKAISEAHKTGIYAVM
FT                   DTLNQPDPMAVLKELNELPDVVELHRAIDVEDTAYAWGSIDAIKELSPKILVAVAGGVR
FT                   VHTIPDALKAGADILVVGRAITNSKDIRQSAEQFVEGLNKPEIDQFRVMTDF"
FT   gene            263018..263686
FT                   /locus_tag="Mmah_0235"
FT   CDS_pept        263018..263686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0235"
FT                   /product="triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /note="COGs: COG0149 Triosephosphate isomerase; InterPro
FT                   IPR000652; KEGG: bvi:Bcep1808_2336 triosephosphate
FT                   isomerase; PFAM: triosephosphate isomerase; PRIAM:
FT                   Triose-phosphate isomerase; SPTR: Q12UK2 Triosephosphate
FT                   isomerase; TIGRFAM: triosephosphate isomerase; PFAM:
FT                   Triosephosphate isomerase; TIGRFAM: triosephosphate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35768"
FT                   /db_xref="GOA:D5E9B7"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022891"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9B7"
FT                   /protein_id="ADE35768.1"
FT                   /translation="MDSPLIVVNFKTYAQGTGEAAVGIATACRDVAEEAGVTIGVAPQL
FT                   CDIYRVSSQVDVPVYAQHVDGVSPGSNTGHVMASCVQQAGAVGSLINHSERRLNLADIE
FT                   ASVRAARAEGLTTIVCTNNIPTTAAAAALDPEYVAVEPPELIGTGVPVSQADPDVVRGS
FT                   VEAVKKINPDVQVLCGAGISRGEDLIAAMELGSVGVLLASGIVKAEDPRSALEDLVSQL
FT                   "
FT   gene            complement(263683..264006)
FT                   /locus_tag="Mmah_0236"
FT   CDS_pept        complement(263683..264006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0236"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q12UK1 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35769"
FT                   /db_xref="GOA:D5E9B8"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9B8"
FT                   /protein_id="ADE35769.1"
FT                   /translation="MKKQTQKSGGKALFGKDITEYLRFYKMGLLLVAGLGIYLGLLGLY
FT                   LIIVDNNYIPGIALFIAALLISPPPIGISNMIIRYFNIELSMGLKLGIATMLLFIAWWQ
FT                   LGF"
FT   gene            complement(264064..265371)
FT                   /locus_tag="Mmah_0237"
FT   CDS_pept        complement(264064..265371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0237"
FT                   /product="prephenate dehydrogenase"
FT                   /EC_number="1.3.1.12"
FT                   /note="COGs: COG0287 Prephenate dehydrogenase; InterPro
FT                   IPR003099; KEGG: sat:SYN_01933 prephenate dehydrogenase;
FT                   PFAM: Prephenate dehydrogenase; SPTR: Q12UK0 Prephenate
FT                   dehydrogenase; PFAM: Prephenate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35770"
FT                   /db_xref="GOA:D5E9B9"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008299"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9B9"
FT                   /protein_id="ADE35770.1"
FT                   /translation="MKILIIGGTGEMGQWFANFFKKRGYEVWLSGRGGKSEVAERLGVH
FT                   FTAEPDIVIPTCDIVIISVPINITPTIIAQTAPKMKKGSLLMDLTSLKKKPVEAMKKYV
FT                   PENVEFLGTHPMFGPSIPSLQGQTFILTPVEGRCDQWFDHIFNLLSEEEASIEVITPDE
FT                   HDHFVSIVQGLTHFAYITIGATMQKLDFDVKGSRRFMSPVYDIMLDFVGRILGQNPELY
FT                   ALIQMENPEVIRVHDIFIEQCRHFSSMVRSHDTGQFCEEMKAAALHFGDTASALRRSDK
FT                   LINSKVAEFEELVHSTGHEKGLLHIYSRKTHVGIVKRVTSNNVTLKEGKKELQLKIGNI
FT                   RILSADELNHWKENKLKPILRDISVFVPQSAKPFTIQQILDCRIEGVKVETIDTYLHKK
FT                   GPTATFRLKIRGDLDAAEIHREMEELLEGMGCTLRK"
FT   gene            complement(265368..266174)
FT                   /locus_tag="Mmah_0238"
FT   CDS_pept        complement(265368..266174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0238"
FT                   /product="shikimate dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="COGs: COG0169 Shikimate 5-dehydrogenase; InterPro
FT                   IPR013708:IPR006151:IPR011342; KEGG: dps:DP3012 shikimate
FT                   5-dehydrogenase; PFAM: Shikimate/quinate 5-dehydrogenase;
FT                   Shikimate dehydrogenase substrate binding domain protein;
FT                   SPTR: Q8THC3 Shikimate dehydrogenase; TIGRFAM: shikimate
FT                   5-dehydrogenase; PFAM: Shikimate dehydrogenase substrate
FT                   binding domain; Shikimate / quinate 5-dehydrogenase;
FT                   TIGRFAM: shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35771"
FT                   /db_xref="GOA:D5E9C0"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9C0"
FT                   /protein_id="ADE35771.1"
FT                   /translation="MKKVFGVLGDPIEHSLSPAMHNAAFRELEMDCEYHAFRVRHKYLK
FT                   NAILGAQAMGFGGLNITVPHKEKALEFTNPDTLARRIGAVNTVSFNDGIRGHNTDGLGA
FT                   EMALLEAGVGINASNVVLVGAGGAARAIAFHFAEKGAGVTIANRTPEKAEVLAEDVGCS
FT                   HAGLENLKELLQDSDILINATSAGMHPHIDSTIASRDILHPGLAVFDIVYNPLQTKLLH
FT                   QAELAGAKPIGGVAMLVHQGAEAFRIWTGQKPPVEVMRNAVLEGLG"
FT   gene            complement(266171..266866)
FT                   /locus_tag="Mmah_0239"
FT   CDS_pept        complement(266171..266866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0239"
FT                   /product="3-dehydroquinate dehydratase, type I"
FT                   /EC_number="4.2.1.10"
FT                   /note="COGs: COG0710 3-dehydroquinate dehydratase; InterPro
FT                   IPR001381; KEGG: kpn:KPN_00073 3-dehydroquinate
FT                   dehydratase; PFAM: dehydroquinase class I; PRIAM:
FT                   3-dehydroquinate dehydratase; SPTR: Q12UJ8 3-dehydroquinate
FT                   dehydratase; TIGRFAM: 3-dehydroquinate dehydratase, type I;
FT                   PFAM: Type I 3-dehydroquinase; TIGRFAM: 3-dehydroquinate
FT                   dehydratase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35772"
FT                   /db_xref="GOA:D5E9C1"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9C1"
FT                   /protein_id="ADE35772.1"
FT                   /translation="MTGFVAGKDVKIVASIDSDPLLQARIAKVLGADILEIRLDFLEIK
FT                   EAVQAKKLFDLLDQQGGVPRIATNRVHTEGGSWQGTEEQRITLLEDLIPYVDMIDIERK
FT                   CTDCLRNRLVEEAKSQGTKVIMSSHFFETTPPEKDMVAILNECTDKGADIAKLAVMPQK
FT                   PEDILELFHAALQARGEVCVIAMGELGRHSRVVACRYGSLLTYGCVEKPVAPGQIRIDQ
FT                   LKRALETTV"
FT   gene            complement(266869..268011)
FT                   /locus_tag="Mmah_0240"
FT   CDS_pept        complement(266869..268011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0240"
FT                   /product="3-dehydroquinate synthase II"
FT                   /note="COGs: COG1465 alternative 3-dehydroquinate synthase;
FT                   InterPro IPR002812; KEGG: dol:Dole_1951 3-dehydroquinate
FT                   synthase; PFAM: 3-dehydroquinate synthase; SPTR: Q12UJ7
FT                   3-dehydroquinate synthase; PFAM: 3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35773"
FT                   /db_xref="GOA:D5E9C2"
FT                   /db_xref="InterPro:IPR002812"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9C2"
FT                   /protein_id="ADE35773.1"
FT                   /translation="MKKQVWIRADEGDWEDKKERITGGLESGADCVLVEAEDVDKTKEL
FT                   GDIKIAAFTDNADTAADIIVIGRGGEGDGTLPLPVDMSNSRDFEQLATLRRQKKSIAAL
FT                   VVIQDKKYEKFAAAIGTECDYLIAIGTDWKVIPLENLIAQLQEKEVNIISGVRDADEAK
FT                   LALETMEHGSDGVLLDTANPDTLKKTVKLAEEAGVEGIDLVPATITRIEPVGMGDRVCV
FT                   DTCNLMERGEGMLVGSQSAGMFLVHSESEESPYVASRPFRVNAGAVHAYVKVGDKTRYL
FT                   SELEAGDEVTIVNTEGQQRKGIVGRVKIERRPLMLVEAQSKDGKTVKNILQNAETIKLV
FT                   STSKEPVSIASLKEGDEVLVHMEDTGRHFGMKVQETIIEK"
FT   gene            complement(268021..268818)
FT                   /locus_tag="Mmah_0241"
FT   CDS_pept        complement(268021..268818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0241"
FT                   /product="2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate
FT                   synthase"
FT                   /EC_number="4.1.2.13"
FT                   /note="COGs: COG1830 DhnA-type fructose-1 6-bisphosphate
FT                   aldolase; InterPro IPR002915:IPR010210; KEGG: dma:DMR_19010
FT                   putative aldolase; PFAM: deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase;
FT                   PRIAM: Fructose-bisphosphate aldolase; SPTR: Q12UJ6
FT                   2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase;
FT                   TIGRFAM: predicted phospho-2-dehydro-3-deoxyheptonate
FT                   aldolase; PFAM: DeoC/LacD family aldolase; TIGRFAM:
FT                   predicted phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35774"
FT                   /db_xref="GOA:D5E9C3"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR010210"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041720"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9C3"
FT                   /protein_id="ADE35774.1"
FT                   /translation="MPEIGKQIRIERIMDRDSRNMVIIPMDHGITDGPIKGLINIADSI
FT                   NSVAEGGANAVLMQKGMILHGHRGYGHDVGLILHMSASTSLGPDPNDKVLVCTVEEASR
FT                   MGADAVSVHINVGSETESEQLKILGHIGRQCDYWGIPLIAMMYPRGRKVTNPRDPQMVA
FT                   HAARVGAELGADVIKTVYTGDIESFSRVVEGCPVPVVIAGGPKTNTDREFLEMIREAMD
FT                   AGARGVAIGRNVFQHPSPTRMTQAITEIAHNNQTVDEALKQLQ"
FT   gene            268975..269550
FT                   /locus_tag="Mmah_0242"
FT   CDS_pept        268975..269550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0242"
FT                   /product="GMP synthase, small subunit"
FT                   /note="COGs: COG0518 GMP synthase - Glutamine
FT                   amidotransferase domain; InterPro
FT                   IPR006220:IPR011702:IPR000991:IPR004739; KEGG:
FT                   cff:CFF8240_1264 GMP synthase; PFAM: glutamine
FT                   amidotransferase class-I; SPTR: Q12UJ5 GMP synthase
FT                   [glutamine-hydrolyzing] subunit A; TIGRFAM: GMP synthase,
FT                   small subunit; PFAM: Glutamine amidotransferase class-I;
FT                   TIGRFAM: GMP synthase (glutamine-hydrolyzing), N-terminal
FT                   domain or A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35775"
FT                   /db_xref="GOA:D5E9C4"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR023686"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9C4"
FT                   /protein_id="ADE35775.1"
FT                   /translation="MEELRILVINNHGQFCHLIHRTVRDLDMDTSIVPNTTPVEEILAE
FT                   KPHGLIFSGGPSLERGGLCEEYAKELDIPILGICLGHQLIAHAYGGSTGAGSHGGYAAV
FT                   DVEVVEEDDILKGLGPRISTWASHGDEVTELPTGFLKLARSDICAIEAMKHPDKPLYGI
FT                   QWHPEVAHTDKGEELFMNFFEVCANYNK"
FT   gene            complement(269567..270394)
FT                   /locus_tag="Mmah_0243"
FT   CDS_pept        complement(269567..270394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0243"
FT                   /product="Endonuclease IV"
FT                   /EC_number="3.1.21.-"
FT                   /note="COGs: COG0648 Endonuclease IV; InterPro
FT                   IPR012307:IPR001719; KEGG: dma:DMR_37530 putative
FT                   endonuclease IV; PFAM: Xylose isomerase domain protein TIM
FT                   barrel; SMART: AP endonuclease family 2; SPTR: Q12UI4
FT                   Endonuclease IV; PFAM: Xylose isomerase-like TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35776"
FT                   /db_xref="GOA:D5E9C5"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9C5"
FT                   /protein_id="ADE35776.1"
FT                   /translation="MSLLFGTAGTPLSAKGRGSEGGVRRVKELGLGCMELEFVRGVRMK
FT                   EPTAEKIADTARKTGISLSVHAPYYINLNSKEEEKIQASIKRIYDSAYIGNICGAGSIV
FT                   FHPAYYHEQNGNTVFSKVESLLEELAGQLEDEGINATLRPETTGKPSQFGNLEETLALS
FT                   ASIEGVMPCIDFAHLHARSKGEENSYAEFSAVLEKVEEYLGKEGLRNMHMHISGIEYTD
FT                   KGEKNHLVLEESDLNFSELMQALKDFRAQGLVICESPNLEQDALLLQKTYENK"
FT   gene            complement(270396..270725)
FT                   /locus_tag="Mmah_0244"
FT   CDS_pept        complement(270396..270725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0244"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q12UI2 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35777"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9C6"
FT                   /protein_id="ADE35777.1"
FT                   /translation="MGREFTDRDMDIFNKLAPEAGGNNISQMGHPYPFILRPISHRFAE
FT                   SGEDFRNRLEKLDRADVEYLADLAIEGKEDVRGLEDEDMDSFFSVLEGFSPEKLEELKD
FT                   KLGMI"
FT   gene            complement(270750..271217)
FT                   /pseudo
FT                   /locus_tag="Mmah_0245"
FT   gene            271308..271748
FT                   /locus_tag="Mmah_0246"
FT   CDS_pept        271308..271748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0246"
FT                   /product="transcriptional regulator, TrmB"
FT                   /note="COGs: COG1846 Transcriptional regulators; InterPro
FT                   IPR000835:IPR002831; KEGG: sat:SYN_00652 MarR family
FT                   transcriptional regulator; PFAM: regulatory protein MarR;
FT                   transcriptional regulator TrmB; SMART: regulatory protein
FT                   MarR; SPTR: Q8TP67 Transcriptional regulator, MarR family;
FT                   PFAM: MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35778"
FT                   /db_xref="GOA:D5E9C7"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9C7"
FT                   /protein_id="ADE35778.1"
FT                   /translation="MNEDEHVHSFGAMIACLHRQNLRYLSQELEIYGIGGGQFRFLLAL
FT                   YHVEGIRPEELSRMLMVNRATATRALKRLEEAGYVRRTPDPKDRRALVVNLTEEGHRMH
FT                   RFIRQLSQKRSECMLAGFSEEEKTLFRNLLEKAISNCVRACK"
FT   gene            271745..273103
FT                   /locus_tag="Mmah_0247"
FT   CDS_pept        271745..273103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0247"
FT                   /product="MATE efflux family protein"
FT                   /note="COGs: COG0534 Na+-driven multidrug efflux pump;
FT                   InterPro IPR002528; KEGG: dal:Dalk_2553 MATE efflux family
FT                   protein; PFAM: multi antimicrobial extrusion protein MatE;
FT                   SPTR: Q8TTU1 Uncharacterized membrane protein; TIGRFAM:
FT                   MATE efflux family protein; PFAM: MatE; TIGRFAM: putative
FT                   efflux protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35779"
FT                   /db_xref="GOA:D5E9C8"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9C8"
FT                   /protein_id="ADE35779.1"
FT                   /translation="MKEQSRALGVESVGKLLFRLSAPATVGMVVMGLYNIVDTIFVGRA
FT                   LGGESVQGIGGIAVSFPVIMIAMAVSLAIGLGGSSIISRRLGGDDLEGAERTFGNMVGL
FT                   SLSLGFLVFIFGSFFIVPILKAFGATPTILPFARDYLQIILYGTPLITFSQAINNVVRS
FT                   EGNAKVAMYTMLIGAGLNILLDPILIFGLDMGIRGAAAATVISQFATTIFLVHYFLSGK
FT                   SSLQFHTGFMRPDMEIIKEMVAIGASPFARNSSTSAIVVVVNNILALYGGDVSIAIYGI
FT                   FNRMLMFSFMPMIGLLQGMQPIIGFNYGAHNFERVRETLRICVLISSVIAVAAFLLLFF
FT                   FGSNLFSIFTTDATLIKEGTDATKIMVLAIPLLGIQFVSGGMYQALGKARPSFILSTAR
FT                   QVFLLPLVLVLPWFFDTTGVWIAFPVSDLLAVLLAVYMFMKEYRLLEWRASVS"
FT   gene            273207..274184
FT                   /locus_tag="Mmah_0248"
FT   CDS_pept        273207..274184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0248"
FT                   /product="DNA repair and recombination protein RadA"
FT                   /note="COGs: COG0468 RecA/RadA recombinase;
FT                   InterProIPR013632:IPR003593:IPR020588:IPR020587:IPR 011938;
FT                   KEGG: DNA repair protein RAD51; PFAM: Rad51 domain protein;
FT                   SMART: AAA ATPase; SPTR: Q12UG7 DNA repair and
FT                   recombination protein radA; TIGRFAM: DNA repair and
FT                   recombination protein RadA; PFAM: Rad51; TIGRFAM: DNA
FT                   repair and recombination protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35780"
FT                   /db_xref="GOA:D5E9C9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR011938"
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="InterPro:IPR016467"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033925"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9C9"
FT                   /protein_id="ADE35780.1"
FT                   /translation="MSEILLEELDHVGPATAQKLNDAGYNSVEAVAVASPSELVATAEI
FT                   GESTAAKIISAARSAADIGGFETGDFVMQRRMEVGKLRTGCEEFDELMGGGIETQSITE
FT                   MYGEFGSGKTQIAHQLAVNTQLPKEMGGLDGSVIIIDTENTFRPERIEHMVAGLSHKFE
FT                   QDFDPAEFLKNIHVARAYNSNHQILLVDAATEMANKLKNTDKPVRLVIVDSLTAHFRAE
FT                   YVGRGTLADRQQKLNKHLHDLQRFGDLNNASVIVTNQVMSKPDAFFGDPTRPIGGHILG
FT                   HTATFRLYIRKSKGDKRIVKLVDSPCLPDGEAVACITTDGLCDA"
FT   gene            274218..274901
FT                   /locus_tag="Mmah_0249"
FT   CDS_pept        274218..274901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0249"
FT                   /product="phosphoglycolate phosphatase"
FT                   /EC_number="3.1.3.18"
FT                   /note="COGs: COG0561 hydrolase of the HAD superfamily;
FT                   InterProIPR005834:IPR013200:IPR006382:IPR006379:IPR 006378;
FT                   KEGG: rhi:NGR_c19510 putative phosphoglycolate phosphatase;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase type
FT                   3; Haloacid dehalogenase domain protein hydrolase; PRIAM:
FT                   Phosphoglycolate phosphatase; SPTR: Q8PZN6 Phosphoglycolate
FT                   phosphatase; TIGRFAM: SPP-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; Sucrose-phosphate phosphatase
FT                   subfamily; PFAM: haloacid dehalogenase-like hydrolase;
FT                   TIGRFAM: Sucrose-phosphate phosphatase subfamily;
FT                   HAD-superfamily hydrolase, subfamily IIB; sucrose-phosphate
FT                   phosphatase-like hydrolase, Archaeal"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35781"
FT                   /db_xref="GOA:D5E9D0"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR006382"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9D0"
FT                   /protein_id="ADE35781.1"
FT                   /translation="MMKFKALAIDIDGTITYSDRRLHFLAAEHLRNLGIPVVLATGNVL
FT                   CYAAATSKLIGLGGKVISENGGVISTGFDTNPHISESMEECEKAFSYLSNRFDLIRLDG
FT                   DLRKTEIALRRNVNADDLQASLEGAGFYIEVIDTQFALHIKSKKVNKGTGLEKMASLMD
FT                   LDVSDFIAIGDSVNDREMFEVAGYGIAVDNADPGLKLIADHVTSMSFGEGTVEALQILC
FT                   RRDFF"
FT   gene            complement(274898..275155)
FT                   /locus_tag="Mmah_0250"
FT   CDS_pept        complement(274898..275155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0250"
FT                   /product="PRC-barrel domain protein"
FT                   /note="InterPro IPR007903; PFAM: PRC-barrel domain protein;
FT                   SPTR: Q12UG5 PRC-barrel protein; PFAM: PRC-barrel domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35782"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9D1"
FT                   /protein_id="ADE35782.1"
FT                   /translation="MPKVFAKNLSNKQVMTTDGTEIGILDNIVMEVKTGKLEDLMVKPD
FT                   IGLDTSKYVTDGQFLKIPFKAVRSIKDYIVVDKQIATNLD"
FT   gene            complement(275173..277404)
FT                   /locus_tag="Mmah_0251"
FT   CDS_pept        complement(275173..277404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0251"
FT                   /product="AAA family ATPase, CDC48 subfamily"
FT                   /EC_number="3.6.1.3"
FT                   /note="COGs: COG0464 ATPase of the AAA+ class;
FT                   InterProIPR004201:IPR003959:IPR011704:IPR003338:IPR
FT                   003593:IPR003960:IPR005938; KEGG: gur:Gura_2842 AAA family
FT                   ATPase, CDC48 subfamily protein; PFAM: AAA ATPase central
FT                   domain protein; cell division protein 48 CDC48 domain 2;
FT                   ATPase associated with various cellular activities AAA_5;
FT                   AAA ATPase VAT domain protein; PRIAM:
FT                   Adenosinetriphosphatase; SMART: AAA ATPase; SPTR: Q12UG4
FT                   AAA family ATPase, CDC48 subfamily; TIGRFAM: AAA family
FT                   ATPase, CDC48 subfamily; PFAM: Cell division protein 48
FT                   (CDC48), N-terminal domain; ATPase family associated with
FT                   various cellular activities (AAA); Cell division protein 48
FT                   (CDC48), domain 2; TIGRFAM: AAA family ATPase, CDC48
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35783"
FT                   /db_xref="GOA:D5E9D2"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR005938"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029067"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9D2"
FT                   /protein_id="ADE35783.1"
FT                   /translation="MEELQIKVEKAHPIDFGRGIIRLDPSTLLSLQLSPGDIVLIEGKR
FT                   QTTAKVWRADRQDWGQGIARIDGYTRQNAEVGIGERITLSKAEPIPAEKILLAPPEGIV
FT                   MEFGDNTSAVIKHNILKRPFVKGDIIPIISSMGQTTPGSQAIPLIAVDTEPSDGILIIN
FT                   ENTQIQLQQKPVVGYEGAARGINYEDIGGLRTEIQRVREMIELPLKHHELFLRLNIDPP
FT                   KGVILYGPPGTGKTLIARAVASESNAYFINIAGPEIMGKYYGESEERLRKIFDEAAENA
FT                   PSIIFVDEIDSIAPKREDVTGEVERRVVAQLLTLMDGMDERKQVVVIAATNRLDSIDPA
FT                   LRRPGRFDREIEIGVPDSEDRLEILQIHTRGMPLNENIDEEYFEHLAEYTQGFVGADLL
FT                   ALVQEASMRALRRLLPDINLDEEEIPQEILEKLEVTPDDFEEALKEIEPSAMREVMVEI
FT                   PSVGWDDIGGLDLARQDISEAVEWPLKWPDKISQMGIKPPTGILLYGPPGTGKTLLAQA
FT                   VANEANANFISVKGPQILSKYVGESEKAIRDTFKKARQVAPCIIFFDEIDAISSTRQGG
FT                   SDVGSRVSEQVVNQMLTEMDGLEPLNEVVVIAATNRPDLIDPALLRSGRFDRLVMVGAA
FT                   LAEGREKIFRIHTMGIPLDSDVDIRELATMTEGYVGSDIESICREAAMLSLREDFDNEK
FT                   VSKRHFLSAMEKVKPTVNEDMIDFYNRVQEKLKGGSIRKTDAGSFAGYI"
FT   gene            277581..277784
FT                   /locus_tag="Mmah_0252"
FT   CDS_pept        277581..277784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0252"
FT                   /product="deoxyribonuclease/rho motif-related TRAM"
FT                   /note="COGs: COG3269 RNA-binding protein contains TRAM
FT                   domain; InterPro IPR002792; KEGG: dol:Dole_1585 RNA
FT                   methyltransferase; PFAM: deoxyribonuclease/rho
FT                   motif-related TRAM; SPTR: Q12YA1 Putative uncharacterized
FT                   protein; PFAM: TRAM domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35784"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9D3"
FT                   /protein_id="ADE35784.1"
FT                   /translation="MFERVESSAPVESGETYDVVIEDIAKKGDGIARIDGFVIFVPETE
FT                   VGDELSIKVTKVLSKFAFGEVV"
FT   gene            complement(277941..278120)
FT                   /locus_tag="Mmah_0253"
FT   CDS_pept        complement(277941..278120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0253"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q46AL3 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35785"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9D4"
FT                   /protein_id="ADE35785.1"
FT                   /translation="MQSFIVEHYLGTELDIYCGGPDTFKGTVEACADGVLTINKDNKYT
FT                   HIAIDKIIAVWEEK"
FT   gene            278302..279348
FT                   /locus_tag="Mmah_0254"
FT   CDS_pept        278302..279348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0254"
FT                   /product="phosphoesterase PA-phosphatase related protein"
FT                   /note="InterPro IPR000326; KEGG: efe:EFER_1728 putative
FT                   membrane protein, putative acid
FT                   phosphatase/vanadium-dependent haloperoxidase; PFAM:
FT                   phosphoesterase PA-phosphatase related; SPTR: Q46AZ8
FT                   Putative uncharacterized protein; PFAM: PAP2 superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35786"
FT                   /db_xref="GOA:D5E9D5"
FT                   /db_xref="InterPro:IPR026841"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9D5"
FT                   /protein_id="ADE35786.1"
FT                   /translation="MYSFIQLLLSEIISSFSGQWLSQYMMTIVMIPLLFLMVTAGYVLF
FT                   VPVENRRPEFSSMKGFFHFVVDVVIYAIPMLIVYALVHMQTTAATLLGVPANQNYAHYI
FT                   MILEGDVVSLIQEIATPLLTYASGFFYLLMFPFLLTFTFLLLVYLQRHKAVQEFVVAFI
FT                   LIYLLAFPFYILFPVHVTGYTLSGVSPLLYNLSPFIAEGVRIVDPDLNNCFPSLHTALS
FT                   VMAMIMVLHNVKSRRYQAFAVITTAAILFTILYLGIHWLSDLVGGTLLAIVCCLIAFRY
FT                   SEHLFSIYRWIVAMLSWKLKGPALPCVGCNRRINFDSVMQCDYCGTEYNIKGRVFSLLK
FT                   RFRKRFSP"
FT   gene            complement(279354..280382)
FT                   /locus_tag="Mmah_0255"
FT   CDS_pept        complement(279354..280382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0255"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG0392 integral membrane protein; InterPro
FT                   IPR005242; KEGG: maq:Maqu_3008 hypothetical protein; PFAM:
FT                   conserved hypothetical protein; SPTR: Q12TG6 Putative
FT                   uncharacterized protein; PFAM: Uncharacterised protein
FT                   family (UPF0104); TIGRFAM: conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35787"
FT                   /db_xref="GOA:D5E9D6"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9D6"
FT                   /protein_id="ADE35787.1"
FT                   /translation="MNKFAKWLAVSFIISIITMVGVFIYTIDPKTTESLYNIRPLYLLA
FT                   AASIHMMGFVMWSIRTKMMAGALGYHVSIKKSFEIVTSSSFLASMTPSSVGGEPLRIHL
FT                   LQKDRMPVGSATAVVLGERVLDAIIILTAAPFALSLFGEVLGGGKLDSLLMFGQLFLFF
FT                   ILAILLYAIWKPHYTRRFLQWVVNKCSRLFGDDKKHVFCKISEKVDTELEEFHYSIFVF
FT                   LKEGRWGLLAGILFTFAFWFIEFSMLPVLLMGLNQYPSAIIVYAAQVLLMIVVIIPATP
FT                   GSSGVAEIGATTLFSVFVPTYVLGIVVVAWRALTFYLNLLVGGFVSFKILKDTVEVDEL
FT                   LK"
FT   gene            complement(280477..281613)
FT                   /locus_tag="Mmah_0256"
FT   CDS_pept        complement(280477..281613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0256"
FT                   /product="Glycosyltransferase 28 domain protein"
FT                   /note="COGs: COG1819 Glycosyl transferase related to
FT                   UDP-glucuronosyltransferase; InterPro IPR007235; KEGG:
FT                   gme:Gmet_2041 putative glycosyl transferase; PFAM:
FT                   Glycosyltransferase 28 domain; SPTR: Q46AZ9
FT                   Glycosyltransferase; PFAM: Glycosyltransferase family 28
FT                   C-terminal domain; TIGRFAM: conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35788"
FT                   /db_xref="GOA:D5E9D7"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9D7"
FT                   /protein_id="ADE35788.1"
FT                   /translation="MSLKILIFVCGEGLGHTGRCLAAGRELSRAGHEVTCGAYGYSAQF
FT                   LAEHGMNVKEIPPEIRLVGEKGSLNLGESIKESIKLGQLPGLFDVQSLVNEEKPDVILS
FT                   DSYYLGTIAALRRKVPVALMVNQSNMEIFFQENYLFQGMGIVAKKFYNGIFKRVDRTII
FT                   PDYPQPNTICALNLNFEDETIPKVEYTGPLPARNYEDVRAQDLPRPHVLSLIGGFGYRA
FT                   PIFRRIIEAASMDSTINYTLLSGPGLDREELPHLPDNAELLPFIPDQFPYLKSCDLAIA
FT                   PGGHTTMMEALAYGVPMLSFPDREHSEQQNNAEGLEAKGCGKQMDYKASSSEILEAVRE
FT                   AVKGKYRNKTEQMKKIAGEMNGPEKLRKILEEIACQRL"
FT   gene            complement(281660..281782)
FT                   /locus_tag="Mmah_0257"
FT   CDS_pept        complement(281660..281782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0257"
FT                   /product="putative transcriptional regulator, CopG family"
FT                   /note="SPTR: Q12UF9 Putative nickel-responsive regulator;
FT                   PFAM: NikR C terminal nickel binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35789"
FT                   /db_xref="InterPro:IPR014864"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9D8"
FT                   /protein_id="ADE35789.1"
FT                   /translation="MEIIIFDGDGESIKKLDENLISLKGVKYVKLNTTPPAEKL"
FT   gene            complement(281796..282080)
FT                   /locus_tag="Mmah_0258"
FT   CDS_pept        complement(281796..282080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0258"
FT                   /product="transcriptional regulator NikR, CopG family"
FT                   /note="COGs: COG0864 transcriptional regulator protein
FT                   containing the CopG/Arc/MetJ DNA-binding domain and a
FT                   metal-binding domain; InterPro IPR002145:IPR014864; KEGG:
FT                   sat:SYN_00477 nickel-responsive regulator; PFAM: CopG
FT                   domain protein DNA-binding domain protein; NikR nickel
FT                   binding; SPTR: Q12UF9 Putative nickel-responsive regulator;
FT                   PFAM: Ribbon-helix-helix protein, copG family; NikR C
FT                   terminal nickel binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35790"
FT                   /db_xref="GOA:D5E9D9"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR014864"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9D9"
FT                   /protein_id="ADE35790.1"
FT                   /translation="MEQELMRIGVSLPNNLLEKFDSIIEQRGYSSRSEGIRDAIRSYIN
FT                   YHEWMGDISGRRVGTITLIYDHTKRGLSNAIADAQHGYTDIIKTSIHPS"
FT   gene            282217..282948
FT                   /locus_tag="Mmah_0259"
FT   CDS_pept        282217..282948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0259"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="COGs: COG0152
FT                   Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR)
FT                   synthase; InterPro IPR001636:IPR018236; KEGG: maq:Maqu_1689
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase;
FT                   PFAM: SAICAR synthetase; PRIAM:
FT                   Phosphoribosylaminoimidazolesuccinocarboxamide synthase;
FT                   SPTR: Q12UF8
FT                   Phosphoribosylaminoimidazole-succinocarboxamide synthase;
FT                   TIGRFAM: phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase; PFAM: SAICAR synthetase; TIGRFAM:
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35791"
FT                   /db_xref="GOA:D5E9E0"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9E0"
FT                   /protein_id="ADE35791.1"
FT                   /translation="MMSDIQIKDELYSGKAKTIYTTNDPEVFVSHFRDSLTAFDGKKKS
FT                   EAEKKGYYNAQISRKLFEMLEDEGINTHYLGMFDDERMLVEKVEIIPIEVIPRNIAAGS
FT                   ITRKYPFNEGDEFKEPVLVMDYKSDEYGDPMLNEDIAIALGIATSEDIAKIRELAMNIN
FT                   SILTTYMEKQGLLLVDFKLEFGWANGEIVLADEISCDTCRFWDAGTRESLDKDVFRFNK
FT                   GDVSGTYEKLARRLVPEIFEN"
FT   gene            complement(283107..284324)
FT                   /locus_tag="Mmah_0260"
FT   CDS_pept        complement(283107..284324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0260"
FT                   /product="Protein of unknown function DUF650"
FT                   /note="COGs: COG1602 conserved hypothetical protein;
FT                   InterPro IPR006978:IPR006979; PFAM: Protein of unknown
FT                   function DUF650; Protein of unknown function DUF651; SPTR:
FT                   Q12UF3 Putative uncharacterized protein; PFAM: Archaeal
FT                   protein of unknown function (DUF650); Archaeal protein of
FT                   unknown function (DUF651)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35792"
FT                   /db_xref="GOA:D5E9E1"
FT                   /db_xref="InterPro:IPR006978"
FT                   /db_xref="InterPro:IPR006979"
FT                   /db_xref="InterPro:IPR033167"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9E1"
FT                   /protein_id="ADE35792.1"
FT                   /translation="MKTQCIECKGKGLCGRTRCPILEKFRATAKYSPQKQGGKTIFGAS
FT                   PPAIFVGRYGYPEISAGPMIPPLLESDEAAKLEDPHALLGMGIDDIIQKRCQLVRANTT
FT                   VKVKQFEKGRLIEKAQEMALSRKPVDTEVLLSKPLKPAQKFDGVLTPMGPAGKMERFEI
FT                   SENPKVPDKVDYLTYDNDVKATDAALELYGHNIGCEHITRLLSIGLLGQERKLVPTRWA
FT                   ITATDDMVGKELTKDLLDYPEIKDIQLYSGGSLGNHFEILLIPRSYSFELLELWMARTV
FT                   WSADKAWIGQDMEGTSGKKGYSPLAGGYYAARLPVLEKLKSIRKQAAVFAIREITPDYW
FT                   APLGVWVVREAARNALSTEPYSFETLEEALMNMKTRINTPFYQWRDKSKLLPYVKEQTT
FT                   LSRFLP"
FT   gene            complement(284321..284680)
FT                   /locus_tag="Mmah_0261"
FT   CDS_pept        complement(284321..284680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0261"
FT                   /product="transcriptional regulator protein"
FT                   /note="COGs: COG2522 transcriptional regulator protein;
FT                   SPTR: Q12UF2 Putative uncharacterized protein; PFAM:
FT                   Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35793"
FT                   /db_xref="GOA:D5E9E2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9E2"
FT                   /protein_id="ADE35793.1"
FT                   /translation="MKPACEIMVQRVLPAIRAVLARELMNEHKCTQQQVANLLGLSRAA
FT                   VSQYVSEKRGAEVGFSENTNEEIRKFAFCLATDGLTPKQKVKRMCEVCKHVQKSGWLYK
FT                   NAPEVGYCILCGEDD"
FT   gene            complement(284857..285165)
FT                   /locus_tag="Mmah_0262"
FT   CDS_pept        complement(284857..285165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0262"
FT                   /product="translation initiation factor 1 (eIF-1/SUI1)"
FT                   /note="COGs: COG0023 Translation initiation factor 1
FT                   (eIF-1/SUI1) and related protein; InterPro
FT                   IPR001950:IPR005872; KEGG: hch:HCH_00188 translation
FT                   initiation factor SUI1; PFAM: translation initiation factor
FT                   SUI1; SPTR: Q12UF1 Protein translation factor SUI1 homolog;
FT                   TIGRFAM: translation initiation factor SUI1; PFAM:
FT                   Translation initiation factor SUI1; TIGRFAM: translation
FT                   initation factor SUI1, putative, prokaryotic"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35794"
FT                   /db_xref="GOA:D5E9E3"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR005872"
FT                   /db_xref="InterPro:IPR022851"
FT                   /db_xref="InterPro:IPR036877"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9E3"
FT                   /protein_id="ADE35794.1"
FT                   /translation="MSSEMCSVCGLPKELCICEEVAKEQQRITVKVNRRRYGKEVTVVE
FT                   GFDANEIDLHELSTYLKSKFACGGTVRGNAVELQGNHLGRMKDVLVQKGFSPDQIKN"
FT   gene            285243..285602
FT                   /locus_tag="Mmah_0263"
FT   CDS_pept        285243..285602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0263"
FT                   /product="protein of unknown function DUF192"
FT                   /note="COGs: COG1430 conserved hypothetical protein;
FT                   InterPro IPR003795; KEGG: tgr:Tgr7_0576 hypothetical
FT                   protein; PFAM: protein of unknown function DUF192; SPTR:
FT                   Q12UF0 Putative uncharacterized protein; PFAM:
FT                   Uncharacterized ACR, COG1430"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35795"
FT                   /db_xref="InterPro:IPR003795"
FT                   /db_xref="InterPro:IPR038695"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9E4"
FT                   /protein_id="ADE35795.1"
FT                   /translation="MLLKVNGKMIARDVEMADNLLKRTRGLMFRMNILQDYAMFFSINK
FT                   PCRFSIHMLFVPFFLDVFFLDSNYRITQIESLRPWLGFTRAKYATRYMVEMPAGSVEKF
FT                   GLEVGQKMSLENTHS"
FT   gene            285664..287808
FT                   /locus_tag="Mmah_0264"
FT   CDS_pept        285664..287808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0264"
FT                   /product="phosphoribosylformylglycinamidine synthase
FT                   subunit II"
FT                   /EC_number="6.3.5.3"
FT                   /note="COGs: COG0046 Phosphoribosylformylglycinamidine
FT                   (FGAM) synthase synthetase domain; InterPro
FT                   IPR010918:IPR000728:IPR010074; KEGG: ade:Adeh_4214
FT                   phosphoribosylformylglycinamidine synthase II; PFAM: AIR
FT                   synthase related protein domain protein; AIR synthase
FT                   related protein; PRIAM: Phosphoribosylformylglycinamidine
FT                   synthase; SPTR: Q12UE9 Phosphoribosylformylglycinamidine
FT                   synthase II; TIGRFAM: phosphoribosylformylglycinamidine
FT                   synthase II; PFAM: AIR synthase related protein, N-terminal
FT                   domain; AIR synthase related protein, C-terminal domain;
FT                   TIGRFAM: phosphoribosylformylglycinamidine synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35796"
FT                   /db_xref="GOA:D5E9E5"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9E5"
FT                   /protein_id="ADE35796.1"
FT                   /translation="MLPEDDLKIIVEKMGRQPNDVEQGCFLNLWSEHCSYRSSAPLLKS
FT                   FTTTGDRVIIGPGDDAAIVRFGDGWVLALGMESHNHPSYVDPYNGSATGVGGIVRDIIS
FT                   MGARPIALMDPLYFGPLNTPKNLYLFEHIIEGIGGYGNCIGVPVVRGEAFFDESYSGNP
FT                   LVNVVCVGLAREDQLVTATAQKAGNKIILIGSTTGRDGLGGASFASRDLSESAEAEDRP
FT                   SIQIGDPFTEKLLIELSLEAVAEGVVKSCRDLGAAGLAGASSEMASKGDLGIHIIADRV
FT                   AQREAGMNAFEIMIAESQERILFEVEPENVDYMLQLAEKYDLNGAVIGELTERPYFTVD
FT                   FEGNTETDIPIHLLTEGAPTFERPSTPFTVKKDPVPDATGDLKQAILDVLASHNVASKE
FT                   WIYRQYDHEVQIRTVAKPGSDSAIQRIVGDRGIALSCGCNPRHTYLDPYEGGKGTLAEN
FT                   AMNLAVKGGRGLALLDCLNFGNPEKPDIYWQFKYAINGLADAARELSIPVVGGNVSLYN
FT                   ESEEHQTSILPTPAIGVVGEVEDVSTVPSSQFTGTGQSVILVGTTKAELGGSEYYNVRR
FT                   TPNAGDVPQVPADMVDIVESLITTIREGKVSVSHDISHGGLAAALCEMCGNVGLEVDLS
FT                   EIAGDMSTEAVLFSESHGRALLATDDPHVVSAQLGNIPHIVVGTTGGDSVRITVNTDHI
FT                   EVGLDEIKDARASLTRLMME"
FT   gene            complement(287811..288989)
FT                   /locus_tag="Mmah_0265"
FT   CDS_pept        complement(287811..288989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0265"
FT                   /product="aminotransferase class V"
FT                   /note="COGs: COG0520 Selenocysteine lyase; InterPro
FT                   IPR000192; KEGG: rlt:Rleg2_1896 cysteine desulfurase, SufS
FT                   subfamily; PFAM: aminotransferase class V; SPTR: Q12UD3
FT                   Aminotransferase, class V; PFAM: Aminotransferase class-V;
FT                   TIGRFAM: cysteine desulfurases, SufS subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35797"
FT                   /db_xref="GOA:D5E9E6"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9E6"
FT                   /protein_id="ADE35797.1"
FT                   /translation="MYDVENIRADFPVLKDNIYLDNAATTQTPVQAVRAMEEYFFKYAA
FT                   NHGRGAHHLARQTTDHFENARETIADLLNCPAENTIFTKNATEGLNLIARGIEWQDGDH
FT                   IITTLIEHHSDLLPWMELRERGVELTIVEPDNEGHVSVEALEQHIRPSTRLVAVTHISN
FT                   SFGSIQDANGICKLARDHGSLCLIDGSQSAGHMPVNLKQMDCDFFTTPGHKGLLGPQGT
FT                   GVTYIKEPELIKPLIIGGGAVRSVTTTGYELEEAPARFEAGTPNIPGGIGLGRAVKYVQ
FT                   EIGVSDIEKHERRLAQNAAYRLAQIEGVEVYGPPDRGAVVPFNVLGLNPHDVAMILDET
FT                   RQICLRSGYHCAMPGIDFMKIEGTVRASFALYNTEEEVDALVEAVEQITTLA"
FT   gene            complement(289031..289183)
FT                   /locus_tag="Mmah_0266"
FT   CDS_pept        complement(289031..289183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35798"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9E7"
FT                   /protein_id="ADE35798.1"
FT                   /translation="MTTIMKKHDILGCEDKKGKCHSVVGGHTEGKLNEDDKELYHFMVG
FT                   GMQAK"
FT   gene            289465..290745
FT                   /locus_tag="Mmah_0267"
FT   CDS_pept        289465..290745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0267"
FT                   /product="methanogenesis marker protein 1"
FT                   /note="COGs: COG1944 conserved hypothetical protein;
FT                   InterPro IPR003776:IPR017667; KEGG: scl:sce8753
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF181; SPTR: Q12UD2 Putative uncharacterized protein;
FT                   TIGRFAM: methanogenesis marker protein 1; PFAM: YcaO-like
FT                   family; TIGRFAM: uncharacterized domain; putative
FT                   methanogenesis marker protein 1; bacteriocin biosynthesis
FT                   docking scaffold, SagD family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35799"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="InterPro:IPR017667"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9E8"
FT                   /protein_id="ADE35799.1"
FT                   /translation="MPIIDIDPYVKYAGDSQRVLDGEATLEKASGGLDKIGVTRIANIT
FT                   DLDRLGIPVFSGIRPTAADGAISVYSGKGVNPQQARISTIMECYERCLAERNGVNADID
FT                   ENVAADEFMATMEEAGVHHDLIHPEEFLMPQPLDSTSLIEWTEGFDLLSGNEVYVPSNA
FT                   VYHPYDAPGMSAHLFRSNTNGLASGNVMEEAILHGLLEVIERDALSMAEFNRNPGMELV
FT                   LTEEDGHAYEMLKAFRDSGVDIRLWVLLHDTPVTTVVAATDDVQLKDPALLVMGAGSHL
FT                   RPDIAVMRAITEAAQSRVVQIHGAREDTTREDLVRKIGYERMRRMNVYWYEEGVDKISL
FT                   ADMQDISSPTPAGNINTVLSHLEKIARNAVVVDLSRSSINIPVVRVIIPGFEQYTLDRE
FT                   RVGKRIRLVGKRKGPEKEKPWKRRPKV"
FT   gene            290742..291389
FT                   /locus_tag="Mmah_0268"
FT   CDS_pept        290742..291389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0268"
FT                   /product="TfuA domain protein core"
FT                   /note="COGs: COG3482 conserved hypothetical protein;
FT                   InterPro IPR012924; KEGG: scl:sce9073 hypothetical protein;
FT                   PFAM: TfuA domain protein core; SPTR: Q12UD1 TfuA-like
FT                   protein; PFAM: TfuA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35800"
FT                   /db_xref="InterPro:IPR012924"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9E9"
FT                   /protein_id="ADE35800.1"
FT                   /translation="MKTIVFAGTSIGLEEAGKLSGATVHGPVKRGDVTQAVKQGYDLIG
FT                   IIDGIFFHRAAVGHREILEALRKNVTIVGGCSMGALRASEMDRHGMIGVGKIYEWYRDG
FT                   VIEDDDEVAVTTNPETYESISAPLVNIRCTFLSAMDEGIISAGQEAFLLDIAKATHYSL
FT                   RSYYGIIKSARDKGMLDEKTAAFLLDFCRDREVDIKRKDALAVLSRIKELNI"
FT   gene            complement(291392..291811)
FT                   /locus_tag="Mmah_0269"
FT   CDS_pept        complement(291392..291811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0269"
FT                   /product="iron (metal) dependent repressor, DtxR family"
FT                   /note="COGs: COG1321 Mn-dependent transcriptional regulator
FT                   protein; InterPro IPR000835:IPR001367; KEGG: tcx:Tcr_0904
FT                   iron dependent repressor; PFAM: iron dependent repressor;
FT                   regulatory protein MarR; SMART: iron dependent repressor;
FT                   SPTR: Q12UD0 Iron dependent repressor; PFAM: Iron dependent
FT                   repressor, metal binding and dimerisation domain; Iron
FT                   dependent repressor, N-terminal DNA binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35801"
FT                   /db_xref="GOA:D5E9F0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9F0"
FT                   /protein_id="ADE35801.1"
FT                   /translation="MEKITGLELSPRKIEYLKYIHKKKENVRTNELSAHLQVDPSTTTK
FT                   TINELAEEGYVNHVPYRGVRLTEKGKEYAAFLIRRHRILSLMLKNYGLSPEEACSEVKR
FT                   FESFVSLQAIDTICSTMGHPTMGVCGKIEHPHCDV"
FT   gene            complement(291858..293153)
FT                   /locus_tag="Mmah_0270"
FT   CDS_pept        complement(291858..293153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0270"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG3174 membrane protein; InterPro IPR003416;
FT                   KEGG: har:HEAR1033 hypothetical protein; SPTR: Q12UC8
FT                   Putative uncharacterized protein; PFAM: MgtC family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35802"
FT                   /db_xref="GOA:D5E9F1"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="InterPro:IPR025105"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9F1"
FT                   /protein_id="ADE35802.1"
FT                   /translation="MEIVPTIGLDPFLFNFLQKLILSLMIGIIIGIEREHRRAEHPVFA
FT                   GVRTYALAAVTGMLATIAGKTIGNDIIVAAAVLIIACSIALIYRTYTMRGKLGMTSALS
FT                   LFCTFLLGILVANGNYLFAIAGGVAITFLTIEKRPLHSFAQNLSNEDILNSLQFLAVAF
FT                   ILYPLVPAEELWGIVDLKATILIVVLVMFIGFISYISLKRFGAGGGISYSGLLGGFVSS
FT                   EATTAALASIAKEKSGFVNAFYIGILLSNLSMFISNLLIALIVDNSGKTTLNMLPPQLL
FT                   MILVVIGIFWKNKNISKKMEGTLDIGSPFALKPALRFGAIFLVLQIFATFANEYAGTYG
FT                   TYVTALGGVASSSAVTASMASLAVKGEISYMLAGETAVIAGIVSTLNKITYIRIAGALE
FT                   LEKRARMTLMILSIVGIIGLVVWIYADVKPVF"
FT   gene            complement(293191..293475)
FT                   /locus_tag="Mmah_0271"
FT   CDS_pept        complement(293191..293475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0271"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dol:Dole_3055 hypothetical protein; SPTR:
FT                   Q8PT46 Methyltransferase; PFAM: Rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35803"
FT                   /db_xref="GOA:D5E9F2"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9F2"
FT                   /protein_id="ADE35803.1"
FT                   /translation="MLSKIPIDLDAVEDENIDKEILRAGIIAELDAINLYEQMAELASS
FT                   EEIRAVLLDIAKEEKTHVGEFQTMLLEYDDEQGDELEAGRKEVEEEILK"
FT   gene            complement(293532..294188)
FT                   /locus_tag="Mmah_0272"
FT   CDS_pept        complement(293532..294188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0272"
FT                   /product="beta-lactamase domain protein"
FT                   /note="COGs: COG1237 Metal-dependent hydrolase of the
FT                   beta-lactamase superfamily II; InterPro IPR001279; KEGG:
FT                   dal:Dalk_4089 beta-lactamase domain protein; PFAM:
FT                   beta-lactamase domain protein; SPTR: Q12UC6
FT                   Beta-lactamase-like protein; PFAM: Metallo-beta-lactamase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35804"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041712"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9F3"
FT                   /protein_id="ADE35804.1"
FT                   /translation="MQLSVVYDNNAAEGFHAGWGFACLIQQEDTTLLFDTGWNGPALLE
FT                   NLKKVGIKPSDIDILILSHQHWDHIGGLSAILHNSASLEVYVPQAFSPNLKKEIARRAH
FT                   LIEVTRSRQLCKGVFTTGQLGSSIKEQSLILQSEDELYIITGCAHPGLGGIIDSAAKMG
FT                   HVTGVLGGLHDFNDMAKLGQLSYIAAGHCTSHQDEIRRKYPANFAYIYAGYSVDI"
FT   gene            complement(294191..294763)
FT                   /locus_tag="Mmah_0273"
FT   CDS_pept        complement(294191..294763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0273"
FT                   /product="Protein of unknown function DUF1847"
FT                   /note="COGs: COG4887 Uncharacterized metal-binding protein;
FT                   InterPro IPR014997; KEGG: ppd:Ppro_1050 hypothetical
FT                   protein; PFAM: Protein of unknown function DUF1847; SPTR:
FT                   Q12UC5 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF1847)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35805"
FT                   /db_xref="InterPro:IPR014997"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9F4"
FT                   /protein_id="ADE35805.1"
FT                   /translation="MKCAACQNKECRNGKDCSGVAKDIEYTGEDLDCMQVAAAIEGQYY
FT                   MQKTRLEELILFAKKMGYQKLGIAFCIGLANEAATITRILNKDFEVYSTCCKVCGIPKE
FT                   RYELEKIHPEKFEVTCNPKGQAFLLAEKQTELNIIVGLCMGHDIIFTRNSEAPVTTLIV
FT                   KDRVLAHNPAGAIYSGYYLRKKFNLED"
FT   gene            complement(294766..295623)
FT                   /locus_tag="Mmah_0274"
FT   CDS_pept        complement(294766..295623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0274"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="COGs: COG1149 MinD superfamily P-loop ATPase
FT                   containing an inserted ferredoxin domain; InterPro
FT                   IPR001450:IPR002586:IPR017900; KEGG: dol:Dole_0577
FT                   cobyrinic acid ac-diamide synthase; PFAM: Cobyrinic acid
FT                   ac-diamide synthase; 4Fe-4S ferredoxin iron-sulfur binding
FT                   domain protein; SPTR: Q12Y90 Cobyrinic acid a,c-diamide
FT                   synthase; PFAM: CobQ/CobB/MinD/ParA nucleotide binding
FT                   domain; 4Fe-4S binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35806"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9F5"
FT                   /protein_id="ADE35806.1"
FT                   /translation="MKQLTVISGKGGTGKTTLTSSFAALAENATIADCDVDAANMHLLL
FT                   QPEIIKTHDFTALPTAIIHPELCTGCGICVDHCRFGAIKEGFEIDPYICEGCGVCEYVC
FT                   PADAVTMEYNKCGEAYESKTRFGPLVHAKLGIGEEAGGKLVTLVREIAEEVSTKNNCDT
FT                   IIIDGPPGTGCSVIAALTGVDIALVVTEPTVAGIHDLKRVIEVAEHFDIPSLVCINKSD
FT                   INDRKRREIEKFCTQKGIKIAGEIPYDTTPTEAMVKGKTIVEYTDNSFAKCVVEVWERV
FT                   KEEM"
FT   sig_peptide     complement(295546..295623)
FT                   /locus_tag="Mmah_0274"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(295620..296444)
FT                   /locus_tag="Mmah_0275"
FT   CDS_pept        complement(295620..296444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0275"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="COGs: COG1149 MinD superfamily P-loop ATPase
FT                   containing an inserted ferredoxin domain; InterPro
FT                   IPR001450:IPR002586:IPR017900; KEGG: dps:DP0339
FT                   hypothetical protein; PFAM: Cobyrinic acid ac-diamide
FT                   synthase; 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; SPTR: Q46BH0 Putative uncharacterized protein;
FT                   PFAM: CobQ/CobB/MinD/ParA nucleotide binding domain; 4Fe-4S
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35807"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9F6"
FT                   /protein_id="ADE35807.1"
FT                   /translation="MKITVASGKGGTGKTTVAVNFFLSVPKTSFLDCDVEEPNSNLFLH
FT                   NELEKVKEVTIPVPVIDEQKCDHCGKCADFCNYNALAALPQKVMVFPDLCHGCGGCSLV
FT                   CPHDAISETGRNIGDIERSLSGQFYTGILNIGEAMASPLIKELKACAGENTVIMDAPPG
FT                   TACPMITTVEDTDYCILVTEPTPFGLNDLKLAAEVVREMRIPAGVIINRAGVGYGGVEE
FT                   YCQQTGLPVIMKIPYDRRIAEAYSEGIPFVETMPQWKEKFLQMFETIKEGVR"
FT   gene            complement(296456..298372)
FT                   /locus_tag="Mmah_0276"
FT   CDS_pept        complement(296456..298372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0276"
FT                   /product="coenzyme F420 hydrogenase/dehydrogenase beta
FT                   subunit domain protein"
FT                   /note="COGs: COG1035 Coenzyme F420-reducing hydrogenase
FT                   beta subunit;
FT                   InterProIPR006066:IPR006067:IPR001450:IPR007516:IPR
FT                   007525:IPR005117:IPR017900; KEGG: gur:Gura_3941 nitrite and
FT                   sulphite reductase 4Fe-4S region; PFAM: coenzyme F420
FT                   hydrogenase/dehydrogenase beta subunit domain protein;
FT                   nitrite and sulphite reductase 4Fe-4S region; 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein;
FT                   nitrite/sulfite reductase hemoprotein beta-component
FT                   ferrodoxin domain protein; SPTR: Q12Y86 Nitrite and
FT                   sulphite reductase; PFAM: Coenzyme F420
FT                   hydrogenase/dehydrogenase, beta subunit N-term; 4Fe-4S
FT                   binding domain; Nitrite and sulphite reductase 4Fe-4S
FT                   domain; Nitrite/Sulfite reductase ferredoxin-like half
FT                   domain; Coenzyme F420 hydrogenase/dehydrogenase, beta
FT                   subunit C terminus"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35808"
FT                   /db_xref="GOA:D5E9F7"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007516"
FT                   /db_xref="InterPro:IPR007525"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9F7"
FT                   /protein_id="ADE35808.1"
FT                   /translation="MADKKWFLKDNIVDTGMCTLCGACAAICPYDLIRFDENGPHLKDE
FT                   CYRNGEGACKDVCQRVMTDASRIALNAFDFKAKPPSLLGQYEKIVSARATDEDLIKKGQ
FT                   DGGAVSSLIAYCIDNGLIDGAITTAGFAKPAANIIGEREDITSSQGAKYSTVPVLSALR
FT                   DQKDNFNKVAVVGTPCQTYGVRRMQYFNGLNVHPVEKGMDGESANTPKIEYVIGLFCME
FT                   NFNYHKLSDFLEKQGIKLNDIKKYSIQLDEMIITTDEKNIEISLKDLQDCVWDGCKICR
FT                   DAVSKVADISAGSSGSSKGWTTLIARNAKGLKLLNDANEAGYIEISNEVDIEMTKELAQ
FT                   FKIRKFRHELDKRLDSEKKVSYYWVRDYPGVRPEINGTNFVKIKTDSGITTHEYLGKVA
FT                   ELAEKYGDGTLEMTARKSIEIQGVPGRNIDDLMAEVYDAGLKTIGMGYATACPGMDYCP
FT                   EGLVSTKELANKLTMHFAQKLTPHKMKVGVAGCPNSCVRVRDHDIGIMGQLMPVIDETK
FT                   CTGCGRCTELCKFNAISIEGGKAVINRDLCGNCGWCVRGCPHEAALEDKRGYSLWIGGN
FT                   GARRPTEGVLIKSFCDEEEIIETINDIARAFIKYRTNPGKERLGNIMDKIGQGTLIKEI
FT                   MEN"
FT   gene            complement(298382..298747)
FT                   /locus_tag="Mmah_0277"
FT   CDS_pept        complement(298382..298747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0277"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /note="COGs: COG1433 conserved hypothetical protein;
FT                   InterPro IPR003731; KEGG: gem:GM21_0426 dinitrogenase
FT                   iron-molybdenum cofactor biosynthesis protein; PFAM:
FT                   Dinitrogenase iron-molybdenum cofactor biosynthesis
FT                   protein; SPTR: Q8PY77 Conserved protein; PFAM:
FT                   Dinitrogenase iron-molybdenum cofactor"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35809"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR033913"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9F8"
FT                   /protein_id="ADE35809.1"
FT                   /translation="MKVCIPATENSGIDSPVGQHFGKVPYYTIYDSETGKVDVLENTSE
FT                   HMGGVGLPPELLANVGVETMLCGGLGWKAVQMFDQFSIKVFVGAQGKVNDAIEAWKNDR
FT                   LEQAGANNSCSGHDHEH"
FT   gene            complement(298744..299136)
FT                   /locus_tag="Mmah_0278"
FT   CDS_pept        complement(298744..299136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0278"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /note="COGs: COG1433 conserved hypothetical protein;
FT                   InterPro IPR003731; KEGG: dol:Dole_0581 dinitrogenase
FT                   iron-molybdenum cofactor biosynthesis protein; PFAM:
FT                   Dinitrogenase iron-molybdenum cofactor biosynthesis
FT                   protein; SPTR: A0B6M7 Dinitrogenase iron-molybdenum
FT                   cofactor biosynthesis; PFAM: Dinitrogenase iron-molybdenum
FT                   cofactor"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35810"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR033913"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9F9"
FT                   /protein_id="ADE35810.1"
FT                   /translation="MKICITSKNNTSDSEIETRFGRTPYFIIADTENGEFEAVGNPAAG
FT                   ATGGAGIQAAQEVAKMKADVLITGNVGPNAYEVLSTAGIEVVTTSGVSVKEAIEQYNNG
FT                   TLGKVSGPTAKAHAGMGRGQGRGGKK"
FT   gene            complement(299338..300366)
FT                   /locus_tag="Mmah_0279"
FT   CDS_pept        complement(299338..300366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0279"
FT                   /product="methylamine-specific methylcobalamin:coenzyme M
FT                   methyltransferase"
FT                   /note="COGs: COG0407 Uroporphyrinogen-III decarboxylase;
FT                   InterPro IPR000257:IPR006360; KEGG: geo:Geob_2543
FT                   uroporphyrinogen decarboxylase (URO-D); PFAM:
FT                   Uroporphyrinogen decarboxylase (URO-D); SPTR: Q12UC0
FT                   Methylamine-specific methylcobalamin:coenzyme M
FT                   methyltransferase; TIGRFAM: methyltransferase MtaA/CmuA
FT                   family; PFAM: Uroporphyrinogen decarboxylase (URO-D);
FT                   TIGRFAM: methyltransferase, MtaA/CmuA family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35811"
FT                   /db_xref="GOA:D5E9G0"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006360"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9G0"
FT                   /protein_id="ADE35811.1"
FT                   /translation="MVEYTPKERLARVFEGKEVDRMPAICATQTGTVEQMDAVGAYWPE
FT                   AHEDPVKMAALAEAGHTVVGFEAVRVPFDITAEAEFFGCGIKPSTKEQQPSVISHVVSK
FT                   AEDLEQFEGYNIEDGRIGNVCEAVKILSDKYGDELPIIGSMIGPFSLAQHLNGDSWFMN
FT                   IMTDQEFGLKLMEFTTEFCTQYALKQVENGADTFAIIDPTASYQLIGADFYKTFVVPFH
FT                   QKIVEALHEKGIPSILHICGDTTNGLAIMETCGVDAISVDQNVDPAAAVENVDKALILG
FT                   NLDPVSVLWNQGEDNVEGVKEESKNVLDAGVQLLAPGCGIVSKTPTQNLQAMIEAAKNW
FT                   TY"
FT   gene            complement(300508..301287)
FT                   /locus_tag="Mmah_0280"
FT   CDS_pept        complement(300508..301287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0280"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rme:Rmet_1835 6-phosphogluconate
FT                   dehydrogenase, NAD-binding; SPTR: Q12UB9 Putative
FT                   uncharacterized protein; PFAM: NAD binding domain of
FT                   6-phosphogluconate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35812"
FT                   /db_xref="GOA:D5E9G1"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR023914"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9G1"
FT                   /protein_id="ADE35812.1"
FT                   /translation="MALLTPQDLEGLTKQLEYNNNTIKKATGMDIADICKQIYSTTLDG
FT                   EKVGIVPITSGNGIISNFSSSLLTITEYFGLDGDITEHPDVTGYYEAVSSDADIILMAD
FT                   DHIFIAHNMRNGKIATNHVCTGVVYAEIASRYKYADSKDILVIGLGRVGYAGAQHLVKK
FT                   DFDVYAYDPNRETLEKARKELGIIPYDPEEKHKFSMVLEATPNPNTISEGMVAERCLVS
FT                   TPGIPCGLPEDIGKKNEIDLVMEPLMIGVASMIYAVM"
FT   gene            complement(301301..302383)
FT                   /locus_tag="Mmah_0281"
FT   CDS_pept        complement(301301..302383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0281"
FT                   /product="protein of unknown function DUF201"
FT                   /note="COGs: COG0458 Carbamoylphosphate synthase large
FT                   subunit (split gene in MJ); InterPro
FT                   IPR003806:IPR020561:IPR011761; KEGG: bpr:GBP346_A2048
FT                   argininosuccinate lyase 2 (arginosuccinase 2) (asal 2);
FT                   PFAM: protein of unknown function DUF201;
FT                   Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain;
FT                   SPTR: Q12UB8 Putative uncharacterized protein; PFAM:
FT                   ATP-grasp domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35813"
FT                   /db_xref="GOA:D5E9G2"
FT                   /db_xref="InterPro:IPR003806"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR023890"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9G2"
FT                   /protein_id="ADE35813.1"
FT                   /translation="MKTICLIGGKLQGFEVAYLARKSGIRVHLVDRKNKPLIHNCVDEH
FT                   FCFDITERPERLIELSRHSDAIIPTNENLDTLLFLKKIEPELHCPLLFDFTAYDTSMDK
FT                   KRSKEYFKSIDIPIPSEKPQNPPYFVKPPCMSSSKGARIIDNDSELANIDDSMVIEEYV
FT                   PGPVVSLEVVGDGNNFMIGQQTQVHIDQEHDCHRVTPMETDPIFREITHLLASNLYLKG
FT                   IMDVEAILSPEGIRVIEIDARFPSQTPTVVYHSGGVNLLEWLMGSFAGKIKDNKPLPVG
FT                   KQCNYEHLMAVDGKLIPVGEHVLSDGDDYRLFHESNGLEIFKCRGKRQTYTLICTGATR
FT                   HEMCYKRKKAIQLIKSDMKQ"
FT   gene            complement(302385..303425)
FT                   /locus_tag="Mmah_0282"
FT   CDS_pept        complement(302385..303425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0282"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="COGs: COG0502 Biotin synthase; InterPro
FT                   IPR007197:IPR006638; KEGG: dat:HRM2_15240 BioB2; PFAM:
FT                   Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB; SPTR: Q12UB7 Biotin synthase; PFAM: Radical
FT                   SAM superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35814"
FT                   /db_xref="GOA:D5E9G3"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023891"
FT                   /db_xref="InterPro:IPR034422"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9G3"
FT                   /protein_id="ADE35814.1"
FT                   /translation="MDNEQLDKFASSINKGYQLQDQEIRDLLAIEDEEEMQKLFHVARM
FT                   VRDNFFGNKVFLYSFVYFSTYCKNQCSFCYYNCKNKIHRYRLTPDEIEKVCEALENDPI
FT                   HMVDLTMGEDPYYHDHPEKLVSAVRKVKDKLGLPIMISPGVVRKDTLKQMYDNGADFLA
FT                   LYQETYDQELYNKLRVGQVYDQRINCRQDAKEIGYCVEDGILTEIEPEAESTLISLKGL
FT                   RKSNPNMVRVMTFVPQEGTPLASREPGSSKSELKIISILRLMFPDRLIPASLDLEGMEG
FT                   MVYRLDAGANVVTSIIPSGSTLEGVVNYDRELTERNRDAWSVVERLQSMGMEPAKQEDF
FT                   NQILGR"
FT   gene            complement(303443..304657)
FT                   /locus_tag="Mmah_0283"
FT   CDS_pept        complement(303443..304657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0283"
FT                   /product="Pyrrolysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.26"
FT                   /EC_number="6.1.1.-"
FT                   /note="InterPro IPR002314:IPR006195:IPR012739; KEGG:
FT                   dat:HRM2_15230 hypothetical protein; PFAM: tRNA synthetase
FT                   class II (G H P and S); PRIAM: Pyrrolysine--tRNA(Pyl)
FT                   ligase; SPTR: Q12UB6 Pyrrolysyl-tRNA synthetase; TIGRFAM:
FT                   pyrrolysyl-tRNA synthetase; PFAM: tRNA synthetase class II
FT                   core domain (G, H, P, S and T); TIGRFAM: pyrrolysyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35815"
FT                   /db_xref="GOA:D5E9G4"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012739"
FT                   /db_xref="InterPro:IPR023877"
FT                   /db_xref="InterPro:IPR023878"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9G4"
FT                   /protein_id="ADE35815.1"
FT                   /translation="MERKPLDLLIDTNGVWLSRNGLLHGVKNFEVSRNHIHITTDCQSR
FT                   FTVRNSRRSRSARALRNNKYRKACKNCKLSDERITRFVTKDFGRGSQARVITSSKTKKS
FT                   KSPKEAVVKSVSSKANEMPPVVEAKKEKPVKPDYTPAQKKRITTLLSPADDLSSIKELP
FT                   TFKELETELVKKRKQDLRQMYEDDRRHQLAQLERDISLFLIEKGFMEVRTSVLIPAKFI
FT                   ERMGITEEDPLYKQIFRVDENTCLRPMLAPGLYNYLHNFDNIMPDPLKIFEIGTCYRKE
FT                   SDGKEHLEEFTMVNFCQMGSGCTKENLLNIIDDLLKYLNIDYEVISDNCMVYGDTIDIM
FT                   HGDMEISSAVVGPIPQDLDWGVTKPWMGAGMGIERLLKVKHKYTNIKRSSRSISYYNGI
FT                   TTNLR"
FT   gene            304955..306475
FT                   /locus_tag="Mmah_0284"
FT   CDS_pept        304955..306475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0284"
FT                   /product="L-threonine O-3-phosphate decarboxylase"
FT                   /EC_number="4.1.1.81"
FT                   /note="COGs: COG0079 Histidinol-phosphate/aromatic
FT                   aminotransferase and cobyric acid decarboxylase; InterPro
FT                   IPR007212:IPR004839:IPR004838; KEGG: gme:Gmet_0487
FT                   L-threonine O-3-phosphate decarboxylase; PFAM:
FT                   aminotransferase class I and II; cysteine-rich small
FT                   domain; SPTR: Q12UB5 L-threonine O-3-phosphate
FT                   decarboxylase; PFAM: Aminotransferase class I and II;
FT                   Cysteine-rich small domain; TIGRFAM:
FT                   L-threonine-O-3-phosphate decarboxylase;
FT                   histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35816"
FT                   /db_xref="GOA:D5E9G5"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR007212"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9G5"
FT                   /protein_id="ADE35816.1"
FT                   /translation="MHLEKHQLKPADDNHMLPFKENILELIPSTHGGLIRKTSQQYSIP
FT                   LSDIVDFSASLNPLGSPFDNPEWGMDLQDLFATSFERMGQYPDNRYLEYRTAAASFVGG
FT                   GAGVVNVVPGNGSSEIIRLVAGCILNEGDEVMIPQPTFAEYEQQCRVAGAKIVYYPVGS
FT                   LLSISADALESVRILFVCNPNNPTGKLLAREDVLRLARLCAETDTLLFVDEAFIELSDI
FT                   SSTVVDVAISNDHVFVMRSLTKSFALPGIRMGFGVASEAMAEKLNTARLPWNMGSLAEG
FT                   VGCALMEMEGGMESPFMDMSRQKITQYRDYLVERLNDIYGFHPHSSSVNYILVDISELL
FT                   MDSVELTERLARHGVLIRDCSSFPLMEKDYIRLAVRPPEETDILIHTIGEVLTESGKDY
FT                   AEEKLKETIKDASCGCSSSRNTCEYYPCHFEGQDCTFCFCPFYPCEDTRTGGKWIDSTT
FT                   GSRVWSCEDCVLVHNSDVVHKMLDILMEDGGTDISLKKAWDEVIHVSL"
FT   gene            complement(306495..308372)
FT                   /locus_tag="Mmah_0285"
FT   CDS_pept        complement(306495..308372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0285"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterProIPR004358:IPR013655:IPR013656:IPR013767:IPR
FT                   003594:IPR003661:IPR001610:IPR000014:IPR000700:IPR005467;
FT                   KEGG: dal:Dalk_4458 multi-sensor hybrid histidine kinase;
FT                   PFAM: ATP-binding region ATPase domain protein; PAS fold
FT                   domain protein; PAS fold-4 domain protein; PAS fold-3
FT                   domain protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; PAC repeat-containing protein; PAS domain
FT                   containing protein; SPTR: Q8TKN3 Sensor protein; TIGRFAM:
FT                   PAS sensor protein; PFAM: Histidine kinase-, DNA gyrase B-,
FT                   and HSP90-like ATPase; His Kinase A (phosphoacceptor)
FT                   domain; PAS fold; TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35817"
FT                   /db_xref="GOA:D5E9G6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9G6"
FT                   /protein_id="ADE35817.1"
FT                   /translation="MCNVVYVDILEFNAPVSKSKIFADMIQHSTDAIIYTTPDFTINFV
FT                   NRSAEEMFGWTLPEIKGKPITILHDQELTSQQKKEMFSNLYSGKAHEIEGSRKRKDGST
FT                   FYCQIKISPLFTEKSRIYGYMGIIRDITEEKQNEDSLVKELDLLTGLIGTARVIVTVLD
FT                   RQGKIVYCNPHTEKITGYKLKEIKGDDWFSRFIPVREKERIRSVFKKAICGHPTKGNVN
FT                   PIDTKEGKEIIVEWYDTALKNDEGEVTGLLSIGNDITQRVEAEEKLKTIYENMPGGILM
FT                   IGQDYIIKDVNYRTCEITGYKREELVGQLCDIVCPKGSSSKQCPIWEDGQEEFRGMDTS
FT                   IKCKNGIKKPILKNAQEITIKGDTYILELFQDISQRKNAEENAIEAKKAAEQANQTKSE
FT                   FLANMSHELRTPLNSVIGFSDILSKEVRGKLNDSQKKYVSNITKSGSHLLSLINDILDL
FT                   SKIEAGQKQLEYSSFDLHEALDEISILIKPLISKKNIDLQMDLPPEDSRVYADRKKFKQ
FT                   IMYNLLSNASKFTPDKGTITIVANQEKDKLKVAVQDTGMGIPEADQATIFEPFQQVKSA
FT                   KSSEYKGTGLGLSLARELVEMHGGQVGLKSEVGMGSTFTFTIPDKPNTN"
FT   gene            complement(308513..309196)
FT                   /locus_tag="Mmah_0286"
FT   CDS_pept        complement(308513..309196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0286"
FT                   /product="Queuine tRNA-ribosyltransferase containing PUA
FT                   domain"
FT                   /note="COGs: COG1549 Queuine tRNA-ribosyltransferase
FT                   contain PUA domain; SPTR: Q12UA6 Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35818"
FT                   /db_xref="GOA:D5E9G7"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="InterPro:IPR040777"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9G7"
FT                   /protein_id="ADE35818.1"
FT                   /translation="MTPIIPENERSDEPLDTERLIYHPDMIRANKWVLNEYEAPTRKFC
FT                   IFVPCSMRKPYHTSPSHRMYDRIIFDLLKPEDVHIVVFGTCGVTPREIDTEYPFTDYKF
FT                   MMGKCNVAKIKRDFISMESKRIATYLEKTRDNYGHRIAYCTGDFRKAMLKGLEKTDIEV
FT                   NIVPRQKTMEEHIRPNKRFIYGSLSQKGYLQDLSDAITDKLGIERRVVGIDPECSENDN
FT                   DWYLL"
FT   gene            309302..309685
FT                   /locus_tag="Mmah_0287"
FT   CDS_pept        309302..309685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0287"
FT                   /product="transcriptional regulator, TrmB"
FT                   /note="COGs: COG3355 transcriptional regulator protein;
FT                   InterPro IPR002831; PFAM: transcriptional regulator TrmB;
FT                   SPTR: Q12UA5 Transcriptional regulator TrmB; PFAM:
FT                   Sugar-specific transcriptional regulator TrmB"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35819"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9G8"
FT                   /protein_id="ADE35819.1"
FT                   /translation="MTGSISEMLKANCECDDVAKCILGLKDLDLKAYKILLSNGPLTAE
FT                   KLGKYLDRERSTAYRSLQNLISCGLVYRETHTIDVGGYFYEYVAVNPAEVRRMLQESVD
FT                   QWYDKVSHLINKIDKELVGDEIP"
FT   gene            309899..311059
FT                   /locus_tag="Mmah_0288"
FT   CDS_pept        309899..311059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0288"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="COGs: COG2814 Arabinose efflux permease; InterPro
FT                   IPR001411:IPR001958:IPR011701; KEGG: dvm:DvMF_0592 major
FT                   facilitator superfamily MFS_1; PFAM: major facilitator
FT                   superfamily MFS_1; SPTR: Q8TU92 Multidrug-efflux
FT                   transporter; PFAM: Major Facilitator Superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35820"
FT                   /db_xref="GOA:D5E9G9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9G9"
FT                   /protein_id="ADE35820.1"
FT                   /translation="MKFRKSHLLLLCVTAFFAMAGGAILAPVLPDMVVPLDTTSHEIGL
FT                   VISVYTISTAIFTLIIGHFVDRLDRKKVLVPCLLIYGLMGLASFFATDLQTLLILRLLQ
FT                   GMGVAGMMSLAMLIIGEAYSGSERLHAMGRVSTTIAIGIIAAPLIGGGLAIAGWNYPFL
FT                   FYALSLPFAVIMFFHLPETRLQNLEINKRGLLDAFGAMRDFRVAYTIFLVFVTFFLLYS
FT                   VVVYVPFMLKEYFGYTADKSGIVLAFQGIAVIIVASNVRRIATKFEMISMIGIGFLLVS
FT                   VAILLLTQVNSVLPVFALMFIFGCGYGLSQTVIDGMIVHISPPQVRGGVLSIHNSTKYV
FT                   GMSLSPALMGMVYFYFGLQTVFLLAGLLALFAGISVYMVREWFVDI"
FT   sig_peptide     309899..309958
FT                   /locus_tag="Mmah_0288"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            311176..311952
FT                   /locus_tag="Mmah_0289"
FT   CDS_pept        311176..311952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0289"
FT                   /product="protein of unknown function DUF88"
FT                   /note="InterPro IPR002790; KEGG: reh:H16_A3546 hypothetical
FT                   protein; PFAM: protein of unknown function DUF88; SPTR:
FT                   Q12YH4 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function DUF88"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35821"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="InterPro:IPR025605"
FT                   /db_xref="InterPro:IPR041966"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9H0"
FT                   /protein_id="ADE35821.1"
FT                   /translation="METDSVQKKLAVLIDADNAQPSIVEGLFSEIAKYGIASVKRIYGD
FT                   WTRPNLKNWKDSLLEHSIQPMQQFSYTYGKNATDSSLIIDAMDLLYSEPLDGFCIVSSD
FT                   SDFTRLSSRIRESGRKVYGFGELKTPKPFIAACDKFIYTENLRKEEDIVDTVAESPMQA
FT                   PGKWDTNRLKGDSKLVKMLRDAVEDSAEESGWAFLGNVGSNLVQKQPDFDPRNYGYKKM
FT                   WDIFRAIDLFDIDEVRADNSSNNRLIYVKDKKSDGK"
FT   gene            complement(311986..313077)
FT                   /locus_tag="Mmah_0290"
FT   CDS_pept        complement(311986..313077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0290"
FT                   /product="aminotransferase class I and II"
FT                   /note="COGs: COG0436 Aspartate/tyrosine/aromatic
FT                   aminotransferase; InterPro IPR001176:IPR004839:IPR004838;
FT                   KEGG: ppd:Ppro_2189 aminotransferase, class I and II; PFAM:
FT                   aminotransferase class I and II; SPTR: Q12UA3
FT                   Aminotransferase; PFAM: Aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35822"
FT                   /db_xref="GOA:D5E9H1"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9H1"
FT                   /protein_id="ADE35822.1"
FT                   /translation="MVSDNEDMISLGVGEPDYITPWHIREACIHSLEQGETSYTSNYGL
FT                   VELRDEISRTYTQKQGLYYDPTCEILVTSGVSEALDLAVRAITDPGDEIIIVEPSYVAY
FT                   APAVIFAGGNPVPVQTCMEDKFKLTSENLKKAITPKTKAILLNYPNNPTGAVMDKRELE
FT                   PIAEVVEEHDIMVISDEVYERMTYDTRHTCFASLDGMRQRTIVLNGFSKAYSMTGFRMA
FT                   YALAPAPVLAAMMRIHQYSMLCAPITAQVGAIEALKNGEEEVEKMVNEYNRRRRLIVKG
FT                   FNNIGLDCFNPGGAFYAFPSVASTGLTSEQFAERLLDQQQVVTIPGNVFGRAGNGYLRC
FT                   AYAASREDIKEALDRIENFISNI"
FT   gene            complement(313167..313658)
FT                   /locus_tag="Mmah_0291"
FT   CDS_pept        complement(313167..313658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0291"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="COGs: COG1522 Transcriptional regulators; InterPro
FT                   IPR000485:IPR019887:IPR019888; KEGG: tmz:Tmz1t_0571
FT                   transcriptional regulator, AsnC family; PFAM: Transcription
FT                   regulator, AsnC-type-like; SMART: Transcription regulator,
FT                   AsnC-type; SPTR: Q12UA2 Transcriptional regulator, AsnC
FT                   family; PFAM: AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35823"
FT                   /db_xref="GOA:D5E9H2"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9H2"
FT                   /protein_id="ADE35823.1"
FT                   /translation="MDRKTRDILEILENDARATHEEISALVDMTPEEVQKRIHQLEKAK
FT                   IIRKYKTVIDWELAGEDYVYAIIELKVTLERKQGYQGIAERLYRFPEVRSVRLLSGEHD
FT                   IALTVRGKSMKQVAFFVAEKIATLEQVHNTATHFVLKTYKEDGLIMEEPEHVKRLPVSP
FT                   "
FT   gene            complement(313683..314060)
FT                   /locus_tag="Mmah_0292"
FT   CDS_pept        complement(313683..314060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0292"
FT                   /product="SSU ribosomal protein S8E"
FT                   /note="COGs: COG2007 Ribosomal protein S8E; InterPro
FT                   IPR001047; KEGG: RPS8; likely cytosolic ribosomal protein
FT                   similar to S. cerevisiae RPS8A (YBL072C) and RPS8B
FT                   (YER102W) small subunit protein; likely intron in 5' UTR;
FT                   PFAM: Ribosomal protein S8E; SPTR: Q12UA1 30S ribosomal
FT                   protein S8e; TIGRFAM: ribosomal protein S8e; PFAM:
FT                   Ribosomal protein S8e; TIGRFAM: ribosomal protein S8.e"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35824"
FT                   /db_xref="GOA:D5E9H3"
FT                   /db_xref="InterPro:IPR001047"
FT                   /db_xref="InterPro:IPR020919"
FT                   /db_xref="InterPro:IPR022309"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9H3"
FT                   /protein_id="ADE35824.1"
FT                   /translation="MISQGRSKRTATSAKRKTARGKRKYEIGSEPAATHVAETRRKSVK
FT                   TRGGAQKIKLLQEKIANVTDPSTGKTSAVTIENVTDNEANEHYVRRNILTKGSIIKTEL
FT                   GDARITSRPGQDGVVNAILTK"
FT   gene            314189..315127
FT                   /locus_tag="Mmah_0293"
FT   CDS_pept        314189..315127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0293"
FT                   /product="RNAse Z"
FT                   /EC_number="3.1.26.11"
FT                   /note="COGs: COG1234 Metal-dependent hydrolase of the
FT                   beta-lactamase superfamily III; InterPro
FT                   IPR001279:IPR013471; KEGG: afw:Anae109_4169 ribonuclease Z;
FT                   PFAM: beta-lactamase domain protein; SPTR: Q46BL2
FT                   Ribonuclease Z; TIGRFAM: ribonuclease Z; PFAM:
FT                   Metallo-beta-lactamase superfamily; TIGRFAM: ribonuclease
FT                   Z"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35825"
FT                   /db_xref="GOA:D5E9H4"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9H4"
FT                   /protein_id="ADE35825.1"
FT                   /translation="MLLLMIFIMLRVVFLGTGGALPTVNRNPSSILVNRDGELLLFDCG
FT                   EGTQQQMMRARTGMMSLSSIFISHFHADHVLGIPGLLQTLSFHGRDTPLTIYGPVWVEQ
FT                   FVKLVSLLGYCRLNFEVKAVPLEAGDVVQREGYVVNAIASEHSVPSLAYALVENERPGK
FT                   FDRRRAEEMGVPVGPLYSRLQKGESVEVNGRIIHPNEVIGPSRRGRKLIYTGDTRPCEA
FT                   ILEASKNADVLIHDGTLAQEKADWARESLHSTANEAADVAKKAGVKRLILTHISSRYTD
FT                   DSSVLLEEAKEVFEKTCVADDLMEFEVLYGE"
FT   gene            complement(315146..315409)
FT                   /locus_tag="Mmah_0294"
FT   CDS_pept        complement(315146..315409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0294"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q12U97 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35826"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9H5"
FT                   /protein_id="ADE35826.1"
FT                   /translation="MTEIEESDRFECKVVNIINNLKWKGVMVKEIKSGGNVYFARTDPK
FT                   RDLRPGDTLYLGVRELPSQMEEMQAEVTLYDKNDEKIDWTFI"
FT   gene            complement(315424..316527)
FT                   /locus_tag="Mmah_0295"
FT   CDS_pept        complement(315424..316527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0295"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="COGs: COG1223 ATPase (AAA+ superfamily); InterPro
FT                   IPR003959:IPR003593:IPR003960; KEGG: hypothetical protein;
FT                   PFAM: AAA ATPase central domain protein; SMART: AAA ATPase;
FT                   SPTR: Q8TLK7 ATPase, AAA family; PFAM: ATPase family
FT                   associated with various cellular activities (AAA)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35827"
FT                   /db_xref="GOA:D5E9H6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9H6"
FT                   /protein_id="ADE35827.1"
FT                   /translation="MARSAQRSSLKKIPQEAIEAKEATAEIVILQPIGYPLCGIIEEYP
FT                   RIEEPELFECYARMQWNGYIARKNDYLFDQRMFPDFAYRIQEVRPEDTIIGQSTTIVVN
FT                   QEEKEKTDIEYPVEIAFDDIVGQVKAKRKCKLIERYLEEPERFGKWAPRNILFHGPSGT
FT                   GKTMVAKALANKTDVAFLPIKATQLIGEFVGEGSRQIHQLYEKAGELAPSIIFIDELDA
FT                   IALDRRYQELRGDVAEIVNALLTEMDGISQSEGVCTICATNRTAVLDGAVRSRFEEEIE
FT                   FVLPGKEERKEIIKLNLQTFPIKAEANVDELAKLTNGLSGRDIVEKILKSALHNAIMDD
FT                   MEKVEAHYFEKAASGLQKKETNTHLYV"
FT   gene            316589..316684
FT                   /locus_tag="Mmah_0296"
FT   CDS_pept        316589..316684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0296"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35828"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9H7"
FT                   /protein_id="ADE35828.1"
FT                   /translation="MTITIITRTHLIEIIKHLDSRRNHVGSVSND"
FT   gene            316901..317266
FT                   /locus_tag="Mmah_0297"
FT   CDS_pept        316901..317266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0297"
FT                   /product="response regulator receiver protein"
FT                   /note="COGs: COG2204 Response regulator containing
FT                   CheY-like receiver AAA-type ATPase and DNA-binding domains;
FT                   InterPro IPR001789; KEGG: pla:Plav_2814 response regulator
FT                   receiver protein; PFAM: response regulator receiver; SMART:
FT                   response regulator receiver; SPTR: Q12U95 Response
FT                   regulator receiver protein; PFAM: Response regulator
FT                   receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35829"
FT                   /db_xref="GOA:D5E9H8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9H8"
FT                   /protein_id="ADE35829.1"
FT                   /translation="MATILVVEDNPMNMELTVDLLESYGYEVMQAEDGSQALDVVEKNT
FT                   FDLILLDMQLPKMDGLEVLEKFKEIENSKDTPVVALTAHAMRGDDKKFINAGCAGYISK
FT                   PIDIHEFQQTISSYVDN"
FT   gene            317503..318279
FT                   /locus_tag="Mmah_0298"
FT   CDS_pept        317503..318279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0298"
FT                   /product="thiazole-adenylate synthase"
FT                   /note="COGs: COG1635 Flavoprotein involved in thiazole
FT                   biosynthesis; InterPro IPR000759:IPR013027:IPR002922; KEGG:
FT                   dol:Dole_2426 ribulose-1,5-biphosphate synthetase; PFAM:
FT                   thiamine biosynthesis Thi4 protein; SPTR: Q12U93 Putative
FT                   thiazole biosynthetic enzyme; TIGRFAM: thiazole
FT                   biosynthesis enzyme; PFAM: Thi4 family; TIGRFAM: thiazole
FT                   biosynthesis enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35830"
FT                   /db_xref="GOA:D5E9H9"
FT                   /db_xref="InterPro:IPR002922"
FT                   /db_xref="InterPro:IPR022828"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9H9"
FT                   /protein_id="ADE35830.1"
FT                   /translation="MELDERIITRAIVEEFTNVFLDYTDVDVALVGGGPANLVAARYLA
FT                   EAGLKTVLFEKKLSVGGGMWGGGMMFPRIVVQEEARRILDDFDVPYHEYEEGYYVANSV
FT                   GTVGKLISAAVSAGVEIFNLVSFEDVMIRDKDEVCGLVINWTAVEIGRLHVDPLTIRSR
FT                   LVLDGTGHEATVCNTVQRKIPGAFGGKGVVGEKPMWADTGERLVMENTREVYPGLIVTG
FT                   MAANAVAGSPRMGPVFGGMLLSGEKAAQLAISRLKD"
FT   gene            318348..318422
FT                   /locus_tag="Mmah_R0002"
FT   tRNA            318348..318422
FT                   /locus_tag="Mmah_R0002"
FT                   /product="tRNA-His"
FT   gene            complement(318471..318812)
FT                   /locus_tag="Mmah_0299"
FT   CDS_pept        complement(318471..318812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0299"
FT                   /product="Protein of unknown function DUF356"
FT                   /note="COGs: COG1844 conserved hypothetical protein;
FT                   InterPro IPR007154; PFAM: Protein of unknown function
FT                   DUF356; SPTR: Q12U92 Putative uncharacterized protein;
FT                   PFAM: Protein of unknown function (DUF356)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35831"
FT                   /db_xref="InterPro:IPR007154"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9I0"
FT                   /protein_id="ADE35831.1"
FT                   /translation="MKSFAVIRGEDKNKVRIALHDLQQYGSMKFSSCPKRIEPNYADTL
FT                   LVKVVGVPLRSNCKFAALVGLENNAGSAINKLRKIHPPAHIVIISPRHDAYEELMDNSE
FT                   IYPEFEINN"
FT   gene            complement(318897..319715)
FT                   /locus_tag="Mmah_0300"
FT   CDS_pept        complement(318897..319715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0300"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="COGs: COG0345 Pyrroline-5-carboxylate reductase;
FT                   InterPro IPR011128:IPR004455:IPR006115:IPR000304; KEGG:
FT                   dat:HRM2_40670 ProC; PFAM: NADP oxidoreductase coenzyme
FT                   F420-dependent; NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase domain protein; 6-phosphogluconate
FT                   dehydrogenase NAD-binding; PRIAM: Pyrroline-5-carboxylate
FT                   reductase; SPTR: Q12U91 Pyrroline-5-carboxylate reductase;
FT                   TIGRFAM: pyrroline-5-carboxylate reductase; PFAM: NADP
FT                   oxidoreductase coenzyme F420-dependent; TIGRFAM:
FT                   pyrroline-5-carboxylate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35832"
FT                   /db_xref="GOA:D5E9I1"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9I1"
FT                   /protein_id="ADE35832.1"
FT                   /translation="MMHLENKKVGIIGTGKMGQSLLRGIVRAGKAKPANIYASDVYEPA
FT                   LQALKDELGINVSTDNFDTVDNSEIIILAVKPQILRNVLRGFADHINENKLIISIAAGV
FT                   PAATIEEELHEDTRVVRVMPNIAATVGEAASAVSAGKNASAEDAEVAMEIFSSMGSAAL
FT                   VPEHLMDAVTGVSGSGPAYIFPVIEAMADGGVLEGLDRESALKLAAQTVLGAAKMVLET
FT                   KKHPAELKDMVTSPAGTTIHGVHALEKNGIRAAFTDAVMASAKRSREMGK"
FT   gene            complement(319722..320204)
FT                   /locus_tag="Mmah_0301"
FT   CDS_pept        complement(319722..320204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0301"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="COGs: COG1813 transcription factor homolog of
FT                   eukaryotic MBF1; InterPro IPR001387:IPR004451; KEGG:
FT                   hypothetical protein; K03627 putative transcription factor;
FT                   PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; SPTR: Q12U90
FT                   Transcriptional regulator, XRE family; PFAM:
FT                   Helix-turn-helix; TIGRFAM: conserved hypothetical protein
FT                   TIGR00270"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35833"
FT                   /db_xref="GOA:D5E9I2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR004451"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9I2"
FT                   /protein_id="ADE35833.1"
FT                   /translation="MQCEICGAEIKGEPFKINVEGSELNACNRCSQYGTSVSTRKPVSR
FT                   KNAPVRQGIKKSSKPKKNPVTAPTEELIDEYEQTIREAREEKGLTQEELASNIKEKASL
FT                   IKKIEKGDIVPEDSVRTKIEQALDIELTEKVGEDDWDTNTLNKGTTLGDIVTIKKK"
FT   gene            320290..321579
FT                   /locus_tag="Mmah_0302"
FT   CDS_pept        320290..321579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0302"
FT                   /product="Proteasome-activating nucleotidase"
FT                   /EC_number="3.6.1.3"
FT                   /note="COGs: COG1222 ATP-dependent 26S proteasome
FT                   regulatory subunit;
FT                   InterProIPR003959:IPR011704:IPR003593:IPR003960:IPR 005937;
FT                   KEGG: hypothetical protein; K03062 26S proteasome
FT                   regulatory subunit T2; PFAM: AAA ATPase central domain
FT                   protein; ATPase associated with various cellular activities
FT                   AAA_5; PRIAM: Adenosinetriphosphatase; SMART: AAA ATPase;
FT                   SPTR: Q12U89 26S proteasome subunit P45 family; TIGRFAM:
FT                   26S proteasome subunit P45 family; PFAM: ATPase family
FT                   associated with various cellular activities (AAA); TIGRFAM:
FT                   26S proteasome subunit P45 family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35834"
FT                   /db_xref="GOA:D5E9I3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="InterPro:IPR023501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032501"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9I3"
FT                   /protein_id="ADE35834.1"
FT                   /translation="MNETSDDTLNQGNYGLKNMSDIEYDYMGSEGDEDFSKYLLDRMKQ
FT                   LESRNSKLKEQCDQIESEKKYVESQKVKYEREVRKLRSEINRLKTVPLIVANIIDVIDS
FT                   NKVLIRSSSGPQFMVGVSQYIDDSRLVAGVRVALNQQTLSIVDVLPSTEEPEVSAMEVL
FT                   ESQDISYEDIGGLDNQIQDIIECVELPLIKPESFERVGVEPPKGVLLHGPPGTGKTMMA
FT                   KAVAHRTDATFIRVVGSELVQKYIGEGSRLVREVFDMARKKAPSIIFIDELDAIAATRL
FT                   SDTNGADREVQRTLMQLLAEMDGFENRGDIRIIAATNRVDILDPAIIRPGRFDRMVEVP
FT                   MPDTESRSLILRIHSRGLSLALDVDFDKLATLTENTSGADLHALTTEAGMFAVRNDRDS
FT                   VTMADFMAAIDKVLKPRQPQVNEHPASMFV"
FT   gene            321699..322181
FT                   /locus_tag="Mmah_0303"
FT   CDS_pept        321699..322181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0303"
FT                   /product="protein of unknown function DUF99"
FT                   /note="COGs: COG1628 conserved hypothetical protein;
FT                   InterPro IPR002802; KEGG: dol:Dole_2350 hypothetical
FT                   protein; PFAM: protein of unknown function DUF99; SPTR:
FT                   Q8PY57 UPF0215 protein MM_1007; PFAM: Protein of unknown
FT                   function DUF99"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35835"
FT                   /db_xref="InterPro:IPR002802"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9I4"
FT                   /protein_id="ADE35835.1"
FT                   /translation="MWLDGVLSTYITRDGMDATDSLIKMISASKHRNQARVIMLDGVTY
FT                   GGFNPIDIVRLNESTGMGVIVLMRSMPDFENIKNALYHLEYPDERFAIIKKAGRISRVV
FT                   TSHSHTPVYIQCAGIDEISATRIVQLSATHSNIPEPLRVAHLIATGIICGESCGKP"
FT   gene            complement(322187..323533)
FT                   /locus_tag="Mmah_0304"
FT   CDS_pept        complement(322187..323533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0304"
FT                   /product="phosphomannomutase; alpha-phosphoglucomutase"
FT                   /EC_number="5.4.2.8"
FT                   /EC_number="5.4.2.2"
FT                   /EC_number="5.4.2.10"
FT                   /note="COGs: COG1109 Phosphomannomutase;
FT                   InterProIPR005841:IPR005844:IPR005846:IPR005843:IPR
FT                   005845:IPR016066; KEGG:
FT                   Phosphoglucomutase/phosphomannomutase, C-terminal domain
FT                   containing protein; K01840 phosphomannomutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III;
FT                   phosphoglucomutase/phosphomannomutase;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; PRIAM: Phosphoglucosamine mutase; SPTR: Q12U88
FT                   Phosphoglucosamine mutase; PFAM:
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain II; Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain III;
FT                   Phosphoglucomutase/phosphomannomutase, C-terminal domain;
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain I"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35836"
FT                   /db_xref="GOA:D5E9I5"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR024086"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9I5"
FT                   /protein_id="ADE35836.1"
FT                   /translation="MGLFGTNGVRGIANEFITPKFAIDLARSLGTHLGEDKTVAIGRDT
FT                   RISGEMLKAAAISGLLSTGIKVIDIGTCPTPSVQYYVRDYADAGIVITASHNPREYNGI
FT                   KLIAADGTEFSKEGEKKVENIYYSGEFHTANWNMTGELNRDYNANDYYINGIISSVNST
FT                   KISAKQFRVAIDTGCGAGSLTLPLLLRKLGCEVITINAQPDGTFPWRNPEPTPDVLGEL
FT                   RDIVKNYDVDLGVAQDGDADRAVFFDENGTFIDEEILLSMMAKYVISGKKGPIVTPVSS
FT                   SRRMLDIAKEAGVELHWTAVGSINVARRMMEIDAVFGGEGNGGLIFPEHQYCRDGAMAC
FT                   AKLLDIMAEGVKPSQMAANVPAYHNAKTKVKCGNLKKTLENVAIHVQGEGIEIDTTDGF
FT                   KIWYEDGWLLIRPSGTEPIVRVFAEAKTEKKARQILERGEKIVLASIQD"
FT   gene            323648..323935
FT                   /locus_tag="Mmah_0305"
FT   CDS_pept        323648..323935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0305"
FT                   /product="signal recognition particle, subunit SRP19
FT                   (srp19)"
FT                   /note="COGs: COG1400 Signal recognition particle 19 kDa
FT                   protein; InterPro IPR002778; KEGG: hypothetical protein;
FT                   K03105 signal recognition particle subunit SRP19; PFAM:
FT                   Ribonucleoprotein complex SRP, Srp19 component; SPTR:
FT                   Q12U87 Signal recognition particle 19 kDa protein; PFAM:
FT                   SRP19 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35837"
FT                   /db_xref="GOA:D5E9I6"
FT                   /db_xref="InterPro:IPR002778"
FT                   /db_xref="InterPro:IPR022938"
FT                   /db_xref="InterPro:IPR036521"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9I6"
FT                   /protein_id="ADE35837.1"
FT                   /translation="MKDEGRLVIWPASIDRSKSRNEGRIVSRKSSVKEPNLEEMEKAAA
FT                   SLGLNPEVQKDKAYPRSWWEKSGRIMVDKNESRTTTARLISKTIKKDRQG"
FT   gene            complement(323963..324136)
FT                   /locus_tag="Mmah_0306"
FT   CDS_pept        complement(323963..324136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0306"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q12U86 Preprotein translocase subunit secG;
FT                   PFAM: Sec61beta family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35838"
FT                   /db_xref="GOA:D5E9I7"
FT                   /db_xref="InterPro:IPR016482"
FT                   /db_xref="InterPro:IPR023531"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9I7"
FT                   /protein_id="ADE35838.1"
FT                   /translation="MGKKKQSNNGLMSSAGLMRYYEEDKRAIHLDPKAVIVFGLLCGLA
FT                   VILLSASYGTWP"
FT   gene            complement(324206..325225)
FT                   /locus_tag="Mmah_0307"
FT   CDS_pept        complement(324206..325225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0307"
FT                   /product="translation initiation factor 2B subunit I family
FT                   (IF-2BI)"
FT                   /EC_number="5.3.1.23"
FT                   /note="COGs: COG0182 translation initiation factor 2B
FT                   subunit eIF-2B alpha/beta/delta family; InterPro
FT                   IPR000649:IPR011559:IPR005251; KEGG: gur:Gura_4322 aIF-2BI
FT                   family translation initiation factor; PFAM: initiation
FT                   factor 2B related; PRIAM: S-methyl-5-thioribose-1-phosphate
FT                   isomerase; SPTR: Q12U85 Translation initiation factor 2B
FT                   subunit I family (IF-2BI); TIGRFAM: translation initiation
FT                   factor, aIF-2BI family; eIF-2B alpha/beta/delta-related
FT                   uncharacterized protein; PFAM: Initiation factor 2 subunit
FT                   family; TIGRFAM: eIF-2B alpha/beta/delta-related
FT                   uncharacterized proteins; S-methyl-5-thioribose-1-phosphate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35839"
FT                   /db_xref="GOA:D5E9I8"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR027363"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9I8"
FT                   /protein_id="ADE35839.1"
FT                   /translation="MRTIQWNAENSTVRMIDQTLLPVEYREIECENLAQLCEAIKSLRV
FT                   RGAPALAAAGAYGIALASKLSSANDMESLLQDLKNATGIILATRPTAINLGWGVHRVIK
FT                   AVSEAYDTEGIRDIALNEAQAIADEDVQTNKTLGKHGASLLEDGDTVMTHCNAGRLACV
FT                   DWGTALGVVRSAVEQGKDINVVACETRPLNQGGRLTTWELMQDNIPVKLISDSMSGYVM
FT                   RHELVDKVIVGADRITEDAVFNKIGTYSHAIVAMEHEIPFYVAAPASTFDFKGWEDSVK
FT                   IEERDPDELRYMQGVQIAPEDVPVINPAFDSTPMEYIEAIITEKGIFRPPFLIDEVRT"
FT   gene            325311..327134
FT                   /locus_tag="Mmah_0308"
FT   CDS_pept        325311..327134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0308"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="COGs: COG1078 HD superfamily phosphohydrolase;
FT                   InterPro IPR006674:IPR003607; KEGG: geo:Geob_0579 metal
FT                   dependent phosphohydrolase; PFAM: metal-dependent
FT                   phosphohydrolase HD sub domain; SMART: metal-dependent
FT                   phosphohydrolase HD region; SPTR: Q12U82 Metal-dependent
FT                   phosphohydrolase; PFAM: HD domain; TIGRFAM: uncharacterized
FT                   domain HDIG"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35840"
FT                   /db_xref="GOA:D5E9I9"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9I9"
FT                   /protein_id="ADE35840.1"
FT                   /translation="MVSSRAIHDPVHKTILLTPLQKELVETPQLQRLRSIQQLGLVDIV
FT                   YPGAKHSRFEHSLGTMHMASLMADALSLPQEDKVKVEVAGLLHDVGHSAYSHAVEDVLK
FT                   RNPDINPQYGGIIRENHEAFSEYVIRNCFAGNGNIARKVEEELGQDPVDFFDQIALMAT
FT                   GKSSFLEKPYLGQLISGDIDADRIDFLLRDSYHTGLSLGLIDVDQIIQNLSIRNGNIVL
FT                   GKKDGCSYDEDMTLTVAESMLIARTHHYNAIVHHPHTQSARIMLLRSLENALAMFGEKK
FT                   DAESVNDEVGLFFTEYNDADLLYFIKTYGNDQAQRLISSVLAGNICDPIVRFNQKNLNP
FT                   ATRMALSTIARHGVAKKMFEEQLEKRIGDVFVDLSVASGVPRSTRVVVNGEDSFFYDES
FT                   ALANGLVRAISRQLSLVVFSPVDGIGCPEAAQLKDVVGHTVETLSPQLLRFIRQENYLP
FT                   VEGLILLFYTVNSIFWKEEGGFVSIPRLRNITWIYRMVQRFSEDVRLRNLFDYNFHCNY
FT                   GFPYSNRVFEDIQLLVAMGIVDEDLRYYEKDNRFHQRYEYVLTMHGVKYGKQLSEAYSR
FT                   EFRELTKVLRQDKHSIPRDIVTIPARRYQQP"
FT   gene            327144..327896
FT                   /locus_tag="Mmah_0309"
FT   CDS_pept        327144..327896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0309"
FT                   /product="tRNA methyltransferase complex GCD14 subunit"
FT                   /note="COGs: COG2519 tRNA(1-methyladenosine)
FT                   methyltransferase and related methyltransferase; InterPro
FT                   IPR014816:IPR016130; KEGG: dde:Dde_0539
FT                   protein-L-isoaspartate methyltransferase-like; PFAM: tRNA
FT                   methyltransferase complex GCD14 subunit; SPTR: Q12U81
FT                   Putative methyltransferase; PFAM: tRNA methyltransferase
FT                   complex GCD14 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35841"
FT                   /db_xref="GOA:D5E9J0"
FT                   /db_xref="InterPro:IPR014816"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9J0"
FT                   /protein_id="ADE35841.1"
FT                   /translation="MKENETVLLRTRHKDKFREYLTTVSGKQFHCEFGIVETAELRDIE
FT                   PGGTIVSHMGQQFSVIRPRAPDMFRLAKRTGAPIMPKDVGQIISHAGINSSDRILEAGT
FT                   GSGVLAIYLGSVAKEVISYEIREDFVENARANLSMAGLSNVEVRCGDIVDVMRQGTDFF
FT                   DAIVLDIKDSAESVKYACSSLLDGGFLVVYSPFIEQAKAVYLEAVGAGFYSVHTLECME
FT                   RELSVSERGTRPAPARVGHTGYLTFARK"
FT   gene            328023..329501
FT                   /locus_tag="Mmah_0310"
FT   CDS_pept        328023..329501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0310"
FT                   /product="cysteine-rich small domain protein"
FT                   /note="COGs: COG0079 Histidinol-phosphate/aromatic
FT                   aminotransferase and cobyric acid decarboxylase; InterPro
FT                   IPR007212:IPR004839; KEGG: ppd:Ppro_0869 putative
FT                   L-threonine-O-3-phosphate decarboxylase; PFAM:
FT                   cysteine-rich small domain; aminotransferase class I and
FT                   II; SPTR: Q12UB3 L-threonine O-3-phosphate decarboxylase;
FT                   PFAM: Aminotransferase class I and II; Cysteine-rich small
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35842"
FT                   /db_xref="GOA:D5E9J1"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR007212"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9J1"
FT                   /protein_id="ADE35842.1"
FT                   /translation="MSGKGLWKKSVESIRKPLEDGHRIALEKGISETAIIDFSSTSNPM
FT                   GSPFDHPGCKLCLEDLFSRVGSMYSHFHDNEYSELRASAAKYFGKNISADNIVPALGVE
FT                   DVIRMVSSSVIETGDTVILSRSQNPANEKHCIISGGEVRYVFEEDFKNISSDVLNKAKI
FT                   ILLTNPDNLSGQLYSKKDLISLLQRCNVHSTLLVVDESLLDLTDVSATLVDEVPSVTNL
FT                   LVIRSLKNTFSLPGAGISFGITDVDFATILNRVRNCCNIGPMDEAVALSLLDMPSDIAN
FT                   DYLTASRQFVRENRQYLMERLGKVRRFIPHESNTSFVLVDVSAASLDSVELTHRLAEKG
FT                   LLVRDCSCFYSMDRNFIRVSVRPKEDTDRLVEAIGTVVVDSARDSAMENLNQILDEEPV
FT                   RPLGANTACPYYPCHFKGQDCTFCFCPFYPCGDERTGGRWVCRSSGGRVWSCEKCGLVH
FT                   KKQNVQKLLDVLKGEGEMEDKLKKAWDEVMEPLL"
FT   gene            329498..330502
FT                   /locus_tag="Mmah_0311"
FT   CDS_pept        329498..330502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0311"
FT                   /product="adenosylcobinamide-phosphate synthase"
FT                   /EC_number="6.3.1.10"
FT                   /note="COGs: COG1270 Cobalamin biosynthesis protein
FT                   CobD/CbiB; InterPro IPR004485; KEGG: scl:sce0211
FT                   adenosylcobinamide-phosphate synthase; PFAM: cobalamin
FT                   biosynthesis protein CbiB; SPTR: Q12UB2
FT                   Adenosylcobinamide-phosphate synthase; TIGRFAM: cobalamin
FT                   biosynthesis protein CobD; PFAM: CobD/Cbib protein;
FT                   TIGRFAM: cobalamin biosynthesis protein CobD"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35843"
FT                   /db_xref="GOA:D5E9J2"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9J2"
FT                   /protein_id="ADE35843.1"
FT                   /translation="MMDFIFAGYMHMIYVLLFAVLIDLAVGEPPARLHPVVWIGTLIGI
FT                   FKKYIPSSGRKAYGVFMGLSCILFASLIAYIVLLVSSQSLVPELVGIVIEAYFLKSTFA
FT                   IRRLLFAGEEVASSLEVGALEEARKQLSMYVSRDTSKLSGSHVSSAAIETVSENYVDSI
FT                   LSPLFYYSVAGPFGLIAAYAFKAVSTLDSMVGYRDEAHRDVGFFSAKLDDVLNWVPARI
FT                   SLFFIWLAVFFLNIMPKTMSFDPSGACSCSTNDCKVPDSPNSGYPMAAVAGAIGVKLEK
FT                   PGVYVLGQGLASPGAESIKKANRLVEGAALISIACFSLVIYVFTNFIWKLYII"
FT   gene            330516..331103
FT                   /locus_tag="Mmah_0312"
FT   CDS_pept        330516..331103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0312"
FT                   /product="alpha-ribazole phosphatase CobZ"
FT                   /note="COGs: COG1267 Phosphatidylglycerophosphatase A and
FT                   related protein; InterPro IPR007686:IPR017577; PFAM:
FT                   phosphatidylglycerophosphatase A; SPTR: Q12UB1 Putative
FT                   uncharacterized protein; TIGRFAM: alpha-ribazole
FT                   phosphatase CobZ; PFAM: Phosphatidylglycerophosphatase A;
FT                   TIGRFAM: alpha-ribazole phosphatase CobZ"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35844"
FT                   /db_xref="GOA:D5E9J3"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR017577"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9J3"
FT                   /protein_id="ADE35844.1"
FT                   /translation="MKLSDVESRNIKGEQPEEADTGYTYDIMDILKEEGITEEVLVEAS
FT                   MGLYTPHPGIETREKAEALFIRELRLAISDPNLCMLIYSGILLEREGRNGTLPNISRDS
FT                   YERDLTFLIADEVLGMSISKYISGDKGMFEFVRFDKQKPGILAELGPFMDDVIGGLIGG
FT                   VSANMYTRGMAEIGKSKNKDDDEKHGGGVIAG"
FT   gene            331100..331927
FT                   /locus_tag="Mmah_0313"
FT   CDS_pept        331100..331927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0313"
FT                   /product="cobalamin-5'-phosphate synthase"
FT                   /EC_number="2.7.8.26"
FT                   /note="COGs: COG0368 Cobalamin-5-phosphate synthase;
FT                   InterPro IPR003805; KEGG: gur:Gura_4186 cobalamin
FT                   5'-phosphate synthase; PFAM: cobalamin-5-phosphate synthase
FT                   CobS; SPTR: Q12UB0 Cobalamin synthase; TIGRFAM: cobalamin
FT                   5'-phosphate synthase; PFAM: Cobalamin-5-phosphate
FT                   synthase; TIGRFAM: cobalamin 5'-phosphate
FT                   synthase/cobalamin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35845"
FT                   /db_xref="GOA:D5E9J4"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9J4"
FT                   /protein_id="ADE35845.1"
FT                   /translation="MSGLLLAVRTGFGFLSTIPVGITMEGLDELVKRSYLFVFTGIVLG
FT                   LLIGMFTGIVEYVFPANISAALVIVFIYYLTGLNHLDGLADFGDGCTAHGSLEKKIKAL
FT                   KDMSLGIGGVAYCVIGLILLYASISSLQQQIYITGTISSLPQWTLLPLSLLVAEIGAKQ
FT                   GMLTIAAFGKSIHEGLGSMVIDKTDVGKYLAGLAMGGVVSVLSLGLIGLIGFVAAILGA
FT                   FGVLNVSNRHFGGVNGDCIGTANEIARLTSLIAITLALIAINAGYGGLSWMLL"
FT   gene            331912..332529
FT                   /locus_tag="Mmah_0314"
FT   CDS_pept        331912..332529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0314"
FT                   /product="adenosylcobinamide-phosphate guanylyltransferase"
FT                   /EC_number="2.7.7.62"
FT                   /note="COGs: COG2266 GTP:adenosylcobinamide-phosphate
FT                   guanylyltransferase; KEGG: swp:swp_4982
FT                   molybdopterin-guanine dinucleotide biosynthesis protein;
FT                   SPTR: Q12UA9 Putative nucleotidyltransferase; PFAM:
FT                   Uncharacterized protein family UPF0007; TIGRFAM: conserved
FT                   hypothetical protein TIGR00454"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35846"
FT                   /db_xref="GOA:D5E9J5"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9J5"
FT                   /protein_id="ADE35846.1"
FT                   /translation="MDAFIMAGGQGLRLGMGEKPCVDILGKPMICYVVDALEESESIGD
FT                   VYVTVSPFTPHTEEVIENRYGGNVKTIDTAGDNYVGDMVYAVEQANVAEPLMVIMSDLP
FT                   LITADLIDSIVEEYYRCGKPSMSVFIPLSLCKKVGLRPDTVFNWSGNLIVPTGINILDG
FT                   SKIREEQEYYNYLLEDPEVALNVNTAEDLQRCTDILEKRQNK"
FT   gene            332543..332938
FT                   /locus_tag="Mmah_0315"
FT   CDS_pept        332543..332938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0315"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q12UA8 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35847"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9J6"
FT                   /protein_id="ADE35847.1"
FT                   /translation="MTNCVNIKGKDYSLETLRLIVGTQNLDLTNSFAEEYLLLCEVVDN
FT                   PFILPFFLEKFYTMDIKDPENFRLALWRVQVDSDLRLGEDISKHQQRSYVTRTLEKLLF
FT                   SEVLLEVVTEPDTSDGSGFLLTSGEDT"
FT   gene            333059..333787
FT                   /locus_tag="Mmah_0316"
FT   CDS_pept        333059..333787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0316"
FT                   /product="putative circadian clock protein, KaiC"
FT                   /note="COGs: COG0467 RecA-superfamily ATPase implicated in
FT                   signal transduction; InterPro
FT                   IPR014774:IPR015140:IPR010624; KEGG: ade:Adeh_3181 putative
FT                   circadian clock protein, KaiC; PFAM: Circadian clock
FT                   protein KaiC central region; KaiA binding; SPTR: Q12UA7
FT                   KaiC; PFAM: KaiC"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35848"
FT                   /db_xref="GOA:D5E9J7"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9J7"
FT                   /protein_id="ADE35848.1"
FT                   /translation="MEETAIPERVSTGISGLDEMLKGGYFKGTANVVSGKSGTGKTIFG
FT                   SQFIYEGAKNGEKVMCIITSEESKSIVREMKASFDWDFKKLEDDGLLSFVDITDPGLRL
FT                   QKSVEIAPSELIKSFKKLIESKLDEVQPQRVFIDSIEALFLAIESNYKLRTLIDDVFGV
FT                   LRSREVTSVISVGKMFDLDAMVEYGADSVIKLERVRVGNNLQRTIFVMKLRGSSTINEV
FT                   RVLNISDNGMSVLAQSPYLE"
FT   gene            complement(333799..334476)
FT                   /locus_tag="Mmah_0317"
FT   CDS_pept        complement(333799..334476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0317"
FT                   /product="DNA repair and recombination protein RadB"
FT                   /note="COGs: COG0468 RecA/RadA recombinase;
FT                   InterProIPR001553:IPR004504:IPR013632:IPR003593:IPR
FT                   020588:IPR011939; KEGG: DNA repair protein rad51; PFAM:
FT                   Rad51 domain protein; SMART: AAA ATPase; SPTR: Q12U80 DNA
FT                   repair and recombination protein radB; TIGRFAM: DNA repair
FT                   and recombination protein RadB; PFAM: Rad51; TIGRFAM: DNA
FT                   repair and recombination protein RadB"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35849"
FT                   /db_xref="GOA:D5E9J8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011939"
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9J8"
FT                   /protein_id="ADE35849.1"
FT                   /translation="MCNITDLLTSGCKPIDELLGGGFEPGVVTQIYGESGSGKTNLCLQ
FT                   LAVYCVNNNKKAILVDTEAISPERFRQIAGENAREIAQNIIIYEPHSFEEQYSAIHEIE
FT                   KISAQNIGLIIVDSATAYYRFGLEDEEKSIRTRRELANQIGYLHGLARKRGIVVVITNQ
FT                   VYSDIGTGKLKPVGGSTVEHMSKTIIQLERTGENKRKANLLKHRSRPEGLSREFTITQE
FT                   GLK"
FT   gene            334809..335063
FT                   /locus_tag="Mmah_0318"
FT   CDS_pept        334809..335063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0318"
FT                   /product="glutaredoxin"
FT                   /note="InterPro IPR002109; KEGG: ech:ECH_1062 glutaredoxin
FT                   3; PFAM: glutaredoxin; SPTR: Q12U79 Glutaredoxin-like
FT                   protein; PFAM: Glutaredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35850"
FT                   /db_xref="GOA:D5E9J9"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9J9"
FT                   /protein_id="ADE35850.1"
FT                   /translation="MSEIIVYTTDVCPKCARLKATLKENNVQFEEADMTSAEALTELRI
FT                   NGVFTSEAPVLQIGDDFLTSDNIFKGSDVDMDVLQDWIY"
FT   gene            335082..337463
FT                   /locus_tag="Mmah_0319"
FT   CDS_pept        335082..337463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0319"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /note="COGs: COG1328 Oxygen-sensitive
FT                   ribonucleoside-triphosphate reductase; InterPro
FT                   IPR005144:IPR012833; KEGG: sat:SYN_01979 anaerobic
FT                   ribonucleoside-triphosphate reductase; SPTR: Q12U78
FT                   Ribonucleoside-triphosphate reductase, anaerobic; TIGRFAM:
FT                   anaerobic ribonucleoside-triphosphate reductase; TIGRFAM:
FT                   anaerobic ribonucleoside-triphosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35851"
FT                   /db_xref="GOA:D5E9K0"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9K0"
FT                   /protein_id="ADE35851.1"
FT                   /translation="MDSMAEEIEKKVKNTDISGVPEDTTTSSNIVEKTSESSPRQQTLD
FT                   GSFVSIMPKVRTTDGHMVEWDRNIVVNQLLKETSLSERFHGIPAVTRDEALVIAKETEK
FT                   RIRSMNLRFLSGPLIREVVNMVLIERNDVEWRNISTRVGTPVYDACEIDMGTGFEAKEN
FT                   ANLQENAETSHKKKADKISKEQYLLLLPPKLSDLHLNGDLHIHDLEYMGTRAFCQDWDL
FT                   RYFFYYGLMPDGSGAKASVAGPAMKAEVAVLHAVKALGSAQTNFAGGQGFYNFLTFLAP
FT                   FLEGKSYKEIEQLMQMFVYEMTQMMVARGGQLVFSSVQLSPGVPKLWRDKPAVYRGRVW
FT                   DGSDGSDVRVYGEYEREVRLGFQALMNVMLEGDYWGKPFNFPKPEISIEPDFMEEDEMF
FT                   NRAHPELPTYDDLYNLTFELTAKFGTPYFDNQLPPYRGAGEGISCYQCCAYQFSANAED
FT                   DDEFEEKLNFTDGKHFSMGSWQVVSLNCPRAAYEAQGDDKELFARLKGLMDRAIEVFHT
FT                   KLKWMTPIIESGRMPFATQQPKDPVTGKKGAVAVDMDSLVFTIGVVGINEMVQYHTGSQ
FT                   MHESKEAFKVAVRAMTEMEMHARKISEEHGIEIALARTPAETTCQRFGVSDLLHDEYRE
FT                   KAASVLKGDVESSVSRLKETHDLPVYYTNGTHAPPGADLSLMERINVEHVFFPIVDGGN
FT                   IMHIWLGEGSPDAKGLKDFTMHLARNTQTGYFAFTKDMTVCMNDFHMMSGLQDCCENCN
FT                   SDNVEHLSRVTGYIQSVGGWNAAKKQELADRMRYGSPDMR"
FT   gene            337441..338259
FT                   /locus_tag="Mmah_0320"
FT   CDS_pept        337441..338259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0320"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /note="COGs: COG1180 Pyruvate-formate lyase-activating
FT                   enzyme; InterPro IPR007197:IPR012840; KEGG: pca:Pcar_2732
FT                   pyruvate-formate lyase-activating enzyme; PFAM: Radical SAM
FT                   domain protein; SPTR: Q12U77 Ribonucleoside-triphosphate
FT                   reductase, anaerobic-like protein; TIGRFAM: anaerobic
FT                   ribonucleoside-triphosphate reductase activating protein;
FT                   PFAM: Radical SAM superfamily; TIGRFAM: anaerobic
FT                   ribonucleoside-triphosphate reductase activating protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35852"
FT                   /db_xref="GOA:D5E9K1"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012840"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9K1"
FT                   /protein_id="ADE35852.1"
FT                   /translation="MAPRTCVKDFEVNFGDYVPLSTLDWPGKASVVFFLRDCPFRCPYC
FT                   QNYSILNGYELVESSQIRQLMETSRPFVSSVVISGGEPLQQEKAVSGIAQMARDMGLLV
FT                   GIHTNGVHTDVLEDLIENELVDGVFIDVKASLENAEDYGRMIGYGSYPAVTISPLDAVN
FT                   NVQRSIKMAAENKLLQELRTTVLPGFMDKPEDIESIASSIVKCAGRDIPYFIQQGETEH
FT                   SMDRNLRELSPLSRDELLSLGNAATPFLNNVCIRTGKNGTEKITSNQSVA"
FT   gene            338567..339451
FT                   /locus_tag="Mmah_0321"
FT   CDS_pept        338567..339451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0321"
FT                   /product="thiamine-phosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /note="COGs: COG0611 Thiamine monophosphate kinase;
FT                   InterPro IPR010918:IPR000728:IPR006283; KEGG: dal:Dalk_0686
FT                   thiamine-monophosphate kinase; PFAM: AIR synthase related
FT                   protein; AIR synthase related protein domain protein;
FT                   PRIAM: Thiamine-phosphate kinase; SPTR: Q12U75
FT                   Thiamine-monophosphate kinase; TIGRFAM:
FT                   thiamine-monophosphate kinase; PFAM: AIR synthase related
FT                   protein, N-terminal domain; AIR synthase related protein,
FT                   C-terminal domain; TIGRFAM: thiamine-monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35853"
FT                   /db_xref="GOA:D5E9K2"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9K2"
FT                   /protein_id="ADE35853.1"
FT                   /translation="MTAVLEFGGEYLVVTTDMLHQKTDFPDTMTPWQIGWMAAAVNFSD
FT                   IAAMGGQPLGLLAAVGYPQNMSLEDAGEIARGMRDCAEFCGTSVIGGDVDSHEELTVTG
FT                   TAMGRVSKEELLTRKGAKPGDLLCVTATLGGAGAALEAYLKNMNVDDDFMKPLLEPVPR
FT                   IAEGRKLAKSGAVTSAMDTSDGLALSLYDLASVNKVGFVLKEESLPIDKRVFEIATSKK
FT                   EALEMALYSGGDFELLVTVSKDKFKALQAESYLTVVGEVVDIDGAISLIGKDGANFAID
FT                   RKGYLHMGTSDQI"
FT   gene            339473..343273
FT                   /locus_tag="Mmah_0322"
FT   CDS_pept        339473..343273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0322"
FT                   /product="S-layer-related duplication domain protein"
FT                   /note="InterPro IPR006457:IPR003961; KEGG: pub:SAR11_0932
FT                   hypothetical protein; PFAM: S-layer-related duplication
FT                   domain; SMART: Fibronectin type III domain protein; SPTR:
FT                   Q12U74 S-layer-related duplication domain; PFAM: Protein of
FT                   unknown function (DUF1608); TIGRFAM: glutamate--cysteine
FT                   ligase/gamma-glutamylcysteine synthetase, Streptococcus
FT                   agalactiae type; S-layer-related duplication domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35854"
FT                   /db_xref="GOA:D5E9K3"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR006457"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9K3"
FT                   /protein_id="ADE35854.1"
FT                   /translation="MKTGFKILLIGFMIIGMGCGVAAAESAPNASVTNVSSDVDSATID
FT                   FNVNQSDASTRIAYGISNSLSSWSDWNYEDSNSRSIVLSELNDGTMYYYSVYAYNGTND
FT                   SFVYNTTISTFNTDSPTAPNASVTNVSSDVDSATIDFNVNQSDASTRIAYGISNSLSSW
FT                   SDWNYEDSNSRSIVLSELNDRTMYYYSVYAYNGTNDSFVYNTTIATLNTTSPTAPNASV
FT                   TNVSSDVDSATIDFNVNQSDASTRIAYGISNSLSSWSDWNYEDSNSRSIVLSELNDGTM
FT                   YYYSVYAYNGTNDSFVYNTTIATLNTTSPTAPSISDISSSNIGGDRATINYVVNQSDAP
FT                   TRIAYGTSSDLSSYEWSGWFNDSTVHNETISNLNGSTKYYYSIYAYNESNNSVFYNSSI
FT                   ESFTTISNWGDRIWDEKANQSNKYTWDGRSFSGFYYDLDTGDTSESMTITIDGRRIDDG
FT                   DLVYTTKPIDKEFEFGSWGEYQIIGFMAERYFAGYSVNTSSDVTGDDVSLISDGVLSKV
FT                   LIDTDDDESVYSGSSLTLEEGYSLNIKQVDVNGDSVWISLTKDGDEVDDAILSSDETYV
FT                   YEKDLGGVDDVPVIAVHIDDVFSGTETNAVFIDGIFQISDDYVEVDRGDEFGEMEVTSL
FT                   SSTEIKMENEDSISLDEGDIIDIMGKLKFIVADDNDVLRFAPFVDMSEPGTYELRGTIA
FT                   EDEGFSWTPLNFEGFYYDIDEGLRSESLNVTNYNGRNIDAGDLIYKSTPVEVEFEYGPW
FT                   GKYNVIGFMAEKYFAGYSGDTSDDITDDTISLMSSGQLSKVLIDDDDEKSVYTGSSLIL
FT                   EEGYALNIREIDVNGDRVMIQLTQDGDNIESAIVSSDDEYVYEKDVGDEDDVPIIVVHF
FT                   NEIFSGTETSAVFVEGIFQISEDYLEVEDGDDFGVMTVDSTSGSIILENEDNIDLDEGD
FT                   TIDIMGEIKFKVADDSSTVRYYPFVEVETKPYDSLDIDIEPTTVVEGDEITFTVTSRGA
FT                   AIRDASILIHGDRVGITSDEGVFEYDADDAGKFTATAEKEGYVSSKGNFEVISPDDESK
FT                   KISIEVSPEEVFEGTPITISVVKAIGSEPLEGAEVFFDGKSLGETDEDGTITYNPKEPG
FT                   THKIEAKVDGYLDAELNIKVNELAANFEFSNLRIDPLPATAGEEFTVMLDSINTGNAEG
FT                   SYTVELSINDNVVDSQEITLGQNNSTTIEFTSTAGEPGTYLVKAGGLSTTMDVEEGTSI
FT                   VWYVLGGLVLVLGGGAAYIFATGGTAKFAEIAESLRSRLGR"
FT   sig_peptide     339473..339544
FT                   /locus_tag="Mmah_0322"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(343314..343841)
FT                   /locus_tag="Mmah_0323"
FT   CDS_pept        complement(343314..343841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0323"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="COGs: COG4800 transcriptional regulator protein with
FT                   an HTH domain; InterPro IPR001387; SMART: helix-turn-helix
FT                   domain protein; SPTR: Q12U73 Transcriptional regulator, XRE
FT                   family; PFAM: Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35855"
FT                   /db_xref="GOA:D5E9K4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR016472"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9K4"
FT                   /protein_id="ADE35855.1"
FT                   /translation="MSIADKVIESAFESDEAFQHTLLKVIKEDLGLTAIEFSEHSSIPP
FT                   STLYKLMSGNREPNLRTMRQIVKTIKKLEGYEGGEFIAVIASRPVLDNIKETKRKIHGN
FT                   LCTIREYAATSMEEAIIAAVRAEREGARALVCAPIVSPTVEKIIKIPVSTIMPRDSLLE
FT                   AIENVARKMEME"
FT   gene            344012..345022
FT                   /locus_tag="Mmah_0324"
FT   CDS_pept        344012..345022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0324"
FT                   /product="aliphatic sulfonates family ABC transporter,
FT                   periplasmic ligand-binding protein"
FT                   /note="COGs: COG0715 ABC-type nitrate/sulfonate/bicarbonate
FT                   transport systems periplasmic components; InterPro
FT                   IPR010067; KEGG: csa:Csal_0183 ABC-type
FT                   nitrate/sulfonate/bicarbonate transport systems periplasmic
FT                   components-like protein; SPTR: Q8TUK2 Sulfonate ABC
FT                   transporter, solute-binding protein; TIGRFAM: aliphatic
FT                   sulfonates family ABC transporter, periplsmic
FT                   ligand-binding protein; PFAM: NMT1/THI5 like; TIGRFAM: ABC
FT                   transporter, substrate-binding protein, aliphatic
FT                   sulfonates family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35856"
FT                   /db_xref="GOA:D5E9K5"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9K5"
FT                   /protein_id="ADE35856.1"
FT                   /translation="MKKISKILFLILVVAGSVFLAGCASQDGDGTEEAADVTTLNIGYQ
FT                   PSTHQLSYMTAREKGWWEEDLASYGVEEVKEYEFPTGAPEMQAMLAGDLDVAYVGAAPF
FT                   ISALSNGLDAKVVAGVNSQGSDLVLRPEHSYEGPEDLKGLSIATFPPGTIQDTILRDWL
FT                   KDNGVDPDDDVDIKPMGPGDAISAISAGQIDAAFLPHPAPTLIEQEGNGRSVVYSGEML
FT                   PDHACCVLVVSGNLIRNHPEMVTEIVNTHIKATDYNLENQDEAAQIFAERQGWEVNVVR
FT                   TSIDEWDGQWIADPAIIADSTVDYAQVQYELGYVNEKFTREDIFDMSFYELAITE"
FT   sig_peptide     344012..344086
FT                   /locus_tag="Mmah_0324"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            345107..345886
FT                   /locus_tag="Mmah_0325"
FT   CDS_pept        345107..345886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0325"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG0600 ABC-type nitrate/sulfonate/bicarbonate
FT                   transport system permease component; InterPro IPR000515;
FT                   KEGG: dal:Dalk_1379 binding-protein-dependent transport
FT                   systems inner membrane component; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: Q12U71 ABC nitrate/sulfonate/bicarbonate
FT                   transporter, inner membrane subunit; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35857"
FT                   /db_xref="GOA:D5E9K6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9K6"
FT                   /protein_id="ADE35857.1"
FT                   /translation="MKTKPVSKKGIEIISLVTAIILWQLLADLVIGNTFILPSFTDVVY
FT                   AFITIIERGVLFTDLTISLLHFGIGIISALVIGVPIGIAMGWFHNADRVADPLIEIVRP
FT                   IPPLAWIPFAIVWFGLTHISAGFVVFVGAVFPIIINTLTGFKSVSKVYVEAGKVLGCMK
FT                   STSLIRYIALPYSLPSIAAGIRIAMGVGWMCLVAAEMFGVSKNGLGYKIWWHYYLHQMD
FT                   FVLVYMLILGFLGLLIDRVFRWYVDGKLLKWRKGVVV"
FT   gene            345887..346642
FT                   /locus_tag="Mmah_0326"
FT   CDS_pept        345887..346642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0326"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1116 ABC-type nitrate/sulfonate/bicarbonate
FT                   transport system ATPase component; InterPro
FT                   IPR003439:IPR003593:IPR017871; KEGG: sat:SYN_00367 sulfate
FT                   transport ATP-binding protein; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase; SPTR: Q12U70 ABC
FT                   nitrate/sulfonate/bicarbonate transporter, ATPase subunit;
FT                   PFAM: ABC transporter; TIGRFAM: nitrate transport
FT                   ATP-binding subunits C and D"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35858"
FT                   /db_xref="GOA:D5E9K7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9K7"
FT                   /protein_id="ADE35858.1"
FT                   /translation="MGRLVIENVGQSFEKDKGESTDALKDVNFEVKDGEFVCIIGPSGC
FT                   GKTTLLRIVAGLDRADSGRILLDGETITSPDPRRGMVFQEYSLFPWRTVIDNVTFGLDM
FT                   SGMDRKESRKIAEEYLRLVGLEQFRDSYPYELSGGMRQRIAIVRALANDPAVLLMDEPF
FT                   GSLDAQTRNKLQQELLQIWESKKITILFVTHSVDEAVYLSDRIAVMTSRPGRIKEMVDV
FT                   DLPRPRDRTSISANKLRNRLLKMLAEENK"
FT   gene            complement(346644..347084)
FT                   /locus_tag="Mmah_0327"
FT   CDS_pept        complement(346644..347084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0327"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; K03240 translation
FT                   initiation factor eIF-2B epsilon subunit; SPTR: Q12U69
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function, DUF583"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35859"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9K8"
FT                   /protein_id="ADE35859.1"
FT                   /translation="MNEDNENIMKFHPQSNTYILRKKSYFEQNISLDGNLITGSDTNFW
FT                   KNLKVAGNVELGKGTVVRGNLHAEEVILGPNCRVDGDIYASRNATLLDRCTIGGHAITD
FT                   GWMKVRPGCNIKFVRAKKELELIGKVNVESIESGTKVIVHSE"
FT   gene            complement(347127..347882)
FT                   /locus_tag="Mmah_0328"
FT   CDS_pept        complement(347127..347882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0328"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q12U67 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35860"
FT                   /db_xref="GOA:D5E9K9"
FT                   /db_xref="InterPro:IPR001330"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9K9"
FT                   /protein_id="ADE35860.1"
FT                   /translation="MKNSIKNLSRKPGDCKIQAKEIKYKDAARRGLDWLDESQPVTLKE
FT                   YARSTTASYHWGRGYTRTSTLIREIHRPQSFREICRGASALATMGIYYPAVTHYIKTKQ
FT                   NNGNLEDIYDRTYALIALADLEVPCPGECQKIIKDFDSTWEHPGTIALIIICLIKQSEL
FT                   TGKDYTDFIREKTDWLLSRVQENGGWKFIATSNLVLQALIMAGRSGEIDQSIRWLLKKQ
FT                   NDNGSWGKNNGDITATAQSLITLALYINA"
FT   gene            complement(347836..348534)
FT                   /locus_tag="Mmah_0329"
FT   CDS_pept        complement(347836..348534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0329"
FT                   /product="protein of unknown function DUF169"
FT                   /note="COGs: COG2043 conserved hypothetical protein;
FT                   InterPro IPR003748; KEGG: glo:Glov_0919 protein of unknown
FT                   function DUF169; PFAM: protein of unknown function DUF169;
FT                   SPTR: Q8PY80 Conserved protein; PFAM: Uncharacterised ArCR,
FT                   COG2043"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35861"
FT                   /db_xref="InterPro:IPR003748"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9L0"
FT                   /protein_id="ADE35861.1"
FT                   /translation="MENKEISDKLKEILQLRYEPVAVKLVKRGEDVPANFNQPEKKTRH
FT                   CQSIMKARKGECLVIPADKHACVVGGSSLGLLETPDNVKSGEFHSKIGMFDTPQAAAKM
FT                   IEERAEFEECSMQATVVCPLAKADFKPDVVILIDLPETLYWIVPAFTFETGGRVTMSTA
FT                   PFQATCVDSTIIPIQTGDINYSMGCFGCRRTTDIGRDEMLVGIPGPILENIVEHLEELY
FT                   KKPIKKARGL"
FT   gene            complement(348569..349402)
FT                   /locus_tag="Mmah_0330"
FT   CDS_pept        complement(348569..349402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0330"
FT                   /product="ATPase-like, ParA/MinD"
FT                   /note="COGs: COG0489 ATPase involved in chromosome
FT                   partitioning; InterPro IPR019591:IPR002586:IPR000808; KEGG:
FT                   sat:SYN_00081 iron-sulfur cluster assembly/repair protein;
FT                   PFAM: ATPase-like, ParA/MinD; Cobyrinic acid ac-diamide
FT                   synthase; SPTR: Q12U65 ATP-binding protein involved in
FT                   chromosome partitioning; PFAM: ParA/MinD ATPase like;
FT                   Anion-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35862"
FT                   /db_xref="GOA:D5E9L1"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9L1"
FT                   /protein_id="ADE35862.1"
FT                   /translation="MSQNIQSAESLVNSKVEEPKIVSNLRGIRNKLMVMSGKGGVGKST
FT                   VSANLAAALARRGKKVGLLDSDIHGPSIPTMFGIADQRPEVGEKGILPVQVADNLKVMS
FT                   IGLLLDDPDSPVVWRGPAKMGAIKQFLEEVDWGVLDYLIIDLPPGTGDEPLSIVQLLGR
FT                   VDGAIVVTTPQDVALTSVRKSLKFAEMLEVPVIGMVENMSGVICPHCNEEIQVFGGESV
FT                   EKAAKDFNTPILATLPIEPDVSSTGDKGDVYVNDDKSIWKEKFDSIVSSVEEKFN"
FT   gene            complement(349417..349722)
FT                   /locus_tag="Mmah_0331"
FT   CDS_pept        complement(349417..349722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0331"
FT                   /product="protein of unknown function DUF134"
FT                   /note="COGs: COG1342 DNA-binding protein; InterPro
FT                   IPR002852; KEGG: ppr:PBPRA3114 hypothetical protein; PFAM:
FT                   protein of unknown function DUF134; SPTR: Q8TIB0 UPF0251
FT                   protein MA_4245; PFAM: Protein of unknown function DUF134"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35863"
FT                   /db_xref="InterPro:IPR002852"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9L2"
FT                   /protein_id="ADE35863.1"
FT                   /translation="MKCRRGRPKCPRRIRAEPTIMCFKPCGIPRSEVEVVELAFEELEA
FT                   IRLVDVDELTQEEAALEMGISRRAFWEELKNARKKVARALVEGQAIDIKGGNYTTE"
FT   gene            349835..350950
FT                   /locus_tag="Mmah_0332"
FT   CDS_pept        349835..350950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0332"
FT                   /product="ORC complex protein Cdc6/Orc1"
FT                   /note="COGs: COG1474 Cdc6-related protein AAA superfamily
FT                   ATPase; InterPro IPR003593:IPR014277; KEGG: similar to
FT                   AGAP005176-PA; K02213 cell division control protein 6;
FT                   SMART: AAA ATPase; SPTR: Q12U63 ORC complex protein
FT                   Cdc6/Orc1; TIGRFAM: orc1/cdc6 family replication initiation
FT                   protein; PFAM: ATPase family associated with various
FT                   cellular activities (AAA); CDC6, C terminal; TIGRFAM:
FT                   orc1/cdc6 family replication initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35864"
FT                   /db_xref="GOA:D5E9L3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR014277"
FT                   /db_xref="InterPro:IPR015163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9L3"
FT                   /protein_id="ADE35864.1"
FT                   /translation="MKNNMLLWDETIFRDPTVLELDYLPEQFMHRDSQLQSLIYSLKPA
FT                   VKGMRPINCLVYGPPGTGKTSAVLKVFEEIETHTSDVVLVKINCQMDSTRFAVVSRIYR
FT                   KLFNIDPPSSGVAFRKLFEKIVLKLIEKDKVMVVCLDDINYLFHGGHADEIMYSILRAH
FT                   EQYPGVKMGVIAIVSDTGKLYRFDPKVSSVFLPEEIEFPSYSYDEVGDIISSRIQLAFY
FT                   PEVVPEEVREKIVNYVDLTGDLRVGIDLLKRSGLNAEKRASKNISEDDVDKAYESSRLL
FT                   HLRRNISSLSDNEKEILRLVAENDEIKAGELYELFTGNNELGYTRFYGLVNKLKDSHYL
FT                   DVSFSGEGMRGRTRIIRLNYPADDVIKCIRG"
FT   gene            351000..351500
FT                   /locus_tag="Mmah_0333"
FT   CDS_pept        351000..351500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0333"
FT                   /product="putative transcriptional regulator, ModE family"
FT                   /note="COGs: COG2005 N-terminal domain of
FT                   molybdenum-binding protein; InterPro IPR000847:IPR005116;
FT                   KEGG: tdn:Suden_1537 ModE family transcriptional regulator;
FT                   PFAM: regulatory protein LysR; TOBE domain protein; SPTR:
FT                   Q12U62 Molybdenum-pterin binding domain; PFAM: TOBE domain;
FT                   Bacterial regulatory helix-turn-helix protein, lysR family;
FT                   TIGRFAM: ModE molybdate transport repressor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35865"
FT                   /db_xref="GOA:D5E9L4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9L4"
FT                   /protein_id="ADE35865.1"
FT                   /translation="MIGAGKVRLLKVIDEEKSLKKACEKLDISYKHAWNILKKMNLRIG
FT                   HDVVRTVRGGKEQGTFLTEYGRDLINQYEMNRDYVDRMVEEELSSENMGETNNIPGKVR
FT                   KVESSDGISRTQIEVESAVLTSIMGEKELGNLHLDEGDEVIATIRAVDIDVSPAKYTKY
FT                   GGE"
FT   gene            351533..352267
FT                   /locus_tag="Mmah_0334"
FT   CDS_pept        351533..352267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0334"
FT                   /product="exodeoxyribonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /note="COGs: COG0708 Exonuclease III; InterPro
FT                   IPR005135:IPR000097:IPR004808; KEGG: dde:Dde_0551
FT                   exodeoxyribonuclease III; PFAM:
FT                   Endonuclease/exonuclease/phosphatase; PRIAM: DNA-(apurinic
FT                   or apyrimidinic site) lyase; SPTR: Q12U61
FT                   Exodeoxyribonuclease III; TIGRFAM: exodeoxyribonuclease
FT                   III; exodeoxyribonuclease III Xth; PFAM:
FT                   Endonuclease/Exonuclease/phosphatase family; TIGRFAM:
FT                   exodeoxyribonuclease III; exodeoxyribonuclease III (xth)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35866"
FT                   /db_xref="GOA:D5E9L5"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9L5"
FT                   /protein_id="ADE35866.1"
FT                   /translation="MRAVAKKGFLEWLTSESPDILCLQETKARPSQLPPNIRRIDGYYS
FT                   YFSAAERKGYSGVALYSKVQPQEVRYGFGINRFDHEGRILIAFFDHFVLFNIYFPNGNS
FT                   SDERLQYKMDFYGAFLEYTQELRQEGYSVVVCGDLNTAHKAIDIARPKQNEKRSGFLPV
FT                   EREWIDKFLSHGFLDTFRLFNEEEGNYTWWDLKTRARDRNVGWRLDYFFVSADLKQGVK
FT                   EAFILSEVTGSDHCPVGLELDS"
FT   gene            complement(352318..354003)
FT                   /locus_tag="Mmah_0335"
FT   CDS_pept        complement(352318..354003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0335"
FT                   /product="thermosome subunit"
FT                   /note="COGs: COG0459 Chaperonin GroEL (HSP60 family);
FT                   InterProIPR017998:IPR001844:IPR002423:IPR002194:IPR 012714;
FT                   KEGG: hypothetical protein; K09496 T-complex protein 1
FT                   subunit delta; PFAM: chaperonin Cpn60/TCP-1; SPTR: Q12U60
FT                   Thermosome, Chaperonin Cpn60/TCP-1; TIGRFAM: thermosome;
FT                   PFAM: TCP-1/cpn60 chaperonin family; TIGRFAM: thermosome,
FT                   various subunits, archaeal"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35867"
FT                   /db_xref="GOA:D5E9L6"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012714"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9L6"
FT                   /protein_id="ADE35867.1"
FT                   /translation="MAGQMSGGQPIFILRDGNQRTRGRDAQSNNIMAAKAVAEAVRTTL
FT                   GPKGMDKMLVDSLGDVVITNDGATILKEMDIEHPAAKMIVEVSKTQDDEVGDGTTTAAV
FT                   ITGELLKKAEDMIEQDVHPTIIASGYRMAAEKAGELLKELAQDVTIDNRDTLINISNTA
FT                   MTGKGAEASKDVLSEIAVSAVASIVDKTDGETIDIDNIKVEKKVGGSIEDSELIEGMIL
FT                   DKERVHSNMPKKVTDAKIALINSAIELKETEVDAEISITSPDQLQSFLDQEEKMLKGLV
FT                   DKVVASGANVVFCQKGIDDMAQHFLAKEGIFAVRRVKKSDMEKLVRSTGGKLITNIEEM
FT                   TADDLGKTEAVEERKIAGDNMVFITGCVNPRSVSILLRGGTEHVVDNIERALHDALRVV
FT                   GVAIEDEKLVSGGGGPEVEVALQLQDYASSLSGREQLAVKAFAESLEVIPRTLAENAGL
FT                   DPIDMLVELRSHHEKGAKTAGLDVYSGKVIDMWDAGVVEPLRIKTQAINAAAEASVMIL
FT                   RIDDVIASSNPSPSGGGGEGGMPPGMGGGMPPGMGGMPPGMGGM"
FT   gene            complement(354167..354340)
FT                   /locus_tag="Mmah_0336"
FT   CDS_pept        complement(354167..354340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0336"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q46F68 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35868"
FT                   /db_xref="InterPro:IPR035258"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9L7"
FT                   /protein_id="ADE35868.1"
FT                   /translation="MGKTGSIEWVKIKGRKGNTIKVKKAKANKAHTAPAQRYSSAGTKR
FT                   RFKRRSQKAIVR"
FT   gene            complement(354453..355349)
FT                   /locus_tag="Mmah_0337"
FT   CDS_pept        complement(354453..355349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0337"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="COGs: COG2113 ABC-type proline/glycine betaine
FT                   transport systems periplasmic components; InterPro
FT                   IPR007210; KEGG: aeh:Mlg_0734 response regulator receiver
FT                   protein; PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; SPTR: Q8TNY0 Glycine
FT                   betaine/L-proline ABC transporter, solute-binding protein;
FT                   PFAM: Substrate binding domain of ABC-type glycine betaine
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35869"
FT                   /db_xref="GOA:D5E9L8"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9L8"
FT                   /protein_id="ADE35869.1"
FT                   /translation="MKYKLLKILACLIVAIALIGAGCTSQSDETPSEETTEEPVRIGVV
FT                   QWDDSRATGNVFLHILDEGGYEYETVSADLGGLYQATSQGDIDVLIQAWLPATQASYWD
FT                   QYGDSLNKAQVVSSGAKIGLAVPDYVYDSGITTVEDLKGNASKFDGKITGIEPGAGIMV
FT                   TTEQALEEYNLEEYELYSSSTVGMATTLQDNLDNEEWIVATLWRPHWTFARMEGLQFLE
FT                   DPKGIYGGSDNLVILTRPGFEEDRPEFYQLIQNYEMDLNDIESIMIAIDEGQSPEEAAS
FT                   DWLTENPEKYDEVLGTQ"
FT   sig_peptide     complement(355269..355349)
FT                   /locus_tag="Mmah_0337"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(355420..356316)
FT                   /locus_tag="Mmah_0338"
FT   CDS_pept        complement(355420..356316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0338"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="COGs: COG2113 ABC-type proline/glycine betaine
FT                   transport systems periplasmic components; InterPro
FT                   IPR007210; KEGG: csa:Csal_3102 substrate-binding region of
FT                   ABC-type glycine betaine transport system; PFAM:
FT                   Substrate-binding region of ABC-type glycine betaine
FT                   transport system; SPTR: Q2KP08 Glycine-betaine binding
FT                   protein (Fragment); PFAM: Substrate binding domain of
FT                   ABC-type glycine betaine transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35870"
FT                   /db_xref="GOA:D5E9L9"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9L9"
FT                   /protein_id="ADE35870.1"
FT                   /translation="MDNKYKAILVGILLVLSLFAAGCAQQGDEGDTDDGNQTQTEEKSV
FT                   TIAYVQWASAVATTNVVQEVFQKDGYEVELNNVAAGIMYQGIANGNADFSVCAWLPNTQ
FT                   ANYWEQYGGQIENVNVNTPNVKTGLVVPQYVDVDTIPELKGNESKFEGTITGIDPGAGI
FT                   MSQTDEAIQEYGLDGYTLQASSGPGMTSALTSAIADEEPIIVTLWNPHWAFARWDLKYL
FT                   DDPKDVYGSDDIVTIARPGLKEDKPQAYEILTRFKWTVTDNEKVMSYIDQGMSAEEAAE
FT                   KWVSDNPEKVNEWLGTE"
FT   sig_peptide     complement(356239..356316)
FT                   /locus_tag="Mmah_0338"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(356369..357199)
FT                   /locus_tag="Mmah_0339"
FT   CDS_pept        complement(356369..357199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0339"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG4176 ABC-type proline/glycine betaine
FT                   transport system permease component; InterPro IPR000515;
FT                   KEGG: dol:Dole_2764 binding-protein-dependent transport
FT                   systems inner membrane component; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: Q2KP09 Transmembrane protein; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35871"
FT                   /db_xref="GOA:D5E9M0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9M0"
FT                   /protein_id="ADE35871.1"
FT                   /translation="MIVPQLPLGSVVEAAVYWISDTFGFALDAFSGVFKFFIDIFKDVL
FT                   MAMPPLLFVVLLAVLAYVIGRKDWKLALGTALGFIVILSMDLWEYSMETIALVISSAAL
FT                   ALIIGIPLGILAAKSETLYRILRPILDLMQTMPSFVYLIPAVIFFGLGNVPGMIATVVF
FT                   SMPPAIRLTTLGITQVPTELVEVADAFGSTSWQKLIKVEIPVALKTIMAGVNQCIMLAL
FT                   SMVVIASMIGARGLGYQVLIGIQRVDIGLGFEAGLGIVIIAIVLDRLTQHLTPK"
FT   gene            complement(357196..358344)
FT                   /locus_tag="Mmah_0340"
FT   CDS_pept        complement(357196..358344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0340"
FT                   /product="glycine betaine/L-proline ABC transporter, ATPase
FT                   subunit"
FT                   /EC_number="3.6.3.32"
FT                   /note="COGs: COG4175 ABC-type proline/glycine betaine
FT                   transport system ATPase component;
FT                   InterProIPR000644:IPR003439:IPR003593:IPR017871:IPR 005892;
FT                   KEGG: mxa:MXAN_2249 glycine betaine/L-proline ABC
FT                   transporter, ATP-binding protein; PFAM: ABC transporter
FT                   related; CBS domain containing protein; SMART: AAA ATPase;
FT                   CBS domain containing protein; SPTR: Q2KP07 ATP-binding
FT                   protein; TIGRFAM: glycine betaine/L-proline ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter; CBS
FT                   domain; TIGRFAM: glycine betaine/L-proline transport ATP
FT                   binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35872"
FT                   /db_xref="GOA:D5E9M1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9M1"
FT                   /protein_id="ADE35872.1"
FT                   /translation="MSYVEEGLSKDEIFNKTGQTVGLYNVSFDVYEGEIFVLMGLSGSG
FT                   KSTLLRCLNRLIEPTSGSITISDEDVTKASSERLRLIREKQISMVFQNFALLPHRTIID
FT                   NVAYGLEIQDFSKDERHEKAAVAIETVGLKGHEFSKPSQLSGGMQQRVGLARALATDPE
FT                   ILLMDEAFSALDPLIRSEMQDELLELEEKMQKTIVFVSHDLDEALKLGDRIALMKDGEI
FT                   AQIGTAEEILTNPANDYVSKFVAGVDKTKILTAENIMKRPDPVVSFKSGLQVALKLMEK
FT                   HGISSIYVVDKAKRLQGFLKADDAVRAQKAGKTMEDVIIKEFPKTTLDTPLQDLISIRA
FT                   ETDQPIAIVNENDKLVGVVVRGSILAALKTTEDEEQVEEAEQ"
FT   gene            358656..359909
FT                   /locus_tag="Mmah_0341"
FT   CDS_pept        358656..359909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0341"
FT                   /product="NurA domain protein"
FT                   /note="InterPro IPR018977; PFAM: NurA domain; SPTR: Q12U58
FT                   Putative uncharacterized protein; PFAM: NurA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35873"
FT                   /db_xref="InterPro:IPR018977"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9M2"
FT                   /protein_id="ADE35873.1"
FT                   /translation="MSLEPIHIKAIQEIASGIEMDVDKKDEDSDATNLLDFLKELKYGS
FT                   RIVLKSIGRLYRGKVDMARMSQSKDPVERTLSSDSGSTNTFLFDSGLALDFCHCAMASS
FT                   PTDLGIHSKRTIVAATYSSSANVTINTSHDWKLFDRGNGRSRLVKIEAGLLETREKRLV
FT                   HNIALYLSESEHILWMKDIFSKGDFFIMDGPIYPKQLMYWMVVPSEEVRIRYDPSALNI
FT                   LQNYIDIMDHSMDNNLPLVGFVKNPEDMQIVQTLKKQETELDIPWLVDAQFFKNVLHPS
FT                   AEDSHNCITYTNWFMQPNQFYENMLQTTSPLMDSSLSHKYDAEDYALTFFVIYVPAMNV
FT                   LFKVESPYGLTKDDDMRHLITRKVLYDISVGGIPPTLSKVDSIAKIRKKERKQILGQFN
FT                   KLRVDTKYNDIRWSDTDG"
FT   gene            359902..361692
FT                   /locus_tag="Mmah_0342"
FT   CDS_pept        359902..361692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0342"
FT                   /product="protein of unknown function DUF87"
FT                   /note="COGs: COG0433 ATPase; InterPro IPR002789; KEGG:
FT                   pfs:PFLU0171 hypothetical protein; PFAM: protein of unknown
FT                   function DUF87; SPTR: Q12U57 ATPase; PFAM: Domain of
FT                   unknown function DUF87"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35874"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9M3"
FT                   /protein_id="ADE35874.1"
FT                   /translation="MDNDDDILAYATGTKGGSVSSREPVEDFEEYVPDTVDNPDESFFD
FT                   DALGTITTGIDPLEITEAGARLTGYITASHRPNVRLGTYVLVPYGDEDLFARVWKLQYL
FT                   QEFEVDDATELHSRRMLKANNTNEIDYKFLAYLDPLCILSPAKAGLMRRMADRLPRPNT
FT                   PILPVSEKLKIQTGLNIPTEGIFLGHLSVGGELVRTHASPPTVAYYLRNDYSMGDPLMF
FT                   RHMLVCGSTGTGKTFLTKNILRQFLASDNQYLVRGEQGRKKNPCLVIMDPQDEYSQLFE
FT                   DNAEIGYADEVTFAEEDVLHGGHQDTRTFLASVDGQSYPGKSRAQQMEFTIPFELVRNN
FT                   SWLISAAELTENQYIGLELLLEDYFRTPANHTYQGFTDFIADEGTRSVYVDSGKIHESS
FT                   YDAIVRKVKNRSFSKVFDQPAKPITEILDEVFKPGRVSVFPTEYINNSRIRDLITLTLM
FT                   TIVVDNKLSTSGNDSVKKTPVLLALDEAHRYLSGAMSAHSRRIVSRFADAARQGRKETL
FT                   GLFLITQDPQDIDDTVLKQINSRIILNLSNDNAINALNVPLEFEKRIPYLRKGQMIIQS
FT                   PDNSDIVEVTGLHKCVVKHA"
FT   gene            complement(361693..362805)
FT                   /locus_tag="Mmah_0343"
FT   CDS_pept        complement(361693..362805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0343"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterProIPR004358:IPR013655:IPR013767:IPR013656:IPR
FT                   003594:IPR003661:IPR000014:IPR000700:IPR005467; KEGG:
FT                   afw:Anae109_3161 PAS/PAC sensor signal transduction
FT                   histidine kinase; PFAM: ATP-binding region ATPase domain
FT                   protein; PAS fold-3 domain protein; PAS fold domain
FT                   protein; PAS fold-4 domain protein; histidine kinase A
FT                   domain protein; SMART: ATP-binding region ATPase domain
FT                   protein; PAS domain containing protein; histidine kinase A
FT                   domain protein; SPTR: Q12Z57 Sensor protein; TIGRFAM: PAS
FT                   sensor protein; PFAM: Histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like ATPase; His Kinase A (phosphoacceptor) domain;
FT                   PAS fold; TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35875"
FT                   /db_xref="GOA:D5E9M4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9M4"
FT                   /protein_id="ADE35875.1"
FT                   /translation="MKRGVIVGKIDKSKQNPTDMYSTLVKKSNDGIIIIQDEAIIFANP
FT                   KFREIIGYKPEELKGMDFKNIFPPENINMISERYHRRLKKDPDIPERYETEMLSKKGSR
FT                   VPVEISASYIEHNNRPADMAIIRDITERRDAEKRLEQYTKSLEKNYHIKELFGDIVSHD
FT                   LKNPAGIIKGYSQLLADREEGAEKKKIALTINRNINRILELIENASVFVKLDTLTDIKF
FT                   ERSDLSMMLKKVADEYKEEIQEKEIDLKINDSGEYPANIHKSIHEAFSNLLSNAIKYGP
FT                   EKGQITIDIIKDNGMWKILFIDEGEGVPDDKKELIFERFERAGSSVSIKGTGLGLAIVK
FT                   KIMEIHGGQTGVEDREDRKGSVFWVTIPRA"
FT   gene            362908..362981
FT                   /locus_tag="Mmah_R0003"
FT   tRNA            362908..362981
FT                   /locus_tag="Mmah_R0003"
FT                   /product="tRNA-Lys"
FT   gene            363165..363428
FT                   /locus_tag="Mmah_0344"
FT   CDS_pept        363165..363428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0344"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_0322 hypothetical protein; SPTR:
FT                   Q12TX4 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF3303)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35876"
FT                   /db_xref="InterPro:IPR021734"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9M5"
FT                   /protein_id="ADE35876.1"
FT                   /translation="MLYMDVSTWEPTLSDKVIEHFKELKPPAGINIIKQWVDLTGGRYF
FT                   ILYECDDAEAYAAFNLPWSDICEIDSVPVMESTDFIKLMSKQ"
FT   gene            complement(363443..364021)
FT                   /locus_tag="Mmah_0345"
FT   CDS_pept        complement(363443..364021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0345"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q12TX5 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35877"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9M6"
FT                   /protein_id="ADE35877.1"
FT                   /translation="MGFYKIINSILKPIEEKPDTKDSDIEWDVSHKRLKPGENITITGN
FT                   TEPDTRINMIVRFNVAVAVHDGRYSYDFHKVQIPEGANEFKVQTRPVKNMTFTVKMLMP
FT                   FRQHRDAEDSVATYIDTNVPSGTFNINISGDAQENTETIQMDVKASQVIRAGPEGDIRY
FT                   TYDTTPFNPGIVEIEIGNDKKEVELIGED"
FT   gene            364179..364349
FT                   /locus_tag="Mmah_0346"
FT   CDS_pept        364179..364349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0346"
FT                   /product="putative transcriptional regulator, CopG/Arc/MetJ
FT                   family"
FT                   /note="SPTR: Q8TUL1 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35878"
FT                   /db_xref="GOA:D5E9M7"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9M7"
FT                   /protein_id="ADE35878.1"
FT                   /translation="MPKVSVDIPQQLLDDLNCHVGENRKFVSQSDAIRTAIRKLLDRMD
FT                   DVDTRHGRVKE"
FT   gene            complement(364339..365118)
FT                   /locus_tag="Mmah_0347"
FT   CDS_pept        complement(364339..365118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0347"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="COGs: COG1082 Sugar phosphate isomerase/epimerase;
FT                   InterPro IPR012307; KEGG: gbm:Gbem_3793 xylose isomerase
FT                   domain protein TIM barrel; PFAM: Xylose isomerase domain
FT                   protein TIM barrel; SPTR: Q46DU7 Putative uncharacterized
FT                   protein; PFAM: Xylose isomerase-like TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35879"
FT                   /db_xref="GOA:D5E9M8"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9M8"
FT                   /protein_id="ADE35879.1"
FT                   /translation="MPPAIGFSARASGEKPLEWAYELEEMGYSAIELVQEGKQKITAEN
FT                   IGRLQQIKDTTNLTFTIHLPFSDINLATLNPGIHKEIIRQMGQCLHTASGLAEIAVVHP
FT                   GYLSPEGALYPEKAWDNTIRSLKEMSTIAEEEGIMLALENMPDMPHIFGKYPAEILEII
FT                   EKVDSDNMGMTLDIGHANTMGLLDEFLDSCREIMIHSHIHDNHEKRDEHLPLGKGCIDW
FT                   KKIFDRIEGYDGLFITEMKNLENGTECMEYLKSNLIL"
FT   gene            complement(365120..365554)
FT                   /locus_tag="Mmah_0348"
FT   CDS_pept        complement(365120..365554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0348"
FT                   /product="Protein of unknown function DUF54"
FT                   /note="COGs: COG1931 conserved hypothetical protein;
FT                   InterPro IPR002739; PFAM: Protein of unknown function
FT                   DUF54; SPTR: Q12U54 Putative uncharacterized protein; PFAM:
FT                   Protein of unknown function DUF54"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35880"
FT                   /db_xref="InterPro:IPR002739"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9M9"
FT                   /protein_id="ADE35880.1"
FT                   /translation="MASVKLWACVNPTEDASKVCEGLTRISGLAPRLDDNIAVIDCNHR
FT                   DLQIFHHLLRDEEILDTARSVLEKGIHSPEEKISFMLNKQVAFVGRISFPAGEEELGSI
FT                   HVEIQCNGGELEDIINWLAPPTEEGKPVYEKDMPPLREGE"
FT   gene            complement(365541..366092)
FT                   /locus_tag="Mmah_0349"
FT   CDS_pept        complement(365541..366092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0349"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG0237 Dephospho-CoA kinase; KEGG:
FT                   hypothetical protein; SPTR: Q8PXA9 UPF0200 protein MM_1313"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35881"
FT                   /db_xref="GOA:D5E9N0"
FT                   /db_xref="InterPro:IPR022970"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9N0"
FT                   /protein_id="ADE35881.1"
FT                   /translation="MKIIAFVGMPASGKSEASKVIRNMGLNVINMGDVIREEVKHRQLE
FT                   PTDSNTGMIANDLRDKEGMDAVARRCIPKIKQKGDDVVVIDGVRGIAEVETFKKEFGNE
FT                   FSLIAISSPIENRFERVRKRCRSDDMQKIEDLKRRDEREMKWGMGQAMETADVTIDNTA
FT                   SLKEFRQHVKDTVERINGQR"
FT   gene            366161..367114
FT                   /locus_tag="Mmah_0350"
FT   CDS_pept        366161..367114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0350"
FT                   /product="TIM-barrel protein, nifR3 family"
FT                   /note="COGs: COG0042 tRNA-dihydrouridine synthase; InterPro
FT                   IPR001269:IPR018517:IPR004652; KEGG: hsm:HSM_1609 nifR3
FT                   family TIM-barrel protein; PFAM: dihydrouridine synthase
FT                   DuS; SPTR: Q12U52 Dihydrouridine synthase, DuS; TIGRFAM:
FT                   TIM-barrel protein, nifR3 family; PFAM: Dihydrouridine
FT                   synthase (Dus); TIGRFAM: putative TIM-barrel protein, nifR3
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35882"
FT                   /db_xref="GOA:D5E9N1"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9N1"
FT                   /protein_id="ADE35882.1"
FT                   /translation="MRIGKVRLGGNLLLAPMAEVTNLAYRVVCRRRGASFAFTEMVNSE
FT                   AILHGNRKSYQMASSCADEGIFGIQIFGNSPVSMAKAAGILENTKFPSIIDINAGCPSP
FT                   RIRKTGAGSMLMEKPDVLENIVRCVVESVTVPVTVKIRVFRDVSQTVELASRLENAGAS
FT                   AITVHGRTATQQYSGLADHLYARRIKEELSIPVIANGDIRNGAFAAQLLEYTGCDGLMI
FT                   GRAAMGDPDVFLRIETFLENGTEFPSADCDQRKNRLEEYLKLLESYGLEKNVNLAAHSA
FT                   WFTRGLAGSRSFRKSIQNVKNSDGIISRMEVLCSES"
FT   gene            367311..367856
FT                   /locus_tag="Mmah_0351"
FT   CDS_pept        367311..367856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0351"
FT                   /product="pyruvate ferredoxin oxidoreductase, gamma
FT                   subunit"
FT                   /EC_number="1.2.7.1"
FT                   /note="COGs: COG1014 Pyruvate:ferredoxin oxidoreductase and
FT                   related 2-oxoacid:ferredoxin oxidoreductase gamma subunit;
FT                   InterPro IPR019752:IPR011894; KEGG: lch:Lcho_2149
FT                   pyruvate/ketoisovalerate oxidoreductase, gamma subunit;
FT                   PFAM: Pyruvate/ketoisovalerate oxidoreductase; SPTR: Q12U51
FT                   Pyruvate ferredoxin oxidoreductase, gamma subunit; TIGRFAM:
FT                   pyruvate/ketoisovalerate oxidoreductase, gamma subunit;
FT                   PFAM: Pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   TIGRFAM: 2-oxoacid:acceptor oxidoreductase, gamma subunit,
FT                   pyruvate/2-ketoisovalerate family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35883"
FT                   /db_xref="GOA:D5E9N2"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011894"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9N2"
FT                   /protein_id="ADE35883.1"
FT                   /translation="MKEIRIHGRGGQGSVTAAELLAGAAFEDSQFSQAFPAFGVERRGA
FT                   PVQAFTRISDAPIRLRSQIYEPDYVIVQDPTLIEVVDVESGAKDDGIILINSDFAPEDF
FT                   DLDTNARIMTVNATKVALDIIGRPIVNTVLLGAFAGATGEVRASSIVNAVKGRFSGKIG
FT                   EKNAEAVQKAYDLMAEEK"
FT   gene            367856..368116
FT                   /locus_tag="Mmah_0352"
FT   CDS_pept        367856..368116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0352"
FT                   /product="pyruvate ferredoxin oxidoreductase, delta
FT                   subunit"
FT                   /EC_number="1.2.7.1"
FT                   /note="COGs: COG1144 Pyruvate:ferredoxin oxidoreductase and
FT                   related 2-oxoacid:ferredoxin oxidoreductase delta subunit;
FT                   InterPro IPR001080:IPR001450:IPR017900:IPR011898; KEGG:
FT                   ppd:Ppro_0323 pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase, delta subunit; PFAM: 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; SPTR: Q2Y4G5 Pyruvate
FT                   synthase, delta subunit; TIGRFAM: pyruvate
FT                   ferredoxin/flavodoxin oxidoreductase, delta subunit; PFAM:
FT                   4Fe-4S binding domain; TIGRFAM: 2-oxoacid:acceptor
FT                   oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35884"
FT                   /db_xref="GOA:D5E9N3"
FT                   /db_xref="InterPro:IPR011898"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9N3"
FT                   /protein_id="ADE35884.1"
FT                   /translation="MSIPLGGVCEPGTTRLNKTGGWRTFRPVYDYDKCIKCKLCELLCP
FT                   DMAVLPRDDGFFEFDYDYCKGCGICANECPTEAIDMVLEEK"
FT   gene            368117..369331
FT                   /locus_tag="Mmah_0353"
FT   CDS_pept        368117..369331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0353"
FT                   /product="pyruvate ferredoxin oxidoreductase, alpha
FT                   subunit"
FT                   /EC_number="1.2.7.1"
FT                   /note="COGs: COG0674 Pyruvate:ferredoxin oxidoreductase and
FT                   related 2-oxoacid:ferredoxin oxidoreductase alpha subunit;
FT                   InterPro IPR005476:IPR002880; KEGG: lch:Lcho_2150 pyruvate
FT                   flavodoxin/ferredoxin oxidoreductase domain-containing
FT                   protein; PFAM: pyruvate flavodoxin/ferredoxin
FT                   oxidoreductase domain protein; Transketolase domain
FT                   protein; SPTR: Q2Y4G6 Pyruvate synthase, alpha subunit;
FT                   PFAM: domain; Transketolase, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35885"
FT                   /db_xref="GOA:D5E9N4"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9N4"
FT                   /protein_id="ADE35885.1"
FT                   /translation="MTVIRTLEKDKMDVAEGSYAVAHAVKVCRPNIISAYPITPQTHIV
FT                   EDLSQFMADGEIPNCEYINVESEFSALSALVGSAAAGARCYSATTSQGLELMHEVLFNV
FT                   SGMRLPVVMTIANRAVSAPINIWNDHQDSISQRDTGWIQMYAEDLQEISDMTAQAYRVA
FT                   EDKDVMMPAMTCMDGFILSHVYEPVVLLEQDLVDEYLPAFEPEYTLDPKNPLTFGAFAD
FT                   PSAYTEFRYLQQQAMDNALPKIEEAANEFYEIFGRYYGGLIDEYETEDADIILMAMGSL
FT                   VGTIRDVVDKLRAKGVKVGLLKVRTFRPFPAEAIKNVIKDAKVVVALDKNISLGLNEGS
FT                   LFTETKASLYNTKVDVPIVGRMLGHGGRDIPVKTIEDIVEEAKGIISSGINTESKYADL
FT                   KEELL"
FT   gene            369328..370206
FT                   /locus_tag="Mmah_0354"
FT   CDS_pept        369328..370206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0354"
FT                   /product="pyruvate ferredoxin oxidoreductase, beta subunit"
FT                   /EC_number="1.2.7.1"
FT                   /note="COGs: COG1013 Pyruvate:ferredoxin oxidoreductase and
FT                   related 2-oxoacid:ferredoxin oxidoreductase beta subunit;
FT                   InterPro IPR011766; KEGG: sat:SYN_00154 pyruvate:ferredoxin
FT                   oxidoreductase beta subunit; PFAM: thiamine pyrophosphate
FT                   protein domain protein TPP-binding; SPTR: Q2Y4G7 Pyruvate
FT                   synthase, beta subunit; PFAM: Thiamine pyrophosphate
FT                   enzyme, C-terminal TPP binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35886"
FT                   /db_xref="GOA:D5E9N5"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9N5"
FT                   /protein_id="ADE35886.1"
FT                   /translation="MKSLFTSGHRGCAGCCDAMVAKFTLMAAGEDCIVISPTGCLEVMS
FT                   TPYPETSWEVPWIHSLFENAGAVASGVEAALKAMGKKGDTKVIALAGDGATLDIGMRSI
FT                   SGAFERGHDITYVCIDNEAYMNTGVQRSGATPFDASTTTSPAGKVSYGNPRPKKNMPAI
FT                   MAAHGSPYIATTSLGYPKDMIKKIKKATEIEGPTYIHAHAPCTTGWGFDTSKTVEVAKL
FT                   AVQTGLWPLYEMENGEVTKVRKIGKQKKPVEDYLKMQKRFKHLFKMEGGEEQLKLIQAL
FT                   ADKNIEDFGLE"
FT   gene            370231..370869
FT                   /locus_tag="Mmah_0355"
FT   CDS_pept        370231..370869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0355"
FT                   /product="endonuclease III; DNA-(apurinic or apyrimidinic
FT                   site) lyase"
FT                   /EC_number="4.2.99.18"
FT                   /EC_number="3.2.2.-"
FT                   /note="COGs: COG0177 EndoIII-related endonuclease;
FT                   InterProIPR003265:IPR003651:IPR004035:IPR004036:IPR 005759;
FT                   KEGG: scl:sce4746 putative endonuclease III; PFAM: HhH-GPD
FT                   family protein; iron-sulfur cluster loop; PRIAM:
FT                   DNA-(apurinic or apyrimidinic site) lyase; SMART: HhH-GPD
FT                   family protein; iron-sulfur cluster loop; SPTR: Q8PYG7
FT                   Endonuclease III; TIGRFAM: endonuclease III; PFAM: HhH-GPD
FT                   superfamily base excision DNA repair protein; Iron-sulfur
FT                   binding domain of endonuclease III; Helix-hairpin-helix
FT                   motif; TIGRFAM: endonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35887"
FT                   /db_xref="GOA:D5E9N6"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9N6"
FT                   /protein_id="ADE35887.1"
FT                   /translation="MTANNLSNFPQIWGLLKKEYPDPQPALHFKTPLQLLVATILSAQS
FT                   TDVQINKVTRELFRKYRSVFDYADADISELEKDIYSTGFYRNKAKHLQQSARVIIEDFD
FT                   GEVPSTMEDLLKLPGVARKTANIVLARGFGVKAGIAVDTHVKRLATRLGFTVNKDPVKI
FT                   ERDLMELVDRNEWDDFSLTLILHGRNICFARKPACGKCVVNHLCPSSLV"
FT   gene            370978..372069
FT                   /locus_tag="Mmah_0356"
FT   CDS_pept        370978..372069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0356"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="COGs: COG0389 Nucleotidyltransferase/DNA polymerase
FT                   involved in DNA repair; InterPro IPR001126:IPR017963; KEGG:
FT                   sat:SYN_02012 DNA polymerase IV; PFAM: UMUC domain protein
FT                   DNA-repair protein; PRIAM: DNA-directed DNA polymerase;
FT                   SPTR: Q8TIW3 DNA polymerase IV; PFAM: impB/mucB/samB family
FT                   C-terminal; impB/mucB/samB family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35888"
FT                   /db_xref="GOA:D5E9N7"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9N7"
FT                   /protein_id="ADE35888.1"
FT                   /translation="MSRIVVHVDMDYFYAAVEEREDPSLRGRSVVVCMYSGRGEHRGSV
FT                   STSNYTARKYGIKSGMPCSRAIKLNQDAVFLPVRKEFYTEVSDSIMEVLRSHADSDESF
FT                   EQISIDEAFIEVTANCNDDFECALKLGEDIKQKILEKEQLTCSVGIGPNKLIAKMASSE
FT                   NKPNGITVISQHDVKPFLEDRTPSQLWGVGDVTAGRLEQMGIKKVGQLASSDIVSLTDA
FT                   FGKKKGSWLKKAAQGMDESPVRQREGSEQIGRIATLPENSSEYDLIMPVLDNLADDVIR
FT                   KTIERGVSFRQVTLIVITSDFKTQTRNHTLQRAVAEKEILRSNLDKLLTTFLEENKSAI
FT                   RRIGVRVAGLQEVSSQTTLASYF"
FT   gene            complement(372075..372533)
FT                   /locus_tag="Mmah_0357"
FT   CDS_pept        complement(372075..372533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0357"
FT                   /product="protein of unknown function DUF151"
FT                   /note="COGs: COG1259 conserved hypothetical protein;
FT                   InterPro IPR003729; KEGG: dde:Dde_2379 hypothetical
FT                   protein; PFAM: protein of unknown function DUF151; SPTR:
FT                   Q46CC4 Putative uncharacterized protein; PFAM:
FT                   Uncharacterised ACR, COG1259"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35889"
FT                   /db_xref="GOA:D5E9N8"
FT                   /db_xref="InterPro:IPR003729"
FT                   /db_xref="InterPro:IPR036104"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9N8"
FT                   /protein_id="ADE35889.1"
FT                   /translation="MPEEDETCQVNVKGVYLMKMDEGIAPTVILESPAGKIMPIYIGHL
FT                   EALSINNALNSETTPRPMTHDLLMSILSRMEGKVENVLIDEKAEGVFYARLTLSKNDVK
FT                   MEFDARPSDCIALALRADVPINIKDEILENDIISPEKLDGAKSFESLL"
FT   gene            complement(372581..373120)
FT                   /locus_tag="Mmah_0358"
FT   CDS_pept        complement(372581..373120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0358"
FT                   /product="Peptidase M23"
FT                   /note="InterPro IPR016047; KEGG: vvu:VV1_1103 hypothetical
FT                   protein; PFAM: Peptidase M23; SPTR: Q468B5 Putative
FT                   metalloendopeptidases; PFAM: Peptidase family M23"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35890"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9N9"
FT                   /protein_id="ADE35890.1"
FT                   /translation="METGNEKRCPLPVPLHVPADGEAGCFWEDRKDRHHCGIDLYAEKG
FT                   TPVFAIEEGEVVEIGIMTSPSMIEYWNKTYHLIIRGNSGTYYKYGEMDMTIPEKGTRVK
FT                   KYDQIGEVGQVLNPAMINSTSPRYIQALKEKNPAMLHFEIWEEYPVTDHKLYLGGNWFG
FT                   SKKPPGLLNPLHYLHQ"
FT   gene            complement(373104..376712)
FT                   /locus_tag="Mmah_0359"
FT   CDS_pept        complement(373104..376712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0359"
FT                   /product="5-oxoprolinase (ATP-hydrolyzing)"
FT                   /EC_number="3.5.2.9"
FT                   /note="COGs: COG0146 N-methylhydantoinase B/acetone
FT                   carboxylase alpha subunit; InterPro
FT                   IPR003692:IPR008040:IPR002821; KEGG: noc:Noc_0378
FT                   5-oxoprolinase (ATP-hydrolyzing); PFAM: Hydantoinase
FT                   B/oxoprolinase; Hydantoinaseoxoprolinase domain protein;
FT                   Hydantoinase/oxoprolinase; PRIAM: 5-oxoprolinase
FT                   (ATP-hydrolyzing); SPTR: Q8TNI5 5-oxoprolinase
FT                   (ATP-hydrolyzing); PFAM: Hydantoinase/oxoprolinase;
FT                   Hydantoinase B/oxoprolinase; Hydantoinase/oxoprolinase
FT                   N-terminal region"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35891"
FT                   /db_xref="GOA:D5E9P0"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9P0"
FT                   /protein_id="ADE35891.1"
FT                   /translation="MQNNSNSWDFWIDRGGTFTDIVALKPEGKLLTHKLLSDNPEQYED
FT                   AAIEGIRQVLNLRKDETLPAEKITSIRMGTTVGTNALLERRGEPTVLVITEGFRDILKI
FT                   GYQNRPSIFALDIKKPKVLYEEVIEARERYSSDGTIVNPLDCDDIKEKLMEYYNKGYRS
FT                   VAVALMHSFRYHAHEEQIEKIAHNAGYTNISLSHRTSPLSKLVARAETTVVDAYLSPVL
FT                   EHYVNLVRNKLNDQKKSTDLFFMQSSGGLVDGDRFRGKDSILSGPAGGIVGSAEVCRTA
FT                   GFDRVISFDMGGTSTDVAHYRGEMERTLESTISGTHLHTPMLNIHTVAAGGGSILHFED
FT                   GRFQTGPDSAGADPGPACYRKGGPLTVTDCNVMLGKISPQNFPQIFGENADLPLDRNIV
FT                   VENFRELAEEIKLQTGKSMNPEEVAEGFLKVAVENMANAIKHISVKRGYHLEDYILCCF
FT                   GGAGAQHAGLVADSLGIGKILIHPFAGVLSAYGMGLADRRVIEEKALEKYLEEGIEKEL
FT                   ADVTKNLFEKGMERMLATGDRNIDIEKVERVRLKYEGTETTFDVPCGPIDEMIKIFHSL
FT                   HTERFGFVSENRKLVVDSAYVEIIGKSKTPAEKTHLLTDKSPNPASSKEVYMEGRWHRI
FT                   PLFTRDVLKPGNRITGPALIMENTTTIILESKWQASVTEHNHLLLEKRITKPRADIGIE
FT                   VDPVMLEIFNNRFMSVAEQMGYRLRNAAHSVNIKERLDFSCAIFDGSGNLVANAPHIPV
FT                   HLGSMEDAVKEVIRNHENDFSEGDTYIINSPYHGGTHLPDITAVSPLISNGKPQFYVAS
FT                   RGHHGDIGGITPGSMPPLSTRIEEEGVLIEEFKITEQGKFREEKLLELFNQATYPPRNP
FT                   EQNIADLKAQIAANQKGIEELRKLVDTYSLKTITAYMQHVQDNAEKAVEKVIDVLEDGN
FT                   FEYRLDDDSKIAVRVRIDRDNTKAIIDFTHTSPQTKSNFNAPSAVCKAAVLYVFRTLVQ
FT                   DDIPLNSGCLRPITIIIPENSMLNPSYPAAVVAGNVETSQYIVDCLYGALGTLAPSQGT
FT                   MNNFTFGNDRFQYYETICGGAGAGNGFDGEDAVQTHMTNSLITDPEIMELRFPVRIEEF
FT                   NIRRGSGGKGKFQGGNGVLRKIHFLKKMKAAILSSHRKYPPEGMAGGGNASTGENLLKR
FT                   KSGETIELAAADEIEVEEGDTFIIKTPGGGGYGNRE"
FT   gene            376839..377264
FT                   /locus_tag="Mmah_0360"
FT   CDS_pept        376839..377264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0360"
FT                   /product="phosphoesterase PA-phosphatase related protein"
FT                   /note="InterPro IPR001011:IPR000326; KEGG: spl:Spea_3788
FT                   phosphoesterase PA-phosphatase related; PFAM:
FT                   phosphoesterase PA-phosphatase related; SMART:
FT                   phosphoesterase PA-phosphatase related; SPTR: Q12U33
FT                   Phosphoesterase, PA-phosphatase related; PFAM: PAP2
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35892"
FT                   /db_xref="GOA:D5E9P1"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9P1"
FT                   /protein_id="ADE35892.1"
FT                   /translation="MVPLTIAGNLFIWLLIAAFLYIFKGKSYAVYYLSLLLIIWLVVYG
FT                   MKSLFMVPRPETGRILVEAAGNSFPSGHTALAFGTATFLHPVSGKSSYMFWIFAMMMGI
FT                   SRITVGVHYPSDVVAGAIAGIILGYAGLLLYPAFVKK"
FT   gene            complement(377271..378683)
FT                   /locus_tag="Mmah_0361"
FT   CDS_pept        complement(377271..378683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0361"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="COGs: COG0034 Glutamine phosphoribosylpyrophosphate
FT                   amidotransferase; InterPro
FT                   IPR000836:IPR000583:IPR002375:IPR005854; KEGG:
FT                   geo:Geob_2890 amidophosphoribosyltransferase; PFAM:
FT                   glutamine amidotransferase class-II;
FT                   phosphoribosyltransferase; SPTR: Q12U32
FT                   Amidophosphoribosyltransferase; TIGRFAM:
FT                   amidophosphoribosyltransferase; PFAM: Phosphoribosyl
FT                   transferase domain; Glutamine amidotransferases class-II;
FT                   TIGRFAM: amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35893"
FT                   /db_xref="GOA:D5E9P2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9P2"
FT                   /protein_id="ADE35893.1"
FT                   /translation="MKEECGVVGVLLDDTKSQSKTAALQIYYSLYALQHRGQESTGITV
FT                   YNGGTTHSMKGMGLVPEVYAREDIAKLIGHVGIGHVRYSTTGHSRIENCQPLIVNYKSG
FT                   TIAIAHNGNLVNGHDLRDELESEGRIFITDSDTEVIAHLLVKELLKHGPVDSIKNVMNR
FT                   LEGSYSLAIMIDDLLIAARDPLGIKPLCIGKTDLGLVVASESVAIDTLNGKLIRDVRPG
FT                   EVVVLKDGEVESHQVYNTTHAAHCVFEYIYFARPDSVIDGQLVYKVRERIGRELAKEHP
FT                   VEADIISPVPDSGITSAVGYTRESGIQYQEGLMKNRYIGRTFILPGQEMRETAVRLKMN
FT                   TIAENIEEKRVVLIDDSVVRGTTSRRIINMIKDAGAREVHARIGSPAIIAPCYMGIDMA
FT                   TRDELIASNNKVENICNTIHADSLGYLSVDGLVRAIGIDKEDLCMGCLTEVYPLEIPGE
FT                   KCQCRQTRLNQF"
FT   gene            complement(378962..379180)
FT                   /locus_tag="Mmah_0362"
FT   CDS_pept        complement(378962..379180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0362"
FT                   /product="Small nuclear ribonucleoprotein, LSM family"
FT                   /note="COGs: COG1958 Small nuclear ribonucleoprotein
FT                   (snRNP) homolog; InterPro IPR001163:IPR006649; KEGG:
FT                   hypothetical protein; K04796 small nuclear
FT                   ribonucleoprotein; PFAM: Like-Sm ribonucleoprotein core;
FT                   SMART: Sm-family ribonucleoprotein; SPTR: Q12U30 Putative
FT                   snRNP Sm-like protein; PFAM: LSM domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35894"
FT                   /db_xref="GOA:D5E9P3"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR016487"
FT                   /db_xref="InterPro:IPR022901"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9P3"
FT                   /protein_id="ADE35894.1"
FT                   /translation="MGNRPLDILNNALNTAVIVRLKGAREFRGTLQGYDVHMNLVLDEA
FT                   EEIKEGEIIRKIGSVVVRGDNVVYVSP"
FT   gene            379345..380673
FT                   /locus_tag="Mmah_0363"
FT   CDS_pept        379345..380673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0363"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /note="COGs: COG0351
FT                   Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase;
FT                   InterPro IPR019293:IPR013749:IPR004399; KEGG: sat:SYN_01521
FT                   phosphomethylpyrimidine kinase / hydroxymethylpyrimidine
FT                   kinase; PFAM: Phosphomethylpyrimidine kinase type-1;
FT                   Phosphomethylpyrimidine kinase; SPTR: Q8Q000 Putative
FT                   phosphomethylpyrimidine kinase; TIGRFAM:
FT                   phosphomethylpyrimidine kinase; PFAM:
FT                   Phosphomethylpyrimidine kinase; Archaeal
FT                   phosphomethylpyrimidine kinase; TIGRFAM:
FT                   phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35895"
FT                   /db_xref="GOA:D5E9P4"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR019293"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9P4"
FT                   /protein_id="ADE35895.1"
FT                   /translation="MSNTKVALTIAGSDSGGGAGIEADIRTFSALGMHPTCAVTCITSQ
FT                   NTMGLQDSMEVPISHISSQIDAVCTDMDVKWAKTGMLSSPEIIAAVASEVKKHRLKLVV
FT                   DPVMTAEAGGTLLAESALSTLKETLLPLAFVVTPNIYEAKALSGVTINTWEDGQKAARR
FT                   IAKFGVDNVIITGGHFDASDLVYESHNDTFTTISSRFVKGGTHGSGCTYSAALLVYLSN
FT                   GLRVPEASRCAKRFVENAISRSTDVGMGVSPVDSLAFLRNSAAKYHTLVNTTDALDTLI
FT                   SEKTFSKLIPEVGCNIAMATPEAETISDVAGVHGRITRSKGRPVASGCVGFGASKHVGS
FT                   VVLAAIHSNPEIRACLNVKYSKEVLAACSQMGFGIASFERKDEPSHVSTMDWGTAYAIG
FT                   KYGKVPEVIYDEGDVGKEPMIRLLGRNATDVVEMALKIVERIN"
FT   gene            380763..382019
FT                   /locus_tag="Mmah_0364"
FT   CDS_pept        380763..382019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0364"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="COGs: COG3264 Small-conductance mechanosensitive
FT                   channel; InterPro IPR006685; KEGG: pin:Ping_1734 MscS
FT                   mechanosensitive ion channel; PFAM: MscS Mechanosensitive
FT                   ion channel; SPTR: Q8PV83 Putative transport channel
FT                   protein; PFAM: Mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35896"
FT                   /db_xref="GOA:D5E9P5"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9P5"
FT                   /protein_id="ADE35896.1"
FT                   /translation="MFDDFYSTIVIVILTLLVVLLLQYLFKKTLIFKGDTFIRNLFFTL
FT                   IIFLGMMLVIFSLPISSDSKQIIVSAIGIIVGATVALSSTTFVSNGMSGIMIRLIKPFY
FT                   VGDYIRSDEIFGRVTDKTILYTRIQSEYRDLITVPNLKIMSNPLTTIRSSGTIISTNVS
FT                   LGYDVCRQDIETALLKAADETGLKDPFVHVLELGDFSVTYKVGGLLKETKALLTERSNF
FT                   KKAVLDSLHRMDIEIVSPTFMNQRVMKNGKRFIPPLRENKKDEEEFRADRDYIPRVSTE
FT                   EIIFDKAIEAEMLDKARKTLEYFDNKKDKVEKQISCLPDESAEIQKNNWSSIKDRLGNI
FT                   EQIVEALEKAPEPGEMESSPEGLLHSKVLEHLRSIMDSILEDYNQMVETMESESCEIED
FT                   KKSDELSDSGESVSENDVN"
FT   gene            382071..382712
FT                   /locus_tag="Mmah_0365"
FT   CDS_pept        382071..382712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0365"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="COGs: COG2095 Multiple antibiotic transporter;
FT                   InterPro IPR002771; KEGG: aeh:Mlg_1602 multiple antibiotic
FT                   resistance (MarC)-related proteins; PFAM: multiple
FT                   antibiotic resistance (MarC)-related protein; SPTR: Q8TKJ4
FT                   Multiple antibiotic resistance protein (MarC-like protein);
FT                   PFAM: MarC family integral membrane protein; TIGRFAM:
FT                   conserved hypothetical protein TIGR00427"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35897"
FT                   /db_xref="GOA:D5E9P6"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9P6"
FT                   /protein_id="ADE35897.1"
FT                   /translation="MDVVSFFIYSFVSIFVIVSPIGAVVTFISLTSSMTQEEKNSIATR
FT                   ATLLACAICIFFAVTGHGILNVFGISVDSLRVAGGILLFKVAFDMLLSRVSGESVTEEE
FT                   IHESLSRDDVWIFPIALPLMTGPATITTVVVLSGTSPLISHKLVVLLAILLTFGICFVT
FT                   LYYSRRLYKLIGYTGAHVITRLLGLFLAALAVDFVTHGVWNIYSNLAGVT"
FT   gene            complement(382705..383226)
FT                   /locus_tag="Mmah_0366"
FT   CDS_pept        complement(382705..383226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0366"
FT                   /product="UspA domain protein"
FT                   /note="COGs: COG0589 Universal stress protein UspA and
FT                   related nucleotide-binding protein; InterPro
FT                   IPR006015:IPR006016; KEGG: maq:Maqu_0351 UspA
FT                   domain-containing protein; PFAM: UspA domain protein; SPTR:
FT                   Q12U28 UspA; PFAM: Universal stress protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35898"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9P7"
FT                   /protein_id="ADE35898.1"
FT                   /translation="MVYNTILITTDGSENARKAVQKGIELARACGSKVYALYVMEMNPV
FT                   GITREAIHRDWKTAMQVSLPEHISPAQWREFAKIADENWKIERKKHLEEKAENILSYVE
FT                   ELGKNKDVNVEKVHIEGKPANEILDFASDKKVDLIVMGTLGMGSDGTFRLGRVAERVIH
FT                   NAGCDVMSVR"
FT   gene            complement(383278..385875)
FT                   /locus_tag="Mmah_0367"
FT   CDS_pept        complement(383278..385875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0367"
FT                   /product="valyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /note="COGs: COG0525 Valyl-tRNA synthetase;
FT                   InterProIPR019754:IPR015413:IPR013155:IPR002300:IPR
FT                   001412:IPR002303; KEGG: rco:RC1053 valyl-tRNA synthetase;
FT                   PFAM: aminoacyl-tRNA synthetase class Ia; tRNA synthetase
FT                   valyl/leucyl anticodon-binding; tRNA synthetase class I
FT                   (M); SPTR: Q12U27 Valyl-tRNA synthetase; TIGRFAM:
FT                   valyl-tRNA synthetase; PFAM: tRNA synthetases class I (I,
FT                   L, M and V); Anticodon-binding domain; TIGRFAM: valyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35899"
FT                   /db_xref="GOA:D5E9P8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022874"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9P8"
FT                   /protein_id="ADE35899.1"
FT                   /translation="MTIPKEYNPQEVEKKWQNAWDMSMYHFDWEDENKPQYIIDTPPPY
FT                   PTGNFHIGNSLNWCYIDFVARYKRMQGFNVMFPQGWDCHGLPTEVKVEEIHGITKNQVP
FT                   RAEFRKLCEELTLGNIEKMRQTMRMLGFSVDWSNEFITMKPEYFVKTQRSFVQMQKQGR
FT                   IYQADHPVNWCPRCETAIAFAEVEYEARDTKLNYLSFDKVRIATTRPELLAACVAVAIN
FT                   PEDERYKENIGENVKVPLFDHEVPVIADKEVDPEFGTGVVMICTFGDKQDVRWWIEHNL
FT                   PLRKAIDRNGFMTGIAGKYEGMKSSECKDAIIQDLKEQGYLYDQDSLDQNVGMCWRCNT
FT                   PIEILSERQWFVKIENDKILATANEINWIPDYMKIRLENWTNTMEWDWCISRQRIFATP
FT                   IPVWYCKQCGKSLIAEEEWLPLDPTQTKPPTPCECGSTDFEAEEDVLDTWMDSSLTALH
FT                   VTGWLTDHEMRSPAQLRPQGHDIIRTWAFYSILRSKALQDSRPWDSIMINGMVLGEDGH
FT                   KMSKSRGNIISPEEVVDQYSSDAFRQWAAIGGSTGSDVMFRWKDVVSGSRYFNKMWSIF
FT                   RFSMSHLEELLPEIPEVATSSLGTVDRWLLSKLNRLIISVTENMDNYQFDEAYKSIRGF
FT                   AWETLADNYIELVKARLYGEDETSKKAARYTLYTTLETLTRMLAPFAPFFAEEVYSHIS
FT                   TGSVHQTKWPSSNREIIDETAEKQGEIIKDLASSIRRYKSDCGMALNAPLKKIEIYSVM
FT                   DDVTDLEGATNSAVEVIEGKPEFEHVPVDVKPNMGIIGPKFRKQAGSIIATLKSMDASR
FT                   VAQMKESRSIDIEVDGEKINLEPESVEIIKEVTSAGRTVDVLEVSDVMAVILR"
FT   gene            complement(386061..386315)
FT                   /locus_tag="Mmah_0368"
FT   CDS_pept        complement(386061..386315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35900"
FT                   /db_xref="GOA:D5E9P9"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9P9"
FT                   /protein_id="ADE35900.1"
FT                   /translation="MKKEKSLYRNPYLIAVLYIIAILFLYTVYRDLIAIAVGGIFITIF
FT                   GLMYGVQEHDRDLIYYSGLFLSASIVAIIIAGTFVSLIV"
FT   gene            complement(386450..387517)
FT                   /locus_tag="Mmah_0369"
FT   CDS_pept        complement(386450..387517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0369"
FT                   /product="response regulator receiver protein"
FT                   /note="COGs: COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain; InterPro IPR001789; KEGG: mmb:Mmol_0499 two
FT                   component transcriptional regulator PhoB, winged helix
FT                   family; PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; SPTR: Q12U26 Response regulator
FT                   receiver; PFAM: Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35901"
FT                   /db_xref="GOA:D5E9Q0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9Q0"
FT                   /protein_id="ADE35901.1"
FT                   /translation="MSGEDTAEIMDTFREGLADKTTVFLAPASVSSERLIYFYIQSILE
FT                   NDDQKHIIWLCLKNSRDKVIANFRDYGMEIEDHLDRMWFIDIEDPSKEKKENTLYYSSQ
FT                   TDYMKIGSHTSKLFSEMPGSTMVIDDLNILSKDNLQVVENFLEYIMSNVHQQEGSAVSM
FT                   LNKGVAGEKEGTLASFFDVVIEISDTGEMHVEMGLKSLDVKYVVEKGKINLYYIQKKIK
FT                   KERLNILIVDDEPDIPDLLKLSLKDEPYDFLVAYNGKDAIEIAREKIPDLILLDIMMPD
FT                   MDGYEVVETLKKERDTRDIAIIMITAKTKVDDKLKGMELGIDDYISKPFDKREVNARIK
FT                   MVMKRFGWKPPEEKE"
FT   gene            complement(387614..390388)
FT                   /locus_tag="Mmah_0370"
FT   CDS_pept        complement(387614..390388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0370"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /note="COGs: COG0013 Alanyl-tRNA synthetase;
FT                   InterProIPR018164:IPR003156:IPR012947:IPR018117:IPR
FT                   018165:IPR002318; KEGG: Alanyl-tRNA synthetase
FT                   (EC:6.1.1.7); K01872 alanyl-tRNA synthetase; PFAM:
FT                   Alanyl-tRNA synthetase, class IIc-like; phosphoesterase
FT                   DHHA1; Threonyl/alanyl tRNA synthetase SAD; PRIAM:
FT                   Alanine--tRNA ligase; SPTR: Q12U25 Alanyl-tRNA synthetase;
FT                   TIGRFAM: alanyl-tRNA synthetase; PFAM: DHHA1 domain;
FT                   Threonyl and Alanyl tRNA synthetase second additional
FT                   domain; tRNA synthetases class II (A); TIGRFAM: alanyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35902"
FT                   /db_xref="GOA:D5E9Q1"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR022429"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9Q1"
FT                   /protein_id="ADE35902.1"
FT                   /translation="MLEEEYDINFFYENGFIRKQCQKCGSYFWTRDRDRDTCGDAPCDP
FT                   YSFIDNPVFKKKFNLAQMREFYLSYFEKNGHTRIERYPVIARWRNDIYLTIASIADFQP
FT                   FVTSGQVAPPANPLTISQPCIRLSDLDAVGRSGRHLTTFEMMAHHAFNKKSNEIYWKDR
FT                   TVQLCDGLLNELGVDPFAVTYKEEPWAGGGNAGACVEVLIGGLEVATLVFMNLQQSKNG
FT                   DIVIKGDTYRKMDNYIVDTGYGLERLVWASQGTPTVYDAIFPEVVGELMELAGVEHRLE
FT                   DEDYANILSQNARLAGLMDVSEKANLLELRKQVASNIGITADKLGTIMEPVETAYAIAD
FT                   HARCITFMLGDGIIPSNVKAGYLARLVIRRTMKMMQDLDIKIPLSDIVQMHINHLPEYP
FT                   EFADRFDVISDILDNEEKKFQETLQRGKKLIQKSAKHYKKKGEKMPLDTVIDMYDSHGI
FT                   PAEISREAASEVGVEVELPDNFYSLVAERHSKSVQEHEKEIPYADRLKKLPPTKRLFYD
FT                   EPNRMEFEAVVLDVFDNNIVLDSTLLYPEGGGQPPDHGTFMVDDALLKVIDVQIFDGIV
FT                   IHTIEEIEDELHIRKGDMVTGKVDEKRRMAHARNHTATHIINDAARQVLGEHIWQAGAQ
FT                   KFADRARLDISHYKRIVPEEINEIEMIANQMVMENKRVISEWMDRSTAEKRYGFSLYQG
FT                   GVPPGDRIRVLHVGSDIEACAGTHCTFTGQVGPIKILKTERIQDGVERIEYAAGEAAVV
FT                   AFQERDKLLRSSAETLRVATEQLPTTIERFFTEWKEFKKENTRLKKELAESRVNQLVEN
FT                   AEQLKEIRLINSRVDGADADELTRMAGELASSDDIVALLISDHEGAKIAAAAGDSAVSK
FT                   GINVGNIVREIANLTGGGGGGKPSMARGGGQDSSKIDEGLALGRRMVEEQLGD"
FT   gene            390636..390911
FT                   /locus_tag="Mmah_0371"
FT   CDS_pept        390636..390911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0371"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q12U24 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35903"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9Q2"
FT                   /protein_id="ADE35903.1"
FT                   /translation="MQTINYMSMVFRGAVEDYETTGVHPSVFLDSSGELQIYLCDPVAA
FT                   EEEFETTYGMGDYEVNGAQFVSDISENENIHEVNYAKLVTPFSMND"
FT   gene            391025..392623
FT                   /locus_tag="Mmah_0372"
FT   CDS_pept        391025..392623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0372"
FT                   /product="choline/carnitine/betaine transporter"
FT                   /note="COGs: COG1292 Choline-glycine betaine transporter;
FT                   InterPro IPR000060; KEGG: dde:Dde_3305
FT                   choline/carnitine/betaine transport; PFAM: BCCT
FT                   transporter; SPTR: A0YTM8 Glycine betaine transporter;
FT                   TIGRFAM: choline/carnitine/betaine transporter; PFAM: BCCT
FT                   family transporter; TIGRFAM: choline/carnitine/betaine
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35904"
FT                   /db_xref="GOA:D5E9Q3"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9Q3"
FT                   /protein_id="ADE35904.1"
FT                   /translation="MQIKASPGFQVNPHVFYVSAVLVLFFVSIGVFFTEKLSVIFGSLQ
FT                   NIIVVNFGWFYILSVAFFLLFVVWLYFSPYGNIRLGKDSDRPEYKDTTWFAMLFSAGMG
FT                   IGLLFYSVAEPILHLASPRDTAPGTIEAAVEAMNLTFFHWGLHAWAIYIVVGLSLAYFS
FT                   YRHDMPLTIRSTMYPLFGDRIYGIRGNIVEVLAIFGTLFGVATSLGLGVMQINAGMDYL
FT                   GLMSVSVNNQILLIVFITLAATTSVMSGLNRGIRILSQVNILLGLTLVTFVFIVGPSVF
FT                   LLGSYVQSIGYYLQNIVYLTFQTDAFTGLEWQKMWTMFYWGWWISWSPFVGMFIARVSR
FT                   GRTIREFIRGVLLAPAIVTFIWIIVFGNTAIHMEVFGNGGIVNAVQTSIPTALYVLLDK
FT                   LPGSLLSSALATIVVMTFFVTSSDSGSLVISILSSGGDPKPAIPLRLFWSLLQGAVAAV
FT                   LLLTGGLVGLQTAALTTALPFCVVLILMCYSISKGLKTEVDGYRVIASEKKPPENTSDN
FT                   KTKQLVGELFEGGSK"
FT   gene            392620..393099
FT                   /locus_tag="Mmah_0373"
FT   CDS_pept        392620..393099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0373"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: psa:PST_0499 choline transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35905"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9Q4"
FT                   /protein_id="ADE35905.1"
FT                   /translation="MNMWEQKLRDIFQMEKKNSGERTTEEMNVRFAELNMRDFFKHVVF
FT                   PAYDDLKKEIEKYGRIVEVNVDDTGMNSASLTVYVPSDKNPDEQVEEFYFEIRGRAYQR
FT                   AGFAFPAHADEEQPRIRKVEILLRNGTVDEYDIENLTREDIIECFVAEYSKWINY"
FT   gene            393149..393937
FT                   /locus_tag="Mmah_0374"
FT   CDS_pept        393149..393937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0374"
FT                   /product="5'-nucleotidase; exopolyphosphatase;
FT                   3'-nucleotidase"
FT                   /EC_number="3.1.3.6"
FT                   /EC_number="3.1.3.5"
FT                   /EC_number="3.6.1.11"
FT                   /note="COGs: COG0496 acid phosphatase; InterPro IPR002828;
FT                   KEGG: ppd:Ppro_2737 stationary phase survival protein SurE;
FT                   PFAM: Survival protein SurE; PRIAM: 5'-nucleotidase; SPTR:
FT                   Q12U23 5'-nucleotidase surE; TIGRFAM: stationary-phase
FT                   survival protein SurE; PFAM: Survival protein SurE;
FT                   TIGRFAM: 5'/3'-nucleotidase SurE"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35906"
FT                   /db_xref="GOA:D5E9Q5"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR030048"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9Q5"
FT                   /protein_id="ADE35906.1"
FT                   /translation="MSKKILLTNDDGVYSAGIRAAYKSVDSLGDVTIAAPAFQQSGVGR
FT                   SISIFEPLRMNRTKIDGVDAYAIGGTPTDSVILGIFSVMKEKPDLIVSGFNIGENISTD
FT                   TATTSGTVGAALEGASYGIPAIAVSIQVIEQGLKFDDLRDYEHDFEVGIRVVNRIAKKV
FT                   LEHGLPENVDVLNVNLPHDVKEDTEIEITRLARKFFNMEVEERHDPRGRPYYWLAGDPM
FT                   PDGEEGTDVHAVTRKGHISITPLSLDSTSRVDNSEIEKLF"
FT   gene            complement(393938..394087)
FT                   /locus_tag="Mmah_0375"
FT   CDS_pept        complement(393938..394087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0375"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q46D83 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35907"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9Q6"
FT                   /protein_id="ADE35907.1"
FT                   /translation="MKVELNVDGENIEINDFVQKILGKTAAASAESLHGVDPTWKEIDI
FT                   HIKK"
FT   gene            394275..395564
FT                   /locus_tag="Mmah_0376"
FT   CDS_pept        394275..395564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0376"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: viral A-type inclusion protein; SPTR: Q64B45
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35908"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9Q7"
FT                   /protein_id="ADE35908.1"
FT                   /translation="MDFLKKLFGKDRDEPEELHLEFENLFEWSKTRYERQVNAAKPLIS
FT                   DLYSVIDNKLEQLRIDKKAFMAATPIESADKKMGKIADSNRDVIVSNLEILDEKIIVPN
FT                   DNSVEGAYAFYTESVSHLDTFLDNTRKSMLYAKSLYPTEYNKINADLANLNHALSDLFS
FT                   AIEKPRNKLDMINNIFVDVEDIHNLESEIMDCRDKIQELENKYSSLDENVQDAKSDLEK
FT                   LIAGSEYPRAEAINSEIEEVRQQLLNVEADIKRMFTPLSKALSRMQKQDENGIHTLSPQ
FT                   VRNILDIVVNDPVSALDHDLDPLYDELILRLQSDSLGLKDKKKDKTLEQVHSIKNSSSL
FT                   KSLYESKTEYNNILRQLRGQLDQMDVYRQKTSMEKDISKKQEALLSTQDKLEDEKKCLE
FT                   SLEEQLVNAKSKLSSHVNDAFEEDIEIHFR"
FT   gene            complement(395577..396497)
FT                   /locus_tag="Mmah_0377"
FT   CDS_pept        complement(395577..396497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0377"
FT                   /product="GTP cyclohydrolase subunit MoaA"
FT                   /note="COGs: COG2896 Molybdenum cofactor biosynthesis
FT                   protein;
FT                   InterProIPR010505:IPR007197:IPR006638:IPR000385:IPR 013485;
FT                   KEGG: dol:Dole_2859 molybdenum cofactor biosynthesis
FT                   protein A; PFAM: Radical SAM domain protein; molybdenum
FT                   cofactor synthesis domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB; SPTR: Q12U21 GTP cyclohydrolase subunit MoaA;
FT                   TIGRFAM: molybdenum cofactor biosynthesis protein A; PFAM:
FT                   Molybdenum Cofactor Synthesis C; Radical SAM superfamily;
FT                   TIGRFAM: probable molybdenum cofactor biosynthesis protein
FT                   A, archaeal"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35909"
FT                   /db_xref="GOA:D5E9Q8"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013485"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9Q8"
FT                   /protein_id="ADE35909.1"
FT                   /translation="MTPEKHLTDSYGRTIKSLRISITDRCNLNCIYCHNEGNMKVADEM
FT                   SAQKISDIIKAASMYGVDRVKFSGGEPLVRRDFEDILKSLPPLKDVSATTNGILLEERA
FT                   RSLKDAGLDRINVSLDSIDDRNYSLITAANPGDVHKVLRGIEKAIEVGLTPVKLNMVML
FT                   KGVNEDKIDQMLEFVRKHKGNTILQLIQLMDFQDVIKYQVDVEEIEKQLEEKADEVRVR
FT                   KMHRRKKYIIDGAEVEVVRPIDNTEFCANCNRLRVTADGKLKPCLLVNDNLVDTKGANA
FT                   EDIPRLLEEVVKKRVPYYRGNVTEG"
FT   gene            396620..397936
FT                   /locus_tag="Mmah_0378"
FT   CDS_pept        396620..397936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0378"
FT                   /product="hydrogenobyrinic acid a,c-diamide synthase
FT                   (glutamine-hydrolyzing); cobyrinate a,c-diamide synthase"
FT                   /EC_number="6.3.5.-"
FT                   /EC_number="6.3.5.9"
FT                   /note="COGs: COG1797 Cobyrinic acid a c-diamide synthase;
FT                   InterPro IPR011698:IPR002586:IPR004484; KEGG: sfu:Sfum_1740
FT                   cobyrinic acid a,c-diamide synthase; PFAM: CobB/CobQ domain
FT                   protein glutamine amidotransferase; Cobyrinic acid
FT                   ac-diamide synthase; SPTR: Q12U20 Cobyrinate a,c-diamide
FT                   synthase / hydrogenobyrinic acid a,c-diamide synthase
FT                   (Glutamine-hydrolyzing); TIGRFAM: cobyrinic acid
FT                   a,c-diamide synthase; PFAM: CobQ/CobB/MinD/ParA nucleotide
FT                   binding domain; CobB/CobQ-like glutamine amidotransferase
FT                   domain; TIGRFAM: cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35910"
FT                   /db_xref="GOA:D5E9Q9"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9Q9"
FT                   /protein_id="ADE35910.1"
FT                   /translation="MKKSIVIAGTHSGVGKTTVSMGIMAALTRRGMNVQPYKVGPDYID
FT                   PTHHTAICGRPSRNLDTFMMGEEGVRQSFHCSYGNADIGVVEGVMGLFDGMNSSDLASS
FT                   AHVAKSLGAPVILVVNVHGMSRSAAALIKGYSEFDSDVRIDGVVLNRVGSPRHAQMIRD
FT                   ALGDVPVVGALPRNQDLTVPSRHLGLHMADERDYDLERLGNFIEENIDLDSVLSLANDP
FT                   RPAAPEECIVNREVDVTIGVAMDSAFCFYYQDMLDYFRRSGAEIKFFSPLEGEIPDVDG
FT                   MYFGGGYPELHIAELEKSRTTHKLKDLSADGMPIYGECGGLQYLCTSYEIEDRIYKMAD
FT                   LFPAETVMTKKLQALGYTKGYADSPIFRGEVRGHEFHYSVTDCACDSRLAYTMERGKGI
FT                   VDGMDGIYEHNSVASYMHAHPGSFPVDDFVQSCRKYKQR"
FT   gene            complement(397939..398745)
FT                   /locus_tag="Mmah_0379"
FT   CDS_pept        complement(397939..398745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0379"
FT                   /product="ExsB family protein"
FT                   /note="COGs: COG1606 ATP-utilizing protein of the PP-loop
FT                   superfamily; InterPro IPR005232; KEGG: dal:Dalk_2473 ExsB
FT                   family protein; SPTR: B8GH89 PP-loop domain-containing
FT                   protein; PFAM: Asparagine synthase; TIGRFAM: conserved
FT                   hypothetical protein TIGR00268"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35911"
FT                   /db_xref="GOA:D5E9R0"
FT                   /db_xref="InterPro:IPR005232"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9R0"
FT                   /protein_id="ADE35911.1"
FT                   /translation="MKNMTNNKLKQLENFIQSTGPIAILFSGGVDSSLLSVVSREVHGD
FT                   KHICILLNSPFIPEYAVRRAKQTANEYGLKLHILDIDPLEYENIRMNPRDRCYHCKKKV
FT                   IEVARKYAASLGYTVIADGTNVSDTQTLRPGLAASREEGILHPFVSANITKADIRQIAK
FT                   QKDCDFWDLPSSACLASRIPYGEMLDAGKLGRAEEGEDILHRMGFLQCRMRLHDGGALA
FT                   RIEVPAEQITTAVLKKDDLIRQLKTTGITHVCLDLEGYRSGSMDET"
FT   gene            complement(398747..399472)
FT                   /locus_tag="Mmah_0380"
FT   CDS_pept        complement(398747..399472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0380"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="COGs: COG0476 Dinucleotide-utilizing protein
FT                   involved in molybdopterin and thiamine biosynthesis family
FT                   2; InterPro IPR007901:IPR000594; KEGG: aeh:Mlg_1160
FT                   molybdopterin biosynthesis protein MoeB; PFAM:
FT                   UBA/THIF-type NAD/FAD binding protein; MoeZ/MoeB domain
FT                   protein; SPTR: Q8TU19
FT                   4-methyl-5-(Beta-hydroxyethyl)thiazole monophosphate
FT                   synthesis protein ThiF; PFAM: MoeZ/MoeB domain; ThiF
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35912"
FT                   /db_xref="GOA:D5E9R1"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9R1"
FT                   /protein_id="ADE35912.1"
FT                   /translation="MLNDVDKELYSRQIMMIGEDGQDKLKGATVLVAGCGGLGSPVLNY
FT                   LAVAGIGHIRLIDKDTVELSNLNRQILHWHRNIGKPKSLSAQEKLGELNPNIKLEAINA
FT                   EINADNADELAQGVDIIVDALDNYDTRVLLNRMAINKGVPLVHGAVHGFHGQVTTIIPG
FT                   KTPCIECLIPEKPPKEIFPIIGCTAGIVGTMQANEVIKYLLGREDLHSGHIVMWDGRSG
FT                   TLDRMKICRRMDCPECGHL"
FT   gene            complement(399462..399866)
FT                   /locus_tag="Mmah_0381"
FT   CDS_pept        complement(399462..399866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0381"
FT                   /product="FeS cluster assembly scaffold protein NifU"
FT                   /note="COGs: COG0822 NifU homolog involved in Fe-S cluster
FT                   formation; InterPro IPR002871:IPR017787; KEGG:
FT                   dol:Dole_0755 NifU domain-containing protein; PFAM:
FT                   nitrogen-fixing NifU domain protein; SPTR: Q2FNE5
FT                   Nitrogen-fixing NifU-like; TIGRFAM: FeS cluster assembly
FT                   scaffold protein NifU; PFAM: NifU-like N terminal domain;
FT                   TIGRFAM: SUF system FeS assembly protein, NifU family; FeS
FT                   cluster assembly scaffold IscU; FeS cluster assembly
FT                   scaffold protein NifU, Clostridium type"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35913"
FT                   /db_xref="GOA:D5E9R2"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR017787"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9R2"
FT                   /protein_id="ADE35913.1"
FT                   /translation="MMYSEKVMEHFMNPHNVGEMEDADGVGEVGNPQCGDIMRIYLKIE
FT                   DNVIADAKFMTFGCGAAIASSSMATELIKGKTLEQAWKVTNKAVAEALEGLPPVKMHCS
FT                   VLAEEGIHKAINDYREKQGLKPLEEKPDAE"
FT   gene            complement(399872..401065)
FT                   /locus_tag="Mmah_0382"
FT   CDS_pept        complement(399872..401065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0382"
FT                   /product="cysteine desulfurase NifS"
FT                   /EC_number="2.8.1.7"
FT                   /note="COGs: COG1104 Cysteine sulfinate
FT                   desulfinase/cysteine desulfurase;
FT                   InterProIPR001597:IPR000192:IPR020578:IPR006025:IPR 017772;
FT                   KEGG: sat:SYN_01251 cysteine desulfurase / selenocysteine
FT                   lyase; PFAM: aminotransferase class V; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; SPTR: A2SQ36
FT                   Aminotransferase, class V; TIGRFAM: cysteine desulfurase
FT                   NifS; PFAM: Aminotransferase class-V; TIGRFAM: cysteine
FT                   desulfurase NifS"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35914"
FT                   /db_xref="GOA:D5E9R3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR017772"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9R3"
FT                   /protein_id="ADE35914.1"
FT                   /translation="MKNNNKNTGNTVYLDHAATTFTDPVVLETMLPYFTENFGNPSSPY
FT                   NIAHISREALDKARQQVADAINADTEEIYFTSGGTESDNWAIKGVAFANRKRGNHIITS
FT                   AIEHHAVLHTCQWLEKQGFEVTYLPVDKYGQVRTEDVKRAIRGDTILISVMLANNEIGT
FT                   IQPIPEIGRIARKKGIYFHTDAVQGIGQIPVDVEALNVDLLSLSSHKFYGPKGVGALYI
FT                   KKGSRIDNHSHGGAQEKKKRAGTENVPGIVGMGAAIEQAISQLEEHAAHMKKLRTRLLE
FT                   GLLQIPATHLAGHPEKRLPNNVNVIFEYIEGESILLMLNSFSIAASTGSACTSASLEPS
FT                   HVLIACGFPHEIAHGSLRLTLGKENTEDDVDYVLQIIEPIIKRLRAMSPMTPEELRK"
FT   gene            401272..401607
FT                   /locus_tag="Mmah_0383"
FT   CDS_pept        401272..401607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0383"
FT                   /product="transcriptional regulator protein"
FT                   /note="COGs: COG2522 transcriptional regulator protein;
FT                   SPTR: Q12Z32 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35915"
FT                   /db_xref="GOA:D5E9R4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9R4"
FT                   /protein_id="ADE35915.1"
FT                   /translation="MKRENMKIETPCQVVVWDVLPAIRAALAKELVDNGVTQQEVARLF
FT                   GMAPSAVSQYLTKKRGYRIEFDDNIKVSIANLAADIQNGKVDDLSHRFCDICRQLRADD
FT                   ACPAGED"
FT   gene            401705..401775
FT                   /locus_tag="Mmah_R0004"
FT   tRNA            401705..401775
FT                   /locus_tag="Mmah_R0004"
FT                   /product="tRNA-Cys"
FT   gene            401790..403169
FT                   /locus_tag="Mmah_0384"
FT   CDS_pept        401790..403169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0384"
FT                   /product="Sep-tRNA:Cys-tRNA synthase"
FT                   /EC_number="2.5.1.-"
FT                   /note="COGs: COG1103 pyridoxal phosphate-dependent protein;
FT                   InterPro IPR008829:IPR001597:IPR000192:IPR013375; KEGG:
FT                   hha:Hhal_0536 SufS subfamily cysteine desulfurase; PFAM:
FT                   Soluble liver antigen/liver pancreas antigen; aromatic
FT                   amino acid beta-eliminating lyase/threonine aldolase;
FT                   aminotransferase class V; SPTR: B8GHE2 Sep-tRNA; TIGRFAM:
FT                   Sep-tRNA; PFAM: Soluble liver antigen/liver pancreas
FT                   antigen (SLA/LP autoantigen); TIGRFAM: Sep-tRNA:Cys-tRNA
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35916"
FT                   /db_xref="GOA:D5E9R5"
FT                   /db_xref="InterPro:IPR008829"
FT                   /db_xref="InterPro:IPR013375"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9R5"
FT                   /protein_id="ADE35916.1"
FT                   /translation="MKGAKDHLIGKTFEALFELEDMREVIRRSLPTGMSATEETAFMES
FT                   TANLKSVIEDLEKGTSENQTNFPQIVDRIGLRYREEGSINIQPIQAAGRLTPEARKALI
FT                   SYGDGYSTCDSCRKPFRLDKISRPPIADFHEELAGFVNMDTARVVPGARRGFQAVTSSL
FT                   VGKGDSVIVSSLAHYTEFLAVEAAGGKVREIPLDHGNKVDIDSMAEKIEDVIREDGKPP
FT                   SLMMMDHYDYQYANQHDIRSIAKVAHDYDIPVLYNGAYTVGVMPVDAKKLGADFVVGSG
FT                   HKSMASPAPSGILATTDEYSDLVFRTTRMKGDVTGRKFGIKEVEMMGCTLMGGTLLAMM
FT                   ASFPHVKERTQNWDEEVRNSNRFIEEFLKIEGNKVLSEYPRRHTLTKVDTTHTFDKVAK
FT                   EHKRRGFFLSDELSKLGIVGMFPGATRAWKLNTYGLSREKIDYLSDAFKEIAVKYNLNV
FT                   D"
FT   gene            403180..404484
FT                   /locus_tag="Mmah_0385"
FT   CDS_pept        403180..404484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0385"
FT                   /product="O-acetylhomoserine sulfhydrolase"
FT                   /EC_number="2.5.1.49"
FT                   /note="COGs: COG2873 O-acetylhomoserine sulfhydrylase;
FT                   InterPro IPR000277:IPR006235; KEGG: geo:Geob_1890
FT                   O-acetylhomoserine/O-acetylserine sulfhydrylase; PFAM:
FT                   Cys/Met metabolism pyridoxal-phosphate-dependent protein;
FT                   PRIAM: O-acetylhomoserine aminocarboxypropyltransferase;
FT                   SPTR: B8GHE1 O-acetylhomoserine/O-acetylserine
FT                   sulfhydrylase; TIGRFAM: O-acetylhomoserine/O-acetylserine
FT                   sulfhydrylase; PFAM: Cys/Met metabolism PLP-dependent
FT                   enzyme; TIGRFAM: OAH/OAS sulfhydrylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35917"
FT                   /db_xref="GOA:D5E9R6"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9R6"
FT                   /protein_id="ADE35917.1"
FT                   /translation="MSRSNNYNPETLSIHAGQKPDPTTGSRAVPIYQTTAYVFDDTEHA
FT                   ANLFALKEFGNIYTRLMNPTTDVFEKRMAAIEGGTGSLAVSSGMSAISLALLTITRLGD
FT                   EIVAADNLYGGTYQLFNHTFPKLGRSTTFVDSTNPEAFRQVINENTRAVYIESIGNPKL
FT                   DVPDFEAIAAIAHEADIPLVVDNTVGVGLVKPIEHGADIVVLSATKYVCGHGTSLGGVI
FT                   IDSGNFDWGSGKFPEFTEPDPSYHGLVYWDAFKDVPGMGNIAFVLKARVQWLRDLGAAV
FT                   SPFNSFLFLQGLETLFLRVKKHSENAFEIARFLQDHPKVAWVNYPGFEDHISHERAEKY
FT                   LDGGFGPIVGFGIKGGLEAGKQFIENLELFSHLANIGDAKSLVVHPASTTHQQLTPEEQ
FT                   ASTSVTPDYIRLSIGIEDAKDLIADLDQALNEVDV"
FT   gene            404481..405932
FT                   /locus_tag="Mmah_0386"
FT   CDS_pept        404481..405932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0386"
FT                   /product="homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /note="COGs: COG2021 Homoserine acetyltransferase; InterPro
FT                   IPR000073:IPR000644:IPR006296; KEGG: dol:Dole_0752
FT                   homoserine O-acetyltransferase; PFAM: CBS domain containing
FT                   protein; alpha/beta hydrolase fold; PRIAM: Homoserine
FT                   O-acetyltransferase; SMART: CBS domain containing protein;
FT                   SPTR: A7I9Z6 Homoserine O-acetyltransferase; TIGRFAM:
FT                   homoserine O-acetyltransferase; PFAM: CBS domain;
FT                   alpha/beta hydrolase fold; TIGRFAM: homoserine
FT                   O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35918"
FT                   /db_xref="GOA:D5E9R7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:D5E9R7"
FT                   /protein_id="ADE35918.1"
FT                   /translation="MTERSVGYVETKHHHLKEPFRLVSGDELAEVSIAYETYGKLNSDK
FT                   SNVILICHALTGDAHAAGWHEGDKKPGWWDIVIGPGKAFDTNKYFIICSNVLGGCKGTT
FT                   GPSSTNPQSGLPYGLSFPRITIEDMVNLQHTLLNNLGISRLYAIAGGSMGGMQVLQWAV
FT                   SYPGFMKRSIVLASTAISSPQQIAFNEVARQAIIRDPYWNDGDYYGVELPKQGLSLARM
FT                   IGHITYLSDDSMHDKFGRDIRENEMFQVESYLHHQGDTFTSRFDPNSYLYLTGAIDKFD
FT                   LSNGYSLAKTFSNIESEFMVISVSSDWLYPSYQSEEIVQALGSNDVDVQYRKLISHFGH
FT                   DAFLLEKGQLNYLLSTFLGHLTVGDVMSEDVSTLHEGCTLEEAAQLMILKNATHIPILA
FT                   TSGRITGIVTSWDITRAVANKISSIENILSRDILTSRPDESLSSAALVMEDHAISALPV
FT                   VDDRGCLVGILSSDTISAMVGKGTK"
FT   gene            complement(405957..407012)
FT                   /locus_tag="Mmah_0387"
FT   CDS_pept        complement(405957..407012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0387"
FT                   /product="DNA primase, large subunit"
FT                   /note="COGs: COG2219 Eukaryotic-type DNA primase large
FT                   subunit; InterPro IPR007238; KEGG: Prim2; primase, DNA,
FT                   polypeptide 2; K02685 DNA primase large subunit; PFAM: DNA
FT                   primase, large subunit; SPTR: Q12U19 Probable DNA primase
FT                   large subunit; PFAM: Eukaryotic and archaeal DNA primase,
FT                   large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35919"
FT                   /db_xref="GOA:D5E9R8"
FT                   /db_xref="InterPro:IPR007238"
FT                   /db_xref="InterPro:IPR023642"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9R8"
FT                   /protein_id="ADE35919.1"
FT                   /translation="MERAELALYPFTSAASQYVGELDFELDRLINSRAFQSARLRGEER
FT                   LIQSLTSGIRKPSLTNTDEGRVLTELLSYPYAKILVSCLNDPYLNRKYSHAEAEAAYSL
FT                   LLEREDFFLREIGEEFGIHAKQHERGFHLHFADFLKYSTTLKAIEWKLINQRMVHGNVF
FT                   VERKDFARLLQEAIKKSIHESLPLKVPEKTCTDCSGALSRLKEILQQKKGDVENGQMGE
FT                   VDSKLFPPCINYAINNVRTGVNLAHSMRFAMTSFLTGIGMTIDDIINMFNVSPDFDEEK
FT                   TRYQIEHIAGSSGTKYTPPSCSTMKTYGNCHGADELCKKINHPLNYYRRKMWYKNKFKK
FT                   PANTKEKKGTE"
FT   gene            complement(407016..407753)
FT                   /locus_tag="Mmah_0388"
FT   CDS_pept        complement(407016..407753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0388"
FT                   /product="monomeric archaeal DNA polymerase sliding clamp"
FT                   /note="COGs: COG0592 DNA polymerase sliding clamp subunit
FT                   (PCNA homolog); InterPro IPR000730; KEGG: hypothetical
FT                   protein; K04802 proliferating cell nuclear antigen; PFAM:
FT                   Proliferating cell nuclear antigen, PCNA; SPTR: Q12U18 DNA
FT                   polymerase sliding clamp; TIGRFAM: proliferating cell
FT                   nuclear antigen PcnA; PFAM: Proliferating cell nuclear
FT                   antigen, N-terminal domain; Proliferating cell nuclear
FT                   antigen, C-terminal domain; TIGRFAM: proliferating cell
FT                   nuclear antigen (pcna)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35920"
FT                   /db_xref="GOA:D5E9R9"
FT                   /db_xref="InterPro:IPR000730"
FT                   /db_xref="InterPro:IPR022648"
FT                   /db_xref="InterPro:IPR022649"
FT                   /db_xref="InterPro:IPR022659"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9R9"
FT                   /protein_id="ADE35920.1"
FT                   /translation="MLEATIDASLLKDSIESLSVLVDEARVHISPEGIGVKAVDPANVA
FT                   MVSFELQADAFDEYKAEESEIGLDLTRVLDILGVAEKTDKVKMKLEEDSRKLSISIGGI
FT                   SYTLTLLDPSTIRAEPRIPQLELPAEIVINGKGFSRTVKAAEKISDHMSMGVEGETFFL
FT                   EAEGDTERMRQEMPRDELISITPGPARSLFSLDYLSDIVKPASKSNEVTLQIGNDFPIK
FT                   INFEIAGGRGKVGYLLAPRIESE"
FT   gene            complement(407837..408151)
FT                   /locus_tag="Mmah_0389"
FT   CDS_pept        complement(407837..408151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0389"
FT                   /product="DNA-directed RNA polymerase, subunit M"
FT                   /EC_number="2.7.7.6"
FT                   /note="COGs: COG1594 DNA-directed RNA polymerase subunit
FT                   M/Transcription elongation factor TFIIS; InterPro
FT                   IPR001529:IPR001222:IPR019761:IPR006288; KEGG: hypothetical
FT                   protein; K03019 DNA-directed RNA polymerase III subunit
FT                   C11; PFAM: Transcription factor TFIIS; DNA-directed RNA
FT                   polymerase, M/15 kDa subunit; SMART: Transcription factor
FT                   TFIIS; DNA-directed RNA polymerase, M/15 kDa subunit; SPTR:
FT                   Q12U17 DNA-directed RNA polymerase, subunit M; TIGRFAM:
FT                   transcription factor S; PFAM: RNA polymerases M/15 Kd
FT                   subunit; Transcription factor S-II (TFIIS); TIGRFAM:
FT                   transcription factor S, archaeal"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35921"
FT                   /db_xref="GOA:D5E9S0"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR001529"
FT                   /db_xref="InterPro:IPR006288"
FT                   /db_xref="InterPro:IPR012164"
FT                   /db_xref="InterPro:IPR019761"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9S0"
FT                   /protein_id="ADE35921.1"
FT                   /translation="MEFCPKCKSMMFPSDGDLKCRKCGYEKSREEGAETMVSKTKRDER
FT                   EVTVLEENVDEGLPTTLAQCPECGNNKAYWWMRQLRSADESETRFFKCTKCSYTWREYD
FT                   "
FT   gene            complement(408129..408545)
FT                   /locus_tag="Mmah_0390"
FT   CDS_pept        complement(408129..408545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0390"
FT                   /product="NUDIX hydrolase"
FT                   /note="COGs: COG1051 ADP-ribose pyrophosphatase; InterPro
FT                   IPR020476:IPR000086:IPR020084; KEGG: sfu:Sfum_1206 NUDIX
FT                   hydrolase; PFAM: NUDIX hydrolase; SPTR: Q12U16 NUDIX
FT                   hydrolase; PFAM: NUDIX domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35922"
FT                   /db_xref="GOA:D5E9S1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9S1"
FT                   /protein_id="ADE35922.1"
FT                   /translation="MRPKTPLLTVDGVIILNGKIVLIRRKNEPYRGSFALPGGFVEIGE
FT                   TTEEAVKREVMEETGLLIEILKLVGVYSEPSRDPRGHTVSVAYLAVGKGEPRADTDAAE
FT                   VGCFDPGNLPELAFDHQRIINDAGDDIDGILSKM"
FT   gene            408609..409430
FT                   /locus_tag="Mmah_0391"
FT   CDS_pept        408609..409430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0391"
FT                   /product="Exosortase EpsH-related protein"
FT                   /note="COGs: COG4083 membrane protein; InterPro IPR019127;
FT                   PFAM: Exosortase EpsH-related; SPTR: Q12U15 Putative
FT                   uncharacterized protein; PFAM: Transmembrane exosortase
FT                   (Exosortase_EpsH)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35923"
FT                   /db_xref="GOA:D5E9S2"
FT                   /db_xref="InterPro:IPR014522"
FT                   /db_xref="InterPro:IPR026392"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9S2"
FT                   /protein_id="ADE35923.1"
FT                   /translation="MTDYILLIAIGLMILSAILPGKLSYRKLIGAFGWISFGAHWAYQP
FT                   IHYMGINDYFNVFLTIMIACFCLMMAYSMIDEYRTGILPVTNLDITSMVTSATAIGSLF
FT                   YFPFAQLPSLNYWIIATVTDNITWLLGVLGYQVTQDAWNLISYNGYTVEIILACTAIES
FT                   IALFSGLIVSVRAPAFKLFQAFIVSVPVIYILNIFRDVFVIIAYGEQWFGAESFEIAHH
FT                   MIAKMGSALALFVIGYAVLKILPQLFDLIDGLVSLSRFRLKGIIDKIAGNR"
FT   gene            409431..410132
FT                   /locus_tag="Mmah_0392"
FT   CDS_pept        409431..410132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0392"
FT                   /product="phosphatidylserine decarboxylase related protein"
FT                   /EC_number="4.1.1.65"
FT                   /note="COGs: COG0688 Phosphatidylserine decarboxylase;
FT                   InterPro IPR003817:IPR004428; KEGG: bbt:BBta_3505
FT                   phosphatidylserine decarboxylase; PFAM: phosphatidylserine
FT                   decarboxylase-related; PRIAM: Phosphatidylserine
FT                   decarboxylase; SPTR: Q12U14 Phosphatidylserine
FT                   decarboxylase proenzyme; TIGRFAM: phosphatidylserine
FT                   decarboxylase related protein; PFAM: Phosphatidylserine
FT                   decarboxylase; TIGRFAM: phosphatidylserine decarboxylase
FT                   precursor-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35924"
FT                   /db_xref="GOA:D5E9S3"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033175"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9S3"
FT                   /protein_id="ADE35924.1"
FT                   /translation="MLAKGSHSWVFTALLLTIAMGFMYVTSRLQIFIPQFMLDMPLLGG
FT                   NTFFLSLFSGWQIFLYSTFGFGLLTVFFVVFFRDPKRDSTLCKSCILAPADGKISDIRG
FT                   RKVCIFMNINNVHVNRAPFCGKVLSVKHFKGGYLPAFTKDSSRNERTNIMLQTSAGKIE
FT                   VTQIAGFLARRIVTYVEEGDDVLQGEKIGMIRLGSRVDVTIPEGFDICVSKGDKVYAGD
FT                   TKIAKTPHHER"
FT   gene            410136..410819
FT                   /locus_tag="Mmah_0393"
FT   CDS_pept        410136..410819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0393"
FT                   /product="CDP-diacylglycerol/serineO-phosphatidyltransfera
FT                   se"
FT                   /note="COGs: COG1183 Phosphatidylserine synthase; InterPro
FT                   IPR000462:IPR004533; KEGG: nam:NAMH_0138
FT                   CDP-diacylglycerol--serine O-phosphatidyltransferase; PFAM:
FT                   CDP-alcohol phosphatidyltransferase; SPTR: A3QPW9
FT                   Phosphatidylserine synthase; TIGRFAM:
FT                   CDP-diacylglycerol/serine O-phosphatidyltransferase; PFAM:
FT                   CDP-alcohol phosphatidyltransferase; TIGRFAM:
FT                   CDP-diacylglycerol--serine O-phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35925"
FT                   /db_xref="GOA:D5E9S4"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="InterPro:IPR026475"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9S4"
FT                   /protein_id="ADE35925.1"
FT                   /translation="MDIFKDLVLPDIMTLTNAVFGLMAIFAAFSGHIELGFVFVLVAAV
FT                   ADGMDGYLARTISQGPMGEYLDSLADAVSFGVAPSCLVFLGVSGPLRYAAGLFACLYLV
FT                   CGILRLARFNTKKKTIPDFEGLPITASAVVLSSYALLAPRYIYTWVIFGLVVLLCYLMI
FT                   SDHPYPKLRGPRAMGAVSILFFSTILSYFLLNSYMWVFSTILFLSLMLYLESPIMRIPR
FT                   QYYEK"
FT   gene            complement(410859..413468)
FT                   /locus_tag="Mmah_0394"
FT   CDS_pept        complement(410859..413468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0394"
FT                   /product="ATP-dependent chaperone ClpB"
FT                   /note="COGs: COG0542 ATPase with chaperone activity
FT                   ATP-binding subunit;
FT                   InterProIPR001270:IPR003959:IPR019489:IPR013093:IPR
FT                   011704:IPR004176:IPR003593:IPR018368:IPR017730; KEGG:
FT                   sfu:Sfum_0263 ATPase; PFAM: ATPase AAA-2 domain protein;
FT                   Clp ATPase-like; AAA ATPase central domain protein; ATPase
FT                   associated with various cellular activities AAA_5; Clp
FT                   domain protein; SMART: AAA ATPase; SPTR: A3QPW8 ClpB;
FT                   TIGRFAM: ATP-dependent chaperone ClpB; PFAM: AAA domain
FT                   (Cdc48 subfamily); C-terminal, D2-small domain, of ClpB
FT                   protein; Clp amino terminal domain; ATPase family
FT                   associated with various cellular activities (AAA); TIGRFAM:
FT                   ATP-dependent chaperone ClpB"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35926"
FT                   /db_xref="GOA:D5E9S5"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9S5"
FT                   /protein_id="ADE35926.1"
FT                   /translation="MDLNNFTQKAQEAIQNSRTIAARYYHQQIDSEHLFLSLLEQREGL
FT                   VPSLLERMNISSAMVKEQLEKHMSGLGQVSGPGSENVYFTQKAIRVLDNAATLASKMND
FT                   EYTSVEHILVSLVREKDSYSKKLLEEFGADEQRLKQAIKEIRGNRRVTSENPEDTYEPL
FT                   EKYGIDFTELANQGKLDPVIGRDHEIRHTIEILSRRRKNNPVLIGEAGVGKTAIVEGLA
FT                   QRIAKKDVPDAMKNKRIVALDMGSLVAGAKFRGEFEERLKAVLKEVAESEGLIILFIDE
FT                   LHTIVGAGATEGAMDAGNLLKPMLARGELHCIGATTLDEYRKYIEKDAALERRFMPVMV
FT                   NAPDVENTISILRGLKEKYEVHHGVRIKDSALVAAAVLSDRYISDRFLPDKAIDLLDEA
FT                   ASKVKTAIDSKPASLDEADRKLMQLEIEKEALKKEKDAASKERLQSLEKEISEIRAESD
FT                   AMRTRWENEKATIAKLNSLKEQIDDTKTQLDLAETEGDFEKASRLKYGTLVPLQHEYEE
FT                   EENRLKEKQTNMLLKEEVDEEDIAHVVSEWTRIPITKLMEGERDKLVHLEDRLHERVIG
FT                   QDEAVKAVSDAVIRAHAGIKDPRRPIGSFIFLGPTGVGKTELAKALATELFDSEDHMIR
FT                   IDMSEYMEKHTVARLIGAPPGYIGHDEGGQLTEAVRRNPYSVVLFDEIEKAHHDVFNIM
FT                   LQLLDDGRLTDSKGRTVDFKNTIVIMTSNICVDYAISKLEEGVAYSKMQETAMNELTKH
FT                   FRPEFLNRIDEIAIFRALTKDQLTYIVDIKIEDLVQRLKERRIDLEITDRAKKYLGDAG
FT                   YSETYGARPLKRVIQNELETEVGKRIVSKEVMESDTVVVDADERGLNFKVRKGEEHT"
FT   gene            complement(413601..415211)
FT                   /locus_tag="Mmah_0395"
FT   CDS_pept        complement(413601..415211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0395"
FT                   /product="chaperonin GroEL"
FT                   /note="COGs: COG0459 Chaperonin GroEL (HSP60 family);
FT                   InterPro IPR017998:IPR001844:IPR002423:IPR018370; KEGG:
FT                   rec:RHECIAT_PC0000530 chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1; SPTR: A3QPW7 GroEL; TIGRFAM: chaperonin GroEL;
FT                   PFAM: TCP-1/cpn60 chaperonin family; TIGRFAM: chaperonin
FT                   GroL"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35927"
FT                   /db_xref="GOA:D5E9S6"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9S6"
FT                   /protein_id="ADE35927.1"
FT                   /translation="MTTKQITFDENARQALLAGIDKVSNTVKVTLGPKGRNVVLDKSGN
FT                   PTVTNDGVTIAKEIELKDKFENMGAKLVKEVASRTQDNTGDGTTTATLLAQAMISEGIR
FT                   NITAGANPIEIKRGIDKATAKVVEYLQTQSKEVKDRERIIQVGTISANNDEEIGKLISD
FT                   AMDRVGYNGVITVDDSKTMETSLEVVEGMQFDRGYVSPYMATDQEKMVCELENPYILLT
FT                   DKKINNVNQIVPVLEKVAQEGKPLLIVAQDVEGDAQAALILNIMRGSLKVSAVKAPGFG
FT                   NDQKDMLEDLAALTGGTVVSEDKGMKLEDVTDDMLGSAHKVSVDKQKTTIIEGKGDKNA
FT                   IESRMEMIESQINITDAEYKKKELQKRLAKLGGGVAVIKVGAATETELEEKKMRIDDAL
FT                   NATKAAVEEGVVAGGGVTLFHAIPYLEKIELEEDQMVGANIVKKALEAPLRQIAHNAGK
FT                   EGAEVIALIKAEADEEVGYNAKKGIVENLYNAGVIDPTKVVRSGLQNAASIAGMVLSTE
FT                   ALVAEYDEEKDENAPAIII"
FT   gene            complement(415229..415504)
FT                   /locus_tag="Mmah_0396"
FT   CDS_pept        complement(415229..415504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0396"
FT                   /product="chaperonin Cpn10"
FT                   /note="COGs: COG0234 Co-chaperonin GroES (HSP10); InterPro
FT                   IPR001476; KEGG: scl:sce5910 GroES-like protein; PFAM:
FT                   chaperonin Cpn10; SPTR: A3QPW6 GroES; PFAM: Chaperonin 10
FT                   Kd subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35928"
FT                   /db_xref="GOA:D5E9S7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9S7"
FT                   /protein_id="ADE35928.1"
FT                   /translation="MNVKPVGERVLIKPIKEEEVTSGGIYIPESAQKEKKEGNVVAVGT
FT                   YEDGKELPVKKGDHIIYGGFQSDEMEMDGEKYLFIDFKDVLAIVEE"
FT   gene            415672..416079
FT                   /locus_tag="Mmah_0397"
FT   CDS_pept        415672..416079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0397"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR000485; SPTR: Q8PW08 Conserved protein;
FT                   PFAM: Sugar-specific transcriptional regulator TrmB"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35929"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9S8"
FT                   /protein_id="ADE35929.1"
FT                   /translation="MSRQIILLNLEKPREKDPEKDLHWLCDSFGLSSGRDVENTANQIV
FT                   MTLLDNIAENERVSSEMIAEALGINLSRVNHHVRNLVKAGLVYREKRLLYLRGGSLKAA
FT                   VHEMRKDSERMFDELEVIASEIDRQKGISNR"
FT   gene            416248..417042
FT                   /locus_tag="Mmah_0398"
FT   CDS_pept        416248..417042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0398"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1119 ABC-type molybdenum transport system
FT                   ATPase component/photorepair protein PhrA; InterPro
FT                   IPR003439:IPR003593; KEGG: scl:sce8517 ABC transporter,
FT                   ATP-binding protein; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase; SPTR: Q8TJV1 ABC transporter, ATP-binding
FT                   protein; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35930"
FT                   /db_xref="GOA:D5E9S9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9S9"
FT                   /protein_id="ADE35930.1"
FT                   /translation="MNKKNAKPMIIEMEKVTVCKKGNILLDNFSLNIKTGENVAIIGPN
FT                   GAGKSSFIRTVTGDLRPLHSEKTFVRLFGKERWNVFGLRNKMGIISGDLQDEYMRNIPG
FT                   IEVVVSGFFSSIGLYRNHSISRDMKRRAHEVLGFLGIEYLALRPINEMSTGQARRLLVA
FT                   RALVHDPDVLILDEPTNSLDLRARHIFRQSMRTIASKGKNIILVTHNLEDLIPEIDKVV
FT                   LLSEGSVYRDGPMDEILTAENLSDIFGVQVQVFSEGGYYHVW"
FT   gene            complement(417043..418386)
FT                   /locus_tag="Mmah_0399"
FT   CDS_pept        complement(417043..418386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0399"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="COGs: COG1249 Pyruvate/2-oxoglutarate dehydrogenase
FT                   complex dihydrolipoamide dehydrogenase (E3);
FT                   InterProIPR013027:IPR000103:IPR000815:IPR001327:IPR
FT                   004099:IPR012999; KEGG: gbm:Gbem_3786 pyridine
FT                   nucleotide-disulphide oxidoreductase dimerisation region;
FT                   PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; SPTR: Q46EZ2
FT                   Glutathione reductase (NADPH); PFAM: Pyridine
FT                   nucleotide-disulphide oxidoreductase; Pyridine
FT                   nucleotide-disulphide oxidoreductase, dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35931"
FT                   /db_xref="GOA:D5E9T0"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9T0"
FT                   /protein_id="ADE35931.1"
FT                   /translation="MAREYDIVIIGTGVAGTVCANKASAAGMKIAITDIREYGGTCALR
FT                   GCVPKKVLVGVAETVEQVNRFNKLGIMPQSSVNWNKLMDFKQTFVDNFPQNKEEKFTNM
FT                   DIDTYHGGAKFVSKNEVKIADTILKGKHILIAPGSVPRKTGIKGEENLITSEQFLNLDE
FT                   LPRKIVFVGGGYISFELAHIAARAGSQVTILQRSEVLKQFDRDMVKLLVKASEEAGINV
FT                   NTGISVSSVESTSSGFTVNTRNREGKESRIECDLVVNGSGRIAALEGMELEKGNVETKD
FT                   GFVETNDYMQSVSNPYVYAAGDCVKPGAPLTPVASLQGTTAADNMIKGNVKTVDYTGIP
FT                   STVFTLPPLSSVGISLSESTDRYEVLIHDRSHWYNSRRLSENYAASKVIIEKESQKIAG
FT                   AHILGSHSEEVINIFAMAIRLGLTLSQFKKVVYVFPTVSSEIQSMIRG"
FT   sig_peptide     complement(418312..418386)
FT                   /locus_tag="Mmah_0399"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(418450..419919)
FT                   /locus_tag="Mmah_0400"
FT   CDS_pept        complement(418450..419919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0400"
FT                   /product="replication factor C large subunit"
FT                   /note="COGs: COG2812 DNA polymerase III gamma/tau subunits;
FT                   InterPro IPR003959:IPR003593; KEGG: replication factor C
FT                   subunit 1; K10754 replication factor C subunit 1; PFAM: AAA
FT                   ATPase central domain protein; SMART: AAA ATPase; SPTR:
FT                   Q12TX1 Replication factor C large subunit; PFAM: ATPase
FT                   family associated with various cellular activities (AAA)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35932"
FT                   /db_xref="GOA:D5E9T1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR023935"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9T1"
FT                   /protein_id="ADE35932.1"
FT                   /translation="MTIAQDWAEKYRPAKLADVVGNNKPLQALRDWEEEWEHGVPEKKA
FT                   AILSGPAGVGKTSAAHALGNEMGWEIIEMNASDQRTAGIIEKVAGSASRMSTLTGIQKR
FT                   LIILDEADNMHGSADRGGTRAITNVIKKSNQPIILIANDLYALSSTLRSHCVNIKFNPI
FT                   PQRSILPALKKICKMEGIMCGTGVLEKIAENTGGDLRSAIKDLQATATDKKEIEVADVT
FT                   TAERDTKESIFKVLTKVFKGREPIEAYRATFSLDETPEDLIQWVDENLPNQYLDKDETI
FT                   NEDITAAYQNLSRADTYLGRVRLRQNYGLWRYAGFLLSGGTAMAKKHSHSGFRKLQPPS
FT                   MWRRMGQLRSKRNMRDNIAAKVGLHCNEPIRDCRIDLLRMYGLLLKNEDYAVDAAYTLE
FT                   LDVDEIAYLTESKKVTKKIQKIYDASREMMHEKEDEDIDVFMHAPEKDNGQSTLDSMFS
FT                   AEKDPAEENQMDGKEKDNPKPAKSQKTLFDF"
FT   gene            420008..420850
FT                   /locus_tag="Mmah_0401"
FT   CDS_pept        420008..420850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0401"
FT                   /product="methanogen marker protein 4"
FT                   /note="COGs: COG4002 phosphotransacetylase; InterPro
FT                   IPR016764; KEGG: dac:Daci_2106 malic enzyme; SPTR: Q12TX0
FT                   N5-methyl-tetrahydromethanopterin--coenzyme M
FT                   methyltransferase subunit X; TIGRFAM: methanogen marker
FT                   protein 4; TIGRFAM: putative methanogen marker protein 4"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35933"
FT                   /db_xref="GOA:D5E9T2"
FT                   /db_xref="InterPro:IPR016764"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9T2"
FT                   /protein_id="ADE35933.1"
FT                   /translation="MQKKTDGLLDIIRTRALDNCPRVALGVRNPTPKLIQSAEKAEVEG
FT                   YARVVLVGDQRDISAIGTNLEVIDTPQPEEVLGSLLASGDVDAAVRGTAKASGTLSHLK
FT                   EILGIEKLYRVAFLLTHDNNPFFLAPVGIDEGHSLSDKIELVKRSAAYIRRFGIEPEVG
FT                   ILSGGRMGDLGRDERVDRTLADADFLANRLNDAGIDAKHYTILIEDAIRESNFILAPDG
FT                   ISGNLIFRSLVFLGGGNGIGAPVLMDRHVFIDTSRVGGHYTLAIMLAASLVSNKREVV"
FT   gene            420852..421436
FT                   /locus_tag="Mmah_0402"
FT   CDS_pept        420852..421436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0402"
FT                   /product="tetrahydromethanopterin S-methyltransferase,
FT                   subunit A"
FT                   /EC_number="2.1.1.86"
FT                   /note="COGs: COG4063 Tetrahydromethanopterin
FT                   S-methyltransferase subunit A; InterPro IPR013340; KEGG:
FT                   dar:Daro_2280 tetrahydromethanopterin S-methyltransferase
FT                   subunit A; PFAM: Tetrahydromethanopterin
FT                   S-methyltransferase subunit A domain protein; PRIAM:
FT                   Tetrahydromethanopterin S-methyltransferase; SPTR: O32854
FT                   Putative methyltransferase mtx subunit A; PFAM:
FT                   Tetrahydromethanopterin S-methyltransferase, subunit A;
FT                   TIGRFAM: N5-methyltetrahydromethanopterin:coenzyme M
FT                   methyltransferase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35934"
FT                   /db_xref="GOA:D5E9T3"
FT                   /db_xref="InterPro:IPR030688"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9T3"
FT                   /protein_id="ADE35934.1"
FT                   /translation="MDTVSEKWPVTKGDFSAGNTKSCIAVVTLASSMPLFEKAAIWGSC
FT                   KTENLGAEKVVMNVVSNCNIRYVLLCGGESRGHLAGQTLKALYENGIDEDGRILGSEGA
FT                   IPFIENLEIETIQRFRQQVELIDRIGLTDLDEICSIVDNYHDSEKPFEAFPVSFRKAVR
FT                   KYQAPESIGADIVISEKVVMDAFSGLIYEIA"
FT   gene            421446..422378
FT                   /locus_tag="Mmah_0403"
FT   CDS_pept        421446..422378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0403"
FT                   /product="tetrahydromethanopterin S-methyltransferase,
FT                   subunit H"
FT                   /EC_number="2.1.1.86"
FT                   /note="COGs: COG1962 Tetrahydromethanopterin
FT                   S-methyltransferase subunit H; InterPro IPR002856; PFAM:
FT                   Tetrahydromethanopterin S-methyltransferase MtrH subunit;
FT                   PRIAM: Tetrahydromethanopterin S-methyltransferase; SPTR:
FT                   Q12TW9 Tetrahydromethanopterin S-methyltransferase, subunit
FT                   A / tetrahydromethanopterin S-methyltransferase, subunit H;
FT                   TIGRFAM: tetrahydromethanopterin S-methyltransferase, MtrH
FT                   subunit; PFAM: Tetrahydromethanopterin S-methyltransferase
FT                   MtrH subunit; TIGRFAM:
FT                   N5-methyltetrahydromethanopterin:coenzyme M
FT                   methyltransferase subunit H"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35935"
FT                   /db_xref="GOA:D5E9T4"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR023467"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9T4"
FT                   /protein_id="ADE35935.1"
FT                   /translation="MFRFQKDQKIANIAGVKIGGNPGELPTALAGTIFYEGHDIVGDAN
FT                   EGLFDRKIAEDLLNSQRASSDETGNPCLVHIFGNTEQALRNYIDFVSEITDSPFLIDSP
FT                   DPLARMAATEYVSEIGLGDRAVYNSINMTIGEKERQVLKDSDIDSSIVLGFNAMDSGFK
FT                   GRMQLLESGTSSMDKGLIDIALECGMCNILIDPGITPMGNGSGVSLRITLTAKAKWGLP
FT                   VGSGIHNAPSSWEWLRDKKKHDPLVFKMCDIASAVMQQAAAGNFVLYGPIENAPYIFPV
FT                   AAMSDIMIYESVEEFEIEPASSHPFNRLV"
FT   gene            422403..422999
FT                   /locus_tag="Mmah_0404"
FT   CDS_pept        422403..422999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0404"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35936"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9T5"
FT                   /protein_id="ADE35936.1"
FT                   /translation="MVDTNEVIQMRQLKIDIHDSLFAKLELMPDSDNFICSLLEEALDP
FT                   EKTMDDSGLMAQKLMSIENRLKSIEDHLAGTSSPDPVRPFPVHDTVSPDEKSAVAANPA
FT                   PEEVAKQEDDPFYSKMKRIKNNEKVISVDETPSPLKQSILQYLPDGMIIKKQVLVSLLS
FT                   VRYPKDEIEKDIEDMIGEGTISLADKEDGTCIQRC"
FT   gene            complement(423001..424662)
FT                   /locus_tag="Mmah_0405"
FT   CDS_pept        complement(423001..424662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0405"
FT                   /product="dihydroxyacid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="COGs: COG0129 Dihydroxyacid
FT                   dehydratase/phosphogluconate dehydratase; InterPro
FT                   IPR000581:IPR020558:IPR004404; KEGG: sat:SYN_01708
FT                   dihydroxy-acid dehydratase; PFAM: dihydroxy-acid and
FT                   6-phosphogluconate dehydratase; PRIAM: Dihydroxy-acid
FT                   dehydratase; SPTR: Q12TW7 Dihydroxy-acid dehydratase;
FT                   TIGRFAM: dihydroxy-acid dehydratase; PFAM: Dehydratase
FT                   family; TIGRFAM: dihydroxy-acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35937"
FT                   /db_xref="GOA:D5E9T6"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9T6"
FT                   /protein_id="ADE35937.1"
FT                   /translation="MRSDSIKKGTERAPNRSLLRATGVTDSEMEKPFIAVVNSWTEVVP
FT                   GHIHLDKVSEAVKAGIRNAGGVPFEFNTIGICDGIAMGHEGMKYSLPSREVIEDSIELM
FT                   LEGHRLDGMVMITSCDKITPGHLMAAGRLDIPTIVVTGGPMLPGFSGDEPRDLVSVFEG
FT                   IGEHRTGKATDEQLKVLENVSCAGAGSCAGMFTANTMACMTEALGLSLPGCATAHAVDA
FT                   KKIHIAKESGERIMALVDEGLSARKVVSQKSFENAIMVDMAVGGSTNTALHLPAIAHAF
FT                   DMELPLDTFDRLGRSIPHLIGLRPGGKYHMIDFERAGGVHAIMQRLRSKINRGEKTVTG
FT                   KTVGENIDEYVIINPAINKKIIQTLEKPLHQEGGLAILKGNLAPEGGVVKQAAVEPAMM
FT                   QHKGPARVFESEEEAMHAILDNDIKPGDVVVIRYEGPKGGPGMREMLSPTSAIAGMGLA
FT                   DSVALITDGRFSGGTRGPCIGHISPEAMEGGPIGLIEEGDMIEIDIPARKLELLIDEEE
FT                   MQKRKENFKPLVKEVKGYLARYRKSVSSANKGAIRE"
FT   gene            424754..426289
FT                   /locus_tag="Mmah_0406"
FT   CDS_pept        424754..426289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0406"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG1031 Fe-S oxidoreductase; InterPro
FT                   IPR007197:IPR006638; KEGG: tmz:Tmz1t_0865 tRNA-i(6)A37
FT                   thiotransferase enzyme MiaB; PFAM: Radical SAM domain
FT                   protein; SMART: Elongator protein 3/MiaB/NifB; SPTR: Q12TW6
FT                   Fe-S protein, radical SAM family; PFAM: Radical SAM
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35938"
FT                   /db_xref="GOA:D5E9T7"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9T7"
FT                   /protein_id="ADE35938.1"
FT                   /translation="MKVAIIDGYVDEPACFGVPPYISPYIRYIAGALVECGIGRDDISY
FT                   FTIDGIRNSKREDLAPLSRSDLVVILSGMTVPGKYLRSSPITLKEIEYLCRATSGVKVI
FT                   GGPIRLGYSSEGGMAASTLEMADEDVFVARQDIEAFVHDIIGPGPCIEDPDNVEHRMRT
FT                   VGEIGRWADRGAFIIRRHPDFPNIMCEMETYRGCGRDTHCSFCTEFFYGPSTYRPVEDV
FT                   VTEAGSLYREGALYFRLGRQPDLFTYHALDCGDSLPGPNPQALESLYSGIRKVAPGLEV
FT                   LHMDNANPATIATYPDECSKIMKTILKYHTPGDVAAMGMESADPAVIRANNLKAMPDDV
FT                   FEAVKLMNEIGSIRGDNGLSHLLPGLNFVHGLAGETKKTFGLNYDFLKNILDNDLLLRR
FT                   INIRQVMPFSGTPAAEQALPLAKNRKIFLKYKEQVRKDIDLPMLRRVVPRGTILKDVLC
FT                   EVWGEGSVGTFGRQMGSYPILIGISEKLPLGEFVDVRVTGHGFRSISATVVRE"
FT   gene            426324..426854
FT                   /locus_tag="Mmah_0407"
FT   CDS_pept        426324..426854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0407"
FT                   /product="peptidylprolyl isomerase FKBP-type"
FT                   /note="COGs: COG1047 FKBP-type peptidyl-prolyl cis-trans
FT                   isomerase 2; InterPro IPR001179; KEGG: predicted protein;
FT                   PFAM: peptidylprolyl isomerase FKBP-type; SPTR: Q12TV9
FT                   Peptidylprolyl isomerase, FKBP-type; PFAM: FKBP-type
FT                   peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35939"
FT                   /db_xref="GOA:D5E9T8"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9T8"
FT                   /protein_id="ADE35939.1"
FT                   /translation="MRKLLFIIAIAAILLISGCSTPAEVAEEGDNVTVDYVGELENGTV
FT                   FDTSVEEVALEAGIHNPARTYEPLGFTLGGEGMIKGFDSAVQGMTVGGEKTVQLSPEQA
FT                   YGSYKEELVRAVPFDDLPNKTTPYQIGDRLSTAYGQQVSIVDVNDTAAMIDFNHPLAGE
FT                   TLTFNITLVSIEE"
FT   sig_peptide     426324..426398
FT                   /locus_tag="Mmah_0407"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(426907..428067)
FT                   /locus_tag="Mmah_0408"
FT   CDS_pept        complement(426907..428067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0408"
FT                   /product="Nucleotidyl transferase"
FT                   /note="COGs: COG1208 Nucleoside-diphosphate-sugar
FT                   pyrophosphorylase involved in lipopolysaccharide
FT                   biosynthesis/translation initiation factor 2B gamma/epsilon
FT                   subunits (eIF-2Bgamma/eIF-2Bepsilon); InterPro
FT                   IPR001451:IPR005835; KEGG: ppd:Ppro_0028 nucleotidyl
FT                   transferase; PFAM: Nucleotidyl transferase; transferase
FT                   hexapeptide repeat containing protein; SPTR: Q12TW4
FT                   Nucleotidyl transferase; PFAM: Nucleotidyl transferase;
FT                   Bacterial transferase hexapeptide (three repeats); TIGRFAM:
FT                   glucose-1-phosphate thymidylylransferase, long form"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35940"
FT                   /db_xref="GOA:D5E9T9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9T9"
FT                   /protein_id="ADE35940.1"
FT                   /translation="MKACIMCGGKGTRLRPLTFDRPKPNIPIINKASVVHLVEHLAKEG
FT                   FTEIIITLGYMGDKIREELGDGSMFGAHVEYVYEEKKLGTAGGVKNAEKYLCDEPFLVV
FT                   GGDHVMDLELRTMYRFHESNDAIITIGLLSIDDPREFGIADMNVNNRINRFLEKPGPGE
FT                   IFSNLASTGIYMCDPEIFKWIPENQPYDFAKDLFPSLMAEDRRINGLLVRGHWTDVGNP
FT                   AAYRQAQRWMLESMPGTTIEGHFNTKDSRINGPLKIGNNVVIGSNTAVVGPVVLGENTT
FT                   IGDNVLIGPYTTIGSNCVIKDGCRILSSYIFNDVTIGSNCNTSGTVIDNATVVGQNCSL
FT                   ENGTVIGPRVHIGNNSTIHSNVKIWPDLTIKSGSIIQENILNPDYG"
FT   gene            complement(428109..428492)
FT                   /locus_tag="Mmah_0409"
FT   CDS_pept        complement(428109..428492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0409"
FT                   /product="nucleic acid binding OB-fold tRNA/helicase-type"
FT                   /note="InterPro IPR004365; PFAM: nucleic acid binding
FT                   OB-fold tRNA/helicase-type; SPTR: Q12TW1 Nucleic acid
FT                   binding protein; PFAM: OB-fold nucleic acid binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35941"
FT                   /db_xref="GOA:D5E9U0"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9U0"
FT                   /protein_id="ADE35941.1"
FT                   /translation="MEKEEKVIAILLTMAILSLAVAYVTYFPNSFNKTGEQPLTDSTEV
FT                   GETVTIEGTLYSKETTFNGNHLILQIDYNSDLLTVFVPEDNGAMDIDSRIAVGDKLRIK
FT                   GEVDEYKGDQEIIVENENDIKKM"
FT   sig_peptide     complement(428427..428492)
FT                   /locus_tag="Mmah_0409"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            428599..429972
FT                   /locus_tag="Mmah_0410"
FT   CDS_pept        428599..429972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0410"
FT                   /product="Deoxyribodipyrimidine photo-lyase type II"
FT                   /EC_number="4.1.99.3"
FT                   /note="COGs: COG0415 Deoxyribodipyrimidine photolyase;
FT                   InterPro IPR006050:IPR005101:IPR008148; KEGG: sat:SYN_00402
FT                   deoxyribodipyrimidine photolyase; PFAM: DNA photolyase
FT                   FAD-binding; DNA photolyase domain protein; SPTR: P12769
FT                   Deoxyribodipyrimidine photo-lyase; TIGRFAM:
FT                   deoxyribodipyrimidine photolyase; PFAM: FAD binding domain
FT                   of DNA photolyase; DNA photolyase; TIGRFAM: photolyase
FT                   PhrII"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35942"
FT                   /db_xref="GOA:D5E9U1"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR008148"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR032673"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9U1"
FT                   /protein_id="ADE35942.1"
FT                   /translation="MANIGRIHWLNEKPIGSGTYVLYWMQSSQRVDYNHALEFAIQQAN
FT                   KMDLPLLVLFCLTKYPQANLRHYTFMLEGLVQTKKSLEKLGIQFVMLKGNPVDVVHEFA
FT                   RDASLLVTDQDYQKLQRGWRENLAASISCPFAQVESNVIVPVENVSDKEEWSAATLRRK
FT                   IHKHLDEFVHPFELSALANSSLEIDQDSLDLNDFEQILNSMDIDRSVKPSPRYKGGIHQ
FT                   AREKLSDFIAHRLGDYDEKRNDPNLDFLSGMSPYLHFGQISPLEIALKVQDAKKGGSTA
FT                   YMEELVVRRELAMNFVYYDKDYDSLDCLPDWAKKTLAEHRDDFRQYIYTQEEFEQARTH
FT                   DPYWNAAQREMVLTGKMHGYMRMYWGKKILEWTDSPEQAYQIALYLNNKYELDGRDPNG
FT                   YAGIAWCFGKHDRAWKERDIFGKVRYMNANGLKRKFDAGGYVEKITRLEEKLGYLTDK"
FT   gene            complement(430187..431374)
FT                   /locus_tag="Mmah_0411"
FT   CDS_pept        complement(430187..431374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0411"
FT                   /product="beta-lactamase domain protein"
FT                   /note="COGs: COG0426 flavoprotein; InterPro
FT                   IPR008254:IPR001279; KEGG: dat:HRM2_00830
FT                   metallo-beta-lactamase family protein (IMP
FT                   dehydrogenase/GMP reductase:beta-lactamase-like); PFAM:
FT                   beta-lactamase domain protein; flavodoxin/nitric oxide
FT                   synthase; SPTR: Q8PS95 Flavodoxin; PFAM:
FT                   Metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35943"
FT                   /db_xref="GOA:D5E9U2"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR016440"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9U2"
FT                   /protein_id="ADE35943.1"
FT                   /translation="MNTYFVPEISDNVYWVGAKDWDRRMFDALIPLPQGTSYNAYLVKG
FT                   DAKTALIDSVNPGFEKELEKKISQVHDIESIDYVIMNHAEPDHSHSIPRIMEKAPEAML
FT                   VTTEKGAKMAETYYGVFQEQIMVVKEGDTLDLGNRTLRFISAPWLHWPETMFTFLEENR
FT                   VLFPCDFFGAHTAFGMYDEDVEDLMSLAKKYFGEIMMPFRKMGKKGLEKAQGLSPAMIA
FT                   PSHGPIYRNPEKIFDAYSDWTSGKTKEKATIVYVSMWQSTQDMIMQMVEILQSEGIDVC
FT                   LYNLENADIGDIAMDLVDSRAIVLGTPTVLGGMHPLALHAANLVKILRPPLKYGAALSS
FT                   YGWGGGALSQVQDVLGSTKIELVGALGVKGPSTEEDTNKIVDLGRELAEKIKDNE"
FT   gene            complement(431452..431682)
FT                   /locus_tag="Mmah_0412"
FT   CDS_pept        complement(431452..431682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0412"
FT                   /product="putative ferredoxin"
FT                   /note="InterPro IPR001080; KEGG: bba:Bd0590 putative
FT                   ferredoxin; SPTR: Q8PSU2 Putative ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35944"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9U3"
FT                   /protein_id="ADE35944.1"
FT                   /translation="MADKANKVPQNVDGPYYVDNQCIACRLCTSDAPDNFMMTDDESTA
FT                   YVYKQPENDSEREACEEAVDTCPVDAIGNDG"
FT   gene            complement(431872..431948)
FT                   /locus_tag="Mmah_R0005"
FT   tRNA            complement(431872..431948)
FT                   /locus_tag="Mmah_R0005"
FT                   /product="tRNA-Ala"
FT   gene            432115..432543
FT                   /pseudo
FT                   /locus_tag="Mmah_0413"
FT   gene            432729..432805
FT                   /locus_tag="Mmah_R0006"
FT   tRNA            432729..432805
FT                   /locus_tag="Mmah_R0006"
FT                   /product="tRNA-Ile"
FT   gene            432966..433343
FT                   /locus_tag="Mmah_0414"
FT   CDS_pept        432966..433343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0414"
FT                   /product="transcriptional regulator protein"
FT                   /note="COGs: COG4738 transcriptional regulator protein;
FT                   SPTR: Q12TV3 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35945"
FT                   /db_xref="InterPro:IPR017185"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9U4"
FT                   /protein_id="ADE35945.1"
FT                   /translation="MEEDELFSMTENQREIAKLLRRLHLSKPIARTLACLSCGEEVSSR
FT                   KIESMSQLRQPEVSIAMNFLLKKKGWVEYEEIKRNEGKGRPIKVYKLVVPMDSIIESIE
FT                   HEILSENQILLENINRLKEFS"
FT   gene            433521..435818
FT                   /locus_tag="Mmah_0415"
FT   CDS_pept        433521..435818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0415"
FT                   /product="CoB--CoM heterodisulfide reductase subunit A"
FT                   /note="COGs: COG1148 Heterodisulfide reductase subunit A
FT                   and related polyferredoxins; InterPro
FT                   IPR001450:IPR003813:IPR017900; KEGG: dal:Dalk_1624
FT                   methyl-viologen-reducing hydrogenase delta subunit; PFAM:
FT                   methyl-viologen-reducing hydrogenase delta subunit; 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein; SPTR: Q8PZV2
FT                   Heterodisulfide reductase subunit HdrA; PFAM: Pyridine
FT                   nucleotide-disulphide oxidoreductase;
FT                   Methyl-viologen-reducing hydrogenase, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35946"
FT                   /db_xref="GOA:D5E9U5"
FT                   /db_xref="InterPro:IPR003813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039650"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9U5"
FT                   /protein_id="ADE35946.1"
FT                   /translation="MNDSKKPSGIFICHCGGNISDNIDIKKLKDSFPDCKVFDYEYLCS
FT                   NRGQQYLKDEIENSGLERVVVGACTPAKHENLFKKCASQCGINQEFLRVVNLREQCSWV
FT                   HTDSDRATHKAFSMLNSSMLRLFRAQPVEQYSLPINPDALVIGGGIAGINAALNLANSG
FT                   VHTYLVEKETTIGGNAAKIGKIFSPEKLVEECAMCSLSPLMNEVASHPKIELLTDCEIR
FT                   NIDSITGNFQVSITQNPRYVTDKCVCCGKCAAVCPVVTENEFNCGSKDKKAVSIKFAQA
FT                   VPQIYSINPEHCIELKGGRCGKCREVCNVDAIDFSQQDKHIEIQVGAIIAATGFGEYDP
FT                   SSKPQYGYGRFPNVLTQMELARILGVNGPTQGKLLRPSDAKRPKNVVMIQCVGSRDEKS
FT                   SGNRYCSRYCCMAALKHASLIKKKYPDVNVTICYIDMRAFGLYEHYYRAVQEMAVQFVR
FT                   GRPAEIAERDNSELVVKVEDTLNQQLMELPADMVVLSAAMEPSEGTQQIARIMDTNLSE
FT                   DGFIKERHSKLRPVDTSKEGIFVCGSAQSPKDITDSIAQAGLAASRAHAFLAAGEIYLD
FT                   PHIAVADPDVCTLCGKCVTCPFGAISIEDKVKIDPLVCNGCGYCTSLCDEDAIHIRGYS
FT                   REELVAEIEGLAQAGDTIVFASCNIAYSTIDNIGSSAQDYPASTKIIRVPTTTIVTAEM
FT                   LDMAFNRGVFHVVFVEEPPDNQIGEIIYPLAEARFFELKAEYGDRLHLKKAYIPHAKGL
FT                   SDMFSSLEEVEE"
FT   gene            435815..436420
FT                   /locus_tag="Mmah_0416"
FT   CDS_pept        435815..436420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0416"
FT                   /product="Heterodisulfide reductase subunit C"
FT                   /note="COGs: COG1150 Heterodisulfide reductase subunit C;
FT                   InterPro IPR017900; KEGG: afr:AFE_2555 iron-sulfur
FT                   cluster-binding protein; SPTR: Q46B51 Heterodisulfide
FT                   reductase subunit HdrC"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35947"
FT                   /db_xref="GOA:D5E9U6"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9U6"
FT                   /protein_id="ADE35947.1"
FT                   /translation="MNENHDTPECGSLVETVKKSLRTSDSIGIERCMQCGACTSSCPAA
FT                   RYSDYNPRNVMKRVKENDWSVIEDKTIWNCFYCYTCNLRCPRNNSPSQIVQVLRQMAIN
FT                   KGIGIERLSVLFEYPESFARLGISQIPAPYIGQMEEDLGKHWQHFRDNLEDIREELGLG
FT                   PLAIEDERGEIKALLKGIGFEDRFVRLKEMAAEEGEDE"
FT   gene            436417..437352
FT                   /locus_tag="Mmah_0417"
FT   CDS_pept        436417..437352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0417"
FT                   /product="CoB--CoM heterodisulfide reductase"
FT                   /EC_number="1.8.98.1"
FT                   /note="COGs: COG2048 Heterodisulfide reductase subunit B;
FT                   InterPro IPR004017; KEGG: dal:Dalk_5067 CoB--CoM
FT                   heterodisulfide reductase; PFAM: protein of unknown
FT                   function DUF224 cysteine-rich region domain protein; PRIAM:
FT                   CoB--CoM heterodisulfide reductase; SPTR: Q8PZV0
FT                   Heterodisulfide reductase subunit HdrB; PFAM: Cysteine-rich
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35948"
FT                   /db_xref="GOA:D5E9U7"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9U7"
FT                   /protein_id="ADE35948.1"
FT                   /translation="MKELADVPVKGLLLFKSCLVSSEYPGIESSTKYAFDRLGVDYLVS
FT                   GEQSCCTGLGHYFDLFDQMTTTAIAARNFAVAKKEGYTNITTMCATCYAINKKSCSLLN
FT                   NNRQVISLVNDNVEAAGLDDLKYEADSFDEVGNFYHVVEVLAKNANRIGELSIIDFAGV
FT                   KMAAHHACHYYKIDYEDVAGNPEHPELIDHIAKACGGDVVEWYEDRTLTCGAGFSQRYV
FT                   NREMSLKATHAKLESLKRADVQLVLHMCPNCQVQYDRYQPVIEKEFGEEYDMVHMNIAQ
FT                   FTALALGGDPWKICGFQTHSVDLTDFLKTL"
FT   gene            437432..438673
FT                   /locus_tag="Mmah_0418"
FT   CDS_pept        437432..438673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0418"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="COGs: COG0065 3-isopropylmalate dehydratase large
FT                   subunit; InterPro IPR001030:IPR018136:IPR011826:IPR006251;
FT                   KEGG: sfu:Sfum_3029 3-isopropylmalate dehydratase, large
FT                   subunit; PFAM: aconitate hydratase domain protein; SPTR:
FT                   Q12TV2 3-isopropylmalate dehydratase, large subunit;
FT                   TIGRFAM: 3-isopropylmalate dehydratase; homoaconitate
FT                   hydratase family protein; PFAM: Aconitase family (aconitate
FT                   hydratase); TIGRFAM: 3-isopropylmalate dehydratase, large
FT                   subunit; homoaconitate hydratase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35949"
FT                   /db_xref="GOA:D5E9U8"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006251"
FT                   /db_xref="InterPro:IPR011826"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9U8"
FT                   /protein_id="ADE35949.1"
FT                   /translation="MSTISEKIFSRAAGKEAKANDFVIADIDYAMAHDGTSILAVRSFR
FT                   QMEVEKVWDPSRIVIPFDHLAPANSDTTAGLQKDIRGWVRQQGIRNFYDIGNGICHQVL
FT                   PEKGFAMPGKLIVGADSHSCTYGAFGAFGTGVGATDMAEIFASGKLWFRVPESIRITAE
FT                   GKLDDRVCAKDLTLKIIGEVTASGATYKAVEFYGDAIENLSMAGRMTLSNMAIEMGAKA
FT                   GIVPPDATTFEYLKNRAVSDYEPVYSDGDADYVAEYHIDVNSLEPQVACPHEVDNVCGV
FT                   SGIAGKKLDQAFIGTCTNGRLEDLEAAAEVLKGNEVAVRTIIIPASRQIMKEAASKGLI
FT                   EIFLDAGATMGTPGCGPCLGGHMGVIGEGEVCISTANRNFRGRMGTGGYIYLASPATVA
FT                   ASAIKGEITDPRNV"
FT   gene            438683..438889
FT                   /locus_tag="Mmah_0419"
FT   CDS_pept        438683..438889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0419"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dat:HRM2_13610 hypothetical protein; SPTR:
FT                   Q12TV1 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35950"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9U9"
FT                   /protein_id="ADE35950.1"
FT                   /translation="MEEINRDKLKHLLGHWIEHNENHCESFENWIPQLEDAGFQQAAEY
FT                   VSAASSEMEQSTDMLRKALESLE"
FT   gene            complement(438892..439392)
FT                   /locus_tag="Mmah_0420"
FT   CDS_pept        complement(438892..439392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0420"
FT                   /product="UspA domain protein"
FT                   /note="COGs: COG0589 Universal stress protein UspA and
FT                   related nucleotide-binding protein; InterPro
FT                   IPR006015:IPR006016; KEGG: sfu:Sfum_0624 UspA
FT                   domain-containing protein; PFAM: UspA domain protein; SPTR:
FT                   Q12Y07 UspA; PFAM: Universal stress protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35951"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9V0"
FT                   /protein_id="ADE35951.1"
FT                   /translation="MRSLPNVNIIYLHYYVMGNLMNNVKKILIATDGSEHSKKAASEGI
FT                   SLAKIYGARVFAVHVMKELSSKTLPYGARITNFDIPHEDIKREGQEALQYVEELGDPQG
FT                   VAVDTALLTGNPAEEILDFAKENEIDIIVMGSLGRTGLERYLMGSVSEKVLRHAKTAVM
FT                   VIP"
FT   gene            complement(439389..439550)
FT                   /locus_tag="Mmah_0421"
FT   CDS_pept        complement(439389..439550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35952"
FT                   /db_xref="GOA:D5E9V1"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9V1"
FT                   /protein_id="ADE35952.1"
FT                   /translation="MIVLITTVIIYVATVNLIFYMAGGNIPIYAPGTLVVALLGYVLGT
FT                   YLYSKIYE"
FT   gene            439800..440990
FT                   /locus_tag="Mmah_0422"
FT   CDS_pept        439800..440990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0422"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="COGs: COG1252 NADH dehydrogenase FAD-containing
FT                   subunit; InterPro IPR013027; KEGG: dvm:DvMF_0624
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; PFAM: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; SPTR: A4WJC6
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; PFAM: Pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35953"
FT                   /db_xref="GOA:D5E9V2"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9V2"
FT                   /protein_id="ADE35953.1"
FT                   /translation="MKERVLILGAGYAGAVIANTLAREFRRKIAKGELEITVLDKNDMG
FT                   VNQGGFTFLPFGLYTPEDLVRPRKESLSPRIKSRFGDQGEVTGIDLNRQQVTVKSGKNY
FT                   SYDHLVIAMGARSDASGVPGLEDDLNTFYTSMDDALEVGELIRNFKGGRIVVSVSRMPI
FT                   PCPGAPVKFSFLLESYLRDIRNIRDDVQLTLLWPMEPIGPPEFNKLVTGRLEEKGIEAI
FT                   RQFQLGKVDASNKMVESTDGRQENYDLLITVPPHKPQKAVLDSGLTDEKGWIDADKTTL
FT                   QYRGPLGDKDNVYIVGDNGPADILKTGIGAHYQAQVVSHNLINTINGNNIKSKYKGETG
FT                   CPIITDMASDAHTGRAYIATWSYKNPPQSFDTTQLGWYLYRMYYYLHWDMSIKALM"
FT   sig_peptide     439800..439853
FT                   /locus_tag="Mmah_0422"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            441001..441366
FT                   /locus_tag="Mmah_0423"
FT   CDS_pept        441001..441366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0423"
FT                   /product="protein of unknown function DUF1641"
FT                   /note="InterPro IPR012440; KEGG: dma:DMR_13130 hypothetical
FT                   protein; PFAM: protein of unknown function DUF1641; SPTR:
FT                   Q4JBT0 Conserved protein; PFAM: Protein of unknown function
FT                   (DUF1641)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35954"
FT                   /db_xref="InterPro:IPR012440"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9V3"
FT                   /protein_id="ADE35954.1"
FT                   /translation="MAEDIKNVNIGMTQADIDAFVDIVRTARIMQSYLNDETVHGVANV
FT                   MTPMLKLLNGVASTDLVDVLERSMQDPGLDKALMNPPKVGMYGALREMGDEDFQKGLGI
FT                   AIEFLKALGRASEDIGE"
FT   gene            441472..442065
FT                   /locus_tag="Mmah_0424"
FT   CDS_pept        441472..442065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0424"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR000182"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35955"
FT                   /db_xref="GOA:D5E9V4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9V4"
FT                   /protein_id="ADE35955.1"
FT                   /translation="MRLTEDRDIGRVACCKEAIDASRAIYDSFSLLDYFHDCEFAMHSR
FT                   RFAWGEAVAYVYEARDAIYILLLFSRQQKRGHGHRLVNCIIGHARYKGYSRVYVTTSYR
FT                   SPHHYAAGRFYVSCGFRMIGSDEEHMYYGLDVNTAHVSDCTNDYANPPELLYRLSDYFL
FT                   ILIALLVVFLKPQRDEPQVVKMLRKIISEKEKSQ"
FT   gene            complement(442071..445061)
FT                   /locus_tag="Mmah_0425"
FT   CDS_pept        complement(442071..445061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0425"
FT                   /product="von Willebrand factor type A"
FT                   /note="COGs: COG4548 Nitric oxide reductase activation
FT                   protein; InterPro IPR002035; KEGG: dol:Dole_3133 von
FT                   Willebrand factor type A; PFAM: von Willebrand factor type
FT                   A; SMART: von Willebrand factor type A; SPTR: Q8PST9
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35956"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9V5"
FT                   /protein_id="ADE35956.1"
FT                   /translation="MPADKKSPAIRNKRVANTYEKTKTELIPLMDEEVFHLWQSVINIL
FT                   AEKEIKCAIEFTRKTKIVFPVIPSWQRLKLLITTQKFAAKYPRTSLVFFTDAPLAMASL
FT                   DKAGSLDKTGFERWETTALKLAEKEEDVAIIFIQRTSRLLNDLDLDEILDWVERGSELF
FT                   STRPEAVELFFEGTFNGLANHIGKTSRKQRKCLFERGFKLALTNHRCVQSYFEKSPPVI
FT                   TELPKDEFTKWANTGEKIAEGSTFYCREYYNNSFTTLKRINPLFYDLIFNNAQSLLKKE
FT                   QLLAGIYFSKLQEILLSIHPEELKTWVNTGIKLFEKDREIAIQYFRNSAILLQDLEITE
FT                   LEEWAMKGLEIFENNSAGARLYFSLKSKKSREFIEYLMSGVALKRVNNILTYYALGISG
FT                   INFNIRSRNLLPEDHVDSIQPVVSGKTIYLVPTMKGYGDFEDNFMIYKLSVMHEVGHQK
FT                   FGTTGYATKSFLPLLNKTSTNINSTHLEKIVASGDDKDNTVSLKDIISLFPQPSLAADI
FT                   MGIVEDARIEYMITRVYRGLRRDFERVREKMVRNRKVPQNRTGIFMEALLLLSVDQEPP
FT                   LVIDEVTKDLLEKARVLLDLKIFQPQSLTIDSLEVTFEIYEMLEKSILPENPRQYTSIQ
FT                   NLEYRGVGPGLHSENETEGNAGKALERFIPLTEWELAENEIIQENIQAGPKCALAKNWE
FT                   VLSSFTYDEWDSRLRDYKSGWSTVYEVCPTGKSTDFYRDTLQNYIHEISLIKRIFRMMK
FT                   PVSFRKLRRQSDGDEIDFDAIVEAFTDRKCGINPTERLYIRRDKRERDVATLFLVDISA
FT                   STRKKLDNSKSILDVEKEALVLMTEALESIGDKYAIYAFSGDTRNDVEYYTIKDFGEVF
FT                   SENVECKIDALEPADNTRLGPVIRHSITKLKEIDAKIKLLVLLSDGEPYDFGIADGKYE
FT                   NEVAIEDTKMAIQEGKALGMHFFCITVDSKASDYMHSIFSDVGYTIIDNATTLPERLPM
FT                   LYNRLTT"
FT   gene            complement(445069..445893)
FT                   /locus_tag="Mmah_0426"
FT   CDS_pept        complement(445069..445893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0426"
FT                   /product="CbbQ/NirQ/NorQ domain protein"
FT                   /note="COGs: COG0714 MoxR-like ATPase; InterPro
FT                   IPR013615:IPR011704; KEGG: neu:NE1919 nitric oxide
FT                   reductase NorQ protein; PFAM: CbbQ/NirQ/NorQ domain
FT                   protein; ATPase associated with various cellular activities
FT                   AAA_5; SPTR: Q8PST8 Conserved protein; PFAM: AAA domain
FT                   (dynein-related subfamily); CbbQ/NirQ/NorQ C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35957"
FT                   /db_xref="GOA:D5E9V6"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR013615"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9V6"
FT                   /protein_id="ADE35957.1"
FT                   /translation="MKAISYQEQPVEEYVIREKPYYVPVKDEVEIFTAAFENNLPVNLK
FT                   GPTGCGKTRFMEYMAYKLERPLITIACHEDLTASDLIGRFLIKNESTQWNDGPLTKAVK
FT                   NGAICYLDEFVEARMDTRVVIHPLTDDRRVMPIDKLGIILHAPPEFMLTISYNPGYQSV
FT                   LKDLKQSTRQRFVAIDFDYPPADTEYEIVAHESGIDMEDARTLVDIGQKIRNFKQHGLE
FT                   EGVSTRLLIYAGMLIRSGIDQKEACRAAMIKPITDDYELQKSIDEIITAIVE"
FT   gene            complement(446062..446571)
FT                   /locus_tag="Mmah_0427"
FT   CDS_pept        complement(446062..446571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0427"
FT                   /product="protein of unknown function DUF985"
FT                   /note="COGs: COG3542 conserved hypothetical protein;
FT                   InterPro IPR009327; KEGG: ppd:Ppro_3205 hypothetical
FT                   protein; PFAM: protein of unknown function DUF985; SPTR:
FT                   A1ZGG0 Putative uncharacterized protein; PFAM: Cupin
FT                   superfamily (DUF985)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35958"
FT                   /db_xref="InterPro:IPR009327"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR039935"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9V7"
FT                   /protein_id="ADE35958.1"
FT                   /translation="MTKADEIIEYLDMSKHPEGGYFKETYRSEETIKHKFLPERFTINH
FT                   AFSTAIYFLLKQGEFSALHTIKQEEIWHFYSGAPVDIHMLHPGDVYESIHLGNNILNGE
FT                   VPQGVVPAGSAFGATVCDNTKDDYSLVGCTVAPGFEFEDFTLHKKDELLERFPRHRKLI
FT                   ESLTRE"
FT   gene            complement(446926..449307)
FT                   /locus_tag="Mmah_0428"
FT   CDS_pept        complement(446926..449307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0428"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterProIPR004358:IPR013655:IPR003018:IPR013767:IPR
FT                   013656:IPR003594:IPR003661:IPR001610:IPR000014:IPR000700:I
FT                   PR005467; KEGG: pmy:Pmen_0835 multi-sensor hybrid histidine
FT                   kinase; PFAM: ATP-binding region ATPase domain protein; PAS
FT                   fold-3 domain protein; GAF domain protein; PAS fold domain
FT                   protein; PAS fold-4 domain protein; histidine kinase A
FT                   domain protein; SMART: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; PAC
FT                   repeat-containing protein; PAS domain containing protein;
FT                   SPTR: Q8TPF6 Sensor protein; TIGRFAM: PAS sensor protein;
FT                   PFAM: Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase; His Kinase A (phosphoacceptor) domain; PAS fold;
FT                   TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35959"
FT                   /db_xref="GOA:D5E9V8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9V8"
FT                   /protein_id="ADE35959.1"
FT                   /translation="MMVMRGYFQKSFLDKISEGYAYNRIILDENGVPCDYEFLEVNAAF
FT                   EKQTGLKCSDIIGKKATEVLPWIQDYSFDWIKFCGDIALNGRDEKNKTIFHPLSRWYKV
FT                   HVYSPEKYLFVTLYTDLSKDEEIFHRLNDNSQDIIFRYELSPVRGFTYVNNAAASIIGY
FT                   TPEEYYDDPDMCLKIIHPDDRKLLGDCVQGKIPLHKPIVLRYIHKNGQTVWIEQRNLPT
FT                   YDTNGNLIALEGIGRDITERKQAEDNIYNGYVRESAINEILRLSFKDLPIERLLEKALN
FT                   LILDIPDFELENAGAVFLVEDDADCLVLKASHGLADPLLRKCARVPFGKCLCGRAASTE
FT                   KMIFADRVDECHDIHYEGMKPHGHYCTPLRFKNQTIGVLNLYVQEGHTYSAKLEQFLVS
FT                   SANALSGIIARKKAEEDINHYAGMITSLLDSIPDIIFFKDVKGVYMGCNPAFTEFVGRP
FT                   REEIIGKTDYDLFDKAFADFFRKHDERTLELLQPRHNEEWITYPDGRKILLDMLKTPYR
FT                   GPDGLLIGILGIGRDITERNRAEQALLKGKLIAEENDRMKSEFITNMSHELRTPLNSVI
FT                   GFSDVLLKEIKGELNDSQKKYISNISKSGRHLLELINDILDLSKIEEGKMELQCEDFDL
FT                   NSILSEVESIFSPQAAKKDINLQFVLSEKIPRIKGDKIKIKQVIFNLLTNAIKFTPKNG
FT                   AISVIAKENDDNIIEVSVSDTGIGIPEAKLEDVFDPFIQVDASTSRNYGGTGVGLSLAK
FT                   KFVQMHDGKFCVESEVYKGSTFTFTIVNQEYTSQSSYSKQ"
FT   gene            449500..449745
FT                   /pseudo
FT                   /locus_tag="Mmah_0429"
FT   gene            449779..449928
FT                   /locus_tag="Mmah_0430"
FT   CDS_pept        449779..449928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35960"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9V9"
FT                   /protein_id="ADE35960.1"
FT                   /translation="MRPVLHTTVGQRTAYIIHRVMKEKKCKKSEVLDYIVAEYEIRKGG
FT                   RACR"
FT   gene            complement(450248..450871)
FT                   /locus_tag="Mmah_0431"
FT   CDS_pept        complement(450248..450871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0431"
FT                   /product="peptidylprolyl isomerase FKBP-type"
FT                   /note="COGs: COG1047 FKBP-type peptidyl-prolyl cis-trans
FT                   isomerase 2; InterPro IPR001179; KEGG: dde:Dde_2668
FT                   peptidyl-prolyl cis-trans isomerase, FKBP-type; PFAM:
FT                   peptidylprolyl isomerase FKBP-type; SPTR: Q46B63
FT                   Peptidyl-prolyl cis-trans isomerase; PFAM: FKBP-type
FT                   peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35961"
FT                   /db_xref="GOA:D5E9W0"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9W0"
FT                   /protein_id="ADE35961.1"
FT                   /translation="MRPKILITTILLGCILLFSGCADVDDTLSETVVEEGDTVALDFTL
FT                   MQEDGTVVETSSEDVAAENNIEATPQLLEFKAGSEQMLPGINEGIIGMSEGEEDTLTLS
FT                   PEEAFGPYQDELVESMPIEEYQNATGTNETPEVGQQMITQMGTVTVSDINDTHIELDAN
FT                   PPLAGETIVFEFTVESIEKADDASNIGAEEMPEEGVPEMPEEEF"
FT   sig_peptide     complement(450800..450871)
FT                   /locus_tag="Mmah_0431"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            451549..454653
FT                   /locus_tag="Mmah_0432"
FT   CDS_pept        451549..454653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0432"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterProIPR004358:IPR013655:IPR013656:IPR013767:IPR
FT                   003594:IPR003661:IPR001610:IPR000014:IPR000700:IPR005467;
FT                   KEGG: pla:Plav_0648 PAS/PAC sensor signal transduction
FT                   histidine kinase; PFAM: ATP-binding region ATPase domain
FT                   protein; PAS fold-3 domain protein; PAS fold-4 domain
FT                   protein; PAS fold domain protein; histidine kinase A domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; PAC repeat-containing
FT                   protein; PAS domain containing protein; SPTR: Q8PTE2 Sensor
FT                   protein; TIGRFAM: PAS sensor protein; PFAM: Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase; His Kinase A
FT                   (phosphoacceptor) domain; PAS fold; TIGRFAM: PAS domain
FT                   S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35962"
FT                   /db_xref="GOA:D5E9W1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9W1"
FT                   /protein_id="ADE35962.1"
FT                   /translation="MPNSTDNDFEKDSFAYARHKIILDENGKPVNYRFLDVNPTFEDMT
FT                   DLKKENILNKTVTEVLPEIVEDDFDWIALFGHVALTGEDINFTHYSLALGQWYQIYVQS
FT                   SEKGYFVTLFSVLSQNEAKFYEFAERSSEPIYRYDLIPRPGYTYVNKATTQMDGYTPEE
FT                   HYRDPQLAIKIVHPEDKQLFLDYFEGKIPIDKRIQLRWVHKKGQTVWFEYVNKPVYDSN
FT                   GNLIAVEGIGRDITDMKIAQEREQHIKDVLLSIRNVNKMIVKEHDPNRVIQKACNNLTE
FT                   TLGYYSAWIALVDDEKNVISAASSFSDFASVFERLKGQLKEGIFPQCMQQVLEKDEILI
FT                   MDNPAEECQECPLSCTYSDHASLCYRLQYNSKVCGILSVAVPRKYADLDEIHDLFREVS
FT                   DDLGFALYKIEMEKKRDQYEAHIRLMTRNMNDVIIEADVEGRYTYISPSHQRVLGRGKE
FT                   LLGKNCMKDLHPDDIDFVASIFKKIVETGEQQHAEYRYLHPDKGYIWLGSVATSYVDEN
FT                   GQKRVLINTRDVTERKENEEEIKKLTEEYQTVFQGTQDSMFLIEVTDDNEFRYMRNNRA
FT                   HQVSTGFTSAYFRGKTPQELAGKKTGDQLSANYKRCIDSNDTVSYEETLEFPAGTRMWQ
FT                   TALTPIFQHGEVRYIVGSSQDITGRIKAENELRQSKQKYQSLVENLNEIVYTLDQNATV
FT                   TYVTPNIENISGYKPEEVIGKNFVEFVHPDDIRGRMEQFRKVLSGIDEPSEYRFLTKSG
FT                   DTVWVRTNAKPIIKDDKIVGIQGLLMDITDVKKAEKQLEDAVLRANEMAIQAEYANKTK
FT                   SQFLANMSHELRTPLNSVIGFSDILLKEIKGELNDSQKKYISNISNGGRHLLDLINDIL
FT                   DLSKIEAGKMELACEDLNLDSVFSEIESVISPQAQKKSIDLEISKPADIEINADKSKIK
FT                   QIIFNLLSNAIKFTDENGKVSMSAGEVDRDQVEITVKDTGIGIPEDKLDKIFDPFMQAD
FT                   SSTSRKYGGTGLGLPLVKEYVEMHGGEILVESEVGKGSVFTLLFH"
FT   gene            complement(454817..455563)
FT                   /locus_tag="Mmah_0433"
FT   CDS_pept        complement(454817..455563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0433"
FT                   /product="protein of unknown function DUF541"
FT                   /note="COGs: COG2968 conserved hypothetical protein;
FT                   InterPro IPR007497; KEGG: rpb:RPB_0357 hypothetical
FT                   protein; PFAM: protein of unknown function DUF541; SPTR:
FT                   Q8TTW4 Outer membrane protein; PFAM: Protein of unknown
FT                   function (DUF541)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35963"
FT                   /db_xref="GOA:D5E9W2"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9W2"
FT                   /protein_id="ADE35963.1"
FT                   /translation="MSPENGKDKLYYVVIALSAVLILMAATLYAGSVGSSDRSSENTMH
FT                   MSGNSEMMVVPDTATLNIGAEVMAPTAEEASQENAAIMNAVIEELKNIGLEEEDIQTSR
FT                   VSVRPVYNYEERTRTIEGYSASNNVQITTTMLDSLGEMIDRSASAGANQIGGISFTVSD
FT                   DKQKELREDLISEAVADASSKAEILAENLGVEIISVKSSSISDNNQPRIFYEEVAEEIE
FT                   KESGPTPIEPGESKISMSVQVTYITQ"
FT   sig_peptide     complement(455474..455563)
FT                   /locus_tag="Mmah_0433"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(455923..456033)
FT                   /locus_tag="Mmah_0434"
FT   CDS_pept        complement(455923..456033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0434"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35964"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9W3"
FT                   /protein_id="ADE35964.1"
FT                   /translation="MQLTDSDDELFDILMDAIKHNPDIFIKTVQKNKTNQ"
FT   gene            complement(456327..456400)
FT                   /locus_tag="Mmah_R0007"
FT   tRNA            complement(456327..456400)
FT                   /locus_tag="Mmah_R0007"
FT                   /product="tRNA-Thr"
FT   gene            456435..457037
FT                   /locus_tag="Mmah_0435"
FT   CDS_pept        456435..457037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0435"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="COGs: COG0235 Ribulose-5-phosphate 4-epimerase and
FT                   related epimerase and aldolase; InterPro IPR001303; KEGG:
FT                   geo:Geob_1876 class II aldolase/adducin family protein;
FT                   PFAM: class II aldolase/adducin family protein; SPTR:
FT                   Q12U01 Class II aldolase/adducin-like protein; PFAM: Class
FT                   II Aldolase and Adducin N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35965"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9W4"
FT                   /protein_id="ADE35965.1"
FT                   /translation="MAHKFYGWLNLYLTPMWQEMARIGKKLVDHGLVESHFGNISVRQG
FT                   NSMVITRSGCPLDEICEENVVEVPIHNTCEFDGLASSETRVHRRIYQETDAGCIVHGHC
FT                   PFAVVMSLLDESGSIEPLDSEGVYFLGHVSIVEGSIGSEELAANSAAALAETNGVIVKS
FT                   HGTISTGKTLDHAYINTTQIEHTCKVRYYYDLAKRSL"
FT   gene            457082..457693
FT                   /locus_tag="Mmah_0436"
FT   CDS_pept        457082..457693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0436"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /note="COGs: COG0558 Phosphatidylglycerophosphate synthase;
FT                   InterPro IPR000462; KEGG: ank:AnaeK_4279 CDP-alcohol
FT                   phosphatidyltransferase; PFAM: CDP-alcohol
FT                   phosphatidyltransferase; SPTR: Q12U02 CDP-alcohol
FT                   phosphatidyltransferase; PFAM: CDP-alcohol
FT                   phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35966"
FT                   /db_xref="GOA:D5E9W5"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9W5"
FT                   /protein_id="ADE35966.1"
FT                   /translation="MTLDRFRPVFAGPISRLAKIFADMGITPNQVTLASLLFSAAAGLC
FT                   YAFGATNIFLIGAAFIFVVLNSLFDALDGSMARYLLINDKAGDFLDHVVDRYADVFIVG
FT                   GLIFGEYAGWGIGLFTMVGILLTSYLGTQAQALSIGRFYGGIMGRADRLVLIMAASLLH
FT                   IIYPQAIFGYTLLGWSLILMGIASHVTALQRIHFIRTRLG"
FT   sig_peptide     457082..457114
FT                   /locus_tag="Mmah_0436"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            457738..458166
FT                   /locus_tag="Mmah_0437"
FT   CDS_pept        457738..458166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0437"
FT                   /product="archease family protein"
FT                   /note="COGs: COG1371 conserved hypothetical protein;
FT                   InterPro IPR002804; KEGG: ZBTB8OS; zinc finger and BTB
FT                   domain containing 8 opposite strand; PFAM: protein of
FT                   unknown function DUF101; SPTR: Q12U03 Archease family
FT                   protein; PFAM: Archease protein family (DUF101/UPF0211)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35967"
FT                   /db_xref="GOA:D5E9W6"
FT                   /db_xref="InterPro:IPR002804"
FT                   /db_xref="InterPro:IPR022952"
FT                   /db_xref="InterPro:IPR023572"
FT                   /db_xref="InterPro:IPR036820"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9W6"
FT                   /protein_id="ADE35967.1"
FT                   /translation="MKKYEYIEHTADARFKAFGSTAEEAFANAAEAMFNVMIDTSGIEP
FT                   QITEYIELQAPDMENLLVDWLSELLYLFEVNMVVFSNFEVFAIEKKGDEYLLSAKAEGE
FT                   PLDLEKHVFDTEVKAVTYNDLGVQITSQGVTVRITVDT"
FT   gene            458163..459644
FT                   /locus_tag="Mmah_0438"
FT   CDS_pept        458163..459644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0438"
FT                   /product="protein of unknown function UPF0027"
FT                   /note="COGs: COG1690 conserved hypothetical protein;
FT                   InterPro IPR001233; KEGG: dol:Dole_2571 hypothetical
FT                   protein; PFAM: protein of unknown function UPF0027; SPTR:
FT                   Q12U04 Putative uncharacterized protein; PFAM:
FT                   Uncharacterized protein family UPF0027"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35968"
FT                   /db_xref="GOA:D5E9W7"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9W7"
FT                   /protein_id="ADE35968.1"
FT                   /translation="MKRGFDRMDTEGPEIEGLERIDNDIWQVPMGYKSGMRVPGRIYLS
FT                   DKLFANLEKEAVDQVANVATLPGIQKFSMAMPDAHVGYGFPIGGVAAFDAEEGVISPGG
FT                   VGFDINCGVRLIRSNLDKSDVDGKVNDLLDSLFKAVPSGVGSKSRIRASESELEAIFTN
FT                   GSRWAVEQGYGVEADLTHCEGEGCIEGGDPAQVSAKARKRGRPQLGTLGSGNHFLELQY
FT                   VDEIYDPVAAEAFNLKQGQLTFMVHCGSRGAGHQVCTDHLRNLTRAVEKYKIDLPDKQL
FT                   ACAPAQSEEAQAYFGAMASAANYAWTNRQIIMHHCREVFEQQMNMDADELGLDLVYDVA
FT                   HNVAKLEEHNVNGGKKQVYVHRKGATRAFPAGHHEVPKAYRDVGQPVLIPGSMGTPSYV
FT                   LCGKQSAMDVSFGSACHGAGRVMSRSGAKHTFRGEQIQKDLSGQGISVRAAHPSVIAEE
FT                   APGVYKSSSEVVDVVDRLGIAGKVAKLMPVGVVKG"
FT   gene            459837..460316
FT                   /locus_tag="Mmah_0439"
FT   CDS_pept        459837..460316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0439"
FT                   /product="PUA domain containing protein"
FT                   /note="COGs: COG1370 Prefoldin molecular chaperone
FT                   implicated in de novo protein folding alpha subunit;
FT                   InterPro IPR002478; PFAM: PUA domain containing protein;
FT                   SMART: PUA domain containing protein; SPTR: Q12U05 PUA
FT                   domain protein; PFAM: PUA domain; TIGRFAM: uncharacterized
FT                   domain 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35969"
FT                   /db_xref="GOA:D5E9W8"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029402"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR038250"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9W8"
FT                   /protein_id="ADE35969.1"
FT                   /translation="MAMTKEESRIKQVRTMADYQFGKGCGNILFSGDITFKLSRTKRIR
FT                   QIFSEEKRMATVRARDGMFTLSIEGASRIHSHLPAPGYRVMMCDDAIPFVSKGKTAFAK
FT                   HVENIDSDLRAGDEVLLVDKHDNLIATGQLLLAPEEVLAMQNGPAVDVRVGVNSS"
FT   gene            460449..461294
FT                   /locus_tag="Mmah_0440"
FT   CDS_pept        460449..461294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0440"
FT                   /product="acyltransferase"
FT                   /note="COGs: COG4801 acyltransferase; InterPro IPR001451;
FT                   KEGG: gsu:GSU2266 UDP-3-O-3-hydroxymyristoyl glucosamine
FT                   N-acyltransferase; SPTR: Q12U06 Putative uncharacterized
FT                   protein; PFAM: Protein of unknown function, DUF583"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35970"
FT                   /db_xref="GOA:D5E9W9"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9W9"
FT                   /protein_id="ADE35970.1"
FT                   /translation="MEEHNIVLDEDIIVGNHSDIRYGIIADSVIIGERVSVSGDVLARS
FT                   DIRIDIWSKIGGNVRCGENGYIGEFVKIDGKLFVNGDLDVGNDVKINRGFEAHGWIVVR
FT                   NPVPVITYIFLYISELLRMGKGEEVERAMSEFFEEEAKEISYGAMVVPNGSRISADSIR
FT                   VPGTATIGNNCRLVGNIRAESLEMGDATTLYGSIRTASDIEIGENNAIHGNIVSRGRVI
FT                   VGKGTHILGEINAYSIRIHEDSRVDGVMRATGGTTFIREEEEVAQDRELIKLDVADQQQ
FT                   "
FT   gene            461309..462472
FT                   /locus_tag="Mmah_0441"
FT   CDS_pept        461309..462472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0441"
FT                   /product="acetylornithine aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.11"
FT                   /note="COGs: COG4992 Ornithine/acetylornithine
FT                   aminotransferase; InterPro IPR005814:IPR004636; KEGG:
FT                   gsu:GSU0151 acetylornithine aminotransferase; PFAM:
FT                   aminotransferase class-III; SPTR: Q12U07 Acetylornithine
FT                   aminotransferase; TIGRFAM: acetylornithine and
FT                   succinylornithine aminotransferase; PFAM: Aminotransferase
FT                   class-III; TIGRFAM: acetylornithine and succinylornithine
FT                   aminotransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35971"
FT                   /db_xref="GOA:D5E9X0"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9X0"
FT                   /protein_id="ADE35971.1"
FT                   /translation="MSETTEIYNSIVEKDSKYVMQNYGRYPIALDKGAGALVWDTAGKQ
FT                   YIDCVAGIAVNNVGHCHPQVVNAIQEQAGKLIHVSNLYYTDVQADLAEKLSQITGMDRL
FT                   FFCNSGTEAIEAAMKLARAHSGKKNFVATEGSFHGRTMGALAVTSKEAYRKPFEPLPGR
FT                   VDFVSYDNADAIADAIDSDTAAVIVEPIQGEGGVNVPTSNYLKEVREICDETDTLLIFD
FT                   EVQTGFGRTGKWFCKDYFNVTPDIMTMAKALGGGFPMGAIASREGIVFQKGQHAATFGG
FT                   GPLACAAALASINAIEKEGLVERSRIMGEYFVKKLEGLNREDFLEIRGKGLMMGVHVKD
FT                   SCAEMVTEGLERGVLLNCTAGNILRMVPPLVITEEQVDSVVDIIGNL"
FT   gene            462459..463544
FT                   /locus_tag="Mmah_0442"
FT   CDS_pept        462459..463544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0442"
FT                   /product="histidinol phosphate aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.9"
FT                   /note="COGs: COG0079 Histidinol-phosphate/aromatic
FT                   aminotransferase and cobyric acid decarboxylase; InterPro
FT                   IPR004839:IPR000277:IPR001917:IPR005861; KEGG:
FT                   dol:Dole_1983 histidinol-phosphate aminotransferase; PFAM:
FT                   aminotransferase class I and II; Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; SPTR: Q12U08
FT                   Histidinol-phosphate aminotransferase; TIGRFAM:
FT                   histidinol-phosphate aminotransferase; PFAM:
FT                   Aminotransferase class I and II; TIGRFAM:
FT                   histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35972"
FT                   /db_xref="GOA:D5E9X1"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9X1"
FT                   /protein_id="ADE35972.1"
FT                   /translation="MAIYELVKPEIRSIAPYVPGKSIAEIAEKYNLESDSIIKLGSNEN
FT                   PLGPSPAAVSALQEAAATVNIYPSADARELVDAISAYVGMPQANIVASGPGMDGLLDGL
FT                   MRMLMSADSEVVVTTPTFSYYEISATACGAKPVFVKRNENFDVDIDRVIAAVNENTKVV
FT                   FICSPNNPTGNITAEKELRRLLDSVECLVFVDEAYVEFAGSDIASLVGEYDNLVVGRTF
FT                   SKAFGLAGLRLGYGIMPAWLKVEYMKAATPFNVSAPAVAAGIAALSDREHLEASQQMVI
FT                   DGREYLQANLPFKVYGSQANFMLVDVAPNSAKDVCDHLLRRGIIVRDCTSFRDAGDSFI
FT                   RVTVGTEEQNARIVEGFSTYL"
FT   gene            complement(463539..463901)
FT                   /locus_tag="Mmah_0443"
FT   CDS_pept        complement(463539..463901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0443"
FT                   /product="Protein of unknown function DUF381"
FT                   /note="COGs: COG2098 conserved hypothetical protein;
FT                   InterPro IPR007179:IPR007181; PFAM: Protein of unknown
FT                   function DUF381; Protein of unknown function DUF372; SPTR:
FT                   Q46E45 Putative uncharacterized protein; PFAM: Domain of
FT                   unknown function (DUF381); Domain of unknown function
FT                   (DUF372)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35973"
FT                   /db_xref="GOA:D5E9X2"
FT                   /db_xref="InterPro:IPR007181"
FT                   /db_xref="InterPro:IPR027508"
FT                   /db_xref="InterPro:IPR036839"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9X2"
FT                   /protein_id="ADE35973.1"
FT                   /translation="MENRPDDAQIAAFEAGIKLGALYHQFTGSPLNLQNADSMERAIAE
FT                   SISVQPFVEEINVNINRDMIATKLNDEFGYCELEGRMLTVGLQVIHGNTRIRASMTYNQ
FT                   ERDYPLMEINEVESLS"
FT   gene            464007..464498
FT                   /locus_tag="Mmah_0444"
FT   CDS_pept        464007..464498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0444"
FT                   /product="Rubrerythrin"
FT                   /note="COGs: COG1592 Rubrerythrin; InterPro
FT                   IPR004039:IPR003251:IPR009040; KEGG: glo:Glov_1794
FT                   rubrerythrin; PFAM: Rubrerythrin; Rubredoxin-type Fe(Cys)4
FT                   protein; SPTR: O26912 Rubrerythrin; PFAM: Rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35974"
FT                   /db_xref="GOA:D5E9X3"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9X3"
FT                   /protein_id="ADE35974.1"
FT                   /translation="MSTLENLEGAFAGESMANRKYLAFAKKADDEGFPQIAKLFRAAAA
FT                   AETVHAHNHLEIMNGIKSTEENLREAIEGETYEFEEMYPAFITQAKKEDNGKAAWSFDV
FT                   ANQVEAIHAELYKKALDNAGNNDEVDYYVCEVCGNTVENGAPDVCPICGAPASKFKKID
FT                   "
FT   gene            464668..465963
FT                   /locus_tag="Mmah_0445"
FT   CDS_pept        464668..465963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0445"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR018486:IPR006025; KEGG: AAL127Wp; SPTR:
FT                   Q12YY9 Putative uncharacterized protein; PFAM: Peptidase
FT                   family M1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35975"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9X4"
FT                   /protein_id="ADE35975.1"
FT                   /translation="MESGHYSFTSIVFYSLISVTLFCVLATSQASADWGQNEVEVNSVY
FT                   EVGCGVVHVSKEITFTNMDENTRYWQGFYSSLNYPVAPGHSNLSSFDDSSEIKSKRAED
FT                   GGNYYMFTFNENVWYGDSYILTLEYDVRMDPIYTTFTIREQSDSGNVKLIVPDNYEAYL
FT                   EDVDYAKENLDDHAVYTFDNKSFQEFPLRIDCVKTVDTMVDSEIVSLEGRNVSISVEYR
FT                   QGNDEWAQNVLDKTATYLPLLEDVWGAPYPGNSYLTIRESSIAETKGYDGFNYGNGTIS
FT                   LLHSAGDRVLIHELSHSWTHACNFEQLWMHEGYANLYTFLVLKQTNPEKALTMKSELED
FT                   GYGKNGHNFVQALDGWSIPDEYNTSSSESIGYGYSKSFVFVSDIYENVGFERMQIANRK
FT                   LLATGNVDTSDHISIIESVSGKEFDEMYSNFV"
FT   sig_peptide     464668..464763
FT                   /locus_tag="Mmah_0445"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(466180..466836)
FT                   /locus_tag="Mmah_0446"
FT   CDS_pept        complement(466180..466836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0446"
FT                   /product="iron (metal) dependent repressor, DtxR family"
FT                   /note="COGs: COG1321 Mn-dependent transcriptional regulator
FT                   protein; InterPro IPR007167:IPR001367; KEGG: gem:GM21_2623
FT                   iron (metal) dependent repressor, DtxR family; PFAM: iron
FT                   dependent repressor; FeoA family protein; SMART: iron
FT                   dependent repressor; SPTR: O29994 Iron-dependent repressor
FT                   (DesR); PFAM: FeoA domain; Iron dependent repressor, metal
FT                   binding and dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35976"
FT                   /db_xref="GOA:D5E9X5"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9X5"
FT                   /protein_id="ADE35976.1"
FT                   /translation="MKISNDAEEIIEKMWRFTEEKGMVSVPLDTLGVEKKSPEILELIE
FT                   KKNITLQGNNIILSQKGIENGRNVVRRHRLAERLLADVLDTKDRYIHNAACEFEHVLHR
FT                   GIDDKICTLLGHPKTCPHGRNIPEGECCRKAKDRIERVVAPLSALSNGQQGKVAYFDIK
FT                   DEERLQKIMSMGVLPSMPIGLVQSYPSYVFDLEHTRYAVDREMADCIYVKIESGS"
FT   gene            complement(466833..466997)
FT                   /locus_tag="Mmah_0447"
FT   CDS_pept        complement(466833..466997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0447"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: geo:Geob_2254 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35977"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9X6"
FT                   /protein_id="ADE35977.1"
FT                   /translation="MKCPFCGFEFDEPDKSTCAGCGKLHSCNMQKCPNCKYEIPKETKL
FT                   EKLLRGVFK"
FT   gene            complement(466994..469027)
FT                   /locus_tag="Mmah_0448"
FT   CDS_pept        complement(466994..469027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0448"
FT                   /product="ferrous iron transport protein B"
FT                   /note="COGs: COG0370 Fe2+ transport system protein B;
FT                   InterProIPR006073:IPR001806:IPR011642:IPR002917:IPR
FT                   011619:IPR011640:IPR005225:IPR003373; KEGG: gur:Gura_3001
FT                   ferrous iron transport protein B; PFAM: GTP-binding protein
FT                   HSR1-related; nucleoside recognition domain protein;
FT                   Ferrous iron transport protein B domain protein; Ferrous
FT                   iron transport B domain protein; SPTR: O29993 Iron (II)
FT                   transporter (FeoB-1); TIGRFAM: ferrous iron transport
FT                   protein B; small GTP-binding protein; PFAM: Ferrous iron
FT                   transport protein B; Ferrous iron transport protein B C
FT                   terminus; Nucleoside recognition; TIGRFAM: ferrous iron
FT                   transporter FeoB; small GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35978"
FT                   /db_xref="GOA:D5E9X7"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9X7"
FT                   /protein_id="ADE35978.1"
FT                   /translation="MKLPTLKTKGKCCQISETPSNGLEKIVLVGNPNVGKSVLFNHFSN
FT                   SYTIVSNYPGTTVEISKGDGTIAGKEYEIIDTPGMYSMLPITEEERVAQKYVLDEDAHV
FT                   YLHVVDAKNLRRMLPLTIQLIEADVPLILVLNMMDEAEERGVEIDTQRLAQRLGIPVVS
FT                   TVSTTGRGLKELEETIANYKPTQKHFIPNYGEEIESAIEKTVSSLNSEYRVAKRALAQL
FT                   LLQKDLIAFEKIQRKEEEPERIGLIVDDSQAEHSEPLNLKIAIKRQDNVNEIIDSVMTQ
FT                   KEDREKAAEKKTHENENSISRRIDKLLIRPITGIPILLLILYFGLYKFVGVFAAGTVVD
FT                   YLEGTLFGEQINPWVIANFNALVPYPVIQDLFVGEYGIFTQAITYAIALIMPLVGAFFI
FT                   VFSIIEDTGYLPRLAMLIDRLFKKIGLSGRAVIPMVLGFGCVTMATMVTRTLETKRERV
FT                   IASMLLALAIPCSAQLGVILGVLSFSSKALFIWAIVVFLELILIGFLASKVMSGEKPNF
FT                   FVEMPPLRLPKISNVAIKTYSRMQWYFLEVLPLFIVASVVIWIGRLIGLFDIAVKLLAY
FT                   PSQWIGLPAEAGVMFLFGFFRRDFGAAGLFDMYNAGMLTGVNIVVAAVTLTLFMPCIAQ
FT                   FMMTVKERGLKTAFAMAAFIFPSAFGVGFVVNYLLNYFGVIL"
FT   gene            complement(469265..469342)
FT                   /locus_tag="Mmah_R0008"
FT   tRNA            complement(469265..469342)
FT                   /locus_tag="Mmah_R0008"
FT                   /product="tRNA-Glu"
FT   gene            complement(469415..470641)
FT                   /locus_tag="Mmah_0449"
FT   CDS_pept        complement(469415..470641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0449"
FT                   /product="Proteasome-activating nucleotidase"
FT                   /EC_number="3.6.1.3"
FT                   /note="COGs: COG1222 ATP-dependent 26S proteasome
FT                   regulatory subunit;
FT                   InterProIPR003959:IPR011704:IPR003593:IPR003960:IPR 005937;
FT                   KEGG: hypothetical protein; K03066 26S proteasome
FT                   regulatory subunit T6; PFAM: AAA ATPase central domain
FT                   protein; ATPase associated with various cellular activities
FT                   AAA_5; PRIAM: Adenosinetriphosphatase; SMART: AAA ATPase;
FT                   SPTR: Q12TR9 26S proteasome subunit P45 family; TIGRFAM:
FT                   26S proteasome subunit P45 family; PFAM: ATPase family
FT                   associated with various cellular activities (AAA); TIGRFAM:
FT                   26S proteasome subunit P45 family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35979"
FT                   /db_xref="GOA:D5E9X8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9X8"
FT                   /protein_id="ADE35979.1"
FT                   /translation="MSDATANTPIENTNNTVDNAEEMDSEIESLKKENEELRVQSESMR
FT                   AKLLEANMLANNYLEEMEKLKEQLERITSPPLFIATVMETEDDMALIRQHGNNQEVVTQ
FT                   IPAEFRDEIEPGVRVSINAAFSIVSIMRKATDMRAQIMEVINSPDVDYDMIGGLDDVLN
FT                   EVIESVEMPLTEPELFDKIGIEPPSGVLMYGDPGTGKTLIAKAVASRAHASFIRMSGSD
FT                   LVQKFIGEGARLVKDVFQMARDKSPCILFIDEIDAVGGMRTHDGTTGSAEVNRTMLQLL
FT                   SEMDGFEPRGQVKIIAATNRIDLLDPALLRPGRFDRVIEIPIPDEKAREDILRIHTRHM
FT                   NLADDVDMAKLAKMANGLSGADLKIIVKEAGMFVLRRRGEQITMKDMTEAFNKITTEEE
FT                   QGTVSGMFA"
FT   gene            471145..471885
FT                   /locus_tag="Mmah_0450"
FT   CDS_pept        471145..471885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0450"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to proline rich 8; SPTR: Q12TR8
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35980"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9X9"
FT                   /protein_id="ADE35980.1"
FT                   /translation="MKIRLELFDDDDNEVARVQFEGDTWQNRSIQFINMFGEAQPQSEE
FT                   SSSFNLSSQSQNSHEVNTPSHSGAQYPPQQQVPPQMVPPNYPPMPAQHYYNPMYYPPVY
FT                   YPSMMPQPLPPMQPTTQAPSMSQPPHVQQGQQSGSVNRSFPSQQVNKSKSDPSLTISER
FT                   LELFLKYEFPRMWGTSQEIQHQYEQVYGPIKLSTVSTYLSRMYRKDLLQRRGNRTNREY
FT                   LYVGDMEEQSSVHQSFSPGYIQRT"
FT   gene            471916..472164
FT                   /locus_tag="Mmah_0451"
FT   CDS_pept        471916..472164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0451"
FT                   /product="Protein of unknown function DUF131"
FT                   /note="InterPro IPR002849; PFAM: Protein of unknown
FT                   function DUF131; SPTR: Q8TIM6 Putative uncharacterized
FT                   protein; PFAM: Protein of unknown function DUF131; TIGRFAM:
FT                   conserved hypothetical protein TIGR00304"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35981"
FT                   /db_xref="GOA:D5E9Y0"
FT                   /db_xref="InterPro:IPR002849"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9Y0"
FT                   /protein_id="ADE35981.1"
FT                   /translation="MNSAENSITKGFVLITIGFFLLFLGFITKAIYGNGAQSEFGGLVL
FT                   IGPIPIVIGSSVGVSYSMLLLGLLIFAIYILLWRTNR"
FT   gene            472161..472472
FT                   /locus_tag="Mmah_0452"
FT   CDS_pept        472161..472472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0452"
FT                   /product="Protein of unknown function DUF131"
FT                   /note="InterPro IPR002849; PFAM: Protein of unknown
FT                   function DUF131; SPTR: Q8TIM7 Putative uncharacterized
FT                   protein; PFAM: Protein of unknown function DUF131; TIGRFAM:
FT                   conserved hypothetical protein TIGR00304"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35982"
FT                   /db_xref="GOA:D5E9Y1"
FT                   /db_xref="InterPro:IPR002849"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9Y1"
FT                   /protein_id="ADE35982.1"
FT                   /translation="MIGNILVYGGMAFIGIGIFLIMRGVYEQNVFHKKQSSSQTHGHVN
FT                   EIHTGDEGDYSRTDVKSGGVIMIGPLPIIFGSDSNTSKKAMVLAIILMLIYLLVVVLV"
FT   gene            472506..474482
FT                   /locus_tag="Mmah_0453"
FT   CDS_pept        472506..474482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0453"
FT                   /product="Excinuclease ABC subunit B"
FT                   /note="COGs: COG0556 Helicase subunit of the DNA excision
FT                   repair complex;
FT                   InterProIPR001650:IPR001943:IPR006935:IPR014001:IPR
FT                   014021:IPR004807; KEGG: gur:Gura_0291 excinuclease ABC
FT                   subunit B; PFAM: helicase domain protein; UvrB/UvrC
FT                   protein; type III restriction protein res subunit; SMART:
FT                   DEAD-like helicase; helicase domain protein; SPTR: Q12TR7
FT                   UvrABC system protein B; TIGRFAM: excinuclease ABC, B
FT                   subunit; PFAM: Helicase conserved C-terminal domain;
FT                   UvrB/uvrC motif; Type III restriction enzyme, res subunit;
FT                   Ultra-violet resistance protein B; TIGRFAM: excinuclease
FT                   ABC, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35983"
FT                   /db_xref="GOA:D5E9Y2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9Y2"
FT                   /protein_id="ADE35983.1"
FT                   /translation="MPEFELVSNYSPRGDQPQAIDNLSNGINGGFRHQTLLGVTGSGKT
FT                   FTMANVIQNVQRPTLVIAHNKTLAAQLFSEFRDFFPDNAVEYFVSYYDYYQPEAYLPTT
FT                   DTYIEKDSSINEEIDRLRLSATKSLMERRDVIVVSSVSCIYNLGSPKEWQEMSLFLKPG
FT                   DEVDRSWIFGKLVDIQYERNDVEFTQGTFRARGDTVEIFPAQDNVAVRVEMFGDEIDRI
FT                   SYFEPLTGKVVREVEDDMQVVIYPAKHFVMPQSQIDRALVSIEEELKDTVAEFEKQGQL
FT                   LEAQRIMQRTRFDIEMIEELGYCSGIENYSRHFDGRKPGEAPSSLLDFFPDDYLLIIDE
FT                   SHVTIPQIGGMHNGDRARKKSLIEYGFRLPSAFDNRPLNYREFEERINQAVYVSATPAD
FT                   YELGLSDQVVEQIIRPTGLVDPPVQVRPVANQIDDLMEEVRKVSERGYRTLVTTLTKKM
FT                   AEDLTDYLLEMGIRVRYMHSDIDTLERAEIVRELRKGTFDVLVGINLLREGLDIPEVAL
FT                   VAILDADKEGFLRSERSLIQTIGRASRNVDAYAIMYADRITGSMSRAMSEMERRRNIQL
FT                   EFNRKHNITPTSIMKEIQREIVEVEEVSTPAAGVDMGLSKMEANSMLIDLEAEMHEAAR
FT                   NLEFEEAARLRDAIREMRETYSL"
FT   gene            474573..474644
FT                   /locus_tag="Mmah_R0009"
FT   tRNA            474573..474644
FT                   /locus_tag="Mmah_R0009"
FT                   /product="tRNA-Gly"
FT   gene            474710..475408
FT                   /locus_tag="Mmah_0454"
FT   CDS_pept        474710..475408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0454"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG4912 DNA alkylation repair protein; KEGG:
FT                   sfu:Sfum_2664 hypothetical protein; SPTR: Q0W8Y0 Putative
FT                   uncharacterized protein; PFAM: DNA alkylation repair
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35984"
FT                   /db_xref="InterPro:IPR014825"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9Y3"
FT                   /protein_id="ADE35984.1"
FT                   /translation="MTTTDTILEKLHENAKPDAVDGMKKYGITPSESLGVSIPILRSIA
FT                   KDTGKDHELALALWEIDLRETRILASMVDVPSKVTTEQMDRWARDFDYWEICDQCCMNL
FT                   FEKTSLARDRAFEWSGKQEEFVKREGFVMMARLAVSDKQAPDEAFLAFFPVIEREAVDG
FT                   RNMVKKAVNWALRQIGKRSLYLNNRATECAERIGKIDSKSARWIASDALRELRSEKVLE
FT                   RLNRKVARNH"
FT   gene            475462..475962
FT                   /locus_tag="Mmah_0455"
FT   CDS_pept        475462..475962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0455"
FT                   /product="SOUL heme-binding protein"
FT                   /note="InterPro IPR006917; KEGG: pnu:Pnuc_1414 SOUL
FT                   heme-binding protein; PFAM: SOUL heme-binding protein;
FT                   SPTR: Q12TR6 SOUL heme-binding protein; PFAM: SOUL
FT                   heme-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35985"
FT                   /db_xref="InterPro:IPR006917"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9Y4"
FT                   /protein_id="ADE35985.1"
FT                   /translation="MGVPTAEYDVLEKPADDIEIRYYPEMVIARTNASSSKEAFRKIAA
FT                   YIFGSNEKQLKISMTTPVITCYPQEEGMEMAFVLPEEFTSTKPPAPLSEDVVLQTLSPR
FT                   RIAVVKFRGSISDAIISHKRSYLEQFLDSHDYIHKGLFFRLSYDPPWVPDFLKRHEIAT
FT                   RIE"
FT   gene            476080..476164
FT                   /locus_tag="Mmah_R0010"
FT   tRNA            476080..476164
FT                   /locus_tag="Mmah_R0010"
FT                   /product="tRNA-Leu"
FT   gene            complement(476269..476619)
FT                   /locus_tag="Mmah_0456"
FT   CDS_pept        complement(476269..476619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0456"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35986"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9Y5"
FT                   /protein_id="ADE35986.1"
FT                   /translation="MRFMFKICSVLIIFIALLAIGCTGFDNEVVIVQTKGTSSFDFSKG
FT                   VVYDIDVWVKNEGSSSHNARVTANLISNTDEIRDSLSKTITLQPGEKRNIEFTLDGESG
FT                   VDYNYRCNVEQL"
FT   sig_peptide     complement(476548..476619)
FT                   /locus_tag="Mmah_0456"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(477064..477756)
FT                   /locus_tag="Mmah_0457"
FT   CDS_pept        complement(477064..477756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0457"
FT                   /product="transposase IS4 family protein"
FT                   /note="InterPro IPR002559; PFAM: transposase IS4 family
FT                   protein; SPTR: B8GK76 Transposase IS4 family protein; PFAM:
FT                   Transposase DDE domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35987"
FT                   /db_xref="GOA:D5E9Y6"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9Y6"
FT                   /protein_id="ADE35987.1"
FT                   /translation="MSVAGRSHLPIYSCKYSKRKYTQHQLLTLVLFKDYINENFRKFVK
FT                   LVDLMEGVQSKIGINRLPHFTTLHKFTNRISSFYFNSLLHQTLKLFYSHGERIPLVAID
FT                   SSGFTGGHCSYYYSVRTGKKRRSYLKTSIAVDVENFIVNGFKISGKPVHDAKHALILLR
FT                   QCHKRRKSDCYLMDKGYDSEKIHALINEELKAEAIIPVRCRKRKRIKGKYRRKMRDEFD
FT                   AATIIETW"
FT   gene            complement(478176..479354)
FT                   /locus_tag="Mmah_0458"
FT   CDS_pept        complement(478176..479354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0458"
FT                   /product="SCP-like extracellular"
FT                   /note="COGs: COG2340 Uncharacterized protein with SCP/PR1
FT                   domains; InterPro IPR014044; KEGG: mes:Meso_3523 allergen
FT                   V5/TPX-1 related; PFAM: SCP-like extracellular; SPTR:
FT                   B9ZCZ8 SCP-like extracellular; PFAM: Cysteine-rich
FT                   secretory protein family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35988"
FT                   /db_xref="GOA:D5E9Y7"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9Y7"
FT                   /protein_id="ADE35988.1"
FT                   /translation="MKYYQELISLNKEDLLKNKFENRAFNVFILIGFIIAITSAGCLQS
FT                   NSMEFNFYVEETGENLNGNVYIDDKFLGTTENGILNAPKDELYPGEISLKGNYEGDSFV
FT                   FYYDFFESDFEYNAIDFTVPESRLADISYSAEDVITDSAEDSIFQLINEERKYLDITPL
FT                   ERSEILDDIAESRSKDMVQRGYFSHTTPDGYGVGDILKENEIFYFSATENLMYLPVNRT
FT                   TDIADETVQGWIESPGHRIPVLDTDKPILWDHVGIGVVATDESVDDGKETACYITAVFA
FT                   SFDSTYEDTLPNGYTQYYNIYDKSLGLEFDTNVNIKLQSSDDVDFYIVSDEEKYDDFLN
FT                   RQNIQSSSVISKNDIQYFDREIEIEPGYGAIIDASESYKDVEYELSMVYNPE"
FT   gene            479488..479901
FT                   /locus_tag="Mmah_0459"
FT   CDS_pept        479488..479901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0459"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hch:HCH_04153 major facilitator superfamily
FT                   permease; SPTR: A3KR72 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35989"
FT                   /db_xref="GOA:D5E9Y8"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9Y8"
FT                   /protein_id="ADE35989.1"
FT                   /translation="MNDSNNNLNSTSIPLWKFILLSLITFGIYEIYWMYKQWKFLKLKD
FT                   DLNISPFWRSILAIIFLHELLERIATLADNVGYEKASSTKMNTFRFVFWFLTASINKFQ
FT                   IPLPFGLITYLHFLALINAVQSINFYWKINDTF"
FT   gene            480146..480676
FT                   /locus_tag="Mmah_0460"
FT   CDS_pept        480146..480676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0460"
FT                   /product="integrase family protein"
FT                   /note="COGs: COG4974 Site-specific recombinase XerD;
FT                   InterPro IPR002104; KEGG: sdn:Sden_1137 phage integrase;
FT                   PFAM: integrase family protein; SPTR: A8TGC2 Integrase
FT                   family protein; PFAM: Phage integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35990"
FT                   /db_xref="GOA:D5E9Y9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9Y9"
FT                   /protein_id="ADE35990.1"
FT                   /translation="MLNNPNISEKYEIWILLMYTPALRVTEAINIRVKDIDLEDECIDI
FT                   WGGKGRDVTELQKAPCNIRVLKRIKRFCEHSDLRPTGYIMYSQKSKQVNRSHVYKVFND
FT                   ICSESGINKTIGTHTMRRSRAEHLLDKGLPLTFVSKYLRYKNLSTTMKYLDVSVADIQR
FT                   EMEMIDDCVNALV"
FT   gene            480978..481088
FT                   /locus_tag="Mmah_0461"
FT   CDS_pept        480978..481088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35991"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9Z0"
FT                   /protein_id="ADE35991.1"
FT                   /translation="MIKKIVTSVILFLLLIGLTSGYQNDTSINVTNGGKQ"
FT   sig_peptide     480978..481049
FT                   /locus_tag="Mmah_0461"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            481085..483922
FT                   /locus_tag="Mmah_0462"
FT   CDS_pept        481085..483922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0462"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="COGs: COG2113 ABC-type proline/glycine betaine
FT                   transport systems periplasmic components; InterPro
FT                   IPR007210:IPR006457:IPR010916; KEGG: csa:Csal_1901
FT                   substrate-binding region of ABC-type glycine betaine
FT                   transport system; PFAM: Substrate-binding region of
FT                   ABC-type glycine betaine transport system; S-layer-related
FT                   duplication domain; SPTR: Q2KP08 Glycine-betaine binding
FT                   protein (Fragment); PFAM: Substrate binding domain of
FT                   ABC-type glycine betaine transport system; Protein of
FT                   unknown function (DUF1608); TIGRFAM: S-layer-related
FT                   duplication domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35992"
FT                   /db_xref="GOA:D5E9Z1"
FT                   /db_xref="InterPro:IPR006457"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9Z1"
FT                   /protein_id="ADE35992.1"
FT                   /translation="MKRLTVILMAALMVLIVFSGVASAADSVEVRGEAAVDTASFTWDA
FT                   DNFAGFWYDVDNGVFSETMDITRDASPSRNIDDGNLVYTATVQPESTEFDFAGETTTTG
FT                   AFTNYPIGKIGLFASEYYVVGDGQLSEVLMDTDVSYTMRTGETLELAEGYAITPQQINV
FT                   NDGKVWLELTKDGQFLDGKVIDVSGDNTAWIYEQDVMNEEDVVTLQINIDQVFQGQVDS
FT                   LCIVEGIFQISDTGLHIEKYDTFGKLIVTTVDSTQIVMENENSFNVPKDGTTEISEDFY
FT                   LRGNDNVGAPPNDIWYLATEYTEPGTYEVRGEAAVDASSFTWDADNFAGFWYDLDEDDS
FT                   SETMEINVTDDKDILEGDLVYTATAVDDQTTEFGFTESSTSATGFTYTKLGLFAEEYFV
FT                   VNDAIDTLSKILMDDDSSYTMRTGETLELEEGYAITPQQIDVDGNKVWLELTKDGEFVD
FT                   DKIISTSGDATQANKTWFYEQDIEDQEDVATIMVHVDEVFQGQVDSLCSIEGVFQISDE
FT                   AMVVQTDDEFGELEVTSIGTDSIEMANMDDLDVPDDGVLDITDELMVRGNDGATLWYLF
FT                   TERTIGGEEPVEPVEPEERTTSIGYVMWDGEIASTNVMKEVLEQAGYEVEIIAVDAGPL
FT                   YQGLADGQFDFTTSAWLPQTQANYWEQYGDQVDRVAVNLEDCKLGLAVPTYMEDINSIE
FT                   DLNANKEKFNGKITGIDPGAGIMQNTEDAIDMYNLDYDLEASSSAGMASALDGAYRDEQ
FT                   PIVVTLWTPHWAFDRYDLKMLDDPQQAYGEADHVETLARQGLEDDKPELYAIINRFNWT
FT                   HNEIQTVMADMEAGMSAEDAAANWVENNPDRVNEWINGSDSSSGSSGGGSGASYSTYNM
FT                   SLQKGWNLVSIPIIPESSVLSTFENTSDVLLPVYSWNTENKQYYEVEHLEIGRGYWVLA
FT                   LNDTEVNVEGATYYP"
FT   sig_peptide     481085..481156
FT                   /locus_tag="Mmah_0462"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            483936..485168
FT                   /locus_tag="Mmah_0463"
FT   CDS_pept        483936..485168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0463"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: Q12VI2 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35993"
FT                   /db_xref="GOA:D5E9Z2"
FT                   /db_xref="InterPro:IPR026453"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9Z2"
FT                   /protein_id="ADE35993.1"
FT                   /translation="MQKVSFLAFVLLLVIGTLSVVSADTNDSWEVKLYFTSLSSSSGNT
FT                   SPPPAPATYERIFGINSTAIDGFDRDIDKPAPPEPQGDALDVYFPCEHEVVTRLATDIK
FT                   SNDTDKWKLNIVMPSQSITHLRWDNTSLPADEDFIIIVDGSETDMQSKDMIELTSGANE
FT                   ITVHMGDIPTSTKPSDPPGGGSGGGGGGATGEEFENIASKHAQVSKVAAGENVRYEFSE
FT                   DDIDLMTIQFTSLSNEGQTKTSVEVLKDTSALVDSSAPGKVYQNLNIWVGNVAFNEDDM
FT                   EIPVVGFRVSKEWISDNDVESSSVVLCRYNDGEWTQLPTEVIDENENYFIYESETPGFS
FT                   PFAISAIYEEEESSEDTISSSEEKYDDFVEEEEVVENDSNTPDSNATPGFSILLSMGVL
FT                   LLMAMIFRKKG"
FT   sig_peptide     483936..484004
FT                   /locus_tag="Mmah_0463"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(485415..485912)
FT                   /locus_tag="Mmah_0464"
FT   CDS_pept        complement(485415..485912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35994"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9Z3"
FT                   /protein_id="ADE35994.1"
FT                   /translation="MDCFDEAAAWYLNKIKRIPQDPGKLGCENCLTIEQLLDLFTGKYY
FT                   IQEKFKGGLVARGTRGRSYAIYYDSDMNHNVDKIIVRRNNVKCFKDFTGRKVGTPNSVT
FT                   YFASEFSTDTPSIKEIYEVLNNYLHEPALYDKNNKAGIVVKNYGTFGPGRYLFGEYLMD
FT                   ES"
FT   gene            complement(485991..487112)
FT                   /locus_tag="Mmah_0465"
FT   CDS_pept        complement(485991..487112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35995"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9Z4"
FT                   /protein_id="ADE35995.1"
FT                   /translation="MEHQLVTFKKTFEDLNNLGNNSLFDFDGEKIVLLNNRTKLFFIET
FT                   LGLHDPAINFCSLGLTQIPKVALEENIKNSFEEIMHKNFVFVHKPGRTAINRFVEGLED
FT                   TKICIQADIPSNYVHFPNKYIISTEKLGTLVSMLYFREKGYIVQNPLGTYGKEGNDRPG
FT                   IDDVVAWKSPTLDELRKFRFIDKGCHISELACLRWLDRVPEPSTHLDSPVNNELILVEV
FT                   KSSKRYGLSNSPSRGVDQLLRAKKEKVAKKLFISFPTVDSDHDEVFAKIKKRMDEGPVA
FT                   GGIFFDDKGLHIHDSESFHDENVTTEIDKYESELKLVLLNNFYFNEILEMIGELDVDTD
FT                   NKGLEEVLDSFNAKIENDVSTNYLLEKLNKLIG"
FT   gene            487396..487533
FT                   /pseudo
FT                   /locus_tag="Mmah_0466"
FT   gene            487656..488153
FT                   /locus_tag="Mmah_0467"
FT   CDS_pept        487656..488153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0467"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR008254; KEGG: dal:Dalk_1616 hypothetical
FT                   protein; SPTR: Q8TTR5 Putative uncharacterized protein;
FT                   PFAM: Flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35996"
FT                   /db_xref="GOA:D5E9Z5"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9Z5"
FT                   /protein_id="ADE35996.1"
FT                   /translation="MKTLVTYMTQTGNTKKIAEAIYGEITGEKDVKDIEDVSNLEGYDL
FT                   VFVGFPVLQFNIPEKVSNFVKENVAGKNIAFFMTHAVPEGFEAIHSWTGSCKDIAASGN
FT                   YLGTFECQGELAQPVIDMLLESDDPQMKEFGEMGPSTKGQPDESRVQKAREFAKEIQAK
FT                   VQ"
FT   gene            complement(488277..488972)
FT                   /locus_tag="Mmah_0468"
FT   CDS_pept        complement(488277..488972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0468"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="COGs: COG1600 Uncharacterized Fe-S protein; InterPro
FT                   IPR001450:IPR017900; KEGG: dal:Dalk_4692 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; PFAM: 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; SPTR: Q12X35 4Fe-4S
FT                   ferredoxin, iron-sulfur binding; TIGRFAM: iron-sulfur
FT                   cluster binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35997"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9Z6"
FT                   /protein_id="ADE35997.1"
FT                   /translation="MTENNITETLRNLAFELDADFISITDKSCFEDSDYTGNKPQDVMD
FT                   NLQSVIILGVSLPRGAFETLPKGRGEYTNTLMAATTTLRVIAFKLAKLIEKEGYMATIA
FT                   PSEGSEYGYWYADRETLKADLSFKYAAYRAGVGNFGMNHLLITKDFGPKVRMAAILTDA
FT                   PLDTEEKAELPFINDACSECMKCIEVCPVDALTSEGVIHKEKCAEYMFNVLGGLRCGLC
FT                   IKVCPLNNF"
FT   gene            complement(489030..489410)
FT                   /locus_tag="Mmah_0469"
FT   CDS_pept        complement(489030..489410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0469"
FT                   /product="protein of unknown function DUF498"
FT                   /note="COGs: COG1504 conserved hypothetical protein;
FT                   InterPro IPR007523; KEGG: C29H11orf67; chromosome 11 open
FT                   reading frame 67 ortholog; K09008 hypothetical protein;
FT                   PFAM: protein of unknown function DUF498; SPTR: Q8TPS9
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF498/DUF598)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35998"
FT                   /db_xref="InterPro:IPR007523"
FT                   /db_xref="InterPro:IPR036748"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9Z7"
FT                   /protein_id="ADE35998.1"
FT                   /translation="MIGEKSMKPKIDSTKFSSITIEGEEYEKDVLIRLSGNIKKRKKKL
FT                   SKAIYGTSHKISLDEAEHVYENGAEKIIIGSGQNGMLELSDEAHDFFKSKDCKVKLCPT
FT                   PEAIDKWNSAKGKVIGLFHLTC"
FT   gene            complement(489574..490077)
FT                   /locus_tag="Mmah_0470"
FT   CDS_pept        complement(489574..490077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0470"
FT                   /product="CBS domain containing membrane protein"
FT                   /note="COGs: COG3448 CBS-domain-containing membrane
FT                   protein; InterPro IPR000644; KEGG: hypothetical protein;
FT                   PFAM: CBS domain containing protein; SMART: CBS domain
FT                   containing protein; SPTR: Q12VD6 CBS domain protein; PFAM:
FT                   CBS domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADE35999"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9Z8"
FT                   /protein_id="ADE35999.1"
FT                   /translation="MPLDAPDKSKNPDYRDRFQISKQCATKKIIEVMTVEVVGIDESSS
FT                   IEDTLELIGKYRFHNFPVVDKDYRLKGVIDQNIVLELLFHDRLPSSSHTHLTAVRSLGE
FT                   DAKSIMIPHPLKVSRDTSLCEGVDMMLKHNINHVWVVDNDDKLIGVITKHDVINEAYRT
FT                   RSKK"
FT   gene            490955..491320
FT                   /locus_tag="Mmah_0471"
FT   CDS_pept        490955..491320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0471"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="COGs: COG0599 gamma-carboxymuconolactone
FT                   decarboxylase subunit; InterPro IPR003779:IPR004675; KEGG:
FT                   smd:Smed_3036 alkylhydroperoxidase; PFAM:
FT                   Carboxymuconolactone decarboxylase; SPTR: Q12Z58
FT                   Alkylhydroperoxidase family protein; TIGRFAM:
FT                   alkylhydroperoxidase like protein, AhpD family; PFAM:
FT                   Carboxymuconolactone decarboxylase family; TIGRFAM:
FT                   alkylhydroperoxidase AhpD family core domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36000"
FT                   /db_xref="GOA:D5E9Z9"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D5E9Z9"
FT                   /protein_id="ADE36000.1"
FT                   /translation="MSEHEELEHEELLDSMSNKLGFTPQILKTLGEIDPHFLKKYNHCN
FT                   QKLLSDGALPAKMKILMALAVVASKQCERCTVVQMQSALKNGATAEEIMETMEVISITS
FT                   GAPAVAACRDALKLLKE"
FT   gene            491366..491869
FT                   /locus_tag="Mmah_0472"
FT   CDS_pept        491366..491869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0472"
FT                   /product="PfpI peptidase"
FT                   /note="COGs: COG0693 Putative intracellular
FT                   protease/amidase; InterPro IPR002818:IPR006286; KEGG:
FT                   gme:Gmet_2409 peptidase C56, PfpI; PFAM: ThiJ/PfpI domain
FT                   protein; SPTR: Q8TMW8 Intracellular protease I; TIGRFAM:
FT                   intracellular protease, PfpI family; PFAM: DJ-1/PfpI
FT                   family; TIGRFAM: intracellular protease, PfpI family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36001"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA00"
FT                   /protein_id="ADE36001.1"
FT                   /translation="MKVLVFGADGFEDLELFYPLHRLKEEGIDARVASVSRGTIEGKHG
FT                   YHVEADLSFDEIDPEEHDALVISGGKGPEIMRLNEYALDIVKHFMNEEKPVAAICHGPQ
FT                   LLISARVLDGRKATCWPGIRDDLIIAGADYRDSEVVVDDNLVTSRHPGDLFAFGRELLG
FT                   LIKR"
FT   gene            complement(491929..492966)
FT                   /locus_tag="Mmah_0473"
FT   CDS_pept        complement(491929..492966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0473"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG1313 Uncharacterized Fe-S protein PflX
FT                   homolog of pyruvate formate lyase activating protein;
FT                   InterPro IPR007197; KEGG: sat:SYN_01999 pyruvate
FT                   formate-lyase activating enzyme; PFAM: Radical SAM domain
FT                   protein; SPTR: Q8TN83 Formate acetyltransferase activating
FT                   enzyme; PFAM: Radical SAM superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36002"
FT                   /db_xref="GOA:D5EA01"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR040085"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA01"
FT                   /protein_id="ADE36002.1"
FT                   /translation="MDSPKFLNRYHAVTNNQLPAQFQIVKSIPTRYDISKSLDELWNIH
FT                   ERSMEQYRSLLDLIDSEKRYPEKLTAACTSLLDLKIAIAEKLIEKCCLCEHRCDVNRKR
FT                   DEKGFCRLTETSRYTSEFLHMGEESELVPSHTIFFTGCVFGCVYCQNWDISAYPEKGHQ
FT                   VNPANLAAIIRERRHSGARNVNFVTPTPHAHNILKILREVSVNIPVIWNSNMYHTREIA
FT                   KLLEGVIDVYLTDFKYGSDRCAKKYSKVQNYLEIVKRNHEIAYQKAEIIIRHLVLPEHL
FT                   ECCTKPVVRWIAKHVPEVRFNLMFQYTPQYRSREYPEISRRLLPDEKEKAIAIVKESGI
FT                   EDILI"
FT   gene            493092..493775
FT                   /locus_tag="Mmah_0474"
FT   CDS_pept        493092..493775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36003"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA02"
FT                   /protein_id="ADE36003.1"
FT                   /translation="MDYCCFVCNDSITSAEYKYSMNKFGRALCRRHQKDSATIDHTNSS
FT                   SNESEKDDQNGNVDQTNSVSNWKQGWRNPENMIKGRIAETLIEELFLQLGFSVFRYGME
FT                   NTIPGVMQLLKGVRSDVATNIRRMPDFVVQNPKTHEVSFVEVKFRKSESFKLKDAGEDY
FT                   PYENCFFIVVSKKHIKCITYQELKKGKEITPKSINYLGNRKEFELDKDTIIQYCDFAVK
FT                   FFESV"
FT   gene            493934..494758
FT                   /locus_tag="Mmah_0475"
FT   CDS_pept        493934..494758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0475"
FT                   /product="nitrite and sulphite reductase 4Fe-4S region"
FT                   /note="COGs: COG2221 Dissimilatory sulfite reductase
FT                   (desulfoviridin) alpha and beta subunits; InterPro
FT                   IPR006066:IPR006067:IPR001450:IPR005117; KEGG:
FT                   gme:Gmet_1570 iron-sulfur cluster-binding protein; PFAM:
FT                   nitrite and sulphite reductase 4Fe-4S region; 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein;
FT                   nitrite/sulfite reductase hemoprotein beta-component
FT                   ferrodoxin domain protein; SPTR: Q8TKG8 Sulfite reductase,
FT                   beta subunit; PFAM: Nitrite and sulphite reductase 4Fe-4S
FT                   domain; Nitrite/Sulfite reductase ferredoxin-like half
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36004"
FT                   /db_xref="GOA:D5EA03"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA03"
FT                   /protein_id="ADE36004.1"
FT                   /translation="MKNNGFLPQKLDNKFSMCTHLVGGCVEANQLRALTDAAEKYVAGH
FT                   VHITSRQGAEIPFVDMDDVENITEDMEDAGIFGGATGQKVRGVVACQGITVCNHGLINC
FT                   PELAARIDEIYFGTYASKKFKIAITGCPASCMKPQENDFGIMGVVRPEWIENNCVACGL
FT                   CEKICKADAISIDNGQLDIDSNSCIFCGECISSCKKSAINGAESGYAIFVGGKVGRFPR
FT                   SCDKPIEFTDENRLFSILEKTLAYYRKYGQDGERFGDLLDRRGFAEYRDTVL"
FT   gene            complement(494764..495987)
FT                   /locus_tag="Mmah_0476"
FT   CDS_pept        complement(494764..495987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0476"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating)"
FT                   /EC_number="1.1.1.38"
FT                   /note="COGs: COG0281 Malic enzyme; InterPro
FT                   IPR012302:IPR012301; KEGG: malic enzyme; K00027 malate
FT                   dehydrogenase (oxaloacetate-decarboxylating); PFAM: malic
FT                   protein NAD-binding; malic protein domain protein; PRIAM:
FT                   Malate dehydrogenase (oxaloacetate-decarboxylating); SPTR:
FT                   Q467K6 NAD-dependent malic enzyme; PFAM: Malic enzyme, NAD
FT                   binding domain; Malic enzyme, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36005"
FT                   /db_xref="GOA:D5EA04"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA04"
FT                   /protein_id="ADE36005.1"
FT                   /translation="MKHLTVKSCMETDDSLGEESLQLHEKHHGVLEVASKVHMDNTQDL
FT                   SIAYTPGVAEPCKRIAENKDDVYKYTLKENTVAIITDGSAILGLGNIGASAGLPVMEGK
FT                   AIIFKELAGINAFPICLDTQETEEIIKTVKNIAPVFGGINLEDISAPRCFEIEERLKKE
FT                   LSIPVTHDDQHGTAIVTIAGLLNSLKLTGKKINEIKVVISGAGAAGMAIAKKLLHTGVR
FT                   PENLLVCDRHGIISKKRTEGMNPEKEKIAEFSNTEEIEGNIDDAVAGSDVFIGVSVPGI
FT                   LTEKMVASMNNDAIIFAMANPIPEIMPSKAFEAGARIVATGRSDCPNQINNCLGFPGIF
FT                   KGALETRATQINLEMELAAANALAAIVEQDGIEENYIIPNPLDKRVVPAVAKAVADAAI
FT                   KSGVARKK"
FT   gene            496157..496588
FT                   /locus_tag="Mmah_0477"
FT   CDS_pept        496157..496588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0477"
FT                   /product="peptidylprolyl isomerase FKBP-type"
FT                   /note="COGs: COG1047 FKBP-type peptidyl-prolyl cis-trans
FT                   isomerase 2; InterPro IPR001179; KEGG: dol:Dole_0174
FT                   peptidylprolyl isomerase FKBP-type; PFAM: peptidylprolyl
FT                   isomerase FKBP-type; SPTR: A0P3R1 Peptidyl-prolyl cis-trans
FT                   isomerase; PFAM: FKBP-type peptidyl-prolyl cis-trans
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36006"
FT                   /db_xref="GOA:D5EA05"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA05"
FT                   /protein_id="ADE36006.1"
FT                   /translation="MSIKDGDTIKIDYKGTLDDGTVFDSSENHEEPLEFTVGAGQVIQG
FT                   FDDAVRDMKEGEEKEFRLEPSEAYGEYNEGLSQPVPKDNIQSDIDVEVGMMLLVKTPDG
FT                   QELPAKIVEVGDEEVILDMNHPLAGKALNFNIQVKEISS"
FT   gene            complement(496764..499541)
FT                   /locus_tag="Mmah_0478"
FT   CDS_pept        complement(496764..499541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0478"
FT                   /product="aconitase"
FT                   /EC_number="4.2.1.3"
FT                   /note="COGs: COG1048 Aconitase A; InterPro
FT                   IPR001030:IPR000573:IPR018136:IPR006249; KEGG:
FT                   hha:Hhal_1406 aconitate hydratase 1; PFAM: aconitate
FT                   hydratase domain protein; SPTR: Q8PWP8 Aconitate hydratase;
FT                   TIGRFAM: aconitate hydratase 1; PFAM: Aconitase C-terminal
FT                   domain; Aconitase family (aconitate hydratase); TIGRFAM:
FT                   aconitate hydratase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36007"
FT                   /db_xref="GOA:D5EA06"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA06"
FT                   /protein_id="ADE36007.1"
FT                   /translation="MDNNSVSFKARDTLDTMGKKSTIYRLDKLEENGLCKISSLPYSIR
FT                   VLLENLVRNTDGKVVTEEDVKNLAGWKPGNIPKTDVPYIPSRVILQDFTGVPAVVDIAA
FT                   IRSAMKRLGGNPEEINPVIPADLIIDHSVQVDCYGTSYARNCNEKHEFQRNGERYELLH
FT                   WAQNAFDNFNVVPPGSGIIHQVNLEHLANVVHLREENGETVAYPDTLVGTDSHTTMING
FT                   LGVLGWGVGGIEAEAVMLGQPYYMPIPEVVGFELRGELKDGITATDLVLTVTQMLREHG
FT                   VVGKFVEFYGPGYRKLSLPDRAILANMGPEYGATMGFCPVDEVTLDYMRMTGRSEEHVN
FT                   MVRQYCKEQGLFAESDAPVPEYTSSLGLDMGTVQPSLAGPKRPQDRIVLSDMSAAFHKT
FT                   MKDVFSLEKGSEDFENDPDYSRWLEEGGYNVVEKTHPDHSGIMKIKCEGEEVDLNHGSV
FT                   TIASITSCTNTSNPSVLIGAGLVAKKAVERGLKVKPFVKTSLGPGSKAVMDYLEAAGLV
FT                   PYLEALGFHLVGYGCLTCIGNSGPLHEAVVKEIEDRDLTVASVLSGNRNFEGRISPHVK
FT                   ANYLASPMLVVAFALAGTVDIDLTKEPIACDPNGEPVYLKDIWPANGEIEQYCGEYVQP
FT                   EMFEKEYANVFQGTERWQELDAPEGLLYDWNNESTYIQEPPFFQDFPVDIENMEDIKDA
FT                   RALVVVDDSITTDHISPAGSIPADYPAGRYLMEHGVAENEFNSYGSRRGNHEVMMRGTF
FT                   GNVRLKNKLVPGKEGSWTVYLPEAEEMPIYDAAMKYMENNIPLVVIAGKEYGTGSSRDW
FT                   AAKGTQLLGVKAVIAQSYERIHRSNLVGMGVIPLQFREGENKESLGLEGDETYTIKGIP
FT                   EMKPGGELEVVARHPDGNEVTFNVTVNLNSDIEVDYCKNGGILHKFLRDKAKGE"
FT   gene            complement(499568..500668)
FT                   /pseudo
FT                   /locus_tag="Mmah_0479"
FT   gene            complement(500934..501572)
FT                   /locus_tag="Mmah_0480"
FT   CDS_pept        complement(500934..501572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0480"
FT                   /product="protein of unknown function DUF1271"
FT                   /note="COGs: COG3592 conserved hypothetical protein;
FT                   InterPro IPR018967:IPR010693:IPR006622; KEGG: mlo:mlr4660
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF1271; Iron sulphur domain-containing, CDGSH-type; SMART:
FT                   zinc finger CDGSH-type domain protein; SPTR: Q12YH8
FT                   Putative uncharacterized protein; PFAM: Iron-binding zinc
FT                   finger CDGSH type; Protein of unknown function (DUF1271)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36008"
FT                   /db_xref="GOA:D5EA07"
FT                   /db_xref="InterPro:IPR010693"
FT                   /db_xref="InterPro:IPR016548"
FT                   /db_xref="InterPro:IPR018967"
FT                   /db_xref="InterPro:IPR042216"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA07"
FT                   /protein_id="ADE36008.1"
FT                   /translation="MDKEDKTIIKVSKDGPYIVSNLNTLRNSKGVFIETMPTIVMCRCG
FT                   GSGNKPFCDGTHMKNGFSGDKKEDRVPDKMDTYKGKAITIHDNRGVCSHMGHCTDNLPS
FT                   VFRMGIEPWIDPDGADPEEIARIIRMCPSGALSYTMDGQLHKDYPHDSEVFVGKDRSYN
FT                   VVGDIELEGPDGSKPETQDHYCLCRCGGSKNKPFCDGSHWHIEFEDEKN"
FT   gene            complement(501646..502071)
FT                   /locus_tag="Mmah_0481"
FT   CDS_pept        complement(501646..502071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0481"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce8824 hypothetical protein; SPTR: Q467T0
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36009"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA08"
FT                   /protein_id="ADE36009.1"
FT                   /translation="MNNDREDFWDKQSFVIITDNTKPAMKYTIDELNKRGKEVYIFDLS
FT                   ANPNKGDIKSVDDIPYNVENAVLGITTSNPADFVQALKNRGCSNFWIHWRTETPEIEDI
FT                   KDHDIQIIKGKCPMMYLGKDFSIHGLHRSIAKFAGKY"
FT   gene            502615..502827
FT                   /locus_tag="Mmah_0482"
FT   CDS_pept        502615..502827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0482"
FT                   /product="S1 IF1 family protein"
FT                   /note="COGs: COG0361 Translation initiation factor 1
FT                   (IF-1); InterPro IPR001253:IPR006196:IPR018104; KEGG:
FT                   hypothetical protein; K03236 translation initiation factor
FT                   eIF-1A; PFAM: S1 IF1 family protein; SMART: initiation
FT                   factor 1A (eIF-1A); SPTR: Q8PUJ8 Translation initiation
FT                   factor 1A 2; PFAM: Translation initiation factor 1A / IF-1;
FT                   TIGRFAM: eukaryotic/archaeal initiation factor 1A"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36010"
FT                   /db_xref="GOA:D5EA09"
FT                   /db_xref="InterPro:IPR001253"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018104"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA09"
FT                   /protein_id="ADE36010.1"
FT                   /translation="MLGGKRLDLQCMDGVVRMGRIPGSRKRRMRIREGDVVLAIPWDIQ
FT                   DSKADVVWKYRRQEVAWLQKKGYLK"
FT   gene            503026..504102
FT                   /locus_tag="Mmah_0483"
FT   CDS_pept        503026..504102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0483"
FT                   /product="L-lysine 2,3-aminomutase"
FT                   /EC_number="5.4.3.2"
FT                   /note="COGs: COG1509 Lysine 2 3-aminomutase; InterPro
FT                   IPR007197:IPR003739; KEGG: dat:HRM2_29300 YodO; PFAM:
FT                   Radical SAM domain protein; PRIAM: Lysine 2,3-aminomutase;
FT                   SPTR: Q46EP3 L-lysine 2,3-aminomutase; TIGRFAM: lysine
FT                   2,3-aminomutase YodO family protein; PFAM:
FT                   Lysine-2,3-aminomutase; TIGRFAM: KamA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36011"
FT                   /db_xref="GOA:D5EA10"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR025895"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA10"
FT                   /protein_id="ADE36011.1"
FT                   /translation="MSEEWKDQITNQINSLEKLEEIINLTESEREAIKTLDTHWGTTPY
FT                   FASLMDKDDPECPIRKQVVPSLQESHNKYGMKDYLVWKENRATEEVRPDSIARQYKDRV
FT                   AFTVFQECGIYCRHCFRKELVVSHDLKLDFNVDDGIEWIRQHPEVRDVLITGGDPLLLS
FT                   DEKIEYIIESLRDIPHVEMIRIGSRLPIVLPHRITDNLKRILGGYHDVPIWLNTQCNHP
FT                   KEITDKTKRAVYDLVSAGVNVGNQAVLLKGINDDVQTIRDLHQKLLTARIRPYYLFYCE
FT                   PAPGIDHFRTPVEKGAELIRDGLRGHTTGLAQPMYVIATNVGKIPLMPDYYMVDKDEEK
FT                   YVLRNHRGELTEIPNIPE"
FT   gene            504479..504949
FT                   /locus_tag="Mmah_0484"
FT   CDS_pept        504479..504949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0484"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="InterPro IPR000835; KEGG: ara:Arad_4079
FT                   transcriptional regulator protein; PFAM: regulatory protein
FT                   MarR; SMART: regulatory protein MarR; SPTR: Q12TU2
FT                   Transcriptional regulator, MarR family; PFAM: MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36012"
FT                   /db_xref="GOA:D5EA11"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA11"
FT                   /protein_id="ADE36012.1"
FT                   /translation="MEIVDSPKKELAELKLEYDILSHKVLYDAIEKVFEDNSGPLPNLK
FT                   NRGHAILILGREKEMMPSLAKFLNLKKSSVTSMIDSLEKEGLVKRTSDPTDRRKAWISL
FT                   TSSGYKYMEVIEDCMEKIVDVMIKDLEDEEVEKMLESMRSVVNLERKILKSI"
FT   gene            505183..507492
FT                   /locus_tag="Mmah_0485"
FT   CDS_pept        505183..507492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0485"
FT                   /product="efflux transporter, hydrophobe/amphiphile
FT                   efflux-3 (HAE3) family"
FT                   /note="COGs: COG1033 exporter of the RND superfamily
FT                   protein; InterPro IPR003335:IPR000731:IPR004767; KEGG:
FT                   dal:Dalk_4262 cyclic nucleotide-binding protein; PFAM:
FT                   SecD/SecF/SecDF export membrane protein; SPTR: Q12TU1
FT                   Hydrophobe/amphiphile efflux-3 HAE3; TIGRFAM: efflux
FT                   transporter, hydrophobe/amphiphile efflux-3 (HAE3) family;
FT                   PFAM: MMPL family; TIGRFAM: The (Largely Archaeal Putative)
FT                   Hydrophobe/Amphiphile Efflux-3 (HAE3) Family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36013"
FT                   /db_xref="GOA:D5EA12"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004767"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA12"
FT                   /protein_id="ADE36013.1"
FT                   /translation="MLLVLVSFEGAQLIKMESGTETFVDKDSQLYQDYDHLYLSLFSKE
FT                   AIVVMVEGGDVQDRALLEAIDRLDRMSSSIPGVLSTQSASSVVKEANKLENGRFEIPQN
FT                   DEQFSELIPYIPSSLSPDKTHTLVYIEMAGDTSEVRKQEILSEVETSVDLAEFPPGYNF
FT                   IVTGDPAFEIGMNKEMMSSMGILLLLSAFLMVIVLYLVFRHVRWRLMPLAIVLLGIIYT
FT                   FGAMGYLGIPMTMVSMAAFPVLIGLGIDYAIQFHNRIEEELERGESPREAVIDTIKHTG
FT                   PAVMIALTITSLGFVSLATSTVPMVQDFAKLLLIGVFMCFLSSLFVGVTVIYGLDTFAK
FT                   KKQEKAKKHRVDSLRHRLITRRFKKPDKKQTSTDSGGFIDNTLRSVATFTMKHPVPVLI
FT                   IAGLICVNGLYTDTFVPIQTDTETFVPEDMPALIDLQHLGDITGGDDELNVIIKTSNIA
FT                   DPDLLQWVDKFSQHEVDNRDNVYAATSLVSLIKDNNGGVLPDSEAGVKHVLSEIPDSAK
FT                   ERYISGQNIMVVNLNIGDAMSGLGLEGIETLANVIENDIQWLAPPPDVSVTITGHSFVF
FT                   IEVIGALTSGRIFMTYLGLGMVFAGLLVIYRDFLKAFVPVITMFMVIGWTGGLMYYLNM
FT                   EYTPMTATLGALILGVGSEYAVLMMERYFEEREKGALPEAAMCEASVKIGKAIVTSGLT
FT                   TLFGFLALVASAFGIISSFGIITVIDVALALIATFVIFPPVIVTLDKWRDKHRAKKAGH
FT                   NMNSSANYLQTGADIS"
FT   gene            507489..508589
FT                   /locus_tag="Mmah_0486"
FT   CDS_pept        507489..508589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0486"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q12TU0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36014"
FT                   /db_xref="GOA:D5EA13"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA13"
FT                   /protein_id="ADE36014.1"
FT                   /translation="MSRIQNNTINFRRPLVFLSLISLILLATLFSGMSTAQSKEYIPPT
FT                   YEYTTNYYRGYGMPDIHASVVGDTHFERGETATLNVILSNRGILHGFKSVTDVEGDKAE
FT                   QALAMKELEYETKRTIAYGIKTRLVSPTDYIEIDSSTNGQALEKLVPGDLPSRPMTFTI
FT                   EISDDAPAGDYVLFLPVSYEYQEDVRMTGGRTIQLGLPEMDHATYYNNSNKTLQIPIHI
FT                   EKAAQFEVVDVAGDLVAGEDRVIQVTYRNVGELTADGALARVVVMDPLSTGSSTALLGT
FT                   LEPGEEHTVSFNVNSDVMAVVKDYAIDSEIRYIDEDGDYAFSENMKINVPLQSSGEWIG
FT                   ITQVSLLLTFLITIYLIVDSIRKKKK"
FT   sig_peptide     507489..507596
FT                   /locus_tag="Mmah_0486"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            508613..509710
FT                   /locus_tag="Mmah_0487"
FT   CDS_pept        508613..509710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0487"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR008162; SPTR: Q12TT9 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36015"
FT                   /db_xref="GOA:D5EA14"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA14"
FT                   /protein_id="ADE36015.1"
FT                   /translation="MNKRNLIIGIIALGISLICLIPASAAGFSPQNDALPDYFDFSDNY
FT                   YTAYGGPDVSATIVGDNEFYRGDSVTLNINLMNKGVITGFRSEKDDDPVDVLDQKLQQE
FT                   EMSYESQRTTAIGIVAILTSPDPNVEVKSGPQEAGSLATGEQTTSPVKFNIDFSNNAPS
FT                   GDYPLILSLYYGYQKNVQVSGDNETSLGVTNMDVGLWYDVGSQNVTIPVNVKREAQFEV
FT                   TNVSGQLAVGEEGMLHVTYTNTGNEPVKDAIVRISAANPFSTTDDQAYLGDLDAGESAV
FT                   AVFKLKVGDSAVEKPYAINSEIKYEDTKGHDRVSDNVKIKTQVSASSNTYTGGLMLPAG
FT                   FAIAALVIGAIVLYMRRKPGQKPEE"
FT   sig_peptide     508613..508687
FT                   /locus_tag="Mmah_0487"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            509860..511086
FT                   /locus_tag="Mmah_0488"
FT   CDS_pept        509860..511086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0488"
FT                   /product="translation initiation factor 2 subunit gamma
FT                   (aeIF-2g)"
FT                   /note="COGs: COG5257 Translation initiation factor 2 gamma
FT                   subunit (eIF-2gamma; GTPase); InterPro
FT                   IPR000795:IPR015256:IPR004161; KEGG: eukaryotic translation
FT                   initiation factor eIF-2 gamma subunit; K03242 translation
FT                   initiation factor eIF-2 gamma subunit; PFAM: protein
FT                   synthesis factor GTP-binding; Initiation factor eIF2 gamma
FT                   domain protein; elongation factor Tu domain 2 protein;
FT                   SPTR: Q12TT8 Translation initiation factor 2 subunit gamma
FT                   (AeIF-2g); PFAM: Elongation factor Tu domain 2; Elongation
FT                   factor Tu GTP binding domain; Initiation factor eIF2 gamma,
FT                   C terminal; TIGRFAM: small GTP-binding protein domain;
FT                   translation elongation factor TU"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36016"
FT                   /db_xref="GOA:D5EA15"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015256"
FT                   /db_xref="InterPro:IPR022424"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA15"
FT                   /protein_id="ADE36016.1"
FT                   /translation="MSQPCVNIGMVGHVDHGKTTLVRSLSGVWTDKHSEELKRGISIRL
FT                   GYADTTLMKCPTCPEPRCYSVKKECPHCGAKTEQVRTISFVDSPGHETLMATMLSGAAI
FT                   MDGAILVIAANEECPQPQTKEHLMALDIIGIKNVVIVQNKIDLVNRKDVIENYKQIKDF
FT                   VKGTVAENAPIIPISAQQDINIDALIGAMEKVIPAPTYKLDKEARMLIARSFDINRPGL
FT                   PIDQISGGVIGGTLTEGTLKAGDDLEIKPGRKVESEGAIHWDPIHTRVTGIIAGTTPVD
FT                   EATPGGLLAVGTELDPDLTKSDSLTGQVAGKPGTLPSTNHSFTLRLKLLDRVVGVDDEG
FT                   EIGQIKTSEPLMLNAGTATTVGIVTSAREDVAEVNLKRPVCADIGSMVAISRRIGSRWR
FT                   LIGIRVIED"
FT   gene            511083..511448
FT                   /locus_tag="Mmah_0489"
FT   CDS_pept        511083..511448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0489"
FT                   /product="Uncharacterized protein of PilT N-term./Vapc
FT                   superfamily"
FT                   /note="COGs: COG1412 Uncharacterized protein of PilT
FT                   N-term./Vapc superfamily; SPTR: Q12TT7 Putative
FT                   uncharacterized protein; PFAM: Fcf1"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36017"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR041120"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA16"
FT                   /protein_id="ADE36017.1"
FT                   /translation="MKVIIDTNGMMLPAQFGVDIFTELRRLGYDQFLLPTAILHELDGL
FT                   VRRCRGEDKIAAKVAISLSQRCDVIEGEGFADDVIVRLAPAYDAAVLTNDIGLQQRLKE
FT                   KEIPIIRLRQKNKLDFL"
FT   gene            511527..512090
FT                   /locus_tag="Mmah_0490"
FT   CDS_pept        511527..512090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0490"
FT                   /product="DNA-directed RNA polymerase, subunit E'"
FT                   /EC_number="2.7.7.6"
FT                   /note="COGs: COG1095 DNA-directed RNA polymerase subunit
FT                   E'; InterPro IPR003029:IPR005576:IPR004519; KEGG:
FT                   hypothetical protein; K03015 DNA-directed RNA polymerase II
FT                   subunit G; PFAM: RNA polymerase Rpb7 domain protein; RNA
FT                   binding S1 domain protein; PRIAM: DNA-directed RNA
FT                   polymerase; SPTR: Q12TT6 DNA-directed RNA polymerase,
FT                   subunit E'; TIGRFAM: DNA-directed RNA polymerase; PFAM: S1
FT                   RNA binding domain; RNA polymerase Rpb7-like, N-terminal
FT                   domain; TIGRFAM: DNA-directed RNA polymerase (rpoE),
FT                   archaeal and eukaryotic form"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36018"
FT                   /db_xref="GOA:D5EA17"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004519"
FT                   /db_xref="InterPro:IPR005576"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR036898"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA17"
FT                   /protein_id="ADE36018.1"
FT                   /translation="MYKRMKLVDTVRVAPRLLADDVRVSVKNALKTKLEGRVDKKIGSV
FT                   VAITDIDEIGEGHILVGDGAVYYDATFEAIMFIPTLQEVIEGEVVETVEFGAFVSIGAM
FT                   DGLLHVSQITDDFMSYDGKNGRLISKNVNKVLSEGDRVRARIVAVSINEREPRDSKIGL
FT                   TMRQPALGKLEWLDEQRKPNVTNK"
FT   gene            512105..512290
FT                   /locus_tag="Mmah_0491"
FT   CDS_pept        512105..512290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0491"
FT                   /product="DNA-directed RNA polymerase, subunit E''"
FT                   /EC_number="2.7.7.6"
FT                   /note="COGs: COG2093 DNA-directed RNA polymerase subunit
FT                   E''; InterPro IPR007178; PFAM: DNA-directed RNA polymerase
FT                   subunit E, RpoE2; SPTR: Q12TT5 DNA-directed RNA polymerase,
FT                   subunit E''; PFAM: Spt4/RpoE2 zinc finger"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36019"
FT                   /db_xref="GOA:D5EA18"
FT                   /db_xref="InterPro:IPR007178"
FT                   /db_xref="InterPro:IPR022800"
FT                   /db_xref="InterPro:IPR029040"
FT                   /db_xref="InterPro:IPR038589"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA18"
FT                   /protein_id="ADE36019.1"
FT                   /translation="MVESVCMDCHRLVSGQECPVCGTTNLSKDWSGLLVIVDPEKSEIA
FT                   KKIGVTIPDKYALKVR"
FT   gene            512292..512882
FT                   /locus_tag="Mmah_0492"
FT   CDS_pept        512292..512882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0492"
FT                   /product="Protein of unknown function DUF359"
FT                   /note="COGs: COG1909 conserved hypothetical protein;
FT                   InterPro IPR007164; PFAM: Protein of unknown function
FT                   DUF359; SPTR: Q12TT4 UPF0218 protein Mbur_2282; PFAM:
FT                   Protein of unknown function (DUF359)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36020"
FT                   /db_xref="InterPro:IPR007164"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA19"
FT                   /protein_id="ADE36020.1"
FT                   /translation="MGGRISIPASLRPLLRKKFGVLYKGSGEETVGKVSGDLGDPIKLI
FT                   SVGDVTTFHLLKSNIIPDILVIDDKTHRQPACEQMITGTKQSGFKELVVNNPAGSITEE
FT                   LVDAFAEALDSNRRVRIFVQGEEDLASLPAIMMAPAGSVVLYGQPGEGMMFVRITASKK
FT                   EEMTELIDKIIDKQHCKEQLYTMWRKLYGYQHN"
FT   gene            512863..513171
FT                   /locus_tag="Mmah_0493"
FT   CDS_pept        512863..513171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0493"
FT                   /product="SSU ribosomal protein S24E"
FT                   /note="COGs: COG2004 Ribosomal protein S24E; InterPro
FT                   IPR001976; KEGG: similar to ribosomal protein S24e; K02974
FT                   small subunit ribosomal protein S24e; PFAM: Ribosomal
FT                   protein S24e; SPTR: Q12TT3 30S ribosomal protein S24e;
FT                   PFAM: Ribosomal protein S24e"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36021"
FT                   /db_xref="GOA:D5EA20"
FT                   /db_xref="InterPro:IPR001976"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA20"
FT                   /protein_id="ADE36021.1"
FT                   /translation="MDISIIEEKNNTLLNRKELKFNVTFEGPTPARNDIKSKLAAMLNV
FT                   PVELIIVQGMRNMFGKQELSGNARIYEDASRMKRVEKEYNLKRNELPETEAEEASEE"
FT   gene            513181..513327
FT                   /locus_tag="Mmah_0494"
FT   CDS_pept        513181..513327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0494"
FT                   /product="SSU ribosomal protein S27AE"
FT                   /note="COGs: COG1998 Ribosomal protein S27AE; InterPro
FT                   IPR002906; KEGG: ubiquitin; PFAM: Ribosomal protein S27a;
FT                   SPTR: Q12TT2 30S ribosomal protein S27ae; PFAM: Ribosomal
FT                   protein S27a; Ribosomal protein L37e"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36022"
FT                   /db_xref="GOA:D5EA21"
FT                   /db_xref="InterPro:IPR002906"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR022845"
FT                   /db_xref="InterPro:IPR038582"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA21"
FT                   /protein_id="ADE36022.1"
FT                   /translation="MAVKEYYKVDGDNIERTRQFCPRCGEGVFLAEHKDRLTCGKCGYT
FT                   EFK"
FT   gene            complement(513334..513729)
FT                   /locus_tag="Mmah_0495"
FT   CDS_pept        complement(513334..513729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0495"
FT                   /product="response regulator receiver protein"
FT                   /note="COGs: COG0784 FOG: CheY-like receiver; InterPro
FT                   IPR001789; KEGG: gur:Gura_2117 putative PAS/PAC sensor
FT                   protein; PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; SPTR: Q12TT1 Response regulator
FT                   receiver; PFAM: Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36023"
FT                   /db_xref="GOA:D5EA22"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA22"
FT                   /protein_id="ADE36023.1"
FT                   /translation="MSGEKILVVEDENIVALGIKKMLKGMGFRVPSIAASGEEAIQKAE
FT                   ITFPDLVLMDIMLKGKIDGIKAAETIYDTMDIPVVYLTAYSDDKILERSKKTNPYGYLI
FT                   KPFEEKTLQNTIKVALDNYRKEKEKKE"
FT   gene            complement(513719..515986)
FT                   /locus_tag="Mmah_0496"
FT   CDS_pept        complement(513719..515986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0496"
FT                   /product="signal transduction histidine kinase"
FT                   /note="COGs: COG3920 Signal transduction histidine kinase;
FT                   InterProIPR013655:IPR011495:IPR003594:IPR003660:IPR
FT                   000700:IPR005467; KEGG: ppd:Ppro_3009 hypothetical protein;
FT                   PFAM: histidine kinase dimerisation/phosphoacceptor; PAS
FT                   fold-3 domain protein; ATP-binding region ATPase domain
FT                   protein; histidine kinase HAMP region domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; SPTR:
FT                   Q12XN1 Multisensor signal transduction histidine kinase;
FT                   PFAM: Histidine kinase; Cache domain; Histidine kinase-,
FT                   DNA gyrase B-, and HSP90-like ATPase; PAS fold"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36024"
FT                   /db_xref="GOA:D5EA23"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA23"
FT                   /protein_id="ADE36024.1"
FT                   /translation="MIEMTWKDVPLKSKLMFFILMGILVVLITSTAVIISTVTTQEEDL
FT                   AYQQSIQKAKNYANQFDIEMRSNQATGQAIAHSLSQYHSENRTEVNNILLKLLEENPDL
FT                   LGTYVCFEPNAFDGMDSRYVNTTGHDETGRFIPYWNRIPGNITLDPLLDYDTSVYYQLP
FT                   KEIKKDIVTEPYYYEGVFIVSYVTPVMRGGEFIGIGGVDVSLNHLNGVVNNVKAFDTGY
FT                   AIMTGNTGILISHPTNEELVGAKTLYDYGVPEITRMADEIKLGKSGYIETIDPITGKDV
FT                   VMFYEPIKTSKFAFILVVPKDEMLAGVTDLRNRLLLISSISLIFMGAIAILITRSVTGP
FT                   INEIVNDFKNISDAAIGGKLDERAETDVDIDFREIPEGLNDILNALENASQLREEMEKV
FT                   VNNSPVIVFKWKAEKNWPVEFVSKNISQFGYSPEDFGPNGLDYGDIIHPDDLPGVETKL
FT                   GEICSGKETQFNIEYRILTKDGETRWVDERTFIQRNQREIIHNMINKDNDIDSQVSDLK
FT                   GKCHDVKYLQGVIVNIDERKQAEEALLKIEDIRKKEIHHRIKNNLQVISTLLYLESEKF
FT                   KDDDVLDAFNNSRDRVRTMALVHEKLYQSKDMESIDFSDYSKNLINYLSQSYVLEKSEV
FT                   DIKINVENIFLGMDTAVPLGIIINELVSNSLKYAFDKGKGTIIVELRKINDHHKLVVSD
FT                   NGIGMKDEIDFEDTDSLGLLLVHTLAEQINATIEIDTSKGTKFEITFQEKNQELREGED
FT                   VR"
FT   sig_peptide     complement(515867..515986)
FT                   /locus_tag="Mmah_0496"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(515997..516776)
FT                   /locus_tag="Mmah_0497"
FT   CDS_pept        complement(515997..516776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0497"
FT                   /product="Domain of unknown function DUF1724"
FT                   /note="COGs: COG4742 transcriptional regulator protein;
FT                   InterPro IPR013561; PFAM: Domain of unknown function
FT                   DUF1724; SPTR: Q8PSW7 Conserved protein; PFAM: Domain of
FT                   unknown function (DUF1724)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36025"
FT                   /db_xref="InterPro:IPR013561"
FT                   /db_xref="InterPro:IPR016490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA24"
FT                   /protein_id="ADE36025.1"
FT                   /translation="MQSSLSDTIWLSEKRKRLLLLLMEGPRNIDQIKTSLNVTSKAMMP
FT                   QIKILKEQNLIIEEDRVYQLSDIGEIIVKNMVPLLKTLGVIEENNDYWATRDLSSIPEE
FT                   LDSRLGDIGECMVIEPDMNHLFDLPEEFSKNLIKSQKVMTIMAYFHPLYPDLYYELAND
FT                   GVQIDLILTEPIYKRMKEEYTDKFRHIVEREHTNLYICNEVNLTSVVTDRFIYLCLFNK
FT                   NDMYDHKKIMSFDASALQWGTELYEHFRQKSTLIEWD"
FT   gene            517092..517703
FT                   /locus_tag="Mmah_0498"
FT   CDS_pept        517092..517703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0498"
FT                   /product="dimethylamine corrinoid protein"
FT                   /note="COGs: COG5012 cobalamin binding protein; InterPro
FT                   IPR006158:IPR003759:IPR012741; KEGG: geo:Geob_2541
FT                   cobalamin B12-binding domain protein; PFAM: cobalamin
FT                   B12-binding domain protein; Methionine synthase B12-binding
FT                   module cap domain protein; SPTR: Q12W94 Dimethylamine
FT                   corrinoid protein; TIGRFAM: methyltransferase cognate
FT                   corrinoid protein; PFAM: B12 binding domain; TIGRFAM:
FT                   methyltransferase cognate corrinoid proteins,
FT                   Methanosarcina family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36026"
FT                   /db_xref="GOA:D5EA25"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR012741"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA25"
FT                   /protein_id="ADE36026.1"
FT                   /translation="MSDAIVSCKKDQVLAAVEKARGELEAPDIIENGLAAGMNEVGTLF
FT                   ERGKLFLPHVMMAAEAMQAGVDELKDDMPEASEKAVSVIVNGTVEGDVHDIGKSIVSTM
FT                   LQTSGFEVHDIGRDTPVADFIAKIKETDANMVGISALMTTTLQGQKEVIEALEEEGLRD
FT                   KVKVMVGGAPATNSWAKKIGADCYAENATEAVNKAKELLL"
FT   gene            517709..519118
FT                   /pseudo
FT                   /locus_tag="Mmah_0499"
FT   gene            519199..520716
FT                   /locus_tag="Mmah_0500"
FT   CDS_pept        519199..520716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0500"
FT                   /product="amino acid permease-associated region"
FT                   /note="COGs: COG0531 Amino acid transporter; InterPro
FT                   IPR004841; KEGG: mlo:mll7301 amino acid transporter; PFAM:
FT                   amino acid permease-associated region; SPTR: Q12TS7 Amino
FT                   acid transporter; PFAM: Amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36027"
FT                   /db_xref="GOA:D5EA26"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA26"
FT                   /protein_id="ADE36027.1"
FT                   /translation="MSEEKGDAGVDLHHAEQCSKVVCDASELERTIDWKQGLAIALGVP
FT                   LLILPSLGYFPMWVSSAAIIVWGLSVFQGFMQNLAYGELATAFPHASGLPGFAQNVFKT
FT                   KDYTGKFDKSKLIGGFSAWSYWFAWNPVLAIFAILVGGYLYNLFPILAETFTEYQLSLV
FT                   AGIVIFGGLILVNYRGLEGGALAGYILAAISLLPLIVITLAPFATGDVVMSNITSQWLP
FT                   ADWAWDAHHILILLGLFAMAQWSACAWETAAIYGPEYRKPGSDVPKALFACGAVCFFSF
FT                   VLVQAAVIGVLGVEGTIAQPISPMIPVAQAAFGSAGAIVAIVMLIAAMVLIIQTAYLGS
FT                   ARAMHSMATEGNLPKVFGKLNSSGTPIVAMVIIGLFNLLLISMGTPTAILAASAIGYTC
FT                   ANGISLFAYVKAKLNPEMAALDRPFKAPTGWKNIALLFGLFNIPLCLVGVVYLNSLEVG
FT                   WTSTWVGFIVLALYLPLWFYSRNEAYKEKETISAVSLVSSISSGKKK"
FT   gene            520922..521101
FT                   /locus_tag="Mmah_0501"
FT   CDS_pept        520922..521101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36028"
FT                   /db_xref="GOA:D5EA27"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA27"
FT                   /protein_id="ADE36028.1"
FT                   /translation="MPDIEDMIIGLLLTSFTVALGLYLVTSGSELYIPRMGEVMMGMVL
FT                   VFVATGYNNFLRNP"
FT   gene            521147..522373
FT                   /locus_tag="Mmah_0502"
FT   CDS_pept        521147..522373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0502"
FT                   /product="peptidase U32"
FT                   /note="COGs: COG0826 Collagenase and related protease;
FT                   InterPro IPR001539; KEGG: pca:Pcar_0411 U32 family
FT                   peptidase; PFAM: peptidase U32; SPTR: Q12WP8 Peptidase U32;
FT                   PFAM: Peptidase family U32"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36029"
FT                   /db_xref="GOA:D5EA28"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA28"
FT                   /protein_id="ADE36029.1"
FT                   /translation="MDSNYPMPELVVGVRDEGTLSACSQYADAVYFSVDRLSLRSRAKA
FT                   ITVDNLSGFVRSVREKGLKAYLVVNSVIYPEDTADLSTILNAARKAKVDAIVAWDPAVI
FT                   LQASSIGLDIHISTQANVSNAKTAEFYGYLGASRIILSRELSLDQIKQIRQHTAIELEV
FT                   FVHGAMCQAISGRCYLSAYLLGKSGNCGQCTQPCRWEWTLNADDGSQVQVGGKYLLSAR
FT                   DLCMIEHIPQLVEAGIDAFKIEGRLRDSRYISTVSRCYSEALEACRSGKFENNQVLEWK
FT                   QQLCAVYNRGFSTGFYFGKPSREGFIVEKDMNASQTLKELIGEVVNYYKNQGAAYVKLT
FT                   DSALSIGDTILIEGENTHLEQHVSSMQVEGNNIKSAEKGMDVGLAVNDRVRPNDKVFRI
FT                   KYPDTSGSE"
FT   gene            522375..522818
FT                   /locus_tag="Mmah_0503"
FT   CDS_pept        522375..522818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0503"
FT                   /product="CMP/dCMP deaminase zinc-binding protein"
FT                   /note="COGs: COG0590 Cytosine/adenosine deaminase; InterPro
FT                   IPR002125; KEGG: dps:DP2354 cytosine deaminase; PFAM:
FT                   CMP/dCMP deaminase zinc-binding; SPTR: Q12WP9 CMP/dCMP
FT                   deaminase, zinc-binding; PFAM: Cytidine and deoxycytidylate
FT                   deaminase zinc-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36030"
FT                   /db_xref="GOA:D5EA29"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA29"
FT                   /protein_id="ADE36030.1"
FT                   /translation="MDQFMKEAINEAMAGRDKGGIPIGSVLVRDGMIIGRGHNLRVQND
FT                   DPLAHAEISCMRDAGRIGSYADTVLYSTLMPCYLCAGAVVQFGIKKVVVGESETFEGAQ
FT                   DFLRSKGVEVVDLGLSECKTLMKEFIREYPELWNEDIGESGSY"
FT   gene            522908..524761
FT                   /locus_tag="Mmah_0504"
FT   CDS_pept        522908..524761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0504"
FT                   /product="DNA topoisomerase VI, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="COGs: COG1389 DNA topoisomerase VI subunit B;
FT                   InterPro IPR015320:IPR003594:IPR005734; KEGG:
FT                   afw:Anae109_2771 DNA topoisomerase VI subunit B; PFAM: DNA
FT                   topoisomerase VI subunit B transducer; ATP-binding region
FT                   ATPase domain protein; PRIAM: DNA topoisomerase
FT                   (ATP-hydrolyzing); SMART: ATP-binding region ATPase domain
FT                   protein; SPTR: Q12WQ0 Type 2 DNA topoisomerase 6 subunit B;
FT                   TIGRFAM: DNA topoisomerase VI, B subunit; PFAM:
FT                   Topoisomerase VI B subunit, transducer; Histidine kinase-,
FT                   DNA gyrase B-, and HSP90-like ATPase; TIGRFAM: DNA
FT                   topoisomerase VI, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36031"
FT                   /db_xref="GOA:D5EA30"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005734"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015320"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR040494"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA30"
FT                   /protein_id="ADE36031.1"
FT                   /translation="MPAPIAEELAKKQQSISVAEFFEKNRQILGFDSAPRSLITTIKEA
FT                   VDNSLDACEESGILPDIMLHIKRSGKSGVVVIIEDNGPGIVKDQIPRVFAKLLYGSRFH
FT                   ALKQSRGQQGIGISAAVLYSQLTAGHATRIISKIGPQSPAHYYELMINTRSNDPEILKD
FT                   EIAEWDRPHGTRVEMEMEATYVKGRRQSVEEYLKATAIVNPHARIKLIDPEGDERIFDR
FT                   ATDKIPEPASEILPHPHGIELGTLMKMLRYTARQRLAPFLRYSFSKIGLLTAEEICSAS
FT                   GLDVDMDPQTIEREDAKRLLDAFQKVKIMSPPTDCLSPIGEELIYKGLEKEFKVDFIAT
FT                   TTRTPSVYSGNPFVVEVGIAYGGNLQKDDRVNIMRFANRVPLLYQQGGCVTTHGVEGIK
FT                   WKQYGINQPGGGLPIGPLVLLIHVASTNVPFTSESKDAIADIPEIQDEVELALKEVGRK
FT                   LNRFLKKKGSLKKRKEKEVIINKVLPRMAEKLAETLDREVPDINPVVARVMGNLLVERQ
FT                   FDDGNANVSLMTKNFGSKKVEFKLHEMLPFQIEATPSPKVVSMGNDYDYIWKIVLRPGE
FT                   AFAVNYQLPDPSDLDSIKEPPIVEGVEEEIVTGARAIKGVV"
FT   gene            524761..525864
FT                   /locus_tag="Mmah_0505"
FT   CDS_pept        524761..525864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0505"
FT                   /product="DNA topoisomerase (ATP-hydrolyzing)"
FT                   /EC_number="5.99.1.3"
FT                   /note="COGs: COG1697 DNA topoisomerase VI subunit A;
FT                   InterPro IPR002815:IPR004085:IPR013049; KEGG:
FT                   afw:Anae109_2770 DNA topoisomerase VI subunit A; PFAM:
FT                   Spo11/DNA topoisomerase VI subunit A domain; PRIAM: DNA
FT                   topoisomerase (ATP-hydrolyzing); SPTR: Q12WQ1 DNA
FT                   topoisomerase, type IIB; PFAM: Type IIB DNA topoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36032"
FT                   /db_xref="GOA:D5EA31"
FT                   /db_xref="InterPro:IPR002815"
FT                   /db_xref="InterPro:IPR004085"
FT                   /db_xref="InterPro:IPR013049"
FT                   /db_xref="InterPro:IPR034136"
FT                   /db_xref="InterPro:IPR036078"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA31"
FT                   /protein_id="ADE36032.1"
FT                   /translation="MAKNEHRKEHDRLAEQRLTGLASELYSHFVDGRIPYVNMPSRTKN
FT                   NIEFNEISDVWVYGGRESERSAKTVKGAFQLLKTSHVLDFLLNNHIGNNRGSTLRELYY
FT                   ISENWDIAKFKEQPESDRLIEDLEIISSLQREYFHMRPEEDGATLFGPLQLREETKRGD
FT                   RDIHCQEDVGESGYQIPFNVENIDFIDHDAKFIIAIETGGMYARLIENGFDELNDAILV
FT                   HLKGQPARSTRRMIKRMNEELGIPVVVFTDGDPWSYRIYASVAYGAIKSAHLSEFMATP
FT                   AAKFVGVQPSDIVEYELSTDKLTDKDVDALRSELTDPRFETDYWKEQINLQLDIGKKAE
FT                   QQAFAGKGLDFVTKTYLPDRLSDMGII"
FT   gene            complement(525869..526117)
FT                   /locus_tag="Mmah_0506"
FT   CDS_pept        complement(525869..526117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36033"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA32"
FT                   /protein_id="ADE36033.1"
FT                   /translation="MSEEKTEQTKTEAQVSVKEWKIGEMGFSDRLATPDEGINYVPHKT
FT                   SGLQSAADMWIDRDRMLEGLHTKKSVDDLLQRTKFFE"
FT   gene            526219..527211
FT                   /locus_tag="Mmah_0507"
FT   CDS_pept        526219..527211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0507"
FT                   /product="metalloendopeptidase, glycoprotease family"
FT                   /EC_number="3.4.24.57"
FT                   /note="COGs: COG0533 Metal-dependent protease with possible
FT                   chaperone activity; InterPro IPR017861:IPR000905; KEGG:
FT                   similar to Osgep-prov protein; K01409 O-sialoglycoprotein
FT                   endopeptidase; PFAM: peptidase M22 glycoprotease; PRIAM:
FT                   O-sialoglycoprotein endopeptidase; SPTR: Q12WQ7 Putative
FT                   O-sialoglycoprotein endopeptidase; TIGRFAM:
FT                   metalloendopeptidase, glycoprotease family; PFAM:
FT                   Glycoprotease family; TIGRFAM: metalloendopeptidase,
FT                   putative, glycoprotease family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36034"
FT                   /db_xref="GOA:D5EA33"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022449"
FT                   /db_xref="InterPro:IPR034680"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA33"
FT                   /protein_id="ADE36034.1"
FT                   /translation="MTLVLGIEGTAWNLSAAVVNEDEVVCEVTHTYKPTTGGIHPREAA
FT                   QHHAQFASWVISNLFGELAEKNINPKDIDAISFSQGPGLGACLRTVATAARALSLSLEI
FT                   PLVGVNHCVAHVEIGRWKTPAKDPVVLYASGANTQVLAYRRGKYRVFGETLDIGVGNAL
FT                   DKFARSAGLSHPGGPQIEMYAKDSVNYVNLPYVVKGMDFSFSGLSTAATDALQKHTLED
FT                   VCYSLQENAFAMLVEVTERALAHTGKNEVLLGGGVGANMRLREMLDIMCDDRGASFYVP
FT                   EKRFMGDNGAMIAWLGLLMYKAGDTIRVDDSHVNPNYRPDMVDVTWLKE"
FT   gene            527217..527786
FT                   /locus_tag="Mmah_0508"
FT   CDS_pept        527217..527786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0508"
FT                   /product="Mn2+dependent serine/threonine protein kinase"
FT                   /note="COGs: COG3642 Mn2+-dependent serine/threonine
FT                   protein kinase; InterPro IPR018934:IPR000719; KEGG: similar
FT                   to TP53-regulating kinase (p53-related protein kinase)
FT                   (Nori-2); K08851 TP53 regulating kinase; PFAM: RIO-like
FT                   kinase; SPTR: Q12WQ8 O-sialoglycoprotein endopeptidase;
FT                   PFAM: RIO1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36035"
FT                   /db_xref="GOA:D5EA34"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR022495"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA34"
FT                   /protein_id="ADE36035.1"
FT                   /translation="MLRDGAEATVIRRNNRLVKSRIPKRYRVRELDERIRRERTRAEAR
FT                   LISEARRAGVATPVIYDIYNSIIEMDYIDGKPLKYVISETLCEKLGELVGRLHSAGIIH
FT                   GDLTTSNVIWDGSKMWLIDFGLAFSAEDLESRGVDIHVLFQTLESSHPNHEVLIDAFCK
FT                   GYYRTLESAKDVLERVIEIETRGRYA"
FT   gene            527854..528408
FT                   /locus_tag="Mmah_0509"
FT   CDS_pept        527854..528408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0509"
FT                   /product="dITPase"
FT                   /EC_number="3.6.1.-"
FT                   /EC_number="3.6.1.15"
FT                   /note="COGs: COG0127 Xanthosine triphosphate
FT                   pyrophosphatase; InterPro IPR002637; KEGG: DNA
FT                   repair-related protein; PFAM: Ham1 family protein; SPTR:
FT                   Q8PZ91 Nucleoside-triphosphatase; TIGRFAM: non-canonical
FT                   purine NTP pyrophosphatase, rdgB/HAM1 family; PFAM: Ham1
FT                   family; TIGRFAM: non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36036"
FT                   /db_xref="GOA:D5EA35"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA35"
FT                   /protein_id="ADE36036.1"
FT                   /translation="MRKIVFVTGNSGKFREIKAILEKRGIEVLQNTDGYPELQEDDLEP
FT                   IAADGARLSCEKLGLSVMVDDSGLFIDALNGFPGPYSAFVEDHLGNPKVLKLMEDEENR
FT                   RAYFKSVIGYCEPGKEPLTFTGIVEGNIGYEEKGKGGFGYDPIFLYGDRTFGEMGDEEK
FT                   NKVSHRKRAVDKFVEWIDSNL"
FT   gene            complement(528403..528792)
FT                   /locus_tag="Mmah_0510"
FT   CDS_pept        complement(528403..528792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0510"
FT                   /product="cyclase family protein"
FT                   /note="COGs: COG1878 metal-dependent hydrolase; KEGG:
FT                   geo:Geob_1077 cyclase family protein; SPTR: Q8TJR9 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36037"
FT                   /db_xref="GOA:D5EA36"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA36"
FT                   /protein_id="ADE36037.1"
FT                   /translation="MGRAYLIDFSGKTEIGYEDMEEAFPFKDKNRCEIILLKTESSDQR
FT                   FTRILPDTAEWIAKKGFMTVGIDSESVDSGEGLENHMMLLRKEINIIENLDLKNVDPGY
FT                   YGFVCLPLKIKGCDGAPARAILLRS"
FT   gene            complement(529017..529652)
FT                   /locus_tag="Mmah_0511"
FT   CDS_pept        complement(529017..529652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0511"
FT                   /product="PHP domain protein"
FT                   /note="COGs: COG1387 Histidinol phosphatase and related
FT                   hydrolase of the PHP family; InterPro IPR004013:IPR003141;
FT                   KEGG: dal:Dalk_2412 response regulator receiver protein;
FT                   PFAM: PHP domain protein; SMART: phosphoesterase PHP domain
FT                   protein; SPTR: Q12WR1 PHP-like protein; PFAM: PHP domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36038"
FT                   /db_xref="GOA:D5EA37"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA37"
FT                   /protein_id="ADE36038.1"
FT                   /translation="MIDLHTHTIFSDGELIPSEQVRRAKTLGYEAIGLTDHADFTNVEH
FT                   ILNCVTKAKYLEEPMEIKVLPGIEITHVPPEKIASLAKLARELGAEIVVVHGESPVEPV
FT                   LPGTNLAAAQCSDVDILAHPGFITEEEAKIATDNNVCLEITSRGGHNRTNGHVVKIAKL
FT                   SGATMVVDTDSHHPSDLITTSTALKVAMGAGLEKDEAKQVLENSRALI"
FT   gene            529786..530088
FT                   /locus_tag="Mmah_0512"
FT   CDS_pept        529786..530088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0512"
FT                   /product="protein of unknown function DUF211"
FT                   /note="COGs: COG1888 conserved hypothetical protein;
FT                   InterPro IPR003831; KEGG: dps:DP2436 hypothetical protein;
FT                   PFAM: protein of unknown function DUF211; SPTR: Q12WR2
FT                   Putative uncharacterized protein; PFAM: Uncharacterized
FT                   ArCR, COG1888"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36039"
FT                   /db_xref="InterPro:IPR003831"
FT                   /db_xref="InterPro:IPR023129"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA38"
FT                   /protein_id="ADE36039.1"
FT                   /translation="MMNNKSGIRRLVLDVLKPHNPSIVELAGVLGDVEGVDGVNLSLYE
FT                   MDQKTENVKITLEGMDLDYELIRQEIENMGAVVHSVDEIAAGKKIIEEVETHQDR"
FT   gene            complement(530092..530886)
FT                   /locus_tag="Mmah_0513"
FT   CDS_pept        complement(530092..530886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0513"
FT                   /product="23S rRNA Um-2552 2'-O-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="COGs: COG0293 23S rRNA methylase; InterPro
FT                   IPR002877:IPR002792; KEGG: mmw:Mmwyl1_1019 ribosomal RNA
FT                   methyltransferase RrmJ/FtsJ; PFAM: ribosomal RNA
FT                   methyltransferase RrmJ/FtsJ; deoxyribonuclease/rho
FT                   motif-related TRAM; SPTR: Q8TR92 Ribosomal RNA large
FT                   subunit methyltransferase J; PFAM: FtsJ-like
FT                   methyltransferase; TRAM domain; TIGRFAM: cell division
FT                   protein FtsJ"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36040"
FT                   /db_xref="GOA:D5EA39"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA39"
FT                   /protein_id="ADE36040.1"
FT                   /translation="MARHRRDTYYWRAKAEGYRSRAAYKLQQINKKFNVIREDSDVVDL
FT                   GAAPGGWLEVARELTKRKVVGVDILRIKPMDRITIIRGDITREETVSQIKEAVGEDGAD
FT                   AVICDAAPNLSGNWNLDHARSIALAESALECATRILKPQGNFVVKVFQGDMFKEYLDKV
FT                   RGEFTYVRAHSPEASRSESAEIYVVGKKFLTAPIRKGEEYDVVIERMGSGGDGTAFVEG
FT                   FVVFICDTEKGEKVRIKVRDVKPNFAFADVIQRLESPEEEEK"
FT   gene            complement(530921..531484)
FT                   /locus_tag="Mmah_0514"
FT   CDS_pept        complement(530921..531484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0514"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: Q12WR4 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36041"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA40"
FT                   /protein_id="ADE36041.1"
FT                   /translation="MIMISIEELSGIIDVLGAATVHEITCTAQEVTYARDYEPPIEKDI
FT                   LNMCEKACSRHFLEKVTCEEIIGMENTEVAVYFILGPDAFPEYPQELSDALDLLGYEKR
FT                   ELDMGKVATRFKRRLKMRTTHLENLINEVQTPAEPEYIQELEQKYMDLVNIYYDFDSWV
FT                   PDALTEIEENIFSLSAQIEELKEA"
FT   gene            531596..532804
FT                   /locus_tag="Mmah_0515"
FT   CDS_pept        531596..532804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0515"
FT                   /product="Phosphopantothenoylcysteine decarboxylase;
FT                   Phosphopantothenate-cysteine ligase"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /note="COGs: COG0452 Phosphopantothenoylcysteine
FT                   synthetase/decarboxylase; InterPro
FT                   IPR007085:IPR003382:IPR005252; KEGG: gbm:Gbem_1667
FT                   phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase; PFAM:
FT                   DNA/pantothenate metabolism flavoprotein domain protein;
FT                   flavoprotein; SPTR: Q466Q5 Phosphopantothenate-cysteine
FT                   ligase / Phosphopantothenoylcysteine decarboxylase;
FT                   TIGRFAM: phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate/cysteine ligase; PFAM:
FT                   DNA / pantothenate metabolism flavoprotein; Flavoprotein;
FT                   TIGRFAM: phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase,
FT                   prokaryotic"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36042"
FT                   /db_xref="GOA:D5EA41"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA41"
FT                   /protein_id="ADE36042.1"
FT                   /translation="MHSTLWIKGTKSKSLEGKTVVLAVTGSIAAVRVVELARELIRNGA
FT                   NVYAVMSEAATRILHPDALHYATGHEVITDITGGVEHVGMCGLQGMADLLLIAPATANT
FT                   ISKIAMGIDDTPVTTFATTAIGSGVATIVVPAMHQSMYDHPAVNSNLEKLGSYGISLVG
FT                   PRVEEGIAKIAPNDDIVLAVERELMGKKLAGKKIVLTSGATAEAIDPIRIITNRASGKT
FT                   GQELAREAFRRGGDVTIIHRNELDADGINEVYAESAASMLDSCMEEIGRGCDVFISSAA
FT                   ISDYTLDSLGSKIKSGQKLILEMHPTEKILPQVRSNYPAIVTVGFKAETGVGEKELVGS
FT                   ATRMLEEYGLDMVVANDVMAGGMGTSENSIYILQDESSASHYSGSKRYLASIIMDRVEQ
FT                   ILL"
FT   gene            532813..533688
FT                   /locus_tag="Mmah_0516"
FT   CDS_pept        532813..533688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0516"
FT                   /product="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /note="COGs: COG1829 kinase (sugar kinase superfamily);
FT                   InterPro IPR006204; PFAM: GHMP kinase; SPTR: Q8PUQ0
FT                   Conserved protein; PFAM: GHMP kinases N terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36043"
FT                   /db_xref="GOA:D5EA42"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR012043"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA42"
FT                   /protein_id="ADE36043.1"
FT                   /translation="MDPRQKCVTCFAPGHITGFFTIHDNDDPAFKGTTGCGIVLNRGVT
FT                   AKVCVGPDITGTEIFLNGSKKQASVTSHLVASLSCEPVRIESHADIPVGCGFGASGAGA
FT                   LAISYCLNDLFSLGLTQNEIVEAAHIAEVVGGGGLGDVEAQAYGGPVIRKRPAPITKGG
FT                   LLDRIVSPSFSVHCVVLGKLSTKTTLADSSVTGKINIAGKTAMKNLLQSPTIEEFMRQS
FT                   RSFSFELGLLSKGAEDIIEAVENVGGFASQAMLGDAVFAVAGPECTDTAIWEVMSEFGT
FT                   VFSSTVAGTD"
FT   gene            complement(533716..534567)
FT                   /locus_tag="Mmah_0517"
FT   CDS_pept        complement(533716..534567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0517"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="InterPro IPR000620; KEGG: afw:Anae109_2816
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF6 transmembrane; SPTR: Q12YH0 Putative uncharacterized
FT                   protein; PFAM: EamA-like transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36044"
FT                   /db_xref="GOA:D5EA43"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA43"
FT                   /protein_id="ADE36044.1"
FT                   /translation="MIPVELMAIFFGLASAVSWGAGDFTGGCASRRTNVYSVVLVTQIV
FT                   GVVLFPILAFVFSENLPPLSKLVWGCLAGFFGTSGLLALYQGLVEGKMGIVAPVAAVIS
FT                   AIVPVIYSAFYEGFPEILRIAGFIFAFIAVWFIVSMDNGPKVKINDLKYPLIAGMGFGL
FT                   FFISIDNFSETAIFWPLAFARGTALLMFLVFVILTGSVKVKPPSIDVLPVIVLAGLFNT
FT                   GGGTFFALASEAGRLDITTILSSLSPGATVLLAYFILKEKLAPRQWLGVASALFAIILM
FT                   SI"
FT   sig_peptide     complement(534508..534567)
FT                   /locus_tag="Mmah_0517"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            534768..535808
FT                   /locus_tag="Mmah_0518"
FT   CDS_pept        534768..535808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0518"
FT                   /product="methyltransferase MtaA/CmuA family"
FT                   /note="COGs: COG0407 Uroporphyrinogen-III decarboxylase;
FT                   InterPro IPR000257:IPR006360; KEGG: geo:Geob_2543
FT                   uroporphyrinogen decarboxylase (URO-D); PFAM:
FT                   Uroporphyrinogen decarboxylase (URO-D); SPTR: Q12X82
FT                   Methyltransferase MtaA/CmuA; TIGRFAM: methyltransferase
FT                   MtaA/CmuA family; PFAM: Uroporphyrinogen decarboxylase
FT                   (URO-D); TIGRFAM: methyltransferase, MtaA/CmuA family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36045"
FT                   /db_xref="GOA:D5EA44"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006360"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA44"
FT                   /protein_id="ADE36045.1"
FT                   /translation="MTGITLKQRFLDSLAGKDVDKVPVCSVTQTGTIELMEATGSHWPE
FT                   AHYDAEKMASLAIGGYEVAGLEAVRYPFDGTAIAQTLGCTIKEGTFDSQPSVLDNPCSN
FT                   KEDVGKFNLPDNFLESQRISTILDATEIVRERVGEDIPVVAGMLGPAAIAISLVGAKNY
FT                   LMWSLTEPETIRELLGMGVEICVEYSNALFERGADAICMPDSEAGPDLLPPEIFESLVL
FT                   PEYDKICSSTDGPMILHMCGDATAILEPMACSGFEGLSIEEKVDAKYAKRIIGDRACLI
FT                   GNVSPVDILLSTPAEEVKRQAKMCVEDGVDILAPGCGLAPYTSLENLKAFVEARDEYYK
FT                   GLNPEL"
FT   gene            535893..536636
FT                   /locus_tag="Mmah_0519"
FT   CDS_pept        535893..536636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0519"
FT                   /product="pantothenate synthetase"
FT                   /EC_number="6.3.2.1"
FT                   /note="COGs: COG1701 conserved hypothetical protein;
FT                   InterPro IPR002855; PFAM: Protein of unknown function
FT                   DUF137; SPTR: Q12WR9 Pantothenate synthetase; PFAM: Protein
FT                   of unknown function DUF137"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36046"
FT                   /db_xref="GOA:D5EA45"
FT                   /db_xref="InterPro:IPR002855"
FT                   /db_xref="InterPro:IPR038138"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA45"
FT                   /protein_id="ADE36046.1"
FT                   /translation="MTGIPRTHPRYHSLIARENIVEGVNKGITSMQGLVAQGRGECFDY
FT                   LLGERTLPSALLAEKIASALLLLADRPVISVNGNTSALVPEKMVELASVTGASLEVNLF
FT                   HRTEERVSRIISHLKSFGATCVLGARGNGRLDLEHARAIVDQEGIYSADVVLVPLEDGD
FT                   RCQKLVEMGKTVIAIDLNPFSRTSKTATLTVVDNVSRAMANLIHYSREFENCNHEELGE
FT                   IAGDFDNATFLSDAVEELMENLKNQ"
FT   gene            536633..537280
FT                   /locus_tag="Mmah_0520"
FT   CDS_pept        536633..537280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0520"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="COGs: COG1418 HD superfamily hydrolase; InterPro
FT                   IPR006674:IPR003607:IPR006675; KEGG: dal:Dalk_2318 metal
FT                   dependent phosphohydrolase; PFAM: metal-dependent
FT                   phosphohydrolase HD sub domain; SMART: metal-dependent
FT                   phosphohydrolase HD region; SPTR: Q12WS0 Metal-dependent
FT                   phosphohydrolase; TIGRFAM: metal dependent phophohydrolase;
FT                   PFAM: HD domain; TIGRFAM: uncharacterized domain HDIG"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36047"
FT                   /db_xref="GOA:D5EA46"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA46"
FT                   /protein_id="ADE36047.1"
FT                   /translation="MKVIVLDIIEITRDYVSDVLSYEPSSHDMGHVERVESLCVHIGEK
FT                   EGGNPDVLRLAGLLHDVGVVREYEEGGDHALYGAEIAGSFLADKEVDEKTIKHVVSCIR
FT                   THRFSRGMVPESLEGQILQDADRIDALGAVGIFRSLLSMGALRGLKHASGMVKESSMNA
FT                   YAQNPFEGFEEYMERKPFKIMASLNTCTSRDIATERLKIMEYFLEQLRKEVY"
FT   gene            537296..538630
FT                   /locus_tag="Mmah_0521"
FT   CDS_pept        537296..538630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0521"
FT                   /product="amidohydrolase"
FT                   /note="COGs: COG0402 Cytosine deaminase and related
FT                   metal-dependent hydrolase; InterPro IPR006680:IPR013108;
FT                   KEGG: sfu:Sfum_2961 amidohydrolase; PFAM: amidohydrolase;
FT                   Amidohydrolase 3; SPTR: Q8TRA4
FT                   5-methylthioadenosine/S-adenosylhomocysteine deaminase;
FT                   PFAM: Amidohydrolase family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36048"
FT                   /db_xref="GOA:D5EA47"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR023512"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA47"
FT                   /protein_id="ADE36048.1"
FT                   /translation="MADILIKNGYILTMDPDTGDLKKGEVAIENGRIIYVGLSYNGKAD
FT                   KIIDASGSVVMPGLVNTHNHAGMTLLRGYADDLPLAEWLEDYIWPVEEKLGPEEIYAGV
FT                   RLACLEMIKSGTTTFADMYIHEQAAARAVEDCGMRAALSYGMIDFGDPQRAESSLLKGR
FT                   NFVKDFNGAANGRISAMYGPHAPHTCSQQFLQDVRKQARKDDVKVHIHVLETEAELNQM
FT                   KEKYGKCSVNMLHDIGFFDSDVLAAHCIWLSEGDMNILAETGVHVSHDPVSNMKTAAGI
FT                   APVPQLLEKGVNVSLSTDGCASNNNLDMFGVMKTAALLHKVNSMDLTVIDARKVLEMAT
FT                   VYGAKALGIEAGMIKEGYYGDLIVVDMKRPHLTPLYDVDSHLVYSARGSDVTTVLVDGK
FT                   VLMENGKVLCMDEYEIMMEASKAAKKTDSQHLIDVLGLNDPSVDQ"
FT   gene            539120..540319
FT                   /locus_tag="Mmah_0522"
FT   CDS_pept        539120..540319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0522"
FT                   /product="methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /note="COGs: COG0192 S-adenosylmethionine synthetase;
FT                   InterPro IPR002133; KEGG: dal:Dalk_2506 methionine
FT                   adenosyltransferase; PFAM: S-adenosylmethionine synthetase;
FT                   PRIAM: Methionine adenosyltransferase; SPTR: Q8CXS7
FT                   S-adenosylmethionine synthetase; TIGRFAM:
FT                   S-adenosylmethionine synthetase; PFAM: S-adenosylmethionine
FT                   synthetase, C-terminal domain; S-adenosylmethionine
FT                   synthetase, central domain; S-adenosylmethionine
FT                   synthetase, N-terminal domain; TIGRFAM:
FT                   S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36049"
FT                   /db_xref="GOA:D5EA48"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA48"
FT                   /protein_id="ADE36049.1"
FT                   /translation="MSKLKYDHVFTSESVGAGHPDKICDQVSDAVLDACLEFDPNSRVA
FT                   CETLVAHDLVVNAGEITCKGMEKIDTEKIAREVVRDIGYDHKDLLFWDKSFEYISKIHE
FT                   QSPDISMGVTEGTGLYEEQGAGDQGMMFGYATNETDEYMPAPIAYSHRLLRYLDSIRQE
FT                   GRVSYLRPDAKSQVSVKYVNGKPDHITAVVVSQQTDDIPLETVRNEMVGFINEVLEPTG
FT                   MLRSDTEYYINPTGAFVLGGPYADAGVTGRKIIVDTYGGVGSHGGGAFSGKDPSKVDRS
FT                   AAYYARYVAKNIVAAGLADKCEIQVAYAIGVSKPLSINVDTYGTGVIEDQEIQDVLESG
FT                   EIFDFRPAALIEDLNLLHPKGWSYRQASSYGHFGRNIFPWEQLDKVDSLKGKFNLNVVK
FT                   "
FT   gene            540426..541832
FT                   /locus_tag="Mmah_0523"
FT   CDS_pept        540426..541832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0523"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="COGs: COG0499 S-adenosylhomocysteine hydrolase;
FT                   InterPro IPR015878:IPR000043:IPR020082; KEGG: dal:Dalk_2505
FT                   S-adenosyl-L-homocysteine hydrolase; PFAM:
FT                   S-adenosyl-L-homocysteine hydrolase;
FT                   S-adenosyl-L-homocysteine hydrolase, NAD binding; PRIAM:
FT                   Adenosylhomocysteinase; SPTR: B3QMF5
FT                   Adenosylhomocysteinase; TIGRFAM: adenosylhomocysteinase;
FT                   PFAM: S-adenosyl-L-homocysteine hydrolase, NAD binding
FT                   domain; S-adenosyl-L-homocysteine hydrolase; TIGRFAM:
FT                   adenosylhomocysteinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36050"
FT                   /db_xref="GOA:D5EA49"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA49"
FT                   /protein_id="ADE36050.1"
FT                   /translation="MVTNNDYKVKDIGLADSGRKQLNIAEQEMPGLMATREKYGPMKPL
FT                   KGARISGSLHMTVQTAVLIETLVELGADVRWASCNIFSTQDEAAAAIADTGVPVFAWKG
FT                   ETLDDYWWCTKQALTWPDGKGPNLIVDDGGDATLMMHRGYAAEDDPSILDEPTDNKELI
FT                   AQNEVLKKSLKEDPQFWHKAVADWKGVSEETTTGVHRLYHWERKGELLTPAINVNDSVT
FT                   KSKFDNVYGCRESLVDAIKRGTDVMIAGKVAVVCGYGDVGKGSAAALANHKARVIITET
FT                   DPICALQALMEGYDVMTVEDALPYGDIYVTTTGNCDVLTTEHMSNMKDQAIVCNIGHFD
FT                   NEIQVDALNKMDNVKKVNIKPQVDEYQFPDGHSIYVLAEGRLVNLGLATGHPSFVMSNS
FT                   FTNQTLAQIDLWESPKEVGVYRLSKVLDEEVARLHLEKLGAKLTKMSQEQAEYIGFPVE
FT                   GPYKPEHYRY"
FT   gene            541995..542786
FT                   /locus_tag="Mmah_0524"
FT   CDS_pept        541995..542786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0524"
FT                   /product="glycine/sarcosine N-methyltransferase"
FT                   /EC_number="2.1.1.156"
FT                   /note="InterPro IPR013216:IPR013217:IPR006162; KEGG:
FT                   hha:Hhal_1678 methyltransferase type 12; PFAM:
FT                   Methyltransferase type 12; Methyltransferase type 11; SPTR:
FT                   A0YIB3 Putative glycine-sarcosine methyltransferase; PFAM:
FT                   Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36051"
FT                   /db_xref="GOA:D5EA50"
FT                   /db_xref="InterPro:IPR014369"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA50"
FT                   /protein_id="ADE36051.1"
FT                   /translation="MNQYEKQDFGDNPIEVRESDHYEEEYVSGFVDKWDELIDWESRAK
FT                   SEGDTIINILKERGVKKVLDVATGTGFNSVRLLQAGFDVVSADGSAEMLVKAFDNARDH
FT                   GYLMRTVQADWRWMNKDIHDKFDAVICLGNSFTHLFDEGDRRKALAEFYTLLKHDGVLL
FT                   LDQRNYDAILDDGYSSKHAHYYCGDTVSVFPEHVDEGLARFRYEFSDGSVYNLNMFPLR
FT                   KDYTRKLLYEVGFQEITTLGDFKETYKEDDPDFFLHVAEKS"
FT   gene            542811..543647
FT                   /locus_tag="Mmah_0525"
FT   CDS_pept        542811..543647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0525"
FT                   /product="sarcosine/dimethylglycine N-methyltransferase"
FT                   /EC_number="2.1.1.157"
FT                   /note="COGs: COG2226 Methylase involved in
FT                   ubiquinone/menaquinone biosynthesis; InterPro
FT                   IPR013216:IPR003333:IPR013217; KEGG: hha:Hhal_1677
FT                   methyltransferase type 11; PFAM: Methyltransferase type 11;
FT                   Cyclopropane-fatty-acyl-phospholipid synthase;
FT                   Methyltransferase type 12; SPTR: A0YIB3 Putative
FT                   glycine-sarcosine methyltransferase; PFAM:
FT                   Methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36052"
FT                   /db_xref="GOA:D5EA51"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA51"
FT                   /protein_id="ADE36052.1"
FT                   /translation="MSENQKTAVDKAQEYYNSDDADNFYFTIWGGEDIHVGLYDSEDEP
FT                   IFDASRRTVERMASKISNLDKDSKVLDIGAGYGGAARYLARKYGCQVVALNLSEVENER
FT                   DRVMNKEQGLDHLVTVEDGSFEDLPYPDYSFDVVWSQDAILHSGNREQVLKEVARVLKS
FT                   GGDFVFTDPMQTDDCPEGVLQPILDRIHLESLGSPGFYRESAKKYGLNEIEFEEHASQL
FT                   PIHYGRVLKETENQEDNLSGVVSQDYINNMKQGLKHWIDGGNGGYLTWGIFHLRKK"
FT   gene            543728..544663
FT                   /locus_tag="Mmah_0526"
FT   CDS_pept        543728..544663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0526"
FT                   /product="Adenosine kinase"
FT                   /EC_number="2.7.1.20"
FT                   /note="COGs: COG0524 Sugar kinase ribokinase family;
FT                   InterPro IPR011611:IPR002173; KEGG: noc:Noc_2548
FT                   carbohydrate kinase, PfkB; PFAM: PfkB domain protein;
FT                   PRIAM: Adenosine kinase; SPTR: A2WCU5 Sugar kinase; PFAM:
FT                   pfkB family carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36053"
FT                   /db_xref="GOA:D5EA52"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA52"
FT                   /protein_id="ADE36053.1"
FT                   /translation="MDKALICGSFAFDNIMVFNDQFKNHILPDKVHILNVSFLVPELRR
FT                   EFGGCAGNIAYNLKLLGGDPLPMGTVGTDFEHYAKWMDEKGINREYVNVVNDTFTAQAF
FT                   ITTDMDDNQITAFHPGAMDYSHNYSVLDVNDPVVGIVAPDGREGMLQHASEFAEAKIPF
FT                   IFDPGQGLPMFNGDELMEFIKQATWLTVNDYEWQLIKERTGKSQEEIATYLDALIITKG
FT                   PEGSLIYSNDEIIQIPAAKPNVLKDPTGCGDAYRAGLLYGLINDMDWDTTGRIASLMGA
FT                   IKIEYQGTQNHHFKLADFKRRFKESFGTVF"
FT   gene            545037..546272
FT                   /locus_tag="Mmah_0527"
FT   CDS_pept        545037..546272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0527"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="COGs: COG0499 S-adenosylhomocysteine hydrolase;
FT                   InterProIPR013116:IPR015878:IPR000043:IPR020082:IPR
FT                   016059:IPR019825; KEGG: sfu:Sfum_0366
FT                   S-adenosyl-L-homocysteine hydrolase; PFAM:
FT                   S-adenosyl-L-homocysteine hydrolase, NAD binding;
FT                   Acetohydroxy acid isomeroreductase catalytic domain
FT                   protein; S-adenosyl-L-homocysteine hydrolase; PRIAM:
FT                   Adenosylhomocysteinase; SPTR: Q12WS2
FT                   Adenosylhomocysteinase; TIGRFAM: adenosylhomocysteinase;
FT                   PFAM: S-adenosyl-L-homocysteine hydrolase, NAD binding
FT                   domain; S-adenosyl-L-homocysteine hydrolase; TIGRFAM:
FT                   adenosylhomocysteinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36054"
FT                   /db_xref="GOA:D5EA53"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA53"
FT                   /protein_id="ADE36054.1"
FT                   /translation="MIDEDLIESGEQKIEWARNHMPVLSIIRKEFEEEKPLKGHRIAMA
FT                   LHVEAKTAVLVETLAAGGAEVAITGCNPLSTQNDVAVALDMKDNIDCFAKYGCSSKEYY
FT                   DSIDRVLDIDPDITIDDGADLIFKLHTERTELLDSILGGCEETTTGIHRLRAMEDEGAL
FT                   KMPVIAVNDAMTKFLFDNRYGTGQSSWDGIIRTTNLLVAGKTVIIGGYGWCGRGAAMRA
FT                   SGLGANVIVTEVDPIRALEAKMDGFRVMPMQKAALYGDIFVMTTGNTDVLTRDHFEVMK
FT                   DGAILANSGHFNVEINLEDLVALSSSVRDVRKNIKEYKVGGKHIHVLADGRLVNLAAGD
FT                   GHPAEVMDMSFANQAQCARYIAENKLEVGVHAVPQDLDVRVARLKLESLGVEIDSYSPK
FT                   QAEYMCGWKCGT"
FT   gene            546491..546567
FT                   /locus_tag="Mmah_R0011"
FT   tRNA            546491..546567
FT                   /locus_tag="Mmah_R0011"
FT                   /product="tRNA-Lys"
FT   gene            546616..546852
FT                   /locus_tag="Mmah_0528"
FT   CDS_pept        546616..546852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0528"
FT                   /product="DNA-directed RNA polymerase, subunit H"
FT                   /EC_number="2.7.7.6"
FT                   /note="COGs: COG2012 DNA-directed RNA polymerase subunit H
FT                   RpoH/RPB5; InterPro IPR000783; KEGG: RNA polymerase Rpb5,
FT                   N-terminal domain containing protein; K03013 DNA-directed
FT                   RNA polymerase II subunit E; PFAM: RNA polymerase Rpb5;
FT                   SPTR: Q12WS3 DNA-directed RNA polymerase subunit H; PFAM:
FT                   RNA polymerase Rpb5, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36055"
FT                   /db_xref="GOA:D5EA54"
FT                   /db_xref="InterPro:IPR000783"
FT                   /db_xref="InterPro:IPR020609"
FT                   /db_xref="InterPro:IPR035913"
FT                   /db_xref="InterPro:IPR039531"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA54"
FT                   /protein_id="ADE36055.1"
FT                   /translation="MSKFSLLDHEFIPRHEIIDEDEIKSVLKKYNIGREQLPKIKIEDP
FT                   VIKEIGAEVGDIVKITRKSQTAGEALYYRYVIE"
FT   gene            546980..548617
FT                   /locus_tag="Mmah_0529"
FT   CDS_pept        546980..548617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0529"
FT                   /product="DNA-directed RNA polymerase, subunit B'"
FT                   /EC_number="2.7.7.6"
FT                   /note="COGs: COG0085 DNA-directed RNA polymerase beta
FT                   subunit/140 kD subunit; InterPro
FT                   IPR007642:IPR007645:IPR007644; KEGG: NRPB2; NRPB2 (EMBRYO
FT                   DEFECTIVE 1989); DNA binding; K03010 DNA-directed RNA
FT                   polymerase II subunit B; PFAM: RNA polymerase beta subunit;
FT                   RNA polymerase Rpb2 domain 3; RNA polymerase Rpb2 domain 2;
FT                   SPTR: Q12WS4 DNA-directed RNA polymerase, subunit B'; PFAM:
FT                   RNA polymerase Rpb2, domain 3; RNA polymerase Rpb2, domain
FT                   2; RNA polymerase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36056"
FT                   /db_xref="GOA:D5EA55"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA55"
FT                   /protein_id="ADE36056.1"
FT                   /translation="MDTSFLSEAYFTRDKIVQHHIDSYNKFLSSGLQKVIDEQHLIETD
FT                   IEDIYVKLGRIRVEKPVVKEADGAIENLYPNEARLRNLSYSAPLFLEMSVVKGGEESEP
FT                   REAKIGQLPVMIKSEICNLVGIDDEDMIEHGEDPLDPGGYFIVNGTERVVMTLEDLAPN
FT                   KILAEIGERYGDRIEVSKVFSQRRGYRALVVVERGRKALLEVSFPSISGRINFITLLRA
FT                   LGIETDEDVVKTVSTDPEIMKFMFENLEESEVDTVEEAVEKIGMRVASGQASEYQVKRA
FT                   NYVIDRYLLPHLGNEPEDRVAKAHFLGRMAESCFELALGRRSADDKDHYSNKRLKLTGD
FT                   LLEDLFRVAFNRLTRDVKYQLERANMRNRELNVSTLVRADVLTDRLQHPLATGNWVGGR
FT                   SGVSQLLDRTDYISTLSHLRRVISPLSRAQPHFEARDLHSTQWGRLCPSETPEGPNCGL
FT                   VKNFAQMVELSTGANDFDKVKNVLYGLGVAPAQLHVPEKILKYSNELGTDTEEHEMPVD
FT                   DLIKSPGYQDITDDSDKKPLGNGGILGD"
FT   gene            548610..550424
FT                   /locus_tag="Mmah_0530"
FT   CDS_pept        548610..550424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0530"
FT                   /product="DNA-directed RNA polymerase, subunit B'"
FT                   /EC_number="2.7.7.6"
FT                   /note="COGs: COG0085 DNA-directed RNA polymerase beta
FT                   subunit/140 kD subunit;
FT                   InterProIPR007647:IPR007641:IPR007646:IPR007120:IPR
FT                   007121:IPR019969; KEGG: rpb2; RNA polymerase II core
FT                   subunit; K03010 DNA-directed RNA polymerase II subunit B;
FT                   PFAM: RNA polymerase Rpb2 domain 6; RNA polymerase Rpb2
FT                   domain 7; RNA polymerase Rpb2, domain 5 protein; RNA
FT                   polymerase Rpb2, domain 4 protein; SPTR: Q12WS5
FT                   DNA-directed RNA polymerase; TIGRFAM: DNA-directed RNA
FT                   polymerase subunit B; PFAM: RNA polymerase Rpb2, domain 5;
FT                   RNA polymerase Rpb2, domain 6; RNA polymerase Rpb2, domain
FT                   4; RNA polymerase Rpb2, domain 7; TIGRFAM: DNA-directed RNA
FT                   polymerase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36057"
FT                   /db_xref="GOA:D5EA56"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007646"
FT                   /db_xref="InterPro:IPR007647"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019969"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA56"
FT                   /protein_id="ADE36057.1"
FT                   /translation="MTDAKVFLNGELIGTHPDPVNLVEDIRKQRRAGMLSRQVNVALYE
FT                   DIHEVIINSDIGRARRALVVVENGLPLVTEDHIDKLKSGDLTSEDLIRQGRIEYLDAEE
FT                   EENSYVALYEEDITPKHTHLEIDPSLILGICAGMVPYPEHNASPRITMGAAMLKQCIGV
FT                   STSNLKLRPDTRAHVLHYPQKALTRTQTCDSIHFDERPAGQNFVVAVMSYEGYNIEDAL
FT                   VFNKGSIERGLGRSHFVRTFEGEERRYPGGQEDKFEIPDSEYRGARSAEAYANLDVDGL
FT                   VNPETTVGPNSVLIGKTSPPRFLEEQTDFGITVEQRRESAITMRSNEKGVVDTVLLTES
FT                   INGTRLTKVKVRDQRIPEIGDKFASRHGQKGVIGLIVPYQDMPFTESGMVPDLVLNPHA
FT                   IPSRMTVGHVLEMIGGKVGSIEGRRIKATAFSGENEDDLRAGLQNHGFSHTGKEVFYDG
FT                   VTGKKVQADIFVGVILYQKLHHMVASKMHARSRGPVQVLTRQPTEGRAREGGLRFGEME
FT                   RDVMIGHGAAMTLKERLLDESDKVEELVCGNCGMIATFDRRRNVRYCSNCGSETDIHRV
FT                   EMSYAFKLLLDEIKSLGVAPRLRLDDAV"
FT   gene            550421..553081
FT                   /locus_tag="Mmah_0531"
FT   CDS_pept        550421..553081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0531"
FT                   /product="DNA-directed RNA polymerase, subunit A'"
FT                   /EC_number="2.7.7.6"
FT                   /note="COGs: COG0086 DNA-directed RNA polymerase beta'
FT                   subunit/160 kD subunit;
FT                   InterProIPR007066:IPR000722:IPR007083:IPR007080:IPR
FT                   006592:IPR012758; KEGG: rpb1; RNA polymerase II core
FT                   subunit; K03006 DNA-directed RNA polymerase II subunit A;
FT                   PFAM: RNA polymerase Rpb1 domain 1; RNA polymerase alpha
FT                   subunit; RNA polymerase Rpb1 domain 3; RNA polymerase Rpb1
FT                   domain 4; SMART: RNA polymerase I subunit A domain protein;
FT                   SPTR: Q12WS6 DNA-directed RNA polymerase; TIGRFAM:
FT                   DNA-directed RNA polymerase subunit A'; PFAM: RNA
FT                   polymerase Rpb1, domain 2; RNA polymerase Rpb1, domain 4;
FT                   RNA polymerase Rpb1, domain 1; RNA polymerase Rpb1, domain
FT                   3; RNA polymerase Rpb1, domain 5; TIGRFAM: DNA-directed RNA
FT                   polymerase subunit A'"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36058"
FT                   /db_xref="GOA:D5EA57"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012758"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA57"
FT                   /protein_id="ADE36058.1"
FT                   /translation="MMVISMDNTIPSIPQRIGAIRFGLLSPREIRKMSVTSIITADTYD
FT                   DDGYPIDMGLMDLRLGVIDPGLKCKTCGGRAGECPGHFGHIELVAPVLHVGFNKIIRKI
FT                   LRSTCRNCSHLLLEDKQKKAYINQFAKLDVMSHLPDDLINNVFKEARKTKICPYCGEEQ
FT                   LEIKFEKPSDYIENDYKLTPTEIRDRLERIPDDDLKVMGMDPESARPEWMVLTVLAVPP
FT                   VTVRPSITLESGQRSEDDLTHKLVDIIRINQRFQENRDAGAPQLIIEDLWELLQYHLTT
FT                   FFDNEVSGVPPARHRSGRPLKTLTQRLKGKEGRFRGSLSGKRVNFSARTVVSPDPNLSI
FT                   NEVGVPYQIAKHMTIPVRVISRNLEMMRAYVARGGETHPGANYVFREDGRRLKITEANK
FT                   EELSEKLEPGWTVERQMQDGDIVLFNRQPSLHKMSIMAHKVKVLPNKTFKLNPAVCPPY
FT                   NADFDGDEMNMHVLQTEESRAEANILMQVQENILSPRFGGPIIGGIHDHISGMFLLTRN
FT                   ENMISKNDALELLRKSEVRELPEPAGYTDVGDPFWTGKQIFSQILPKDLNLEFKANVCF
FT                   KCDVCKGRDCEYDAYVVVENGELVTGTIDEKAIGAFKGKILDSIVKRYGTTEAAQFVDD
FT                   MTRLAIRGVMRTGLSFGISDEDIPREAKLNIDEELERAENEVAELIQAYEAKELEPLPG
FT                   RTLAETIELKIMQSLGKARDHTGTIAGNHLGLENSAVIMAKSGARGSMLNLTQMAACVG
FT                   QQAVRGERIRRGYEGRTLPHFDRGDLGADAHGFVKSSYKSGLNPTEYFFHSVGGREGLV
FT                   DTAVRTSQSGYLQRRLVNALQDLEVQYDRSVRETRGVIVQFKYGEDGIDSTKSDYSSEE
FT                   TVHNIVRSVTGKEVK"
FT   gene            553082..554239
FT                   /locus_tag="Mmah_0532"
FT   CDS_pept        553082..554239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0532"
FT                   /product="DNA-directed RNA polymerase, subunit A'"
FT                   /EC_number="2.7.7.6"
FT                   /note="COGs: COG0086 DNA-directed RNA polymerase beta'
FT                   subunit/160 kD subunit; InterPro IPR007081:IPR012757; KEGG:
FT                   GI21717 gene product from transcript GI21717-RA; PFAM: RNA
FT                   polymerase Rpb1 domain 5; SPTR: Q12WS7 DNA-directed RNA
FT                   polymerase, subunit A'; TIGRFAM: DNA-directed RNA
FT                   polymerase, subunit A''; PFAM: RNA polymerase Rpb1, domain
FT                   5; TIGRFAM: DNA-directed RNA polymerase, subunit A''"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36059"
FT                   /db_xref="GOA:D5EA58"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR012757"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA58"
FT                   /protein_id="ADE36059.1"
FT                   /translation="MVLQEATIEGMVKDLPLPSDVKLTLISDSVKAGVNKKQMGEIIEK
FT                   LLETYDKSCVEPCEAVGVISAQSIGEPGTQMTMRTFHYAGVAEINVTLGLPRLIEIVDA
FT                   RKRPSTPMMTVHLDKEYLEDRDFANKIAWMIEATHVEHLADVTTDLPNMQLVIDLNEKA
FT                   MNKREVGIESVMEKLEHGLGVSVVQAKEVSNQLLIKLKEPSYRELLQLAKKINTITLKG
FT                   IDGIKRVVVRKEDGEYRLYTEGSELKKVLEIDGVDPTRTSTNNIGEIYEVFGIEAARNA
FT                   IIKEATDTLREQGLEVDVRHIMLVADIMSCDGEVKQIGRHGISGEKASVFARAAFEVTV
FT                   NHLLDAGLRGEVDELSGVTENIIVGQPIKLGTGDVHLVSRNPLQG"
FT   gene            554314..554601
FT                   /locus_tag="Mmah_0533"
FT   CDS_pept        554314..554601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0533"
FT                   /product="LSU ribosomal protein L30E"
FT                   /note="COGs: COG1911 Ribosomal protein L30E; InterPro
FT                   IPR004038:IPR000231; KEGG: 60S ribosomal protein L30-2;
FT                   K02908 large subunit ribosomal protein L30e; PFAM:
FT                   ribosomal protein L7Ae/L30e/S12e/Gadd45; SPTR: Q12WS8 LSU
FT                   ribosomal protein L30E; PFAM: Ribosomal protein
FT                   L7Ae/L30e/S12e/Gadd45 family"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36060"
FT                   /db_xref="GOA:D5EA59"
FT                   /db_xref="InterPro:IPR000231"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR022991"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR039109"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA59"
FT                   /protein_id="ADE36060.1"
FT                   /translation="MDINVDKALLKVIRTGDVVIGANRTIDVATNGDAKMVVVSANCPA
FT                   YIREKIEETDLPVIKYAGSSMDLGTVCGKPYTITTMAIVDAGESDIIGLV"
FT   gene            554621..555046
FT                   /locus_tag="Mmah_0534"
FT   CDS_pept        554621..555046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0534"
FT                   /product="NusA family KH domain protein"
FT                   /note="COGs: COG0195 Transcription elongation factor;
FT                   InterPro IPR004044:IPR010212; KEGG: nam:NAMH_0269
FT                   transcription termination factor NusA; PFAM: KH type 2
FT                   domain protein; SPTR: Q12WS9 NusA anti-termination factor;
FT                   TIGRFAM: NusA family KH domain protein; PFAM: KH domain;
FT                   TIGRFAM: NusA family KH domain protein, archaeal"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36061"
FT                   /db_xref="GOA:D5EA60"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010212"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA60"
FT                   /protein_id="ADE36061.1"
FT                   /translation="MSDIKLSTDAIRYIALFESMTGAPIKDCLIDDDRIICVVNNGDMG
FT                   AAIGKHGDNINRFKKAVDKHVDLIEYSDDPITFIKNAFGTIPTKSVEISDKNGKKVAYV
FT                   EVSSMNKGLAIGKSGRNIDKIKRIVNRHHDIEDLILQ"
FT   gene            555089..555517
FT                   /locus_tag="Mmah_0535"
FT   CDS_pept        555089..555517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0535"
FT                   /product="SSU ribosomal protein S12P"
FT                   /note="COGs: COG0048 Ribosomal protein S12; InterPro
FT                   IPR006032:IPR005680; KEGG: 40S ribosomal protein S23;
FT                   K02973 small subunit ribosomal protein S23e; PFAM:
FT                   ribosomal protein S12/S23; SPTR: Q12WT0 30S ribosomal
FT                   protein S12P; TIGRFAM: ribosomal protein S23 (S12); PFAM:
FT                   Ribosomal protein S12; TIGRFAM: ribosomal protein S23
FT                   (S12)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36062"
FT                   /db_xref="GOA:D5EA61"
FT                   /db_xref="InterPro:IPR005680"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022863"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA61"
FT                   /protein_id="ADE36062.1"
FT                   /translation="MTNGKYAAHKLKAARKNARWKDTRYSRRTLGLNVKSDPLSGAPQG
FT                   RGIVLEKVGVEAKQPNSAIRKCVRIQLIKNGRQATAFCPGDGAINFIDEHDEITVERIG
FT                   GRMGGAKGDIPGVRFKVTAVNNVSLNEMVIGKKEKPRR"
FT   gene            555523..556083
FT                   /locus_tag="Mmah_0536"
FT   CDS_pept        555523..556083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mmah_0536"
FT                   /product="SSU ribosomal protein S7P"
FT                   /note="COGs: COG0049 Ribosomal protein S7; InterPro
FT                   IPR000235:IPR005716; KEGG: hypothetical protein; K02989
FT                   small subunit ribosomal protein S5e; PFAM: ribosomal
FT                   protein S7; SPTR: O93631 30S ribosomal protein S7P;
FT                   TIGRFAM: ribosomal protein S7; PFAM: Ribosomal protein
FT                   S7p/S5e; TIGRFAM: ribosomal protein
FT                   S7(archaeal)/S5(eukaryotic)"
FT                   /db_xref="EnsemblGenomes-Gn:Mmah_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADE36063"
FT                   /db_xref="GOA:D5EA62"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005716"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR026018"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:D5EA62"
FT                   /protein_id="ADE36063.1"
FT                   /translation="MNKLFGKWDMTEVEVVDAGLRRYVNVDPIAIPNTGGRHARQQFNK
FT                   SDLSIVERLITSLMRGEENTGKKQCTMTAVKEAFDIIHSKTDKNPVQVLVEAISHTGPR
FT                   EEVVRLKYGGISVPKAVDTAPQRRVDSALRYIAMGTKQTSFKSKRSFASCLATELIAAS
FT