(data stored in ACNUC7421 zone)

EMBL: CP001997

ID   CP001997; SV 1; circular; genomic DNA; STD; PRO; 1980592 BP.
XX
AC   CP001997;
XX
PR   Project:PRJNA32587;
XX
DT   07-APR-2010 (Rel. 104, Created)
DT   18-JAN-2015 (Rel. 123, Last updated, Version 6)
XX
DE   Aminobacterium colombiense DSM 12261, complete genome.
XX
KW   .
XX
OS   Aminobacterium colombiense DSM 12261
OC   Bacteria; Synergistetes; Synergistia; Synergistales; Synergistaceae;
OC   Aminobacterium.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-1980592
RX   PUBMED; 21304712.
RA   Chertkov O., Sikorski J., Brambilla E., Lapidus A., Copeland A.,
RA   Glavina Del Rio T., Nolan M., Lucas S., Tice H., Cheng J.F., Han C.,
RA   Detter J.C., Bruce D., Tapia R., Goodwin L., Pitluck S., Liolios K.,
RA   Ivanova N., Mavromatis K., Ovchinnikova G., Pati A., Chen A.,
RA   Palaniappan K., Land M., Hauser L., Chang Y.J., Jeffries C.D., Spring S.,
RA   Rohde M., Goker M., Bristow J., Eisen J.A., Markowitz V., Hugenholtz P.,
RA   Kyrpides N.C., Klenk H.P.;
RT   "Complete genome sequence of Aminobacterium colombiense type strain
RT   (ALA-1)";
RL   Stand Genomic Sci 2(3):280-289(2010).
XX
RN   [2]
RP   1-1980592
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Ovchinnikova G., Chertkov O., Brettin T., Detter J.C., Han C., Tapia R.,
RA   Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T.,
RA   Wu D., Spring S., Schroeder M., Brambilla E., Klenk H.-P., Eisen J.A.;
RT   "The complete genome of Aminobacterium colombiense DSM 12261";
RL   Unpublished.
XX
RN   [3]
RP   1-1980592
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Ovchinnikova G., Chertkov O., Brettin T., Detter J.C., Han C., Tapia R.,
RA   Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T.,
RA   Wu D., Spring S., Schroeder M., Brambilla E., Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (29-MAR-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 066407ffadc92e3faad6508ec47e1cd7.
DR   BioSample; SAMN02598488.
DR   CABRI; DSM 12261.
DR   EnsemblGenomes-Gn; Amico_R0001.
DR   EnsemblGenomes-Gn; Amico_R0002.
DR   EnsemblGenomes-Gn; Amico_R0003.
DR   EnsemblGenomes-Gn; Amico_R0004.
DR   EnsemblGenomes-Gn; Amico_R0005.
DR   EnsemblGenomes-Gn; Amico_R0006.
DR   EnsemblGenomes-Gn; Amico_R0007.
DR   EnsemblGenomes-Gn; Amico_R0008.
DR   EnsemblGenomes-Gn; Amico_R0009.
DR   EnsemblGenomes-Gn; Amico_R0010.
DR   EnsemblGenomes-Gn; Amico_R0011.
DR   EnsemblGenomes-Gn; Amico_R0012.
DR   EnsemblGenomes-Gn; Amico_R0013.
DR   EnsemblGenomes-Gn; Amico_R0014.
DR   EnsemblGenomes-Gn; Amico_R0015.
DR   EnsemblGenomes-Gn; Amico_R0016.
DR   EnsemblGenomes-Gn; Amico_R0017.
DR   EnsemblGenomes-Gn; Amico_R0018.
DR   EnsemblGenomes-Gn; Amico_R0019.
DR   EnsemblGenomes-Gn; Amico_R0020.
DR   EnsemblGenomes-Gn; Amico_R0021.
DR   EnsemblGenomes-Gn; Amico_R0022.
DR   EnsemblGenomes-Gn; Amico_R0023.
DR   EnsemblGenomes-Gn; Amico_R0024.
DR   EnsemblGenomes-Gn; Amico_R0025.
DR   EnsemblGenomes-Gn; Amico_R0026.
DR   EnsemblGenomes-Gn; Amico_R0027.
DR   EnsemblGenomes-Gn; Amico_R0028.
DR   EnsemblGenomes-Gn; Amico_R0029.
DR   EnsemblGenomes-Gn; Amico_R0030.
DR   EnsemblGenomes-Gn; Amico_R0031.
DR   EnsemblGenomes-Gn; Amico_R0032.
DR   EnsemblGenomes-Gn; Amico_R0033.
DR   EnsemblGenomes-Gn; Amico_R0034.
DR   EnsemblGenomes-Gn; Amico_R0035.
DR   EnsemblGenomes-Gn; Amico_R0036.
DR   EnsemblGenomes-Gn; Amico_R0037.
DR   EnsemblGenomes-Gn; Amico_R0038.
DR   EnsemblGenomes-Gn; Amico_R0039.
DR   EnsemblGenomes-Gn; Amico_R0040.
DR   EnsemblGenomes-Gn; Amico_R0041.
DR   EnsemblGenomes-Gn; Amico_R0042.
DR   EnsemblGenomes-Gn; Amico_R0043.
DR   EnsemblGenomes-Gn; Amico_R0044.
DR   EnsemblGenomes-Gn; Amico_R0045.
DR   EnsemblGenomes-Gn; Amico_R0046.
DR   EnsemblGenomes-Gn; Amico_R0047.
DR   EnsemblGenomes-Gn; Amico_R0048.
DR   EnsemblGenomes-Gn; Amico_R0049.
DR   EnsemblGenomes-Gn; Amico_R0050.
DR   EnsemblGenomes-Gn; Amico_R0051.
DR   EnsemblGenomes-Gn; Amico_R0052.
DR   EnsemblGenomes-Gn; Amico_R0053.
DR   EnsemblGenomes-Gn; Amico_R0054.
DR   EnsemblGenomes-Gn; Amico_R0055.
DR   EnsemblGenomes-Gn; Amico_R0056.
DR   EnsemblGenomes-Gn; Amico_R0057.
DR   EnsemblGenomes-Gn; Amico_R0058.
DR   EnsemblGenomes-Gn; EBG00001146443.
DR   EnsemblGenomes-Gn; EBG00001146444.
DR   EnsemblGenomes-Gn; EBG00001146445.
DR   EnsemblGenomes-Gn; EBG00001146446.
DR   EnsemblGenomes-Gn; EBG00001146447.
DR   EnsemblGenomes-Gn; EBG00001146448.
DR   EnsemblGenomes-Gn; EBG00001146449.
DR   EnsemblGenomes-Gn; EBG00001146450.
DR   EnsemblGenomes-Gn; EBG00001146451.
DR   EnsemblGenomes-Gn; EBG00001146452.
DR   EnsemblGenomes-Gn; EBG00001146453.
DR   EnsemblGenomes-Gn; EBG00001146454.
DR   EnsemblGenomes-Gn; EBG00001146455.
DR   EnsemblGenomes-Gn; EBG00001146456.
DR   EnsemblGenomes-Gn; EBG00001146457.
DR   EnsemblGenomes-Gn; EBG00001146458.
DR   EnsemblGenomes-Gn; EBG00001146459.
DR   EnsemblGenomes-Gn; EBG00001146460.
DR   EnsemblGenomes-Gn; EBG00001146461.
DR   EnsemblGenomes-Gn; EBG00001146462.
DR   EnsemblGenomes-Gn; EBG00001146463.
DR   EnsemblGenomes-Gn; EBG00001146464.
DR   EnsemblGenomes-Gn; EBG00001146465.
DR   EnsemblGenomes-Gn; EBG00001146466.
DR   EnsemblGenomes-Gn; EBG00001146467.
DR   EnsemblGenomes-Gn; EBG00001146468.
DR   EnsemblGenomes-Gn; EBG00001146469.
DR   EnsemblGenomes-Gn; EBG00001146470.
DR   EnsemblGenomes-Gn; EBG00001146471.
DR   EnsemblGenomes-Gn; EBG00001146472.
DR   EnsemblGenomes-Gn; EBG00001146473.
DR   EnsemblGenomes-Gn; EBG00001146474.
DR   EnsemblGenomes-Gn; EBG00001146475.
DR   EnsemblGenomes-Gn; EBG00001146476.
DR   EnsemblGenomes-Gn; EBG00001146477.
DR   EnsemblGenomes-Gn; EBG00001146478.
DR   EnsemblGenomes-Gn; EBG00001146479.
DR   EnsemblGenomes-Gn; EBG00001146480.
DR   EnsemblGenomes-Gn; EBG00001146481.
DR   EnsemblGenomes-Gn; EBG00001146482.
DR   EnsemblGenomes-Gn; EBG00001146483.
DR   EnsemblGenomes-Gn; EBG00001146484.
DR   EnsemblGenomes-Gn; EBG00001146485.
DR   EnsemblGenomes-Gn; EBG00001146486.
DR   EnsemblGenomes-Gn; EBG00001146487.
DR   EnsemblGenomes-Gn; EBG00001146488.
DR   EnsemblGenomes-Gn; EBG00001146489.
DR   EnsemblGenomes-Gn; EBG00001146490.
DR   EnsemblGenomes-Gn; EBG00001146491.
DR   EnsemblGenomes-Gn; EBG00001146492.
DR   EnsemblGenomes-Gn; EBG00001146493.
DR   EnsemblGenomes-Gn; EBG00001146494.
DR   EnsemblGenomes-Gn; EBG00001146495.
DR   EnsemblGenomes-Gn; EBG00001146496.
DR   EnsemblGenomes-Gn; EBG00001146497.
DR   EnsemblGenomes-Gn; EBG00001146498.
DR   EnsemblGenomes-Gn; EBG00001146499.
DR   EnsemblGenomes-Gn; EBG00001146500.
DR   EnsemblGenomes-Gn; EBG00001146501.
DR   EnsemblGenomes-Gn; EBG00001146502.
DR   EnsemblGenomes-Gn; EBG00001146503.
DR   EnsemblGenomes-Gn; EBG00001146504.
DR   EnsemblGenomes-Gn; EBG00001146505.
DR   EnsemblGenomes-Gn; EBG00001146506.
DR   EnsemblGenomes-Gn; EBG00001146507.
DR   EnsemblGenomes-Gn; EBG00001146508.
DR   EnsemblGenomes-Gn; EBG00001146509.
DR   EnsemblGenomes-Gn; EBG00001146510.
DR   EnsemblGenomes-Tr; Amico_R0001-1.
DR   EnsemblGenomes-Tr; Amico_R0002-1.
DR   EnsemblGenomes-Tr; Amico_R0003-1.
DR   EnsemblGenomes-Tr; Amico_R0004-1.
DR   EnsemblGenomes-Tr; Amico_R0005-1.
DR   EnsemblGenomes-Tr; Amico_R0006-1.
DR   EnsemblGenomes-Tr; Amico_R0007-1.
DR   EnsemblGenomes-Tr; Amico_R0008-1.
DR   EnsemblGenomes-Tr; Amico_R0009-1.
DR   EnsemblGenomes-Tr; Amico_R0010-1.
DR   EnsemblGenomes-Tr; Amico_R0011-1.
DR   EnsemblGenomes-Tr; Amico_R0012-1.
DR   EnsemblGenomes-Tr; Amico_R0013-1.
DR   EnsemblGenomes-Tr; Amico_R0014-1.
DR   EnsemblGenomes-Tr; Amico_R0015-1.
DR   EnsemblGenomes-Tr; Amico_R0016-1.
DR   EnsemblGenomes-Tr; Amico_R0017-1.
DR   EnsemblGenomes-Tr; Amico_R0018-1.
DR   EnsemblGenomes-Tr; Amico_R0019-1.
DR   EnsemblGenomes-Tr; Amico_R0020-1.
DR   EnsemblGenomes-Tr; Amico_R0021-1.
DR   EnsemblGenomes-Tr; Amico_R0022-1.
DR   EnsemblGenomes-Tr; Amico_R0023-1.
DR   EnsemblGenomes-Tr; Amico_R0024-1.
DR   EnsemblGenomes-Tr; Amico_R0025-1.
DR   EnsemblGenomes-Tr; Amico_R0026-1.
DR   EnsemblGenomes-Tr; Amico_R0027-1.
DR   EnsemblGenomes-Tr; Amico_R0028-1.
DR   EnsemblGenomes-Tr; Amico_R0029-1.
DR   EnsemblGenomes-Tr; Amico_R0030-1.
DR   EnsemblGenomes-Tr; Amico_R0031-1.
DR   EnsemblGenomes-Tr; Amico_R0032-1.
DR   EnsemblGenomes-Tr; Amico_R0033-1.
DR   EnsemblGenomes-Tr; Amico_R0034-1.
DR   EnsemblGenomes-Tr; Amico_R0035-1.
DR   EnsemblGenomes-Tr; Amico_R0036-1.
DR   EnsemblGenomes-Tr; Amico_R0037-1.
DR   EnsemblGenomes-Tr; Amico_R0038-1.
DR   EnsemblGenomes-Tr; Amico_R0039-1.
DR   EnsemblGenomes-Tr; Amico_R0040-1.
DR   EnsemblGenomes-Tr; Amico_R0041-1.
DR   EnsemblGenomes-Tr; Amico_R0042-1.
DR   EnsemblGenomes-Tr; Amico_R0043-1.
DR   EnsemblGenomes-Tr; Amico_R0044-1.
DR   EnsemblGenomes-Tr; Amico_R0045-1.
DR   EnsemblGenomes-Tr; Amico_R0046-1.
DR   EnsemblGenomes-Tr; Amico_R0047-1.
DR   EnsemblGenomes-Tr; Amico_R0048-1.
DR   EnsemblGenomes-Tr; Amico_R0049-1.
DR   EnsemblGenomes-Tr; Amico_R0050-1.
DR   EnsemblGenomes-Tr; Amico_R0051-1.
DR   EnsemblGenomes-Tr; Amico_R0052-1.
DR   EnsemblGenomes-Tr; Amico_R0053-1.
DR   EnsemblGenomes-Tr; Amico_R0054-1.
DR   EnsemblGenomes-Tr; Amico_R0055-1.
DR   EnsemblGenomes-Tr; Amico_R0056-1.
DR   EnsemblGenomes-Tr; Amico_R0057-1.
DR   EnsemblGenomes-Tr; Amico_R0058-1.
DR   EnsemblGenomes-Tr; EBT00001561672.
DR   EnsemblGenomes-Tr; EBT00001561674.
DR   EnsemblGenomes-Tr; EBT00001561677.
DR   EnsemblGenomes-Tr; EBT00001561679.
DR   EnsemblGenomes-Tr; EBT00001561681.
DR   EnsemblGenomes-Tr; EBT00001561685.
DR   EnsemblGenomes-Tr; EBT00001561687.
DR   EnsemblGenomes-Tr; EBT00001561691.
DR   EnsemblGenomes-Tr; EBT00001561692.
DR   EnsemblGenomes-Tr; EBT00001561694.
DR   EnsemblGenomes-Tr; EBT00001561697.
DR   EnsemblGenomes-Tr; EBT00001561699.
DR   EnsemblGenomes-Tr; EBT00001561703.
DR   EnsemblGenomes-Tr; EBT00001561705.
DR   EnsemblGenomes-Tr; EBT00001561708.
DR   EnsemblGenomes-Tr; EBT00001561711.
DR   EnsemblGenomes-Tr; EBT00001561712.
DR   EnsemblGenomes-Tr; EBT00001561715.
DR   EnsemblGenomes-Tr; EBT00001561718.
DR   EnsemblGenomes-Tr; EBT00001561721.
DR   EnsemblGenomes-Tr; EBT00001561723.
DR   EnsemblGenomes-Tr; EBT00001561725.
DR   EnsemblGenomes-Tr; EBT00001561726.
DR   EnsemblGenomes-Tr; EBT00001561728.
DR   EnsemblGenomes-Tr; EBT00001561730.
DR   EnsemblGenomes-Tr; EBT00001561733.
DR   EnsemblGenomes-Tr; EBT00001561734.
DR   EnsemblGenomes-Tr; EBT00001561735.
DR   EnsemblGenomes-Tr; EBT00001561740.
DR   EnsemblGenomes-Tr; EBT00001561741.
DR   EnsemblGenomes-Tr; EBT00001561742.
DR   EnsemblGenomes-Tr; EBT00001561745.
DR   EnsemblGenomes-Tr; EBT00001561747.
DR   EnsemblGenomes-Tr; EBT00001561749.
DR   EnsemblGenomes-Tr; EBT00001561751.
DR   EnsemblGenomes-Tr; EBT00001561753.
DR   EnsemblGenomes-Tr; EBT00001561755.
DR   EnsemblGenomes-Tr; EBT00001561757.
DR   EnsemblGenomes-Tr; EBT00001561758.
DR   EnsemblGenomes-Tr; EBT00001561759.
DR   EnsemblGenomes-Tr; EBT00001561761.
DR   EnsemblGenomes-Tr; EBT00001561763.
DR   EnsemblGenomes-Tr; EBT00001561765.
DR   EnsemblGenomes-Tr; EBT00001561767.
DR   EnsemblGenomes-Tr; EBT00001561768.
DR   EnsemblGenomes-Tr; EBT00001561769.
DR   EnsemblGenomes-Tr; EBT00001561772.
DR   EnsemblGenomes-Tr; EBT00001561774.
DR   EnsemblGenomes-Tr; EBT00001561776.
DR   EnsemblGenomes-Tr; EBT00001561777.
DR   EnsemblGenomes-Tr; EBT00001561779.
DR   EnsemblGenomes-Tr; EBT00001561781.
DR   EnsemblGenomes-Tr; EBT00001561783.
DR   EnsemblGenomes-Tr; EBT00001561785.
DR   EnsemblGenomes-Tr; EBT00001561786.
DR   EnsemblGenomes-Tr; EBT00001561788.
DR   EnsemblGenomes-Tr; EBT00001561790.
DR   EnsemblGenomes-Tr; EBT00001561793.
DR   EnsemblGenomes-Tr; EBT00001561794.
DR   EnsemblGenomes-Tr; EBT00001561796.
DR   EnsemblGenomes-Tr; EBT00001561798.
DR   EnsemblGenomes-Tr; EBT00001561800.
DR   EnsemblGenomes-Tr; EBT00001561802.
DR   EnsemblGenomes-Tr; EBT00001561803.
DR   EnsemblGenomes-Tr; EBT00001561806.
DR   EnsemblGenomes-Tr; EBT00001561808.
DR   EnsemblGenomes-Tr; EBT00001561810.
DR   EnsemblGenomes-Tr; EBT00001561811.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01343; CRISPR-DR33.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01831; THF.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01990; SECIS_4.
DR   SILVA-LSU; CP001997.
DR   SILVA-SSU; CP001997.
DR   StrainInfo; 163094; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4085722
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Aminobacterium colombiense ALA-1, DSM
CC                            12261
CC   Culture Collection ID :: DSM 12261
CC   GOLD Stamp ID         :: Gi02908
CC   Greengenes ID         :: 1649
CC   Funding Program       :: DOE-GEBA 2007
CC   Sequencing Depth      :: 85.8x 454-Titanium
CC   Gene Calling Method   :: Prodigal, GenePRIMP
CC   Isolation Site        :: Anaerobic lagoon of dairy wastewater
CC                            treatment plant in Colombia
CC   Isolation Country     :: Colombia
CC   Oxygen Requirement    :: Obligate anaerobe
CC   Cell Shape            :: Curved-shaped
CC   Sporulation           :: Nonsporulating
CC   Temperature Range     :: Mesophile
CC   Temperature Optimum   :: 37C
CC   pH                    :: 7.3
CC   Gram Staining         :: gram-
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Wastewater, Fresh water
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1980592
FT                   /organism="Aminobacterium colombiense DSM 12261"
FT                   /strain="DSM 12261"
FT                   /mol_type="genomic DNA"
FT                   /note="type strain of Aminobacterium colombiense"
FT                   /db_xref="taxon:572547"
FT                   /culture_collection="DSM:12261"
FT   gene            141..1469
FT                   /locus_tag="Amico_0001"
FT   CDS_pept        141..1469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; KEGG:
FT                   pca:Pcar_0001 chromosomal replication initiator protein
FT                   DnaA; SMART: Chromosomal replication initiator DnaA domain;
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56150"
FT                   /db_xref="GOA:D5EC68"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D5EC68"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ADE56150.1"
FT                   /translation="MVDKDINVLWDDILKNIEETMPEGTADLWLKTCVPLSVMNDVLVI
FT                   DVPNVFVKEQISKRFQNVIEDVLMDKGYAQSLELKVASEARKDEQQRAERAAQHTGTLP
FT                   RSGLNPNYIFNSFVVGKSNRLAHAASLAVAETPGEAYNPLFIWGGVGLGKTHLMHAIGH
FT                   YVLNKNNSLKVTYVSSEKFINEFIQSIKNNRTQEFKSKYRSVDILLIDDIQFLGNKGSS
FT                   QEEFFHTFNQLHVSKKQIVICSDRPPKEIQNIEDRLVSRFEWGLVTDIQMPDLETRIAI
FT                   LQKKAQIRNYEVPEDVISFLAQNVPSNIRELEGALNRIIACAELNSEPITEENATQWLK
FT                   DIIRHNSKGPVSVDTIQQIVAENFSLTVEDLVGNRRTSDIALARQVAMYLCRKLTDISL
FT                   QQIGFSFKKKDHTTVLHAQRKISKLVEEQPRMKEIVDNIEAKL"
FT   gene            1697..2848
FT                   /locus_tag="Amico_0002"
FT   CDS_pept        1697..2848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: csa:Csal_0002 DNA
FT                   polymerase III subunit beta; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56151"
FT                   /db_xref="GOA:D5EC69"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D5EC69"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADE56151.1"
FT                   /translation="MRLQVSKPDFMKIWQTTERVTSTKSTITSLAGILCRTDDASLTLE
FT                   ATDLKTSIKCIASGVQIEEGGEAILPVKVVGELFKKAPTDTFTVSVKEGKGIIFAGRNT
FT                   YRFSTYPVEEFPHLPSSENAKFFCTVKAETLAQILSEGTVASTLGEEFPKYLGAALFEL
FT                   KGNDIRIVSTDGRRLSLSKVLLDEYGDTEKILLPLAGLKELLRQLSSLEGDKPVQILHD
FT                   DALAYFQMGDIEFSIRKIESSFPNYEKILNPQSTTTLTIERSALTEALERVDVVVRDHT
FT                   RMVIFKLSPNGDLRMMGRAPEIGEAEEILDAQIDGEPLLIAFNVAYLLDGLKALHGESV
FT                   FITFNGPEGQMSMLRPGRDDFLYMLMPIKLSESDFIHERDEEE"
FT   gene            2887..3906
FT                   /locus_tag="Amico_0003"
FT   CDS_pept        2887..3906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="KEGG: dze:Dd1591_0003 DNA replication and repair
FT                   protein RecF; TIGRFAM: DNA replication and repair protein
FT                   RecF; PFAM: SMC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56152"
FT                   /db_xref="GOA:D5EC70"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D5EC70"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ADE56152.1"
FT                   /translation="MTPRRLEWAAGLNLLVGNNGSGKTNALEAIHILSGWGPFRSSRKS
FT                   FLVNWDTEEKQAYLRGYFSGETNLDIVATVGEKNIIQCDGKRITHGNVRSLIPALAFLP
FT                   GDLAIVDGAPSVRRQFLDRLCALLFPLYVRKMSDCRRALRHRVILLRERKDPSLTSKVL
FT                   APLVSWIWSTRAAAVDLLKIGIQEFRILLPSDIVLTFERGGALDLQDPMQDYWESVRKW
FT                   REKEHITGVPQVGPQRDDMIITTKGQSVSIVMSRGQRRRTAVALMLAAGWAVERKLRRK
FT                   PLLILDEIAAELDDRGRNILIDALVESSWQVFAATAESSMNGWPGTVWQVRQGNITPR"
FT   gene            3945..5843
FT                   /locus_tag="Amico_0004"
FT   CDS_pept        3945..5843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0004"
FT                   /product="glucose inhibited division protein A"
FT                   /note="KEGG: pca:Pcar_3141 tRNA uridine 5-
FT                   carboxymethylaminomethyl modification enzyme GidA; TIGRFAM:
FT                   glucose inhibited division protein A; PFAM:
FT                   glucose-inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56153"
FT                   /db_xref="GOA:D5EC71"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5EC71"
FT                   /inference="protein motif:TFAM:TIGR00136"
FT                   /protein_id="ADE56153.1"
FT                   /translation="MEQKKYDVIVVGGGHAGCEASLAAARMGARTLMLNLYLDNTALMP
FT                   CNPSIGGPAKGHLVREGNALGGEQARAADYSTMLVRWLNTSKGPAVQALRAQCDLRDYH
FT                   DHFIWTIETTPNLEVHQDIVTDLWIENGSIRGVKTKYGFTYEAGAVILTTGTYLRGQVH
FT                   IGLLNYSSGPMGQVPSTELSRSLLESGIEMGRMRTDTTPRLHIDTIDTSSLIEQKSAEE
FT                   PLCFDLWGEKKTYTGYSCYLTRTNSYLHNIIRENLERSPLWTGRMSGLGPRYCPSIEDK
FT                   IIRFPDKDSHLIFLEPVSRKNKEVYVQNFSTSLPYDIQVEIVHALPGCEKAQITRAGYA
FT                   IEYDYVIPTQLAPSLETKNIRGLFCAGQINGTSGYEEAAAQGLIAGMNAVLYTRKEAPV
FT                   VLKRSDAYIGVLIDDLVTKGTNEPYRMLTSRCEYRLLLRFDNADRRLAPIGRRMGLIDD
FT                   VKWQILREKWAAVDHEKERLSNLRINPSEEVNDWLVRAGSSPLEESVRAIDLLCRPEVT
FT                   YGAMRPFLPSIERPLTDEEAQSLAIEVKYAGYIERQQRQVIRLSKGEKVYIPEDFSYDE
FT                   VPGLLSESRQKLEKIRPQNLAQASRISGVTPADIQLLSVYLETRRRRKERGITPSS"
FT   gene            5821..6294
FT                   /locus_tag="Amico_0005"
FT   CDS_pept        5821..6294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0005"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   scl:sce9010 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56154"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:D5EC72"
FT                   /inference="protein motif:PFAM:PF05258"
FT                   /protein_id="ADE56154.1"
FT                   /translation="MALRHRHEASSVETLLESIFSSNGKKHILLSHVAQHWQKIVGNVL
FT                   SKRSQPFAIEGTLLCIRAESPAAAQRLSMMGATIAQKVSKEWDLPVSGVKVVIGKIFPR
FT                   RIPKIIGKKQVLITPRADDISKNLERLRDRIDDPDIAISLATLMATWNRRFGK"
FT   gene            complement(6322..6426)
FT                   /locus_tag="Amico_0006"
FT   CDS_pept        complement(6322..6426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56155"
FT                   /db_xref="UniProtKB/TrEMBL:D5EC73"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56155.1"
FT                   /translation="MFNQISKLVAKHEQVGVVAEITGTQHTLIKLQNR"
FT   gene            6595..7347
FT                   /locus_tag="Amico_0007"
FT   CDS_pept        6595..7347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56156"
FT                   /db_xref="UniProtKB/TrEMBL:D5EC74"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56156.1"
FT                   /translation="MKKYKFFWMISLSSLFFILLCSGVWANSWDDLVRFYDLDKRMTYE
FT                   ARILRQKLLQEAYNISSEELWRSLRQDLTPRQKAANSLLLIERLCSGNLQNWEEVKGFW
FT                   YPGLMPKPLALIEGFYFSLWSLSELPDEASPWLAFTLIKDLRSSSRGKLYFLEMAPHEY
FT                   GVILKQLKARGVPLPDNWFDFEERGSLPLIRSFRGRIGYDSVLFKNMVFLNNAGQPASN
FT                   GYYAWDRDRGYVYQVSTSNRRRIFIIWD"
FT   gene            7390..8268
FT                   /locus_tag="Amico_0008"
FT   CDS_pept        7390..8268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0008"
FT                   /product="Protein of unknown function DUF2179"
FT                   /note="PFAM: Protein of unknown function DUF2179; protein
FT                   of unknown function DUF161; KEGG: sat:SYN_01478
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56157"
FT                   /db_xref="GOA:D5EC75"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/TrEMBL:D5EC75"
FT                   /inference="protein motif:PFAM:PF10035"
FT                   /protein_id="ADE56157.1"
FT                   /translation="MLTFLPSKLKQFLQREWLTTIYTTTGTIIISFALVALIMPYRFAS
FT                   AGLTGIALISHYALNISPAWIIAIGNTVLLLWGWKVLSPRFVIWTFYVSILMTVSVMFF
FT                   ELFTYPLIQNVFLAAILGGVLGGLGMGLIFLGGGSSGGTDIIVMAARKKYGIDVGMYSF
FT                   YINMGILLASWFVVDLEQLLMGGVLLYIESLTIDNVLKSFDRRKQLMIITQKPGEVKRF
FT                   IIEELDRSATIIDARGAYSGEPKNMIMVVLTRRQAMELKRHVVSIDPMTFIILSDVAEV
FT                   VGDGFKHWKNI"
FT   gene            8302..9153
FT                   /locus_tag="Amico_0009"
FT   CDS_pept        8302..9153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0009"
FT                   /product="pantoate/beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /note="TIGRFAM: pantoate/beta-alanine ligase;
FT                   cytidyltransferase-related domain protein; KEGG:
FT                   gsu:GSU1706 pantoate--beta-alanine ligase; PFAM:
FT                   Pantoate-beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56158"
FT                   /db_xref="GOA:D5EC76"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/TrEMBL:D5EC76"
FT                   /inference="protein motif:TFAM:TIGR00018"
FT                   /protein_id="ADE56158.1"
FT                   /translation="MEIVNNIDSIRQKLACSRRQGKSIGLVPTMGFLHEGHLSLVRRAA
FT                   KENDIVVVSIFVNPTQFGPQEDFESYPRDLERDALLAEEAGANFIFYPTVGEMYPQKYE
FT                   TFVEVTELTKELCGRSRPGHFRGVTTVVTKLFNIILPDKAYFGQKDAQQAIVIQQMVRD
FT                   LNQNVEICVCPIIREKDGLAMSSRNTYLTPEEREQSTVLSASLEMAQQMIENGERDAER
FT                   IRKAMEELILSKDKARIDYVEIVSAHNLKPVQVLSGKCLIALAVKFGATRLIDNIMVTV
FT                   AQ"
FT   gene            9598..10578
FT                   /locus_tag="Amico_0010"
FT   CDS_pept        9598..10578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0010"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="TIGRFAM: aspartate-semialdehyde dehydrogenase; KEGG:
FT                   sfu:Sfum_3032 aspartate-semialdehyde dehydrogenase; PFAM:
FT                   Semialdehyde dehydrogenase dimerisation region;
FT                   Semialdehyde dehydrogenase NAD - binding"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56159"
FT                   /db_xref="GOA:D5EC77"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5EC77"
FT                   /inference="protein motif:TFAM:TIGR01296"
FT                   /protein_id="ADE56159.1"
FT                   /translation="MRVAVVGATGEVGRTMVRVLEEQGVRPDELRLFASARSAGTSLSF
FT                   CGNSCTVEELGTKVLKEGFDYLLFSAGSNVSKQYASIAAEAGSVVIDNSSAFRMTPDIP
FT                   LVVPEINGDLLRGYRGIVANPNCSTIQMVLGLYEIHRRFGIKSIVVSTYQSVSGAGKNG
FT                   INELESQISGHVEPKKFVRQIHLNVIPQIGAILENGFSEEEIKMVDETHKILQDDSIGI
FT                   WATTVRVPVLYGHSETIWVETRKPASLDEVRKAIEASENVELTDQVISPLDGAGTDLVY
FT                   VSRLRAFDDTRFLMWNVADNIRVGAATNAVRILKKHRALNARSFE"
FT   gene            10593..11477
FT                   /locus_tag="Amico_0011"
FT   CDS_pept        10593..11477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0011"
FT                   /product="dihydrodipicolinate synthase"
FT                   /note="KEGG: ppd:Ppro_3063 dihydrodipicolinate synthase;
FT                   TIGRFAM: dihydrodipicolinate synthase; PFAM:
FT                   dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56160"
FT                   /db_xref="GOA:D5EC78"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:D5EC78"
FT                   /inference="protein motif:TFAM:TIGR00674"
FT                   /protein_id="ADE56160.1"
FT                   /translation="MFSGTGTAVVTPFKSGKVDYESFERFLNFQINGGVDFLVVLGTTG
FT                   EAPAVTAKEREEIVRFVIKTVEGRVPVVVGTGSNSTEAAIELSNQALSLGVDGVLVVTP
FT                   YYNKPPQEGLYQHYRTIASRINKGRLIIYNVPGRTGVNILPETVLRLAEIENIVGIKEA
FT                   SGDEAQVDYLIRKMQKQRPNFFILSGNDDQAFHLVNAGGDGVISVLSNVAPRETSTMIR
FT                   FALDGEIGKARELHLRLFPLMKGLFCETNPIPVKYGVSRLGYCENELRLPLIPASSKAM
FT                   AVVDEALKESGIY"
FT   gene            11477..12139
FT                   /locus_tag="Amico_0012"
FT   CDS_pept        11477..12139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0012"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="TIGRFAM: dihydrodipicolinate reductase; KEGG:
FT                   gsu:GSU0160 dihydrodipicolinate reductase; PFAM:
FT                   dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56161"
FT                   /db_xref="GOA:D5EC79"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5EC79"
FT                   /inference="protein motif:TFAM:TIGR00036"
FT                   /protein_id="ADE56161.1"
FT                   /translation="MRYGLVGASGRMGQEIQKAFAEHTLCLTVDINGETCDDTPQVIVD
FT                   FSNRMALPRTIELCRLHRAGLVVGTTAIVQEDIELLRKLGEEVPVVQSFNFSVGVNILK
FT                   MVLRQFAPYLEDWDLEICETHHNKKKDAPSGTAILMREVTGRNCPTHSLRMGGVPGDHS
FT                   AFFANEGEVLEFTHRALSRSVFALGAYRAAQFVVNAEPGFYSFEEVIACAPRKSSSL"
FT   gene            12109..12807
FT                   /locus_tag="Amico_0013"
FT   CDS_pept        12109..12807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0013"
FT                   /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylateN-ac
FT                   etyltransferase"
FT                   /note="KEGG: hypothetical protein;
FT                   TIGRFAM:2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-acetyltransferase; PFAM: Tetrahydrodipicolinate
FT                   succinyltransferase domain protein; transferase hexapeptide
FT                   repeat containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56162"
FT                   /db_xref="GOA:D5EC80"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR013710"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR019873"
FT                   /db_xref="UniProtKB/TrEMBL:D5EC80"
FT                   /inference="protein motif:TFAM:TIGR03532"
FT                   /protein_id="ADE56162.1"
FT                   /translation="MRTEEIIKLIKESKKRTPAKAYLSGNLEKCVWGELTFIGSNHFGM
FT                   LIGDHKEIELALSANASHIDGTHIEVEARNSALPLADLTKYDARIEPGAIIRDMVEIGK
FT                   GAVVMMGAVINIGAVIGAGTMIDMNVVVGGRAVVGANSHIGAGAVVAGVIEPPSATPVM
FT                   IDDNVLVGANAVILEGVHIGAGAVVAAGAIVTKDVPPGAVVAGSPARIIKMVDAKTADK
FT                   TQIVQDLRNL"
FT   gene            12825..14039
FT                   /locus_tag="Amico_0014"
FT   CDS_pept        12825..14039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0014"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="TIGRFAM: aspartate kinase; KEGG: dvm:DvMF_0276
FT                   aspartate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase; amino acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56163"
FT                   /db_xref="GOA:D5EC81"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:D5EC81"
FT                   /inference="protein motif:TFAM:TIGR00657"
FT                   /protein_id="ADE56163.1"
FT                   /translation="MIVQKYGGSSVATPEMIRAIAEKIKKRVEEGEKLIVVVSAMGKTT
FT                   NNLIDLANQVSSDPLPRELDMLLATGEQTSAALLSMSLNDLGVQAVSYNAFQLGMITTG
FT                   TFCNARIVDIDMKKVERELNQRDVIVVTGFQGITPEGEITTLGRGGSDTSAVAIAAKAG
FT                   ARCEIYSDVAGIYTCDPKICPNAQKLDYVTYNEVLELSSMGAKVLHSRAVEIAKKYNVE
FT                   LYCASTFSDERGTLVVGTLPEWLEQPVVTGVTSDPNQRKVTISPMPGGIQAMSALFTAL
FT                   ADKGINVDMISTVNDNGHSYLTFTVVEGKGPVVRSTVEEVMASYDGWRVTEDDKVAKVS
FT                   AVGVGMESAPGVAARFFSALCREQIRMYGTSTSEIKISTLVAKTDANRAVRALVHEFGL
FT                   TEVEN"
FT   gene            complement(14146..14463)
FT                   /locus_tag="Amico_0015"
FT   CDS_pept        complement(14146..14463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0015"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /note="PFAM: Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein; KEGG: sfu:Sfum_3412 dinitrogenase
FT                   iron-molybdenum cofactor biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56164"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR033913"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:D5EC82"
FT                   /inference="protein motif:PFAM:PF02579"
FT                   /protein_id="ADE56164.1"
FT                   /translation="MRIAAAVNEPSLTSSIAERFARAPYFVILDEEGTLLETIQNPLLE
FT                   QGHGAGGAAARLLSKYNIDIVIVPHVGPNAENALKLAGIKYIKAEGLTLKEALIRVKEL
FT                   S"
FT   gene            complement(14474..15352)
FT                   /locus_tag="Amico_0016"
FT   CDS_pept        complement(14474..15352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0016"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein; KEGG:
FT                   sfu:Sfum_3408 cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56165"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5EC83"
FT                   /inference="protein motif:PFAM:PF01656"
FT                   /protein_id="ADE56165.1"
FT                   /translation="MTPKEIVIISGKGGTGKTCIMAALCSSFSGKAVFCDVDVDAPNLQ
FT                   LLLNPQDEQAFSFTGRKIPEIDTERCTVCGGCVGFCRFNALEKANNGITLLPWKCEGCG
FT                   GCALVCPHQAISMHSYEQGQYWRGTTTYGPLWHARLHAGEENSGMLVARLKKESRKEAL
FT                   KEGVPFIVIDGPPGISCPAISALTGATLAVAVTEPSLSGLHDLLRLSKLCASLDVPLAI
FT                   VLNKSDLSEAKGEEIKNEAKKENWHFLGSIPFRPNVVEAISKKEIPLEALSPEIDSIYN
FT                   NLTNLINIIKR"
FT   gene            complement(15349..16194)
FT                   /locus_tag="Amico_0017"
FT   CDS_pept        complement(15349..16194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0017"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein; KEGG:
FT                   pca:Pcar_1585 MinD family ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56166"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5EC84"
FT                   /inference="protein motif:PFAM:PF01656"
FT                   /protein_id="ADE56166.1"
FT                   /translation="MFRLTVASGKGGTGKTCIAASLALSLSKGTAIDLDVDEPDLGLVL
FT                   QIKNPKKENVYKVVPQIEAARCKGCGVCADNCAFGALNQFGTHAPVVNMQLCHGCGVCE
FT                   LVCPQKAIKDSKASIGIMNIKNQESFWFLEGILDIGEPNPVPLIHAVLKKADSLPFPQI
FT                   VDGPPGNACPMVAAVEQSNFVILVTEPTPFGLSDLALATETVRELHIPAGVVINRSDLG
FT                   NIEEAEIFCKNLALPILARLPFSKEVARAYAKGIAPILIDKQWQEAASDILNHVKEVLS
FT                   "
FT   gene            complement(16204..16554)
FT                   /locus_tag="Amico_0018"
FT   CDS_pept        complement(16204..16554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0018"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /note="PFAM: Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein; KEGG: dvu:DVU2109 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56167"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR033913"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:D5EC85"
FT                   /inference="protein motif:PFAM:PF02579"
FT                   /protein_id="ADE56167.1"
FT                   /translation="MKIAIAKNGDTVSEHFGHVEEFLVVHVENQKEVERKIYATPKGEH
FT                   VPGAMPQWIATLGADVVITGGIGGRASAMLRAQGIDVLCVKPMSIELTIEAFLNQNLEV
FT                   LSDQCSHDHSSL"
FT   gene            complement(16570..16860)
FT                   /locus_tag="Amico_0019"
FT   CDS_pept        complement(16570..16860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0019"
FT                   /product="putative cytoplasmic protein"
FT                   /note="KEGG: sat:SYN_01170 putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56168"
FT                   /db_xref="InterPro:IPR035205"
FT                   /db_xref="UniProtKB/TrEMBL:D5EC86"
FT                   /inference="similar to AA sequence:KEGG:SYN_01170"
FT                   /protein_id="ADE56168.1"
FT                   /translation="MPGYDGSGPRGQGPMTGRGFGYCRFGGYGYRRFPRRGRRFFGFGR
FT                   GMGGWGAPVYPGWGYEPSIEEERNVLQEELSVLEEEMENMRKRLAELEENK"
FT   gene            16959..17528
FT                   /locus_tag="Amico_0020"
FT   CDS_pept        16959..17528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0020"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: nis:NIS_1078
FT                   ferric uptake regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56169"
FT                   /db_xref="GOA:D5EC87"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5EC87"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ADE56169.1"
FT                   /translation="MEHNKKKKRQDFFDILKKAGFRLTNQRQTIIDVLIEGEAEHGNIQ
FT                   LIWEKAHEKDPSIGIATVYRTVGLLSDMGLLYRFSLDEGFERFELPSSSIHFHLYCRCC
FT                   GKVLHLKHEREKEEIITEWLGEAGFQPIPQSLEFAGMCSDCASKVKDHKKMKDLPCTLE
FT                   VEGRGRGRGRCGRRQGCFRQQNNTTL"
FT   gene            17669..18103
FT                   /locus_tag="Amico_0021"
FT   CDS_pept        17669..18103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0021"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: mmb:Mmol_0127 response regulator receiver
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56170"
FT                   /db_xref="GOA:D5EC88"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D5EC88"
FT                   /inference="similar to AA sequence:KEGG:Mmol_0127"
FT                   /protein_id="ADE56170.1"
FT                   /translation="MLEEKNIRLVKILLVERKEKVEQDIFQSLRELKILNTIHVVRSRY
FT                   EALEYLRQVGKYWDRPKPDIVMADCDLPGNCCEGLLFEMRNDPALCYIPILFITSQGES
FT                   VPFETSDYMARFVEKPFSGSNILEALMSFDRFGMAVVKAE"
FT   gene            complement(18229..19008)
FT                   /locus_tag="Amico_0022"
FT   CDS_pept        complement(18229..19008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0022"
FT                   /product="Creatininase"
FT                   /note="PFAM: Creatininase; KEGG: bam:Bamb_3261
FT                   creatininase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56171"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:D5EC89"
FT                   /inference="protein motif:PFAM:PF02633"
FT                   /protein_id="ADE56171.1"
FT                   /translation="MYLASLTWKKLEEKITEETVALIPLGSVEQHGPLAPLGTDYFIPE
FT                   EFAKRVEAAYPDKIMVLPTMPYGVCPYHASFPGTIDMGIEILSEVMTRIAMSLMDTGIK
FT                   KMIFLNGHGGNGPSLDKAALAVYKRGGLAAIVDWWTLAGELNAKWAGGHGAGQETSVMM
FT                   ALKPEWVNMKDFFPANIHHVSDSLQNTHISIVTFEKGSVRIIRDVKDVTSSGAYGGTDA
FT                   PEDANREWGEEILKGVTEYLIRFIAEYFKVSLSREKN"
FT   gene            19198..20379
FT                   /locus_tag="Amico_0023"
FT   CDS_pept        19198..20379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0023"
FT                   /product="isoaspartyl dipeptidase"
FT                   /note="KEGG: eum:ECUMN_4937 isoaspartyl dipeptidase;
FT                   TIGRFAM: isoaspartyl dipeptidase; PFAM: amidohydrolase;
FT                   Amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56172"
FT                   /db_xref="GOA:D5EC90"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR010229"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D5EC90"
FT                   /inference="protein motif:TFAM:TIGR01975"
FT                   /protein_id="ADE56172.1"
FT                   /translation="MMNLILIKNGEIYSPEYLGKSDLLIAGDSIFSVESSISEDAVKSI
FT                   APHAIIIDAGGALVVPGFIDSHVHFNGAGGEGGPQFRTPPLQLSSFIRAGITTAAAPLG
FT                   TDGISRSLRELLAKAHSLENEGISTFIYSGAYGMPSVTITENIVSDIVLIDKVIGVKVA
FT                   LSDHRSSHPTVEELRRLISDARIGGMLAGKAGIVEAHMGSEDWGLDIIEEALSGTQIPK
FT                   SQILPTHVNRNEKLYAQTLNYCSNGGVADLTTSMGSGGHTVKPSEGIGRAVAHQVSLSR
FT                   LTMSTDGNGSMPEFNAEGELVKMGIGEPLSLFAEFRDTVLEERIPMEEALSLVTKNVAA
FT                   RLKLTKKGRLVPGADGDVLIISPDTLTLEYVIGKGVLMMKERSVIKKGIFEEV"
FT   gene            20601..21218
FT                   /locus_tag="Amico_0024"
FT   CDS_pept        20601..21218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0024"
FT                   /product="PHP domain protein"
FT                   /note="KEGG: eba:ebA5293 hypothetical protein; PFAM: PHP
FT                   domain protein; SMART: phosphoesterase PHP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56173"
FT                   /db_xref="GOA:D5EC91"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:D5EC91"
FT                   /inference="protein motif:PFAM:PF02811"
FT                   /protein_id="ADE56173.1"
FT                   /translation="MVIDTHLHSEEFSSDSFLPIGEAIQKGKSMGLDGICVTDHESMGM
FT                   RSFARELSVKYDFLVLVGLELLTYEGDLLVFGLESVPEKKMHASDALELVNRQGGVAVS
FT                   AHPFRDNGRGMGNFIRSLPGLSGIEAFNGSTRLTHNFKAHALANELELPRLGGSDAHFV
FT                   ERVGLYATAFPGIIQNENDFIGAIRTGNVYPVVYDVNRFVKV"
FT   gene            complement(21215..22090)
FT                   /locus_tag="Amico_0025"
FT   CDS_pept        complement(21215..22090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0025"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /note="PFAM: phosphatidate cytidylyltransferase; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56174"
FT                   /db_xref="GOA:D5EC92"
FT                   /db_xref="UniProtKB/TrEMBL:D5EC92"
FT                   /inference="protein motif:PFAM:PF01148"
FT                   /protein_id="ADE56174.1"
FT                   /translation="MIGSAILLGGVSFVLLPLEMAAGLFAAITLWLTLYSAPFLCAYIG
FT                   WLFGMFLGFVHAETHLWGVLSLIPVGIWFVINWRFTLAKEIPSFIKAFRNPLARRKMFR
FT                   YCGLIFPCIIYPLWGPGALNKSLMVATAIAFISEKTVSYVPILGRLFKTIAPASYERRK
FT                   KSISGTTCYLLGAFVASLFPDPASVQAIVMATIGDAWAVLVGKRWGKLKWFEGKTLEGS
FT                   LACLAGALLGSFIYGLMVPEAQIPWLILLWGGLATLFTEGIFRFELDNLFVAPVSAAIM
FT                   TAVIWIAYFF"
FT   gene            complement(22131..22898)
FT                   /locus_tag="Amico_0026"
FT   CDS_pept        complement(22131..22898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0026"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   glo:Glov_1064 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56175"
FT                   /db_xref="GOA:D5EC93"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D5EC93"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ADE56175.1"
FT                   /translation="MIRQIFSFLFTLTCIWSWCFAGGIGHAFAPSPATPQLWGEDIPGV
FT                   RTRLNTQEPVIALTLDACGGKRGNGFDKKLINWLRKHHIPATLFITGRWINANEEIAKE
FT                   LASSPLFEIENHGMNHCPCSVSGRSAYGIPGTGSVEEVMREVSDATVIIEKVTNRQPRF
FT                   FRSGTNYYDEVALALIEDLGYNVVGYSIAGDEGATLSEDAIMKKLLQAKAGDIILCHMN
FT                   QPESDTAEGLIKVIPILQKKGFRFVTLQEYPLR"
FT   gene            complement(22901..23965)
FT                   /locus_tag="Amico_0027"
FT   CDS_pept        complement(22901..23965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0027"
FT                   /product="Fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /note="KEGG: ect:ECIAI39_0920 fructose-bisphosphate
FT                   aldolase; PFAM: deoxyribose-phosphate aldolase/phospho-2-
FT                   dehydro-3-deoxyheptonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56176"
FT                   /db_xref="GOA:D5EC94"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041720"
FT                   /db_xref="UniProtKB/TrEMBL:D5EC94"
FT                   /inference="protein motif:PRIAM:4.1.2.13"
FT                   /protein_id="ADE56176.1"
FT                   /translation="MSQYLEEIKEILGDDGDSLLNYTCWGIPSEMLIPPAANFVDRLSA
FT                   ETDRPIPVLRSLQTLFNTGRLGGTGYLSILPVDQGVEHSAGASFALNPIYFDPEHIVKL
FT                   AIEAECSAVASTLGVLGSMARKYAHRIPFILKINHNELLSYPNTYDQVLFASVKQAQDM
FT                   GALAVGATIYFGSPESRRQIQEVSMAFHMAHEMGMATILWCYLRNKAFKTKEKDYHLAA
FT                   DLTGQANYLGATIEADIVKQKLPVVNGGFRDLHFGKTSSEVYEKLVPEHPIDLLRYQVA
FT                   NCYMGRVGLISSGGASMGTDDLKEAVKTAVINKRGGGMGLILGRKAFQRPFREGIHIIQ
FT                   NVQNVYLEKEIALA"
FT   gene            24062..24934
FT                   /locus_tag="Amico_0028"
FT   CDS_pept        24062..24934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0028"
FT                   /product="6-phosphogluconate dehydrogenase NAD-binding
FT                   protein"
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase NAD-binding;
FT                   KEGG: dat:HRM2_44930 YwkC"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56177"
FT                   /db_xref="GOA:D5EC95"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5EC95"
FT                   /inference="protein motif:PFAM:PF03446"
FT                   /protein_id="ADE56177.1"
FT                   /translation="MKNIGFIGLGVMGASMAGHLLKAGYSLHVYNRTRVKAEKLIEQGA
FT                   SWEEDVPSLASKCDSIITMVGFPRDVEEIYLGQRGLIENARTGTYLIDMTTSSPELAAR
FT                   IYVASKKRGLKALDAPVSGGDKGAREGTLSVMVGGDPEDFDEVRPLFEVMGKNIVYQGE
FT                   AGSGQHTKMANQIAIASNMIGVCEAISYAIKAGLDPDKVLASIAQGAAGSWSLSNLAPR
FT                   MIAGNFDPGFYVKHFIKDMKIALESADRMGLDTPGLEMALSMYKKLALHGHDNEGTQAL
FT                   FRLYSAQKD"
FT   gene            complement(24987..25418)
FT                   /locus_tag="Amico_0029"
FT   CDS_pept        complement(24987..25418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0029"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_3560 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56178"
FT                   /db_xref="InterPro:IPR025540"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D5EC96"
FT                   /inference="similar to AA sequence:KEGG:Sfum_3560"
FT                   /protein_id="ADE56178.1"
FT                   /translation="MFNVKDILQPGLTATIKKTVEIDDTVGNMNIHLNQLLSTPACVQA
FT                   IVGACIKAVDHFLPEGYITVGKSIEVIHEATSMLGVTVEFKATLTSIEGNRLFFEITAS
FT                   DAIGVTLTARHERVIVNHMALMDRAIERVNQLNKIREMP"
FT   gene            25494..25928
FT                   /locus_tag="Amico_0030"
FT   CDS_pept        25494..25928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0030"
FT                   /product="MOSC domain containing protein"
FT                   /note="KEGG: geo:Geob_1631 MOSC domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56179"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:D5EC97"
FT                   /inference="similar to AA sequence:KEGG:Geob_1631"
FT                   /protein_id="ADE56179.1"
FT                   /translation="MAIVLAVCISSKRSSPKRTVEKAFFASGGIEGDSHFGFNEREVSL
FT                   LRREDVEKTEQQANILFPPGSLAENLLVKGLPEDLSPGTILAIGPTVKLEVIEKGKKPG
FT                   EPHTYDYKGWCLLPIWGYFLRVVQGGEVVPGDRVSFLETN"
FT   gene            complement(25992..27575)
FT                   /locus_tag="Amico_0031"
FT   CDS_pept        complement(25992..27575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0031"
FT                   /product="helicase domain protein"
FT                   /note="KEGG: ade:Adeh_3405 DEAD/DEAH box helicase-like;
FT                   PFAM: helicase domain protein; DEAD/DEAH box helicase
FT                   domain protein; SMART: helicase domain protein; DEAD-like
FT                   helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56180"
FT                   /db_xref="GOA:D5EC98"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5EC98"
FT                   /inference="protein motif:PFAM:PF00271"
FT                   /protein_id="ADE56180.1"
FT                   /translation="MERSFYNWQLKAYKKIYEKNAVLSAPTGAGKTLVAYLWAGLLTTE
FT                   GKAQMPEGISRIIFTAPIKALSNERYMDLRRMGFDVGIETGDFKRNEEAPIICCTQEIY
FT                   TLKYTKEPHQKLIIDEFHYIFEDPDRARTYIDGIRGTAPTTSILVMSATFSQPGVIGRY
FT                   LETITERSFTVYESQERVTDLVYVPKKPAQLFSVHDALVFVFSQRGTMDLAYTIARTRR
FT                   RLPREQRSRLYELATILDVPKVQMPLLCGIGIYHGSMLPKEKLLVESAFRERILDVVVG
FT                   TNALALGVNLPAESVIFAQLVQFHDNAPISKNEFLQMAGRAGRKGLFDTGYVTWLSKSP
FT                   CEHRGYDTGDEFKKLLSIPPEAATVSLRPAWGALLRREVHINEEADYISRFSLPEIDPF
FT                   ILRTELRQGLNRIDRAMRRMVRPQQRKRFRTLLADIWYEEMSADENLEMARLFFAEERP
FT                   EALFAAQLIAPYERNYLQSLLKIKRYANHLPEGYYFKSMQMLNQTVDDIDPTIYGFEEK
FT                   INEIEGSLKS"
FT   gene            complement(27662..28513)
FT                   /locus_tag="Amico_0032"
FT   CDS_pept        complement(27662..28513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0032"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: psp:PSPPH_4862 histidine
FT                   ABC transporter, permease protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56181"
FT                   /db_xref="GOA:D5EC99"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D5EC99"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADE56181.1"
FT                   /translation="MFPENLEFHIASHVNNGVNWLLQAMAPTFDSISNGILAMLLKTEN
FT                   LLHIIPWWFYIIFVAFLAWKATRCLSTTIILPLSLILIGSFGLWKLAMGTLAIVIASVF
FT                   LSLLIGIPVGILMAEAKGVEPIVKPILDAMQTMPSFVYLIPAMMFFGLGKVPAVLATLI
FT                   YSLPPVIRLTNLGLKQVPQPAQEAAIAYGATKWQLLKEVRVPLAMPTIMAGVNQTTMMA
FT                   LSMVVVASMIGARGLGQEVLLSINRIDVGRGFEAGISIVIMAIAIDRITQGFARRWDKA
FT                   QR"
FT   gene            complement(28494..29414)
FT                   /locus_tag="Amico_0033"
FT   CDS_pept        complement(28494..29414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0033"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: swd:Swoo_1847 glycine betaine/L-proline ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56182"
FT                   /db_xref="GOA:D5ECA0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECA0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADE56182.1"
FT                   /translation="MIHTTKASKALEIKDLWKVYTKKDIDIDVENGDLITELDKSEDAV
FT                   VAVRGVSLAARQGEVFVIMGLSGSGKSTLIRCVIRLIEPTSGEIWVNGQEVSSLPKKDL
FT                   TEFRRKQIAMVFQHYGLLPHKTIIDNVEFGLKLQGISEKERRERSNVALERVGLKGWEN
FT                   YYPSSLSGGMRQRVGIARALVMDTPILLMDEPFSGLDPLIRREMQDELIRLQKELKKTI
FT                   FFVTHDLDEAMRMGDRMAVMKNGTIVQMGAPAQILANPADEYVARFVQDKRRQIQMADE
FT                   GAFVNGESMDEIPGEGVMDHISRES"
FT   gene            complement(29411..30433)
FT                   /locus_tag="Amico_0034"
FT   CDS_pept        complement(29411..30433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0034"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: dat:HRM2_38080 ProX"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56183"
FT                   /db_xref="GOA:D5ECA1"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECA1"
FT                   /inference="protein motif:PFAM:PF04069"
FT                   /protein_id="ADE56183.1"
FT                   /translation="MKTHLLKKQIIITLCALSTMFLGAIAAEAARPITFIDFSWDSVQV
FT                   HNRIAGYIIVHGYGKNVDYMFAESLPGLMGIERGDADISMELWADNVHEWWEEAQKKGN
FT                   VTSLGMNFPDAPQGWYVPRYMVEGDAERGIEATAPDLKSVYDLPKYWELFKDPEEPNKG
FT                   RLYNGPAGWKVSSINTEKVIAYRLDKNYTAFDPGSQTSLATAIASAYERGKPVLAYYWE
FT                   PTEVMGMYNMVKLEEPPYKKDIWETTRGCDFPSVKVLIIANTKFARENPEITEVFKKYT
FT                   TTLEQNNKTLAYMKTRVVDAEQAAVWFLKNYSEEWKGWIEDESVIAKIEKALEKEVIKD
FT                   "
FT   gene            complement(30535..30840)
FT                   /locus_tag="Amico_0035"
FT   CDS_pept        complement(30535..30840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0035"
FT                   /product="putative TetR family transcriptional regulator"
FT                   /note="KEGG: sml:Smlt3985 putative TetR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56184"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECA2"
FT                   /inference="similar to AA sequence:KEGG:Smlt3985"
FT                   /protein_id="ADE56184.1"
FT                   /translation="MLGLSDKQTTKKERKELIEAVHTALEELLMSQQHIDFKAVARKLG
FT                   IARSTLYRNPIVREEIAAAREKSRVSSISLPQLQEEIRLLKERVQKLEDVSHQWEP"
FT   gene            31058..31318
FT                   /locus_tag="Amico_0036"
FT   CDS_pept        31058..31318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56185"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECA3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56185.1"
FT                   /translation="MECKWKITATEESPHPHEEWVLIYSIIPSEEEKKGGDKPRIVWQQ
FT                   IGDELTDLAVEYDLPFEVVTEYLKKTEKHVNRYVSLFIMEN"
FT   gene            31340..32122
FT                   /locus_tag="Amico_0037"
FT   CDS_pept        31340..32122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0037"
FT                   /product="inositol monophosphatase"
FT                   /note="PFAM: inositol monophosphatase; KEGG: csa:Csal_1824
FT                   inositol-1(or 4)- monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56186"
FT                   /db_xref="GOA:D5ECA4"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECA4"
FT                   /inference="protein motif:PFAM:PF00459"
FT                   /protein_id="ADE56186.1"
FT                   /translation="MKGSMEKILTDLLRDAGEIIMEQRDTQIASRRSMSDYTTVTDVRV
FT                   EAFITQHLQKYFPESVIIGEEFSSSRNSLQLKGSAFVLDPIDGTVNFFHGYPAFAISLA
FT                   YVENYSIRQAYIYDPANGEFFFAAKNEGAFLNDSFISVSQARTLSESLIGFGTAYNKEL
FT                   GKKEIEIVTKIYERCHDVRRRGAASLDVAYVACGRLDGYLEMELKPWDFYAGLLILEEA
FT                   GGKACNWKGLPIQDLVNQNLLCTNNLIHQELFNLVREL"
FT   gene            32263..33876
FT                   /locus_tag="Amico_0038"
FT   CDS_pept        32263..33876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0038"
FT                   /product="Na/Pi-cotransporter II-related protein"
FT                   /note="KEGG: pca:Pcar_1565 Na+/phosphate symporter;
FT                   TIGRFAM: Na/Pi-cotransporter II-related protein; PFAM:
FT                   Na+/Picotransporter; PhoU family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56187"
FT                   /db_xref="GOA:D5ECA5"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR004633"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECA5"
FT                   /inference="protein motif:TFAM:TIGR00704"
FT                   /protein_id="ADE56187.1"
FT                   /translation="MPLSNALQVLGGVGLFLFGIKLMSDALQDLAGDRMRQLVGSLTST
FT                   PVRGVLIGTLVTVLIQSSSGTTIMTVSFVHAGLMTLKQAVGVIMGANIGTTVIAQVIAF
FT                   KIKNFALPVIGIGMLFAVFGKSKRQKYIGNGLVGFGLLFLGMQTMEGAMDFLQGRKDLF
FT                   MMFSRSPLLGVLVGTLVTMVVQASSATIGLTIAMASQGLLSLDAAVPILLGDNIGTTIT
FT                   AVIASLGSNRSAKQAAAAHVMFNVIGVVIFMTILPIFKTVISMTSSDIARQLANAHTLF
FT                   NVTNTLIFLPFTSVFVKLIQAIVPGKSSAINVGPQFLDPKLVTASPAAAIDAIKKEISH
FT                   MGAIALSMLQDVKNAFVNDDPKMIDQVNESEKILNELTHAIAKYSAEIWQESISSELSV
FT                   VLSAYVNGISDIERVGDHCQNLIELYDYKVEHRLTFSPVAMQEFQDMFNTVFRSVTLSL
FT                   ESVAEEDVSKAHEVIDVLEVEVDRKEKTLRKSHIRRLNRGECNPSAGVIFIDILSNLER
FT                   IGDHAHNLSFIALDIAKTHR"
FT   gene            complement(34014..34985)
FT                   /locus_tag="Amico_0039"
FT   CDS_pept        complement(34014..34985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0039"
FT                   /product="biotin/acetyl-CoA-carboxylase ligase"
FT                   /note="KEGG: mxa:MXAN_4152 BirA bifunctional protein;
FT                   TIGRFAM: biotin/acetyl-CoA-carboxylase ligase; PFAM:
FT                   biotin/lipoate A/B protein ligase; Helix-turn- helix type
FT                   11 domain protein; biotin protein ligase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56188"
FT                   /db_xref="GOA:D5ECA6"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECA6"
FT                   /inference="protein motif:TFAM:TIGR00121"
FT                   /protein_id="ADE56188.1"
FT                   /translation="MKKHIINILKQTQGTYVSGQDLCEQLGVSRTAVWKHINQLREEGY
FT                   TIDSSARKGYRLIDVPDLLNEYEVEPLLTTEVLGHPIIHFREVPSTNIEARKYAREGTA
FT                   EGTVIVAEHQTAGRGRSGRSWFSSPEWAIQMSLILRPKVSPALAASITQIGAAAVAKAL
FT                   ESLGLSPQIKWPNDVLLSEKKVCGILTEMSCELDHINHIVIGIGINVNTPHFPDDVASV
FT                   ATSVRIEKGETWNRKKLMAAVLNSFEPLYKEFLEGKEHPEYLRICRALSNLIGQHITYE
FT                   TTKGRLSAKAIDIDNIGRLIVQHSDGSTETLLSGEVHIGTQE"
FT   gene            complement(35006..35805)
FT                   /pseudo
FT                   /locus_tag="Amico_0040"
FT   gene            complement(35964..36722)
FT                   /locus_tag="Amico_0041"
FT   CDS_pept        complement(35964..36722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0041"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: vcj:VCD_000167 phosphate transport ATP-
FT                   binding protein PstB; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56189"
FT                   /db_xref="GOA:D5ECA7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECA7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADE56189.1"
FT                   /translation="MSSILEIHQLAVAFNNKKILKNINANIYPHQITAIIGPSGCGKST
FT                   FLKSLNRLVEDERGVTLSGQIRLDGEDTFTLSPEEVRRRIGMVFQSPTPFPFSIYDNMA
FT                   YPLRYYGYGSKKKSKNLDVIIRNKLEDVGLFEEVKDSLSMNATLLSGGQQQRLCIARAL
FT                   AVEPEILLLDEPCSSLDVKNTQNIEMMLRALCQQYSIIIVTHNLFQARRISHRTFFILD
FT                   GEIIEAGPTKDLFENPCDSRTAEYISGIYG"
FT   gene            complement(36724..37566)
FT                   /locus_tag="Amico_0042"
FT   CDS_pept        complement(36724..37566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0042"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: dol:Dole_1927 phosphate ABC
FT                   transporter, inner membrane subunit PstA"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56190"
FT                   /db_xref="GOA:D5ECA8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECA8"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADE56190.1"
FT                   /translation="MVNDKGKASLFPLRLWLFSSAFFVIASLCVLFGYIFIQGGRELSL
FT                   SFLTNTPQGFPLGVEGGIWPAIVGSFWFTTIACAFGSFLALPTAIFLAFYAKTTWIVSL
FT                   CHFLIHSMAGIPSIILGLFGYTFFVVTLGFGVSLLSGGLILGIMIFPFIEVRVEKTLLE
FT                   FPNNITQASISLGITKTWTLFHLILPGCMDDIAKTIALGGSFAMGATAPILFTGAVLFA
FT                   PSPRSVFSPAMALSNHLYILVGQGISISKAYGTALVLIVLLLILNVVPLVINMCRKER"
FT   gene            complement(37560..38429)
FT                   /locus_tag="Amico_0043"
FT   CDS_pept        complement(37560..38429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0043"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstC"
FT                   /note="KEGG: dvl:Dvul_0764 phosphate ABC transporter, inner
FT                   membrane subunit PstC; TIGRFAM: phosphate ABC transporter,
FT                   inner membrane subunit PstC; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56191"
FT                   /db_xref="GOA:D5ECA9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECA9"
FT                   /inference="protein motif:TFAM:TIGR02138"
FT                   /protein_id="ADE56191.1"
FT                   /translation="MKKELIFVWACKALTLLAVSFLFFIFLFIAKESFMFFQKTPLLHF
FT                   LTGSRWNPMADPPAFGLLPMIFATVYVSLLATAIALPIGVGMAIILSVLAPPKIQWLLL
FT                   PLIDLMAGIPSVVYGFAGLMIIVKFFETHFSWSSGESVLAGGILLAIMILPYVVSTCYE
FT                   SMIKVLHHYERASRALSVSKWHMMRYLVIPTAKKAIFAALILSLSRAMGETMAVMMVIG
FT                   NSPIFPHLFRKAETIPALIALEMGGAVVGSLHYQALFAAGLILMLVLFTFNSFFFFIRK
FT                   HIDEGIKW"
FT   gene            complement(38516..39397)
FT                   /locus_tag="Amico_0044"
FT   CDS_pept        complement(38516..39397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0044"
FT                   /product="phosphate binding protein"
FT                   /note="KEGG: dvl:Dvul_0765 phosphate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56192"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECB0"
FT                   /inference="similar to AA sequence:KEGG:Dvul_0765"
FT                   /protein_id="ADE56192.1"
FT                   /translation="MHRFFRFLFASIMIMSLVIAGSQLAIAADGQIFFKGSSTLAPVIS
FT                   QVAQQFMEKYGTWNKIDASLPDAKIEIFVSGGGSGEGVKAVLDGTSNFGMTARTVKEEE
FT                   KKAIGDYHEFHIGTDALTISVNPDNKVCQVKPNLTKDELVKIFSGEYRTWNNLDPALAK
FT                   EEIVVVIRDIGGGAHEVFQKSVMKKVDVTPSAIQSPSMGALVTKVIENKNAIGYASFGM
FT                   VNVHKGEIVPLKVDGVEPTVENILDGTYYVSRPLLVVKKGNMSPIEKAFIDELLSAEGM
FT                   KIVEQMGFVPAK"
FT   gene            39540..40457
FT                   /locus_tag="Amico_0045"
FT   CDS_pept        39540..40457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0045"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="TIGRFAM: 2-dehydropantoate 2-reductase; KEGG:
FT                   afw:Anae109_2380 2-dehydropantoate 2- reductase; PFAM:
FT                   Ketopantoate reductase ApbA/PanE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56193"
FT                   /db_xref="GOA:D5ECB1"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECB1"
FT                   /inference="protein motif:TFAM:TIGR00745"
FT                   /protein_id="ADE56193.1"
FT                   /translation="MRICIAGLGGVGGYFGGRLAVAYETSAEHEISFLCRGEHMNRIRE
FT                   KGLVVTTPRETFVAHPRVVSDSPAEIGCVDVLFFAVKGYDLQAFAKAARPLCHNQTLLI
FT                   PLGNGVDNADILCKEKIPGILFNGCVYISAFIASPGEIRQVGGNCKMIVGPVNDHIEKH
FT                   RSFEKVMKEGGILFELTPEIDLAVWTKFIFMSPMAAVTTLKRASFGEVLSQKRTRDMVL
FT                   NLMKEVESLAQKRGIALPGNIVEVSLEKAQSFPPETRSSMELDASKGRPTELETFVGAV
FT                   VRLAEDAGISVPLYEKVYKALLQE"
FT   gene            complement(40599..41270)
FT                   /locus_tag="Amico_0046"
FT   CDS_pept        complement(40599..41270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0046"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="KEGG: sfu:Sfum_3900 binding-protein-dependent
FT                   transport systems inner membrane component; TIGRFAM: polar
FT                   amino acid ABC transporter, inner membrane subunit; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56194"
FT                   /db_xref="GOA:D5ECB2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECB2"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ADE56194.1"
FT                   /translation="MNDLLFIQQDVLPALLTGIIMTLKLIVVSIPFGIAAGTVIAIGRV
FT                   YGNNTISFLCRLYVIFFKGTPLLILLFMLYFGLPSFGITLSPFAASVLGFIICNGAYNS
FT                   EYIRGAIQSVKGGQLIAAQALGMTKWQAILNIILPQAFRRAIPGCSNEMIYLIKYSSLA
FT                   YMLTYIELTGAGKIVASRSFRYTLVFTVVGVIYLIMVTLASWLLSLLEKKLYIPGWSQE
FT                   S"
FT   gene            complement(41263..42042)
FT                   /locus_tag="Amico_0047"
FT   CDS_pept        complement(41263..42042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0047"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: sfu:Sfum_3901 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56195"
FT                   /db_xref="GOA:D5ECB3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECB3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADE56195.1"
FT                   /translation="MSDKTKDIILRVEDIHKSYGGVEVLRGISFTVRKGETKVFIGPSG
FT                   TGKSTLLRCINQLTIPDSGQIWLHGEEVTHSKKSINVLRQKMGMVFQNFYLFDHLTALR
FT                   NVEIALLKVKGMDKKHAREKAMLELERVGMAAFADHYPTQLSGGQAQRVSIARALAMDP
FT                   DVMLFDEPTSALDPELIGEVLEVMRNLAKGGMTMLVVTHEMGFACSVANEIMFMEEGRI
FT                   LESGSPDKLLNTPQYERTRQFLRKLMDLYGELGKSNE"
FT   gene            complement(42045..42719)
FT                   /locus_tag="Amico_0048"
FT   CDS_pept        complement(42045..42719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0048"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="KEGG: sfu:Sfum_3902 polar amino acid ABC
FT                   transporter, inner membrane subunit; TIGRFAM: polar amino
FT                   acid ABC transporter, inner membrane subunit; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56196"
FT                   /db_xref="GOA:D5ECB4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECB4"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ADE56196.1"
FT                   /translation="MENIEVVVQSLPYLLQGTLVTLRIVALALALGLCMGLPLAIGQVY
FT                   GSASIQKMVKAYVWIFRGLPNLVLLFLFFFGIFPSLRIDASAFSTAVVVLGLRSAAYQS
FT                   QIFRGSILSLGEGQMLAARSLGMNKLQAIIWIILPQALRIALPGWSNEYPILLTDSSVT
FT                   YAIGVLEILTRANLVVSRTYKPMPIFLTCAIIFILLNYGGMRLLHMIENKMRIPGYGNG
FT                   ER"
FT   gene            complement(42835..43590)
FT                   /locus_tag="Amico_0049"
FT   CDS_pept        complement(42835..43590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0049"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="KEGG: dvl:Dvul_2548 extracellular solute-binding
FT                   protein; PFAM: extracellular solute-binding protein family
FT                   3; SMART: extracellular solute-binding protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56197"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECB5"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ADE56197.1"
FT                   /translation="MKKIGVLLLCCIFVVLGASNVLAADKKTYIVGIDGDYYPYSFIGQ
FT                   DGKPAGFDVESIQWIAKEMGFEVKVQPMAWDGIIPALLAKKIDMVYSGMTASPERREVV
FT                   AFSKVYWIINQAVCVRNNTDTNMGNLFDGKHTIGTQRGCTAAMWLEDYVVKTGIIPSQN
FT                   LKLYDNFPLAAKDLENGRIDAAMMDDVIVAKAVEGKDMKIIGTISTGEEYAVAMRKEDK
FT                   ELHDLINEGLDRLMTSPMWNELKLKYKMF"
FT   gene            43855..44598
FT                   /locus_tag="Amico_0050"
FT                   /note="Contains selenocysteine"
FT   CDS_pept        43855..44598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:44017..44019,aa:Sec)
FT                   /locus_tag="Amico_0050"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="Contains selenocysteine; TIGRFAM: peptide methionine
FT                   sulfoxide reductase; KEGG: hypothetical protein ; K07304
FT                   peptide- methionine (S)-S-oxide reductase; PFAM: Methionine
FT                   sulfoxide reductase A"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56198"
FT                   /db_xref="GOA:D5ECB6"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECB6"
FT                   /inference="protein motif:TFAM:TIGR00401"
FT                   /protein_id="ADE56198.1"
FT                   /translation="MTIIVIGVFLAIYPGIIFAEESNMEKEMAFMENILPAIDSVEHKR
FT                   TELATFALGUFWGPDAQFGLLSGVISTKVGYTGGDRPDPTYHTLGNHTESIQVVYDPDV
FT                   ISYEDLLEVFTEGHDPTLPIFSRQYMSAIFYENEEQKAGAEGWKEHLQQETGRPVRTQI
FT                   LPLETFYLAEAYHQKYWLRMDSAFFQEYKKIYPSLDKLLQSTAVARVNGYLGGYGTLKE
FT                   LEAELLLLGLSEEGQRRLRNIVFSR"
FT   gene            complement(44595..45017)
FT                   /locus_tag="Amico_0051"
FT   CDS_pept        complement(44595..45017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0051"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   geo:Geob_1166 thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56199"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECB7"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ADE56199.1"
FT                   /translation="MIEKLEGSQGCFVCDTTNTNPRSLKLAIYWDSERRKTIIRLTPDS
FT                   SHCGYEGIVHGGIIASIFDDAMAWAVKKETGIWAVTATFEIRYRQPVKIGEEYTFYGKI
FT                   DSVLGKRIRTSALLKNSTGQEAASASALFISMEPNS"
FT   gene            45144..46268
FT                   /locus_tag="Amico_0052"
FT   CDS_pept        45144..46268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0052"
FT                   /product="Monogalactosyldiacylglycerol synthase"
FT                   /note="PFAM: Monogalactosyldiacylglycerol synthase;
FT                   glycosyl transferase group 1; Glycosyltransferase 28
FT                   domain; KEGG: bur:Bcep18194_B0550
FT                   monogalactosyldiacylglycerol synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56200"
FT                   /db_xref="GOA:D5ECB8"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="InterPro:IPR009695"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECB8"
FT                   /inference="protein motif:PFAM:PF06925"
FT                   /protein_id="ADE56200.1"
FT                   /translation="MRPVHLVYVSAGSGHRIAARAIQEELDSRRIPNVIMDLLDFSSDL
FT                   FKWSYSDVYAFVSEHAHLACKVMYELTDQDREESAALRLLEKINMENVKKFMRYLAENQ
FT                   PDVCVGTHFFPLSVLSYMKEQGFYKGKIYGVVTDYGLHRMWVSPHVDAYFVGGAPVKKD
FT                   LVEAGISNDKVLISGIPVLRKYAESYSRYTEEKPLKTPFSLLFVASSVPNSIVLDILEG
FT                   LIETGINLSLTIIAGRNEDLIDQLEGVDIPHRIDFKVLGFVDNLNDYMEEADLMITKPG
FT                   GLTVSEALCVGVPMIMINPIPKQEINNARYLEANGAGIWARSATDAVHHVRGLYTSFER
FT                   LKKIRGAARKLAHPHSAQVIADKVLLSLNKHSML"
FT   gene            46386..47510
FT                   /locus_tag="Amico_0053"
FT   CDS_pept        46386..47510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0053"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   dde:Dde_1622 iron transport periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56201"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECB9"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ADE56201.1"
FT                   /translation="MKWRTGIWSFLLLCSIFFPTQGLASEKSGTSMAIADGTGQQVEVP
FT                   APIEYAICSGSGCLRLLTYLQGQHLVVAVEDNEKRKDFGPRPYALANPHFKDMPLMGEF
FT                   RGNANPELILGLNPLPQVIFKTYPNDGIPAHVLNEKTGIPVIGLNYGNLAHLREDLYAS
FT                   LRIMGKVIDREERAEAIVDFFEKSIADLKSRVQDVPEAEQRTCYVGGVASRGAHGFRST
FT                   ELAYPPFIFTKARHVATADHDAGAKNTHADVAREKLLEWDPEVIFIDLATLNAGGQASA
FT                   LSELKNDPVYQELQAVKSGEVYGVLPYNWYTQNFGSILADAYFVGKVLYPERFQDIDPP
FT                   QKADEIYTFLVGKGVFNEMNALFENMAFQKISLK"
FT   gene            47521..48591
FT                   /locus_tag="Amico_0054"
FT   CDS_pept        47521..48591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0054"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   dal:Dalk_5081 transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56202"
FT                   /db_xref="GOA:D5ECC0"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECC0"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ADE56202.1"
FT                   /translation="MHLEEGTLSPVYKEYQAQKALWLCAGAVLLAITAMLSISLGAVRI
FT                   PPMEVLATVLGKSETSKWQLIIWNVRLPQTLTALVAGAGLSVAGVVMQSILRNPLGSPF
FT                   TLGISNAAAFGAALSVMVFGAGQMQSSQVGAVTLFNPLAATGAAFSTSLIATGIIVLLS
FT                   RMRGATPESMVLTGVALASLFTAATMLLQYFADDAQLAAMVFWTFGDVARAGWRELQIM
FT                   SVFIGVVLIYFFAHRWDYNAIDAGEEAALGLGVQVQRIRLVGMLCASLISSVVVAFVGV
FT                   IGFVGLVCPHMVRLIIGDDHRFLIPGTAIFGALLLLGADTAARLVLAPRVLPVSVLTSF
FT                   LGAPLFIWLVLRRGRL"
FT   gene            48588..49343
FT                   /locus_tag="Amico_0055"
FT   CDS_pept        48588..49343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0055"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: dal:Dalk_5082 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56203"
FT                   /db_xref="GOA:D5ECC1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECC1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADE56203.1"
FT                   /translation="MILSVDDLHFSYGETPILKNISLSVKNQEMVMILGPNGSGKTTLL
FT                   RCLNGINRPQKGTITLEDKNMRRMSGREIARRIGYVPQSSEKVRLTAFDAILLGRRPYV
FT                   GWRLAESDIKKVDAIIHTLGLDELALRYLDEMSGGELQKVTIARALVQEPRILLLDEPI
FT                   SSLDVKNQIEIMETMKHIIKGHGLSAVMSLHDLTMALRYGDRFVFMKKGEIRYILARDE
FT                   ISPQVIADIYDISVDIEFVHGSPVIIPAW"
FT   gene            complement(49345..49956)
FT                   /locus_tag="Amico_0056"
FT   CDS_pept        complement(49345..49956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0056"
FT                   /product="formylmethanofuran dehydrogenase subunit E
FT                   region"
FT                   /note="PFAM: formylmethanofuran dehydrogenase subunit E
FT                   region; KEGG: dde:Dde_1625 formylmethanofuran
FT                   dehydrogenase, subunit E"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56204"
FT                   /db_xref="InterPro:IPR003814"
FT                   /db_xref="InterPro:IPR026328"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECC2"
FT                   /inference="protein motif:PFAM:PF02663"
FT                   /protein_id="ADE56204.1"
FT                   /translation="MPSITSECLEQIIHFHGHWCPGLAIGIRAAQIALAEVGHSSDEEM
FT                   VALCETDMCGIDAIQFLTGCTLGKGNLIIRPYGKMAFSFYRRKDGKSIRLVLKKESGKG
FT                   TGSPDYRELQAKVNTHTITEEERRRFAALRQERCDAIMTMPVEELFEIGTVREAVPPHA
FT                   PMAQSLTCALCREGVMETKARCFKGEYYCAPCFEKIVPRP"
FT   gene            50149..51252
FT                   /locus_tag="Amico_0057"
FT   CDS_pept        50149..51252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56205"
FT                   /db_xref="GOA:D5ECC3"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECC3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56205.1"
FT                   /translation="MLTNILTALAVVVNGIPQGLLALSFGFAAFPTAIAFIIGIAGSLA
FT                   FNSVATISFQAETITLAGTMGRNVRERLSLVFWGAAFLFIPSVFGLNEAIVAFIGPTIV
FT                   TSMMAGVGIMLAYVAIELFNAERWSGTASMISGLAVWLVTKDLAWTIIISVLVSTAVYN
FT                   YLRVSKKVAIEETKIDLSRERFNFGDIEWRFWKNPRVFVGALALACLNIGANISFGKIT
FT                   GSIAGAETNIDHLAIYSSLADMGSSLFGGGPVEAIISGTATAPKPILASVLMMGIMAVI
FT                   LLMKLLPIIGQYVHRSSIAGFLFILGTFVTFATNIQGAIASAPEFAGPYGFGPWGMVIG
FT                   ATTLVSARWNPFFGLLAGLAIKFYFGV"
FT   gene            51260..51802
FT                   /locus_tag="Amico_0058"
FT   CDS_pept        51260..51802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0058"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG: dps:DP0918
FT                   adenine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56206"
FT                   /db_xref="GOA:D5ECC4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECC4"
FT                   /inference="protein motif:PFAM:PF00156"
FT                   /protein_id="ADE56206.1"
FT                   /translation="MNDTYELHISGLTRNLKKVRVADDLVIASFVMLGDTELIERTAED
FT                   LYRKLPDGIDYLVCPEAKGIPLTHAIARRLGINYVIVRKSVKGYMENPVIEKVQSITTR
FT                   EPQIIVLDGLDAQKLENKRVCIVDDVVSTGGSLKALESLLSHVNCTVVTKVAVLLEEGG
FT                   YESKDLVYLARLPVFKE"
FT   gene            complement(51935..54061)
FT                   /locus_tag="Amico_0059"
FT   CDS_pept        complement(51935..54061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0059"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="KEGG: dol:Dole_0421 heavy metal translocating P-
FT                   type ATPase; TIGRFAM: heavy metal translocating P-type
FT                   ATPase; ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC; cadmium-translocating P-type ATPase; PFAM:
FT                   E1-E2 ATPase-associated domain protein; Heavy metal
FT                   transport/detoxification protein; Haloacid dehalogenase
FT                   domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56207"
FT                   /db_xref="GOA:D5ECC5"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECC5"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ADE56207.1"
FT                   /translation="MPLYRIKKLNCQSCASRIEADISALPGVSGVLFDIDTKILRVEND
FT                   GSDLEEKIRAIVTRIEPGVTVTPVNNVENASSEKPSSGKSFLIKRFKEEGKGLGIAAIL
FT                   FIIGLAFREQLAATPYSLGEYSIFLAAYFLSGQEVLWSTVKNLKGLKGMDEFFLMSIAT
FT                   IAAILIGELPEAVAVMLFYRTGELFQELSASRSRSSIRALLAARPQFARLLSGGEERNV
FT                   KPEDVAVNDHILVRPGEKIPLDGIIESGISQIDQSPLTGESIPVTAEPGKRVYGGSINL
FT                   RGALTIRVTSAFEETTIARILEMVEFAVARKSPTERFITTFARYYTPAVVMGALAVAAI
FT                   PPLLGNGSFMNWIYRALVLLVISCPCALVISIPLGYFGGIGAGSRHGILIKGGNVLDAM
FT                   NSAKVVAFDKTGTLTQGVFSVTKIVPQQGVSEEEILSLAASLEQGSNHPIARSITEAAG
FT                   GIELLPPKDLEEISGKGLRGIVEGHRILAGNKKFLEGEGFQNLSDPERGTVVHIAKGGQ
FT                   YLGYIIVSDVIRPDAHSTLKALKKAGLAATIMLTGDTEKGAEWVAREIGVDQYVASLLP
FT                   QDKVAELARLKSGLSANETTIFVGDGLNDAPALAAADIGIAMGGLGSEAAIETADVVIL
FT                   DDNPSKVADALVLARRTRKIVWQNIILALATKGFFIALGIAGMAGMWEAVFADVGVALL
FT                   AVLNSMRTIRFEPA"
FT   gene            complement(54100..55263)
FT                   /locus_tag="Amico_0060"
FT   CDS_pept        complement(54100..55263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0060"
FT                   /product="permease"
FT                   /note="PFAM: permease; KEGG: dps:DP0945 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56208"
FT                   /db_xref="GOA:D5ECC6"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECC6"
FT                   /inference="protein motif:PFAM:PF03773"
FT                   /protein_id="ADE56208.1"
FT                   /translation="MSDRKKFIWIVAAFLFFYFLPANNPRVHGAAIEAFAMLHEYAREH
FT                   VLLCLVPAFFIAGAISVFVSQQSVMKYLGNQAQKIVSYSVAAVSGTILAVCSCTVLPLF
FT                   AGIYSRGAGIGPASAFLYSGPAINILAIILTARVLGFEMGLARAIGAISFSILIGLAMA
FT                   FIFKEEEKKRQEGFASLPIEEPARPLWKTLWTMASMVFFLIFANWAAPKVESGTWAAIY
FT                   DAKWILAGTALGSTLLTTMKWFSRDEQTEWLSATWGYGLQVLPLLFSGVLLAGFLLGRP
FT                   GYEALIPSHYVAALVGGNSIFSNFFASVAGAFMYFATLTEVPILQGLMGAGMGKGPALA
FT                   LLLAGPALSLPNMLVIRNIMGTKKTAAYVALVIFLSTVAGSIYGAFF"
FT   gene            complement(55351..55593)
FT                   /locus_tag="Amico_0061"
FT   CDS_pept        complement(55351..55593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0061"
FT                   /product="redox-active disulfide protein 2"
FT                   /note="TIGRFAM: redox-active disulfide protein 2; KEGG:
FT                   dps:DP0946 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56209"
FT                   /db_xref="InterPro:IPR005243"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECC7"
FT                   /inference="protein motif:TFAM:TIGR00412"
FT                   /protein_id="ADE56209.1"
FT                   /translation="MKIQILGTGCPKCKKLAEMAEKVAQELDLDYEIEKVTDIKEIMSF
FT                   GVLGTPGLVVDGKVLLSGRVPTEAVLKDLLREKAK"
FT   gene            complement(55553..55933)
FT                   /locus_tag="Amico_0062"
FT   CDS_pept        complement(55553..55933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0062"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="KEGG: dde:Dde_3721 ArsR family transcriptional
FT                   regulator; PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56210"
FT                   /db_xref="GOA:D5ECC8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECC8"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADE56210.1"
FT                   /translation="MDASLQQEKAAIFKALGHPVRLSIVETLEKGEMCACEIAELFHFD
FT                   RTTISKHLAILRDLHIIEDRKDGLHIYYSLKMRCLASMLQCVERVIQGHPVYEEHHLQC
FT                   FCAARKEREDENTDIGNRLPKM"
FT   gene            complement(55990..56646)
FT                   /locus_tag="Amico_0063"
FT   CDS_pept        complement(55990..56646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0063"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: dat:HRM2_23230 CbiO1; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56211"
FT                   /db_xref="GOA:D5ECC9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECC9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADE56211.1"
FT                   /translation="MMPLLRLKSIAFAYPRSSPLFTHLSFEIFEKEKIYIRGENGAGKT
FT                   TLFSLIMGLLRPQKGDIIVKGKVIKNQKDLRYLRQTIGFLFQDPDDQLFCPTLLDDVLF
FT                   GPLNGGINKEEAYEQAINVLKTLNIDNLAHTPPYALSGGQKRLGALAAVLAMKPDLLLL
FT                   DEPSSGLDERAWQNLVDVLNQLDMALIIASHDIPFLEHVTRRGYELSSGMLTFAQ"
FT   gene            complement(56643..57365)
FT                   /locus_tag="Amico_0064"
FT   CDS_pept        complement(56643..57365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0064"
FT                   /product="cobalt ABC transporter, inner membrane subunit
FT                   CbiQ"
FT                   /note="KEGG: dat:HRM2_23220 CbiQ1; TIGRFAM: cobalt ABC
FT                   transporter, inner membrane subunit CbiQ; PFAM: cobalt
FT                   transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56212"
FT                   /db_xref="GOA:D5ECD0"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR012809"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECD0"
FT                   /inference="protein motif:TFAM:TIGR02454"
FT                   /protein_id="ADE56212.1"
FT                   /translation="MGNSNFPSLNYQVYIPDSFLSRVSAAIKVVLVFLFALCVALLPSV
FT                   AAQFFLLMYAFMLVTIARIPIKVIITRLLALDSFLLMMWLTLPLSSENGVRLALLITIR
FT                   AHAATLAFISLLRTTTMPDLLQALHRLHVPQKLILLLHFTYRYAHVLSEEAQKIHKSMV
FT                   LRGFHPTVSFSTFRAYGNLVGMLLIRSIIRSERVSKAMALRGFNGSFPFFSFCATSSPP
FT                   DTLCMAALYILLAGCFIL"
FT   gene            complement(57355..57954)
FT                   /locus_tag="Amico_0065"
FT   CDS_pept        complement(57355..57954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0065"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dvu:DVU1072 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56213"
FT                   /db_xref="GOA:D5ECD1"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECD1"
FT                   /inference="similar to AA sequence:KEGG:DVU1072"
FT                   /protein_id="ADE56213.1"
FT                   /translation="MEIKTLSLKFVSMTVLLFLWTGPASAHKLNVFAYMENNTLVGEAY
FT                   FNDGAPARHSAIHVKNAKNNSLIVEGTTDERGQFSIPVDAIGIQSLLVSVNGGIGHLGQ
FT                   TIVTIEAAEPNDRIEKTALVASESSNTASSLSEEKISALTQEIVQKEIAPIRNELSLLR
FT                   KELSKPKFSEIIGGIGYIAGLAGMAFWAGGRKKYGQ"
FT   gene            complement(57945..58553)
FT                   /locus_tag="Amico_0066"
FT   CDS_pept        complement(57945..58553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0066"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiM
FT                   protein"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiM
FT                   protein; KEGG: dds:Ddes_1471 cobalamin (vitamin B12)
FT                   biosynthesis CbiM protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56214"
FT                   /db_xref="GOA:D5ECD2"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECD2"
FT                   /inference="protein motif:PFAM:PF01891"
FT                   /protein_id="ADE56214.1"
FT                   /translation="MHIAEGVLSLPVLLIGATGAAAGVAVGLKRIDAEMIPRAGIVSAA
FT                   LFVSSLIHVNIGPTSAHLVLNGIGGLILGMGLFPSYLVALFLQALLFQFGGVVVLGVNT
FT                   CTMSLSGVLGGLLGRYVLHLGKPAWLAGALAGATGVAGAGIFTALALAGSGEVFFMTAK
FT                   LILLAHIPIMGIESLIGVFVATYVFRTMPSLLEDWEKWK"
FT   gene            complement(58553..59344)
FT                   /locus_tag="Amico_0067"
FT   CDS_pept        complement(58553..59344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0067"
FT                   /product="Nickel transport complex, NikM subunit,
FT                   transmembrane"
FT                   /note="PFAM: Nickel transport complex, NikM subunit,
FT                   transmembrane; KEGG: dol:Dole_2023 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56215"
FT                   /db_xref="GOA:D5ECD3"
FT                   /db_xref="InterPro:IPR019613"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECD3"
FT                   /inference="protein motif:PFAM:PF10670"
FT                   /protein_id="ADE56215.1"
FT                   /translation="MRIWKKQIIVPLVMVCSFFVFASPLRAHFQVIIPNQNIVSQDDNK
FT                   QIDLDLLFTHPFEQHLMNMEKPVQFGVLVRSEKTDLLNFLNEKISKDGLKSWKASYVVK
FT                   RPGDHIFYVEPSPYWEPAENKYIIHYTKTIVNAFGMKDGWDEAVGLRAEILPLTHPYGL
FT                   WAGNVFQGKVVVDGKPVSGADVEVEFYNDKKAIKAPADPFITQVVRTDDQGIFTYVMPW
FT                   EGWWGFAALSDAPETMKTPDGKNDAAIELGAVLWLKTVNKN"
FT   gene            59569..60447
FT                   /locus_tag="Amico_0068"
FT   CDS_pept        59569..60447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0068"
FT                   /product="phenazine biosynthesis protein PhzF family"
FT                   /note="KEGG: rle:RL3189 putative phenazine biosynthesis
FT                   protein; TIGRFAM: phenazine biosynthesis protein PhzF
FT                   family; PFAM: Phenazine biosynthesis PhzC/PhzF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56216"
FT                   /db_xref="GOA:D5ECD4"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECD4"
FT                   /inference="protein motif:TFAM:TIGR00654"
FT                   /protein_id="ADE56216.1"
FT                   /translation="MKKHEFYIVDVFAEKKYSGNQLAVVLGAGDLSKEDMESITREMNY
FT                   SETTFILNHSPVNGGYPARIFTPGGEVPFAGHPTLGTAAVIAREIAPGNPDFITLNLQV
FT                   GPIPVMRKDHLYIMKQNQPEFGPVYPPEDLARVLSIDAKEIETGAPVQWVSTGLPTVIV
FT                   PLKRREVLSRICINRNEYEDFIERMGKVAISIYCKEPIHRHNHLHVRVLTSCFGVEEDP
FT                   ATGSSGGCLAAYLVRHKVMGASVIEDVRVEQGYSLQRPSLLFLSASDQDGGKIDVHVGG
FT                   SVIFVAKGELI"
FT   gene            complement(60499..62061)
FT                   /locus_tag="Amico_0069"
FT   CDS_pept        complement(60499..62061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0069"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: extracellular solute-binding
FT                   protein family 3; binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: mxa:MXAN_5503
FT                   His/Glu/Gln/Arg/opine amino acid ABC transporter
FT                   permease/periplasmic amino acid- binding protein; SMART:
FT                   extracellular solute-binding protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56217"
FT                   /db_xref="GOA:D5ECD5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECD5"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ADE56217.1"
FT                   /translation="MKRLIRFLCALFIVFAACGSPLYATDKPVLKWGGDTEGGVPYMFY
FT                   DPFDMDRLIGYEVEIIDAIADYLGMETEFVQNGWDNLIPGLERHLYDVTLDGLEITPEH
FT                   KEVVNFSIPYYATFLQIAVRKGTKDIETLEDCKGKVVGTLKQSYAYFTLVEAGIKDIRT
FT                   YEDEINAFNDLENGRLDATLFDDPIGVYYAGFNPEIVFVGPPVGRMEYGIAVRKEDKQL
FT                   LSDINEAIVYLRDSGKLREIYDRWNMWSPMMAEMFQDFSPSKIEASMFNHWAEHQKPDI
FT                   TLAKRLNRYASFLPILGKAAIVTMKVSIASMVLAIFLGLLLAMTKIFGPTLLSRLAIGY
FT                   IEAIRGTPVLIQLFFIFYGLPNIGIKLSPFFAGILGLGLNYAAYEAENYRAGLLSVPRQ
FT                   QMEGALALGMTRWQALRHVVLPQALRVALPPVTNDFISLLKDSSLVSVITMVDLTKAYG
FT                   QLATTYYDYFGTGIIVAIIYFLLGLPFVRLARWTEKKMAVAVKGGKRQKNSGSLVGKKP
FT                   GSY"
FT   gene            complement(62062..62847)
FT                   /locus_tag="Amico_0070"
FT   CDS_pept        complement(62062..62847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0070"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: shl:Shal_3486 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56218"
FT                   /db_xref="GOA:D5ECD6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECD6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADE56218.1"
FT                   /translation="MTRAAIPLIHVENLYKSFEDGEVLNGISIDIHEGDLVSIIGPSGC
FT                   GKSTFLRCLNCLEYIDSGTITIAGVTVSRTGKEKELDKSFLEACHHMRQEVGMVFQSFN
FT                   LFPHRTVLENVMLAPMVVKKASEEEAHEIALRLLEKVGLSEHAHKYPATLSGGQTQRGA
FT                   IARALAMNPKVMLYDEPTSALDPELVGEVLQVMKDLDNEGMTQIIVTHQMRFARNASDY
FT                   IVFMDGGEIVEMADGDVLFETPQNKRTKAFLRHFSEDVA"
FT   gene            63054..64253
FT                   /locus_tag="Amico_0071"
FT   CDS_pept        63054..64253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0071"
FT                   /product="threonine synthase"
FT                   /note="KEGG: afw:Anae109_3605 threonine synthase; TIGRFAM:
FT                   threonine synthase; PFAM: Pyridoxal-5'-phosphate-dependent
FT                   protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56219"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECD7"
FT                   /inference="protein motif:TFAM:TIGR00260"
FT                   /protein_id="ADE56219.1"
FT                   /translation="MLEKKLICTACGSTFSLRENLARCQKCREPLEIEEFISKNIDTEE
FT                   RSDIFKRYKSFFPFQSSCSGLSLGEGMTPLLSAPSFAEKYGVKEIFLKNETVNPTWSFK
FT                   DRGTAASIHHAIELGFRRIGTVSTGNMAASVAAFGARAGLETTILVKGDIPSEKLNPVA
FT                   IYNARLIKALGDYDRLYEESLRLGERYGIYFMNSDVPFRVEGSKTIAFEICEQTEFNVP
FT                   DFVIIPTSAGGNIRGIEKGFREFYKSGLIPHIPTIVAAQAEGCAPIARAYEKNSLTIER
FT                   FPNPHTVAHAIENPFPPSGNQVLRMLHRQRGVAVAVSEESIYESQLELAGMGLFVQPAS
FT                   AVSLAALKKLRQTGSISSEQRAACILTGSGLKYTAVFDAYNLNAEECLIDDLEKLLAVK
FT                   "
FT   gene            64277..65398
FT                   /locus_tag="Amico_0072"
FT   CDS_pept        64277..65398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0072"
FT                   /product="threonine synthase"
FT                   /note="KEGG: bja:bll7236 putative threonine synthase;
FT                   TIGRFAM: threonine synthase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56220"
FT                   /db_xref="GOA:D5ECD8"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECD8"
FT                   /inference="protein motif:TFAM:TIGR00260"
FT                   /protein_id="ADE56220.1"
FT                   /translation="MLLCERCHQQHEEDSKYWRCPCGGALLLHVDETRFPSQEALQSRP
FT                   SSLWRYKEALPLRDGTIPVSLGEGLTPLVPLPWKSGRVFFKLDYLCPTGSYKDRGVAYE
FT                   VTRLKELGISSIVEDSSGNAGAAMAAYAARAGIHCQIFVPEYTSAGKCVQIESYGAELV
FT                   RVPGSREDTTRAAEQAASHTYYASHNWSPYFVHGIKTYAFEIWEQLQCTAPHKIIVPAG
FT                   QGSLVLGCYLAFRHLLQSKIISRFPQIIAVQAKNCAPLYEAFIQRKEEPVQIEKQETIA
FT                   EGISSALPVRGREVLAAIRKTGGEMLAVDEEEIKRGFYDLAKAGLYVEPTSAVVAAALA
FT                   KLEGQGKLLTSETTVAFLSGSGLKATDKILHLK"
FT   gene            65516..66706
FT                   /locus_tag="Amico_0073"
FT   CDS_pept        65516..66706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0073"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   dma:DMR_38090 aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56221"
FT                   /db_xref="GOA:D5ECD9"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECD9"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADE56221.1"
FT                   /translation="MNKYIFAERMKNFQASDIAAILKVTADPEIISFAGGLPAPELFPI
FT                   DEMKEVVAYVLEKHGTKALQYSTTEGHVPLREKIASRMNRKYQTRLESDNIMITTGSQQ
FT                   SLDLLAKMFIDDGDVILCESPTYLGALSAFNGYNPRYVEVETDADGMVPEALEEALKRE
FT                   KRAKAVYVIPDFQNPTGKTWTFERRRAFMEVINRYNIVVFEDNPYGELRFKGVVPPSLK
FT                   SFDTKGQVVLLGTFSKIFCPGMRIAWLCAEGEIYEKFSYLKQAADLHSPTLSQYEIDTY
FT                   MEMYDLDAHVGRIIDVYKERCGIMIEAMRAELPPSVSYTVPEGGLFTWVVLPENLSARD
FT                   VLMTCIEKKVAFVPGGAFFPNGGHENTLRLNYSNMPPERIVQGIKLLGNAIKEHLR"
FT   gene            complement(66776..68122)
FT                   /locus_tag="Amico_0074"
FT   CDS_pept        complement(66776..68122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0074"
FT                   /product="Polyferredoxin-like protein"
FT                   /note="KEGG: gsu:GSU0126 iron-sulfur cluster-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56222"
FT                   /db_xref="GOA:D5ECE0"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECE0"
FT                   /inference="protein motif:COG:COG0348"
FT                   /protein_id="ADE56222.1"
FT                   /translation="MKSQKIRLAVQLAFLIFLSWIGYRHQLLGGGPEGVPPVDALCPFG
FT                   GIEGLYAYLKTGTWLRRLAPSSLVLFAGVVAMTVVVGRVFCSWICPLGTIGELSAKVAR
FT                   KLAITPRELPESVDRPARYLKYAILAIILFFTWKLGTLAWRNYDPWVAWMHLSAGWKEV
FT                   VEKPWAYIVLFGAVIAASLWIERFWCRYLCPLGALLALGQKLSLVKIRRNDSSCIHCHL
FT                   CHTSCPVNLNPEAKETENSAECIACGRCTDTCPVEKTLSFGTKKKFFSSLAVGIVGLLL
FT                   FFGFYGAARLSGKWMTYAPSTTEGVRNAASGIYGWMTLHQVSETVKLTEEEVIAITNLP
FT                   AGVPRDVSLKNIEGVDDEEIRALLEAYLEKQKTEIPSSPKTTPQNPEEIKGSMTLSSIA
FT                   ETYGLAAEKILAEAGWPMDAPKDKPLKELAAEYKTEVSVIREAVKKLLK"
FT   gene            complement(68251..68352)
FT                   /locus_tag="Amico_0075"
FT   CDS_pept        complement(68251..68352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56223"
FT                   /db_xref="GOA:D5ECE1"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECE1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56223.1"
FT                   /translation="MNALTMIWLVIGVGIIAAVLIIKKKRSDESTGD"
FT   gene            68599..69162
FT                   /locus_tag="Amico_0076"
FT   CDS_pept        68599..69162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0076"
FT                   /product="CMP/dCMP deaminase zinc-binding protein"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   dvl:Dvul_2895 CMP/dCMP deaminase, zinc- binding"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56224"
FT                   /db_xref="GOA:D5ECE2"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECE2"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ADE56224.1"
FT                   /translation="MDQEKVFWRMLDVIEDFIVPETRLAVPHGHKIFGAAIVRRSDLSL
FT                   VVAETNHEGWSPLWHGEVYTIKKFFELDDHPDPRECIFLSTHEPCSMCLSSIAWSGFPQ
FT                   IYFLFGYEQTRNAFNIPYDIQILNEVFNCPKPSRKNKFFESFSLQEMVLQLSEPDLAKA
FT                   RLEKLQRIYNELSDVYQAREKKRS"
FT   gene            69181..69867
FT                   /locus_tag="Amico_0077"
FT   CDS_pept        69181..69867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0077"
FT                   /product="L-serine dehydratase, iron-sulfur-dependent, beta
FT                   subunit"
FT                   /EC_number="4.3.1.17"
FT                   /note="TIGRFAM: L-serine dehydratase, iron-sulfur-
FT                   dependent, beta subunit; KEGG: psp:PSPPH_3461 L-serine
FT                   ammonia-lyase; PFAM: serine dehydratase beta chain; amino
FT                   acid- binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56225"
FT                   /db_xref="GOA:D5ECE3"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004643"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECE3"
FT                   /inference="protein motif:TFAM:TIGR00719"
FT                   /protein_id="ADE56225.1"
FT                   /translation="MALTDIIGPVMIGPSSSHTAGAARLGRLALACWGSDPLESVEIFL
FT                   RGSFAHTSYGHGTDRALIAGLLDMAPDDIRLRDALLIARERKFNYRFDAEEIDGAHPNS
FT                   ARFVFTGKDGRTLEVIGASIGGGAVELQQVDGFNVSVSGELPSLITFHQDTHGVVAAVT
FT                   RLFADMKINIATLSLYRKSKGGKASLVIELDLQSPPHRSVREAIEKAHPSIERVLPLYN
FT                   EGGNVS"
FT   gene            69864..70733
FT                   /locus_tag="Amico_0078"
FT   CDS_pept        69864..70733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0078"
FT                   /product="L-serine dehydratase, iron-sulfur-dependent,
FT                   alpha subunit"
FT                   /EC_number="4.3.1.17"
FT                   /note="TIGRFAM: L-serine dehydratase, iron-sulfur-
FT                   dependent, alpha subunit; KEGG: dde:Dde_3111 L-serine
FT                   ammonia-lyase; PFAM: serine dehydratase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56226"
FT                   /db_xref="GOA:D5ECE4"
FT                   /db_xref="InterPro:IPR004642"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECE4"
FT                   /inference="protein motif:TFAM:TIGR00718"
FT                   /protein_id="ADE56226.1"
FT                   /translation="MRSLAEVIALSLNQNSSFCQAALSKEELETGLSIEHIREGMKERL
FT                   TDMEKSVSDALSQKWDGKVVKSDFGKMNDYSQSQQSLSSEYILRASEIALAVATYNAAM
FT                   GRIVAAPTAGSCGILPGLLFAYKELFRPEEEALVDALIVAGSVGEVVASRATLAGAEGG
FT                   CQAECGAAVAMGAAALVALRGGTSEAIGHSVALTFKSILGLVCDPVGGLVESPCIKRNG
FT                   LLVSLAVLGADMALAGVESIIPADEVIDAMAQVGRAIPESLRETAQGGLAITPTARRLV
FT                   AEIFHERW"
FT   gene            70737..70916
FT                   /locus_tag="Amico_0079"
FT   CDS_pept        70737..70916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56227"
FT                   /db_xref="GOA:D5ECE5"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECE5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56227.1"
FT                   /translation="MQFFAKILAPIIVILCGVALLLISLRRFRAGQAGRAMLDIVWAIA
FT                   LFILAYMQYFYKSS"
FT   gene            70967..72496
FT                   /locus_tag="Amico_0080"
FT   CDS_pept        70967..72496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0080"
FT                   /product="YbaK/prolyl-tRNA synthetase associated region"
FT                   /note="PFAM: YbaK/prolyl-tRNA synthetase associated region;
FT                   Anticodon-binding domain protein; KEGG: ppd:Ppro_1753
FT                   prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56228"
FT                   /db_xref="GOA:D5ECE6"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECE6"
FT                   /inference="protein motif:PFAM:PF04073"
FT                   /protein_id="ADE56228.1"
FT                   /translation="MRMTTLLTPTLKKEPAGWQDPGAIRLLRGGYALDLHHGEWSLLPL
FT                   GALLRDNVAWTFIHAFMDGGFQQLEDLLYRKEGIQLLAQRVVQSYRDLPLRVMELRGGR
FT                   LLLSGIEASSSEECQKNLLYFIENLLENMALSGVKIEDATLGKEGAYIALHAEEEFAAS
FT                   SEGVECPSCGWHGTTHAHAGETKPFRTEEESSVQEVFTPGAESIDALCSYLEVSSEQTI
FT                   KTMFYMAEVNGVFQPVTVLIRGDRQISERKLLVSLGATEVRIAEEKELIEIMGQKPGFL
FT                   GPVGLPDKLLVIADSSVEGCKGVVTGANRPEYHLTGVTWGRDFKTERVADIALLEEGMD
FT                   CPHCGSALRKYLWNGVAAVWGEPEDALETLYQDQSGSSQKCALWKGWIHLDSIITALAR
FT                   QKTYPLGLAPFDVDIIVPSIKDETAMELATNLYHEMVHQGVVALFDDRNERAGAKFADF
FT                   ELFGIPAKVVVGRKAAEGIVEVQYGEEVKEMQACHVTCFLSSLLNDDDTQL"
FT   gene            72546..73394
FT                   /locus_tag="Amico_0081"
FT   CDS_pept        72546..73394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0081"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   KEGG: ppd:Ppro_3588 PpiC-type peptidyl-prolyl cis- trans
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56229"
FT                   /db_xref="GOA:D5ECE7"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECE7"
FT                   /inference="protein motif:PFAM:PF00639"
FT                   /protein_id="ADE56229.1"
FT                   /translation="MRKNVKLLIAMAIIATVVLSGVAGAKEVEKSDGDKVLAQVGDVEI
FT                   KGQDVEDVIKSLDPQQRMYYENEQGRKAILEELINLEVFVRWAQENDVEKDPIFIERLE
FT                   NIKREILRQVALEKMFGNVSVSEKEARDYYTAHVTDFMIPSQIRASHILVENEEEAKRI
FT                   REEIKTEKITFEDAAQKYSSCPSKAQKGDLGYFQSDQVVPEFSQAAGALKKGEISAPVK
FT                   SQYGWHIIRLEDKKPGSLQPFEEVKGQIETNLLREKRAQIYTDETERLRKQYGVKVFEN
FT                   K"
FT   gene            73492..74010
FT                   /locus_tag="Amico_0082"
FT   CDS_pept        73492..74010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0082"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dvm:DvMF_2297 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56230"
FT                   /db_xref="GOA:D5ECE8"
FT                   /db_xref="InterPro:IPR022930"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECE8"
FT                   /inference="similar to AA sequence:KEGG:DvMF_2297"
FT                   /protein_id="ADE56230.1"
FT                   /translation="MDLLGLVLIFSARILDVSLGTVRILFLVRGRRQLAAVTGFLEVMI
FT                   YMSVLGYILGGGASLTFPQLIAYASGYGAGNFVGSLLEEKLLRAFVTLEIILERNQETQ
FT                   AIIEQIREAGFGATVLVGKGRAGLRLVVKVICNRSDIRHILGLVDEKGFVCISDVKGCW
FT                   GGHFKIKGK"
FT   gene            74027..74305
FT                   /locus_tag="Amico_0083"
FT   CDS_pept        74027..74305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0083"
FT                   /product="protein of unknown function DUF997"
FT                   /note="PFAM: protein of unknown function DUF997; KEGG:
FT                   dvu:DVU0087 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56231"
FT                   /db_xref="GOA:D5ECE9"
FT                   /db_xref="InterPro:IPR010398"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECE9"
FT                   /inference="protein motif:PFAM:PF06196"
FT                   /protein_id="ADE56231.1"
FT                   /translation="MKKKERFGQAHKEALISLGLYGVFFAWWYGAAYGLGSGDPSSYTY
FT                   IWGMPSWFFYSCIVGYVVISFLVWAVVRFFFKEIPLDEPSKEEGSEL"
FT   gene            74305..75780
FT                   /locus_tag="Amico_0084"
FT   CDS_pept        74305..75780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0084"
FT                   /product="sodium/pantothenate symporter"
FT                   /note="KEGG: dde:Dde_3321 sodium/panthothenate symporter;
FT                   TIGRFAM: sodium/pantothenate symporter; SSS sodium solute
FT                   transporter superfamily; PFAM: Na+/solute symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56232"
FT                   /db_xref="GOA:D5ECF0"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR011849"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECF0"
FT                   /inference="protein motif:TFAM:TIGR02119"
FT                   /protein_id="ADE56232.1"
FT                   /translation="MEQRVSMILPLVLYLGGVMAIALWSQRIGKKSRDTKSFIEEYFLG
FT                   SRSMGGFVLAMAIITTYTSASSFVGGPGVAYKMGLGWILLAMIQVPTAFLTLGVLGKKF
FT                   AIIARRIQAVTVTEFLRVRYRNDLVVILSSIALLIFFMASMLAQFIGGARLFQSITGYP
FT                   YLIGLIIFGITVILYTTVGGFRAVVLTDTIQGSMMVVASIALLWSVVHAGGGMTAVMTR
FT                   LYEIDPALITPFGPDNFISKPFILSFWVLVGFAILGLPQTTVKCMGYKDSRSMHNAMII
FT                   GTFIVGFLMLCMHMVGALGRAVIPDIQVGDLAVPTLTIKLLSPFWAGVFIAGPLAAIMS
FT                   TVDSMLILASAAIIKDLYLNYLCKDPEKVNPAALGRMSFISTGILGILVFIAALKPPSL
FT                   LVWINLFAFGGLEAVFLWPTILGLYWKRANAVGALCSIIAGCGAFFYFTITKVTWMGTH
FT                   QIVPTILVGLIAFIIGAYAGKRPDDETIRIFWE"
FT   gene            76008..76787
FT                   /locus_tag="Amico_0085"
FT   CDS_pept        76008..76787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0085"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="KEGG: ent:Ent638_2397 regulatory protein, IclR;
FT                   PFAM: Transcriptional regulator IclR ; regulatory protein
FT                   IclR; SMART: regulatory protein IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56233"
FT                   /db_xref="GOA:D5ECF1"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECF1"
FT                   /inference="protein motif:PFAM:PF01614"
FT                   /protein_id="ADE56233.1"
FT                   /translation="MAGARKNPGYVQSIERAMSIIEVLDEHGELGISEISDELGLEPST
FT                   VHRIVSTLKGLGYVNQNRENHKYSNSFKLFEIGNNVVKALGLKKQAMPFMRELSDKTNE
FT                   AVNLAVMDGKYVIYIDKIESQSTIRVDLSVGKRMPTYCTGLGKIMLAYMPETKVRELLE
FT                   DEPFARFTKNTVPDLETLFQHLARIRKQGYCIDNEEYIEGLFCVAAPVWGHSGEVLAAL
FT                   SVAVPKFLYADTERLFAIRDLVIDVAKRFSTTLGYKS"
FT   gene            76845..77669
FT                   /locus_tag="Amico_0086"
FT   CDS_pept        76845..77669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0086"
FT                   /product="3-methyl-2-oxobutanoatehydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="TIGRFAM: 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase; KEGG: dps:DP2907
FT                   3-methyl-2-oxobutanoate hydroxymethyltransferase; PFAM:
FT                   Ketopantoate hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56234"
FT                   /db_xref="GOA:D5ECF2"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECF2"
FT                   /inference="protein motif:TFAM:TIGR00222"
FT                   /protein_id="ADE56234.1"
FT                   /translation="MAKVTIQKLKEMKQKGEKISMVTAYDYAQAVLVEKSGIEIILVGD
FT                   SLAMTMLGNEGTVQLTTDEMIAHIKPVVKGAPTPMIVGDMVFGSYNESISQAIRSANRL
FT                   MKEGGCDVIKLEGGRPEVVSAIVEAGIPVQGHIGLTPQTASMLGGFKVQGKSLEAAQRI
FT                   IDEAKALEEAGAFSIVVECVPEELGRAITEAVSIPIIGIGAGRYCDGQVLVFHDMLGLF
FT                   DKFLPKFVKQYAQIGDEIVKSLSTYKEEVRQGAFPEEKHTFGGLSREDLKDL"
FT   gene            77691..78617
FT                   /locus_tag="Amico_0087"
FT   CDS_pept        77691..78617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0087"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="TIGRFAM: 2-dehydropantoate 2-reductase; KEGG:
FT                   sfu:Sfum_2753 2-dehydropantoate 2-reductase; PFAM:
FT                   Ketopantoate reductase ApbA/PanE domain protein;
FT                   NAD-dependent glycerol-3-phosphate dehydrogenase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56235"
FT                   /db_xref="GOA:D5ECF3"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECF3"
FT                   /inference="protein motif:TFAM:TIGR00745"
FT                   /protein_id="ADE56235.1"
FT                   /translation="MKIAVLGSGAMGCLYGGKLAEAGYDVTLIDVWKDHIDSINNRGLH
FT                   IEGIEGERTVRSIRAVSSAGEAGPCDLLIVFVKATLTAQAVESARGIIGERTSILTLQN
FT                   GLGNVEKISAVVGEEKVIAGVTGHGSTLLGPGKIRHAGQGVTVIGELNGAVDERLRCIG
FT                   AVLEKGGFDVKLSQNVMGLIWGKLLVNIGINALTAITGLKNGRLVDFSETEELLRSAVE
FT                   EAVAVAKGKGVILEGEDPVEHARNVARLTATNRSSMLQDVSNKRKTEIDVINGAIVQEG
FT                   KRLGIPTPVNKVLYNLVSVKEKTYEEV"
FT   gene            78631..79635
FT                   /locus_tag="Amico_0088"
FT   CDS_pept        78631..79635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0088"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /note="KEGG: pol:Bpro_0088 TRAP dicarboxylate transporter,
FT                   DctP subunit; TIGRFAM: TRAP dicarboxylate transporter, DctP
FT                   subunit; PFAM: Extracellular solute-binding protein, family
FT                   7, bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56236"
FT                   /db_xref="GOA:D5ECF4"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECF4"
FT                   /inference="protein motif:TFAM:TIGR00787"
FT                   /protein_id="ADE56236.1"
FT                   /translation="MKQLKKKSLMIAGLLLCALVLGTVAQPVWAAKYTFKLGHAVSDQH
FT                   PYHLGAVRFKEVVEKETNGEVEINLFPNNQLGTGERDLIEGLQLGTVDLVVSSTGPMSG
FT                   FEKKFMIFDFPFLFKDKAQAYATLDGEIGQYIMGLLEKQGIKGLAWYENGFRHLTNSKR
FT                   PVNMPADAQGLKLRTMENKVQMAIWRAVKADPTPMAWGEVFTALQQGTVDGQENPIPII
FT                   YTQKIYEVQKYVSLTGHVFSPSMIVMGKAKFDKLPKEYQELFLKAAQESAVYEREQITK
FT                   MEEEQVEELKKLGMEINTPDKDAFREATKSVYDEFRGELGEDAKLLDQILAEN"
FT   gene            79725..80204
FT                   /locus_tag="Amico_0089"
FT   CDS_pept        79725..80204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0089"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter DctQ component"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter DctQ component; KEGG: dal:Dalk_0472 tripartite
FT                   ATP-independent periplasmic transporter DctQ component"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56237"
FT                   /db_xref="GOA:D5ECF5"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECF5"
FT                   /inference="protein motif:PFAM:PF04290"
FT                   /protein_id="ADE56237.1"
FT                   /translation="MEKILNGVNRIVEYIVSFLLIVMVIVVFLQVIFRFVLHSSLPWSE
FT                   EVSRYILIWISFLGASIGVKRGAHIGVEVVTNILPSKIKKVVAFLATLFATVFFAIMVV
FT                   YGHRILGIVSSQLSPAMEISMGIPYSAIFISGVLMFVYSVEQALAIVTGRKGEAR"
FT   gene            80201..81481
FT                   /locus_tag="Amico_0090"
FT   CDS_pept        80201..81481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0090"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="KEGG: tmz:Tmz1t_0543 TRAP dicarboxylate transporter,
FT                   DctM subunit; TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; Citrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56238"
FT                   /db_xref="GOA:D5ECF6"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECF6"
FT                   /inference="protein motif:TFAM:TIGR00786"
FT                   /protein_id="ADE56238.1"
FT                   /translation="MTAVLFASLFLFFVINVPIAIAIGLASVAAILFSGSIPPIVVVQK
FT                   MFTAADSFPLMAVPFFILAGSLMEFGGISRRLVEFANSIVGRFSGGLAFVAIMASMFFG
FT                   AISGAAVATVAAIGTILIPAMVRRGYDKPFATAVQATAGTLGVMIPPSIPMIIYGVLTG
FT                   VSIGALFMGGILPGILVGLSLMFVAWLISRKKGYRGDEKSSLNRIWQTFKQAILALMMP
FT                   VIILGGIYGGVFTPTEAAVVAVVYGFVVGFFIYRELNLSQLKDILVTTVVGTSMIMFII
FT                   ATSSVFSWILTAEQIPQVVANAILSISKNPIIILALINLLLLFLGTFMETVAAIIILVP
FT                   VLLPVITQIGVDPLHFGIVLVVNLAIGMVTPPLGVCLFIGCSIADITLEDITRAVWPFI
FT                   LIMIADVLLLTYLPWISTILPRLTGLY"
FT   gene            81584..81682
FT                   /locus_tag="Amico_0091"
FT   CDS_pept        81584..81682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56239"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECF7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56239.1"
FT                   /translation="MKLMKNLAVQSLVALLIVLIISSGSPPGVIGI"
FT   gene            81803..81943
FT                   /locus_tag="Amico_0092"
FT   CDS_pept        81803..81943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0092"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56240"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECF8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56240.1"
FT                   /translation="MVKMGKKGKVQSEKKAVVYEAVDSIEMFNLEGLLEVRWRGPFEGY
FT                   R"
FT   gene            82112..83494
FT                   /locus_tag="Amico_0093"
FT   CDS_pept        82112..83494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0093"
FT                   /product="glucose-inhibited division protein A"
FT                   /note="PFAM: glucose-inhibited division protein A; FAD
FT                   dependent oxidoreductase; KEGG: sat:SYN_02917 FAD-dependent
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56241"
FT                   /db_xref="InterPro:IPR028348"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECF9"
FT                   /inference="protein motif:PFAM:PF01134"
FT                   /protein_id="ADE56241.1"
FT                   /translation="MKYDVIIVGSGPAGVFAAMELVKSDKKVLILDKGKLIKERKCPIL
FT                   EGLSPVCVNCNSCNIVSGWGGAGTASDGKLTLTTGFGGNLEECIGEDALENMIRYVDDT
FT                   FVSFGADKKYYEPTGEIVKDTIQKAASRGIKIIPARIRHIGTDASRMVLNNMYEELKEK
FT                   CDILMNTEVKEVVVHSGVVEGVVLKDGQEINSEYVILAPGREGSSWLEGIVNKYNLPIA
FT                   SMPVDIGVRVEVSDSICQDLTKHFYEVKCLYNTPTFDDRCRTFCMNPSGFVVHEYNKAH
FT                   DLVTVNGHSLKNVKSKNTNFAILVTKNFTQPFNDPIGYATHIAKLANMLAGGGILLQRL
FT                   GDLRDGRRSTEARITRGMVKPTAQAQPGDLSLVLPHRFLIDVVEFIEALNIIMPGINMN
FT                   DTLLYGVEIKLYSLRLELKETLETPAIRNLYMAGDGAGVSRGIIQAASSGVVAARSILY
FT                   QG"
FT   gene            complement(83507..84076)
FT                   /locus_tag="Amico_0094"
FT   CDS_pept        complement(83507..84076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0094"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: har:HEAR2542 putative
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56242"
FT                   /db_xref="GOA:D5ECG0"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECG0"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ADE56242.1"
FT                   /translation="MNLVIETIKNRRSIRRYLPLQINDEELSLIVEAGTWAPSGHNNQP
FT                   WHFSVIQNKELIDMISDKTVALMKKYSVEWIRKMGEKEGYHIYYHAPAIIVISGKKNAD
FT                   SLLKPIADCSAAIENMLIAAESLNIGTCWIGFSGFFFAVATPEELKAIGVPEGYEALYS
FT                   IALGYKDPAHKYGAPKRKEGVVTYIR"
FT   gene            84200..85216
FT                   /locus_tag="Amico_0095"
FT   CDS_pept        84200..85216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0095"
FT                   /product="dihydroorotate dehydrogenase 2"
FT                   /note="KEGG: afw:Anae109_0808 dihydroorotate dehydrogenase
FT                   2"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56243"
FT                   /db_xref="GOA:D5ECG1"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECG1"
FT                   /inference="similar to AA sequence:KEGG:Anae109_0808"
FT                   /protein_id="ADE56243.1"
FT                   /translation="MTVDFSAVYMGVELKNPVIVGASGITSNLETIRQVEDAGAGGMVI
FT                   KSLFEEQIALEALALEHELTDDDERHAEMIALHPGIAHGGPEEHLMWVKKVVKGARIPI
FT                   FASLNAGQKSVWVEWAEKLSQTGVQGLELNLYIMPVDSHLSGEDIEKKQFAMVEEVLRV
FT                   VSIPVAVKISPYYTNPLHVVSTFDKIGVKGHVLFNSFFNPDIDPDKQMEVRDITMSHET
FT                   DSRLPLRFMALLYGAVEGSLCANRGIFSGRDVVKMLLAGADCVQVVSTLYKNGINSLKT
FT                   MIEDIEQWMDKNGYEILDEFKGKLSKKRAHDPYAWERAQYVDILMRHESPFLSRPEI"
FT   gene            complement(85282..86208)
FT                   /locus_tag="Amico_0096"
FT   CDS_pept        complement(85282..86208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0096"
FT                   /product="cysteine synthase"
FT                   /note="KEGG: gur:Gura_3859 cysteine synthase A; TIGRFAM:
FT                   cysteine synthase; cysteine synthase A; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56244"
FT                   /db_xref="GOA:D5ECG2"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECG2"
FT                   /inference="protein motif:TFAM:TIGR01136"
FT                   /protein_id="ADE56244.1"
FT                   /translation="MTFKTDRIALRKRIGRTPLFVFRPSNQGAAIAIKLEGTNIGGSVK
FT                   DRAAWGMLRHAEEKGLLRDETVIVEPTSGNTGIALAMLGQALGLKVILTMPESMSQERR
FT                   SVLAAYGAELHLSPAKEGMRGAIALARHILDETPGAYMPDQFSNPGNSWAHSVTTAPEI
FT                   LTDMEGLPISAFVAGIGSGGTISGTGAVLKAVWPAIHIVGVEPAGSPVLSGGEAGPHKI
FT                   QGIGAGFAPAVLKKEILTEIKTVEDDAALETTRWLARTHGLFCGISTGANVWAAIQTAK
FT                   QFTPDDTVVTIACDRGDKYLSTEAFKN"
FT   gene            complement(86210..86875)
FT                   /locus_tag="Amico_0097"
FT   CDS_pept        complement(86210..86875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0097"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="KEGG: avn:Avin_40420 serine O-acetyltransferase;
FT                   TIGRFAM: serine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56245"
FT                   /db_xref="GOA:D5ECG3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECG3"
FT                   /inference="protein motif:TFAM:TIGR01172"
FT                   /protein_id="ADE56245.1"
FT                   /translation="MKIFVSSILDVWNTVKADVRAVGDNDPAFKGGIWGWLEVVFCYPG
FT                   LHAILAHRIIHFLHATLHIPFLPRLLSHVMRWLTGIEIHPGAKIGKRFFIDHGMGIVIG
FT                   ETAEIGNNVKLFHGVTLGGTGKERGKRHPTVHDNVMIGAGAKLLGNITVGEGAKIGAGA
FT                   VVVRNVEAGSTVVGIPANVRIKHHDQRTSLSSKVLLDRIEMLEQELEILKNYLKKEAA"
FT   gene            complement(87217..88350)
FT                   /locus_tag="Amico_0098"
FT   CDS_pept        complement(87217..88350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0098"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="KEGG: dol:Dole_2219 3-isopropylmalate dehydrogenase;
FT                   PFAM: isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56246"
FT                   /db_xref="GOA:D5ECG4"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECG4"
FT                   /inference="protein motif:PRIAM:1.1.1.85"
FT                   /protein_id="ADE56246.1"
FT                   /translation="MSFKRYSIARIAGDGIGPEVIGEASKILEATGNKWNFAIEWVDYP
FT                   FGADYYLRTGETLPSSAIEEMASCHALFLGAVGDPRVKPGILERGILLNLRFHFDQYVN
FT                   LRPAKSYPKVPLPIEIKGGKTLDTLVVRENTEDFYIGIGGKTEAGHIDLDLAAKRKLYS
FT                   IHGKLTGDFEGKIEGAFQLGIASEPGIRRVTAYACEAAKSRGEEVITLVSKSNALPQIY
FT                   GFWENMAKDEAQQHGVEVSVINVDAMCYHLVRRPDLYNVILAPNMFGDIVSDLLAGLTG
FT                   GLGVAAGADIGDSLSMFEPIHGSAPDIAGTKKANPLAAILSGALLLDHLGEKGAAASIE
FT                   KAVCDFLKGTEVKRMPIEFGGEGTASSVGEDILARLH"
FT   gene            complement(88347..88862)
FT                   /locus_tag="Amico_0099"
FT   CDS_pept        complement(88347..88862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0099"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /note="KEGG: sfu:Sfum_3030 3-isopropylmalate dehydratase,
FT                   small subunit; TIGRFAM: 3-isopropylmalate dehydratase,
FT                   small subunit; PFAM: aconitate hydratase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56247"
FT                   /db_xref="GOA:D5ECG5"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR011827"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECG5"
FT                   /inference="protein motif:TFAM:TIGR02087"
FT                   /protein_id="ADE56247.1"
FT                   /translation="MSHTIKGKAWAYGNHIDTDVIIPARYLTSSNEKELGKHCMEDIDV
FT                   DFYKRVNSGDMIVAKENFGCGSSREHAPLAIKGAGCSCVIAASFARIFFRNAINVGLPI
FT                   FECPEAADSIETGDEIEINTETGTIENRTKGKVFSVTPFSPFLQELIERGGLVPYVKEQ
FT                   LRSERVEK"
FT   gene            complement(88865..90154)
FT                   /locus_tag="Amico_0100"
FT   CDS_pept        complement(88865..90154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0100"
FT                   /product="homoaconitate hydratase family protein"
FT                   /note="KEGG: sfu:Sfum_3029 3-isopropylmalate dehydratase,
FT                   large subunit; TIGRFAM: homoaconitate hydratase family
FT                   protein; 3- isopropylmalate dehydratase; PFAM: aconitate
FT                   hydratase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56248"
FT                   /db_xref="GOA:D5ECG6"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006251"
FT                   /db_xref="InterPro:IPR011826"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECG6"
FT                   /inference="protein motif:TFAM:TIGR01343"
FT                   /protein_id="ADE56248.1"
FT                   /translation="MARTLVSTIIAAHSTGSPQEGEICKVRVDFAFANDITTPPAIQSF
FT                   KAMGAEKVFDPLRCAVLPDHFTPNKDIASAEQAKKGKEFAQSQKMLYWEVGRVGVEHAF
FT                   LPEQGYILPGDIVTGADSHTCTGGALGALSTGMGSTDLAAVWALGETWLRVPPTLRVDF
FT                   VGERPGWVTGKDMILALLGRIGVQGARYMALEFGGEALSCLPMDDRFTIANMAVEAGGK
FT                   AGIFVPDQTMLEYASKRASRRFTPLYPHAQASYLRRETIDVTNMEPVVALPHSPDNVKA
FT                   VRACRPFHIHQVFIGSCTNGRFRDIEMAALLLEGKKVADNVRCIVIPASYEVYNQALEK
FT                   GYIKIFADAGAVVCTPTCGPCLGGHMGILANGERCISTSNRNFVGRMGHSKSELILASP
FT                   LVAAASAVTGKLTDPRDIATHEFFTRLEGK"
FT   gene            complement(90135..91688)
FT                   /locus_tag="Amico_0101"
FT   CDS_pept        complement(90135..91688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0101"
FT                   /product="2-isopropylmalate synthase"
FT                   /note="KEGG: eba:ebA7154 2-isopropylmalate synthase;
FT                   TIGRFAM: 2-isopropylmalate synthase; PFAM: pyruvate
FT                   carboxyltransferase; LeuA allosteric (dimerisation) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56249"
FT                   /db_xref="GOA:D5ECG7"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECG7"
FT                   /inference="protein motif:TFAM:TIGR00973"
FT                   /protein_id="ADE56249.1"
FT                   /translation="MNVQEQIRIFDTTLRDGEQAAGINLNKDEKLQIALQLEKMRVHVI
FT                   EAGFPAASSGDFEAVKCIANQVSTSIVAGLARTKREDIGEAYEALKNAARPMIHTFIAT
FT                   SPIHMEYKLRMTPEEVLNEVRQGVSYARSLMERVEFSAEDASRSEPAFLAEVFRTAAEC
FT                   GATTLNIPDTVGYAEPGEFETFVKNVIAATGIQNVIWSVHCHNDLGLAVANSLAAIKAG
FT                   ARQVECTINGLGERAGNTSLEEIVMALRTRKDRFRYETGLDTKRLWAVSSLVSRMTGFA
FT                   VPPNKAVVGANAFAHEAGIHQHGVLCNKATYEIMNPEDVGAPGSRLVLGKHSGKHAFKK
FT                   QVEDLGFSLSEDRLTEAMALFKHLCDRKEIITSEDIEAMITNEILAGPATKRIVLKNFH
FT                   VHVGKGWGSAAISLEDGGQEFSDAATGNGPVDAAYSAIQRIIGFRPKLEHYSIRSVTEA
FT                   SDAIGEARITLQFEGLVVNGRGASTDVIDASIKAYIDGINHLFQKAVTKGVSIYGKNAG
FT                   "
FT   gene            complement(91795..91893)
FT                   /locus_tag="Amico_0102"
FT   CDS_pept        complement(91795..91893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56250"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECG8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56250.1"
FT                   /translation="MKERYENKNMHAVSSLSLLLGCWFLPGTPAAL"
FT   gene            complement(91983..93191)
FT                   /locus_tag="Amico_0103"
FT   CDS_pept        complement(91983..93191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0103"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; Protein of unknown
FT                   function methylase putative; KEGG: glo:Glov_1090 protein of
FT                   unknown function Met10"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56251"
FT                   /db_xref="GOA:D5ECG9"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041532"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECG9"
FT                   /inference="protein motif:PFAM:PF05175"
FT                   /protein_id="ADE56251.1"
FT                   /translation="MVKNPMNKIKGAIVNKTGLERLNKKHPWIFKGHLASSPLAEPGDL
FT                   VSLHNNRGRIEGWGFWSAGSLCTRVLAFGSQKPDIQRLLAFRLEKSLAFRKRWLSKAEA
FT                   FRLVHSESDGLPGLIVDIYGPIASVQLLSAGWYKHRSMVVDSLLALLPLEGVVLRNDVR
FT                   YLEQEGIPREIRLLWGKLPPQNCIDISFGEIKERVYPLAGQKTGLYLDVRNLPFLFKNI
FT                   SSEADVLDCFCFQGHFGLHALHWGARSVTAVEQSEEALAVYRENLQMNGLSSKDVDLRH
FT                   GNAFDELRRLEGEKKLYDIIIMDPPPFSPGKAQIESARRGYKELALRAYRLLRPEGVLL
FT                   YLCCSHAFSRQMLIEVLRDAAVDRRQAFRIVREGYQPEDHPIALEIPETNYLKGLLVQG
FT                   VEE"
FT   gene            complement(93253..93978)
FT                   /locus_tag="Amico_0104"
FT   CDS_pept        complement(93253..93978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0104"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   bur:Bcep18194_B0495 lytic transglycosylase, catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56252"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECH0"
FT                   /inference="protein motif:PFAM:PF01464"
FT                   /protein_id="ADE56252.1"
FT                   /translation="MRKSIQKMVLTVLLLSMAGLIAFTAGNRYIHFMPRNRKETIQSQK
FT                   IQLHDWVSEPAAASFYQIGRFVTNHFSEVLSKHSTPFISLSHTIQDSIKTMNMLTHFIQ
FT                   KQNPAIPRDVAAQEAAAFMRYSTKYGAPLDLVVAVANTESHFNPDARSSYGAAGVMQVT
FT                   WRIHENLLRANGIHSEKELYTADKGIAAGCLLISRYLRAYGSPEKALGRYYGGSASVYW
FT                   GRVSKNLSKLQRYRPKNHL"
FT   gene            94296..95618
FT                   /locus_tag="Amico_0105"
FT   CDS_pept        94296..95618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0105"
FT                   /product="electron transport complex, RnfABCDGE type, C
FT                   subunit"
FT                   /note="KEGG: sat:SYN_01664 electron transport complex
FT                   protein, NADH-binding subunit; TIGRFAM: electron transport
FT                   complex, RnfABCDGE type, C subunit; PFAM: Respiratory-chain
FT                   NADH dehydrogenase domain 51 kDa subunit; Soluble ligand
FT                   binding domain; 4Fe-4S ferredoxin iron-sulfur binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56253"
FT                   /db_xref="GOA:D5ECH1"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR010208"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR026902"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECH1"
FT                   /inference="protein motif:TFAM:TIGR01945"
FT                   /protein_id="ADE56253.1"
FT                   /translation="MRLLTFRGGAHPPDNKHWTSEKPIEDLWPMGDFVYPMGQHIGAPC
FT                   KPVVEKGDRVLVGQKIGEPQGPVSAAVYSSVSGTVKNIAELPTPPGMDVMSVVIENDGL
FT                   YEEAGPLMSRSFEDLAPDELRAIIKDAGIVGMGGACFPAHIKLTPPADRPIDHVIINGA
FT                   ECEPYLTSDYRMMLEEPDKIAEGARILLQIFPQAHLHMAIEDNKPEAIRKMTEAFKGID
FT                   RASVDVLKTKYPQGGEKQLIFAVAGREVPSGKLPADAGCVVTNTYTVYEIRNAVVTGRT
FT                   SLSRIVTVSGDAVATPKNLRVRLGTSFREVIEAAGGFVTPPIKVLAGGPMMGMSINSLD
FT                   VPVVKGTSGIIALSEKAAPLNEEYSCIRCGRCVEACPMGLLPFKLNALSLKSDYTGFKN
FT                   NGGMNCIECGSCSFMCPSKRHLVQSCREAKRSVIAAMKRKG"
FT   gene            95627..96562
FT                   /locus_tag="Amico_0106"
FT   CDS_pept        95627..96562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0106"
FT                   /product="electron transport complex, RnfABCDGE type, D
FT                   subunit"
FT                   /note="KEGG: pca:Pcar_0262 NADH:ubiquinone oxidoreductase,
FT                   RnfD subunit-like; TIGRFAM: electron transport complex,
FT                   RnfABCDGE type, D subunit; PFAM: NQR2 and RnfD family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56254"
FT                   /db_xref="GOA:D5ECH2"
FT                   /db_xref="InterPro:IPR004338"
FT                   /db_xref="InterPro:IPR011303"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECH2"
FT                   /inference="protein motif:TFAM:TIGR01946"
FT                   /protein_id="ADE56254.1"
FT                   /translation="MTEKKLVVASSPHFRAHATVQTIMGDVLIALAPALAAALYFFGFK
FT                   AFTVIAVCVLASVISEAAWQKLMGHPQTIKDLSAVVTGLLLAFNLPPTVPLWLAAFGSI
FT                   FAIIVVKHFFGGIGQNIVNPALAARAMLLASWPVAMTTWAVDGMTTATPLALLKEGAVA
FT                   ILPTFSDVFIGHVGGCLGETSALALLLGGAYLLWRKVISWHIPVIYISTVFVLTALLGR
FT                   EGWMTGNPLYEIFLGGLMVGAFFMATDYTTSPMTKKGQVIFASGCGILTTLIRLYGGYA
FT                   EGVSYSILIMNLFVPLIDKVTVPRIFGEVR"
FT   gene            96565..97134
FT                   /locus_tag="Amico_0107"
FT   CDS_pept        96565..97134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0107"
FT                   /product="electron transport complex, RnfABCDGE type, G
FT                   subunit"
FT                   /note="KEGG: pca:Pcar_0261 NADH:ubiquinone oxidoreductase,
FT                   RnfG subunit-like; TIGRFAM: electron transport complex,
FT                   RnfABCDGE type, G subunit; PFAM: FMN-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56255"
FT                   /db_xref="GOA:D5ECH3"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR010209"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECH3"
FT                   /inference="protein motif:TFAM:TIGR01947"
FT                   /protein_id="ADE56255.1"
FT                   /translation="MKNICKLGVILFIITASAGFLLGGIHGVTEEPIARLLEKEKLDAM
FT                   RSTLPTAEEFKRISPIISAQSIIHEVNAGYSNGKIVGYNIKISPKGYGGVIDMMVGVSI
FT                   DGTLRGIQILSHAETPGLGAEAGKPAFSNQFVDRQGEGIALVKGKPSKDNEIQALTGAT
FT                   ITSKAVTDGVNEALAFFRSSLKGEGA"
FT   gene            97134..97766
FT                   /locus_tag="Amico_0108"
FT   CDS_pept        97134..97766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0108"
FT                   /product="electron transport complex, RnfABCDGE type, E
FT                   subunit"
FT                   /note="KEGG: pca:Pcar_0260 SoxR-reducing system protein
FT                   RsxE; TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   E subunit; PFAM: RnfA-Nqr electron transport subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56256"
FT                   /db_xref="GOA:D5ECH4"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR010968"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECH4"
FT                   /inference="protein motif:TFAM:TIGR01948"
FT                   /protein_id="ADE56256.1"
FT                   /translation="MGMVLERLKNGIIKNNPIFVQVIGMCPTLAVTTSAENGLAMGLAA
FT                   TVVLMGSNMAISALKRFIPDEVRIPAFIIIIATFVTLIQFFMQAFLPGLNKALGIFIPL
FT                   IVVNCIILGRAEAHASKNSVVSSLFDAIGMGLGFTLALVVLGSIRELLGSGSLFGAQLL
FT                   PAGYSPALIMILAPGGFLTLGILMALINYINTRRKKENKRISHFADA"
FT   gene            97793..98371
FT                   /locus_tag="Amico_0109"
FT   CDS_pept        97793..98371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0109"
FT                   /product="electron transport complex, RnfABCDGE type, A
FT                   subunit"
FT                   /note="KEGG: pca:Pcar_0265 NADH:ubiquinone oxidoreductase,
FT                   RnfA subunit-like; TIGRFAM: electron transport complex,
FT                   RnfABCDGE type, A subunit; PFAM: RnfA-Nqr electron
FT                   transport subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56257"
FT                   /db_xref="GOA:D5ECH5"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR011293"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECH5"
FT                   /inference="protein motif:TFAM:TIGR01943"
FT                   /protein_id="ADE56257.1"
FT                   /translation="MSFFAIFIDAFLVHNIVLSRFLGICAFLGVSNSVATAVGMGLAVV
FT                   FVTTFSSLMTWIVYNLILVPLGITYLYTLAFILVIAALVQFVEMVVRKKWESLYWALGI
FT                   YLPLITTNCAVLGVAVINMNEGYTLLQAIAHSLGASLGFLLAIVLMSGLRERFQDNTNM
FT                   PKALRGLPISLVTAALMSIAFLGFNGLFS"
FT   gene            98386..99186
FT                   /locus_tag="Amico_0110"
FT   CDS_pept        98386..99186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0110"
FT                   /product="electron transport complex, RnfABCDGE type, B
FT                   subunit"
FT                   /note="KEGG: pca:Pcar_0264 ferredoxin; TIGRFAM: electron
FT                   transport complex, RnfABCDGE type, B subunit; PFAM: Fe-S
FT                   cluster domain protein; 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56258"
FT                   /db_xref="GOA:D5ECH6"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR010207"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECH6"
FT                   /inference="protein motif:TFAM:TIGR01944"
FT                   /protein_id="ADE56258.1"
FT                   /translation="MINSLIYPALSLGGLGLFFGLLLGFSARKFAVQVDPRIARIKDAL
FT                   PGGNCGGCGYAGCDAYASAVVSGQAAPNKCTAGGAETAEKIAAILGVDAGSFVQKVAFV
FT                   KCAGSRAKAKEISLYEGVLDCRKATVVPGGGTKACKNGCLGFGSCVTACAFDAISVEDG
FT                   VAVVDESLCTGCGACVAACPRDVITLIPADQAMRVLCNSTKKGAGVKNICAVGCIGCGL
FT                   CAKLCPSQAITMKDNLPVINPDLCTGCKICAMKCPARAIVIVEG"
FT   gene            complement(99239..99748)
FT                   /locus_tag="Amico_0111"
FT   CDS_pept        complement(99239..99748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0111"
FT                   /product="Heptaprenyl diphosphate synthase component I"
FT                   /note="PFAM: Heptaprenyl diphosphate synthase component I;
FT                   KEGG: pca:Pcar_0037 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56259"
FT                   /db_xref="GOA:D5ECH7"
FT                   /db_xref="InterPro:IPR010898"
FT                   /db_xref="InterPro:IPR014535"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECH7"
FT                   /inference="protein motif:PFAM:PF07456"
FT                   /protein_id="ADE56259.1"
FT                   /translation="MLRAKLKAMIVIGLLVGLALTIHVAEAQIPMVFPGIKLGLANIIT
FT                   LMALDLYGWKEALMVTLLRVGLGAFFTGNAISFLCSFTGGLLSCLVMIELHRRFKESVT
FT                   LPYISIAGAISHNIGQLIVIVLIIQNLYVFLYLPVLLVSGVITGYGTGFLASLLSSRIK
FT                   QVPGIL"
FT   gene            complement(99764..100147)
FT                   /locus_tag="Amico_0112"
FT   CDS_pept        complement(99764..100147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0112"
FT                   /product="protein of unknown function DUF1312"
FT                   /note="PFAM: protein of unknown function DUF1312; KEGG:
FT                   dar:Daro_0069 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56260"
FT                   /db_xref="InterPro:IPR024045"
FT                   /db_xref="InterPro:IPR038690"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECH8"
FT                   /inference="protein motif:PFAM:PF07009"
FT                   /protein_id="ADE56260.1"
FT                   /translation="MKKGNKIILTAVLFLLVLSSAGNLLYRSHLNKNKPVALVEQNGEK
FT                   LREISLKDILASEDWVIHKGEEQSVIRIEPGRIRFLEATCPHQQCVKTGWLSRPGETAV
FT                   CLPYKLSITIIGPAGEGPDALSH"
FT   gene            complement(100131..101168)
FT                   /locus_tag="Amico_0113"
FT   CDS_pept        complement(100131..101168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0113"
FT                   /product="ApbE family lipoprotein"
FT                   /note="PFAM: ApbE family lipoprotein; KEGG: eca:ECA1970
FT                   putative thiamine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56261"
FT                   /db_xref="GOA:D5ECH9"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECH9"
FT                   /inference="protein motif:PFAM:PF02424"
FT                   /protein_id="ADE56261.1"
FT                   /translation="MKKVFLAVILGIILFLAIFFMKSVKRPHPLEQTSYALGTILHFQI
FT                   WGKDANQALEKALSRIHDIEVHMSTHDPNSDIYKVNVSSGSSFVPVHEDTFYVVEKAID
FT                   YAYKSSGTFEPTIGGLVNLWGIGTPEERLPSEEEIANAVSLIGYEEVQLDRKNMSIRLP
FT                   RSGQHLDLGGIAKGYAADEVVAILKRKGIKSALVDLGGNIFVLGTKPDSTLWNVGVQNP
FT                   LEPRGQYLGVLRVSNKSVVTSGNYERFFEKDGKRYHHIFDPATGYPAESGLLSVTILSD
FT                   RSIDGDALSTALFVLGKEEGLKLASSIEGVEALVVTKEKKIYGTAGMDDFFKLTNKEYT
FT                   YEKGK"
FT   gene            101559..102917
FT                   /locus_tag="Amico_0114"
FT   CDS_pept        101559..102917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0114"
FT                   /product="amino acid carrier protein"
FT                   /note="KEGG: cco:CCC13826_1827 branched-chain amino acid
FT                   transport protein; TIGRFAM: amino acid carrier protein;
FT                   PFAM: sodium:alanine symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56262"
FT                   /db_xref="GOA:D5ECI0"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECI0"
FT                   /inference="protein motif:TFAM:TIGR00835"
FT                   /protein_id="ADE56262.1"
FT                   /translation="MEVIDVIRSVNNVLWGYVLIFLLCGTGVYFTFRLNFVQIRKFGVV
FT                   CKNAFGGITLFGEKAGKEGMSSFQSLATAIAAQVGTGNLAGAATAIASGGPGAIFWMWI
FT                   SAFFGMSTIFSEAVLAQTYKEKDIDGQIVGGPAYYISRGFGSKGLAVFFAIAIIIALGF
FT                   IGNMVQSNSISDAFQTAFNLPALYVGIALAILAGLIFFGGISRIASFTEKAVPIMALMY
FT                   LIGGVVVLAMNVDAILPAIKMIFYGAFNPKAATGGIIGVGVKEAVRYGVARGLFSNEAG
FT                   MGSTPHAHAVAKVKHPAQQGLVAIMGVFIDTFIVLNITAFVILTTGVLDGKTTGIALTQ
FT                   AGFTQALGGFGNIFVAICLLFFAFSTIIGWYFFGEANIRYLFGIKGLTPYRILVMIFIV
FT                   IGSTMKVDLVWELADTFNGLMVIPNLIAVLGLAKVVSKALDDYDNDGMLKSSK"
FT   gene            complement(103014..105827)
FT                   /locus_tag="Amico_0115"
FT   CDS_pept        complement(103014..105827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0115"
FT                   /product="protein of unknown function UPF0182"
FT                   /note="PFAM: protein of unknown function UPF0182; KEGG:
FT                   sun:SUN_1015 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56263"
FT                   /db_xref="GOA:D5ECI1"
FT                   /db_xref="InterPro:IPR005372"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECI1"
FT                   /inference="protein motif:PFAM:PF03699"
FT                   /protein_id="ADE56263.1"
FT                   /translation="MTKYNPFSEDEWFNNEEATPRRKVKFPVFPGGKKFIWLLAACVVI
FT                   VFLAIPSLGHFYTDYLWFEALEQTAVFWTMLVPKWILFAVATVVSFALLFLNFRIARRN
FT                   TLKLLPEDSPFGNFPKTLTSSAVFIGAGILALMNGFSTQKHWDMILRFLHSNPFEISDP
FT                   IFGKNVAFYIYHLPFWSFMQEWGMGILILSLIGSGALYAFVIVPLFAGNRQTVPQSVFK
FT                   HLSLLVAALALLWGAGFWLERFNLLYSPRGVAFGASYTDMHADLLALNVMTGLTLLVAI
FT                   LLVVGIYRSTWKFSVATLGMLVVASVLLRGIYPEVIQKYVVEPNEFDKERPFIEYNIEA
FT                   TLHAYGLDKLKNVSILPESEATWDKLEQNKESMQNVRLWDSRPLLRSFKQLQEIRSYYD
FT                   FIDVDIDRYRFDEEYRQVMIAARELDLKSLQNPTWVNQHVEFTHGYGIVMNPVNEVSPS
FT                   GLPILWVENLPPRVHIPVDLSRPQIYFGEKPDSYIFVKTTEKEFDYPMGTSNVRTTYEG
FT                   SGGVSIGSFFRRMLFAMRYGDSKILFTSVFTPESRILFYRNVQQRLRRVAPFLLYDSDP
FT                   YLVIHDGRLVWMQDAYTTTDRYPYSEPISISMGDRRGYFKINYIRNSVKATVDAYDGTM
FT                   RFYIVNENDPLIKTWKQIFPSLFSSIEEMPKNLREHIRYPKDMFSIQSETLKTYHMLDP
FT                   NTFYNKEDVWQTYRGSDGTEPLAAHYMIMKLGDGQPAEFALIAPFMPVGRDNMIAWMAG
FT                   RCDGEKYGELLVYTFPKQKLIYGPAQVEALTNQHPEISSQLSLWSQRGSDVIKGNIMVI
FT                   PIEDAVLYVQPLYLRAENSDLPELKRVIVSTGGRVEWGERLDEALEKLLGKREGKTSTK
FT                   PPLPAKEEAGEEKPLLYDGAIKELVQQAQHTWEQAQKALKEGNWNRYGEMMKQLESLLQ
FT                   QLGNAIQ"
FT   gene            105924..106418
FT                   /locus_tag="Amico_0116"
FT   CDS_pept        105924..106418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0116"
FT                   /product="protein of unknown function UPF0066"
FT                   /note="PFAM: protein of unknown function UPF0066; KEGG:
FT                   sfu:Sfum_0270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56264"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECI2"
FT                   /inference="protein motif:PFAM:PF01980"
FT                   /protein_id="ADE56264.1"
FT                   /translation="MMVEEFRLQSIGVIRSPFRQRKGMPIQPAGARGIRGTVEVLPKYE
FT                   KGLQDLEGFSHIYLLYWFHLSEGYDLTVKPFMDSEYRGIFATRAPRRPNQIGLSIVRLV
FT                   SIKGNTLYIEDIDILDGTPLLDIKPFVPEFDIFNRTFRSGWLEKQAVKAEEVKSDERFS
FT                   G"
FT   gene            106550..106930
FT                   /locus_tag="Amico_0117"
FT   CDS_pept        106550..106930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0117"
FT                   /product="endoribonuclease L-PSP"
FT                   /note="KEGG: gsu:GSU2235 endoribonuclease L-PSP, putative;
FT                   TIGRFAM: endoribonuclease L-PSP; PFAM: Endoribonuclease
FT                   L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56265"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECI3"
FT                   /inference="protein motif:TFAM:TIGR00004"
FT                   /protein_id="ADE56265.1"
FT                   /translation="MKKIIASPDAPKAVGPYSQAVMVGGFLFASGQLPVDPATGKMVEG
FT                   DIQTQFHQLMKNVTAVLKEAGLTFDDVVKTTIFLTDMGNFAAVNAVYAEYFKGDKPARS
FT                   CVQVAALPLGGEVEMELIACQK"
FT   gene            107071..108405
FT                   /locus_tag="Amico_0118"
FT   CDS_pept        107071..108405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0118"
FT                   /product="protein of unknown function DUF1063"
FT                   /note="PFAM: protein of unknown function DUF1063; KEGG:
FT                   dal:Dalk_4447 protein of unknown function DUF1063"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56266"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR021144"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECI4"
FT                   /inference="protein motif:PFAM:PF06354"
FT                   /protein_id="ADE56266.1"
FT                   /translation="MFTVKEFLRSEVKPALGCTEPGAVALAVARAWKEADCECVRDVEV
FT                   TVSSSIYKNGIAVGIPGTNGLKGNVVAAALAAVCGNPEYGLEVLRDCSEEAVQKAQDLV
FT                   GEGKVKIIADMNRHGVYVKAVVTTAHHLSECVIEGSHTNIIKVTLDGKSRYTLQGISQN
FT                   TQKNEEKSISDQIKAMTYSETVRLIEDLDEEDVDYVMEGVRMNMEIARLGLDTTRKLGL
FT                   GVGKTMMKFAGDGTDLRTLGDKVKAISAAAADARMSGASLPVMSSAGSGNHGITAILPV
FT                   SIVAEHYQKSREETARAIALSHLTTSFIKSRMGRLSPVCGCSVAAGAGAAAGMTFLLSG
FT                   DLHKAEKAVEILVSNLVGMLCDGAKDTCALKVGTGAYEAYCAAMIVLEGNELDGPQGVV
FT                   GETIEKTIENASAINIEGMIDVDRIIIEFVSKRYADEEALKNAVS"
FT   gene            complement(108483..109664)
FT                   /locus_tag="Amico_0119"
FT   CDS_pept        complement(108483..109664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0119"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   ypi:YpsIP31758_1307 aminotransferase, classes I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56267"
FT                   /db_xref="GOA:D5ECI5"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR027619"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECI5"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADE56267.1"
FT                   /translation="MGKYNFDAIIDRHHTSCEKWDFLKDKFGRDDLLAMWVADMDFTAP
FT                   PEVIEVLKERVDHGIFGYTGRTDSYFDSIVQWVDKRHGWKIEANWIRHAPGVVPALSMS
FT                   VLAFTQPGDGILVQPPVYPPFYSAVNGRGRRVVENPLVFRDGRFEMDFDDLEKKIDSSV
FT                   KMLFLCNPHNPVGRVWTEEELKRLGEICGRHDLIIVSDEIHSDIVFKGFRHVPIASLSP
FT                   ELAARTITCIAPSKTFNIAGLSTSAIIIPNKRIRDNYTTVLDFLHIDSGNIFGTFALEA
FT                   AYSKGEPWLEALIEYLEGNVNFIEDYLKENIPSIKLVRPEATYVPFLDCRGLGLSNGAL
FT                   FDLLINKARVAMNNGAWFGKGGEGFMRINIATPRALIKEGLDRIARALACIEK"
FT   gene            109869..112445
FT                   /locus_tag="Amico_0120"
FT   CDS_pept        109869..112445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0120"
FT                   /product="ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent"
FT                   /note="KEGG: dde:Dde_0113 ribonucleotide-diphosphate
FT                   reductase subunit alpha; TIGRFAM:
FT                   ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent; PFAM: ribonucleotide reductase
FT                   large subunit; Ribonucleotide reductase large subunit
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56268"
FT                   /db_xref="GOA:D5ECI6"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECI6"
FT                   /inference="protein motif:TFAM:TIGR02504"
FT                   /protein_id="ADE56268.1"
FT                   /translation="MKKEFNQRFDHEIDLDVLEHPAEPRLSENATWLLAQRYFIHRYDE
FT                   EEGGVRQERSFEEFARRVARIIASAETLYLDKNDAKSLLWLQTLEKNIFNDILNRRFLF
FT                   NSPCLFGAGAGMTTDPKLSTLVYKSPDHMTFEEYETLLASKTKNQQLFACFVIDIPDSI
FT                   EGIFDSVKDASIISKFGGGVGGNFGWLREKGAGINGGTGGQASGPISFMETWNTMGSVV
FT                   VQGGKRRAALMGMLFDNHPDIMDFIDAKTEENKLSYFNISVCVSDALLKAVEEEGDFPL
FT                   ISRIDGSVAKTVKAKDLWNKLSESAWKRGDPGVFFIDRANADNLLKLDPEWRIESTNPC
FT                   GEQPLPNYTSCNLGSINVEAFVTSKGGLPAFDTDGFVDQVYRSIYYLDLVIDACSYPLP
FT                   RIEERTKRIRPVGLGVMGLADAAILLGMRYGGERFDEYCTSLGESMAAAALCATEEIVS
FT                   VIGKAPFDESHLVKDLFHKFRDETGQKELFTAEWLKSTTIEDIISLIALMRGSETVPYT
FT                   LINAIESIVNNEGLGSEEERLAKVKDVLKALESGQIRNSRRLSIAPTGSISMLMDTSSG
FT                   IEPNFAWTWTRRIIKKDGEGHELREFCHKLLSEELHQELKQTGCISDPTYVTAYDISTD
FT                   EHVAVTGIFSRYIDSGISKTVNLPYSADVEDVQKVYEMCYKLGTKGITIYRDGSRSAQP
FT                   IEVKKKEEGVPHTSKVKQRPGLVVFGKTIKQKTPWGSMYVTLNFDGTEPFEVFASIGKS
FT                   GSELNAMTEALSRAISIGLRSGGKLEDFIATLKGLSGKEYWVFDYDDTHVARSIPDAIA
FT                   MLLEKLIEKEEKPGEKHDLRCPECGSPMEMISGCAYCFSCGHSPCK"
FT   repeat_region   112571..114959
FT                   /rpt_unit_range=112571..112607
FT                   /note="CRISPRS"
FT   gene            complement(115118..115225)
FT                   /locus_tag="Amico_0121"
FT   CDS_pept        complement(115118..115225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56269"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECI7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56269.1"
FT                   /translation="MYYKMIQAPSFEIIFLKVHFLQSLIRTRKGQLIKV"
FT   gene            complement(115215..115499)
FT                   /locus_tag="Amico_0122"
FT   CDS_pept        complement(115215..115499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0122"
FT                   /product="CRISPR-associated protein Cas2"
FT                   /note="KEGG: mxa:MXAN_7259 CRISPR-associated Cas2 family
FT                   protein; TIGRFAM: CRISPR-associated protein Cas2; PFAM:
FT                   protein of unknown function DUF196"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56270"
FT                   /db_xref="GOA:D5ECI8"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="InterPro:IPR021127"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECI8"
FT                   /inference="protein motif:TFAM:TIGR01573"
FT                   /protein_id="ADE56270.1"
FT                   /translation="MKKWFIISYDIRNEKRLRKVAKLMEGYGQRIQYSVFRLHLNERGL
FT                   EHLRWKLSKCTTAEDGLLITELCEKCISRLRMRNGENAWPDEPEKWIVL"
FT   gene            complement(115516..117165)
FT                   /locus_tag="Amico_0123"
FT   CDS_pept        complement(115516..117165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0123"
FT                   /product="CRISPR-associated protein Cas1"
FT                   /note="KEGG: mxa:MXAN_7260 CRISPR-associated exonuclease
FT                   Cas4/Cas1 family protein; TIGRFAM: CRISPR-associated
FT                   protein Cas1; CRISPR- associated protein Cas4; PFAM:
FT                   protein of unknown function DUF48; CRISPR- associated
FT                   protein Cas4"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56271"
FT                   /db_xref="GOA:D5ECI9"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR013343"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="InterPro:IPR023844"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECI9"
FT                   /inference="protein motif:TFAM:TIGR00287"
FT                   /protein_id="ADE56271.1"
FT                   /translation="MTITSENEALLRISSLHALLYCERLFYLEEVEEIRIADASVYAGR
FT                   TLHEELAKEEGEEFRSFFLSSETLGLTGKADAIRHRNGNWVPYEHKKGKPVLRKGEEPQ
FT                   AWETDIVQVTAYALLLEEYFGRELQEARIRYHGTNTTITIKLSNENREKVYNAIQRAQT
FT                   LRQRTERPPISDSPRKCLRCSLAPVCLPEEERFSRTPEWEPIRLFPQEIEGAALHVTGH
FT                   STRIGRSGESFKLEESDTPPQKIPSGNLHSITIHGNAQVTTQALRLCSDKGIHLHWYTG
FT                   GGTHLGSFVPGPGPVQRRIRQYQALINPGQCLKLARRTVLAKVESQLRFLLRSTRGKER
FT                   DSEMEKGLNEMRSLLKAIPAAEGVDILRGIEGNAAHLYFSLIPKILSKDVPPEMIPSGR
FT                   TRRPPKDRFNAILSFGYSMLYRAIIQSIIVVGLEPAFGFLHSPRSSAHPLAMDIIELFR
FT                   VPVWDITTIASINRKQWNPESDFSATKEKVWLSNEGRKKALILFERRIQEKWKHPVLEY
FT                   SLSWQRAMELEVRLLEKEWTDAPGLYARSRIR"
FT   gene            complement(117162..117842)
FT                   /locus_tag="Amico_0124"
FT   CDS_pept        complement(117162..117842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0124"
FT                   /product="CRISPR-associated protein DevS"
FT                   /note="TIGRFAM: CRISPR-associated protein DevS; CRISPR-
FT                   associated protein Cas5; KEGG: scl:sce9175 fruiting body
FT                   developmental protein S"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56272"
FT                   /db_xref="GOA:D5ECJ0"
FT                   /db_xref="InterPro:IPR013422"
FT                   /db_xref="InterPro:IPR021124"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECJ0"
FT                   /inference="protein motif:TFAM:TIGR02586"
FT                   /protein_id="ADE56272.1"
FT                   /translation="MIRLRVTAPFATFRHFATGSFRPTIDFITPSAAFGLLLNIAGVEM
FT                   RGGEGKNGTTLIQKGLPPIKLAIGAIKFPEQQEILQQLHNYPVGTTRKEWKPFTKGSKY
FT                   NILPVTRAFLSGIDAIIAIDSPDFEEKLRNSLEGKTQRKYGLPFLGDNSFILDRIEETT
FT                   PSLPAYWYCCLEEPLIELDKQRINRFTITIDREDMSKTRTALFAPTKERISEIPSGAWV
FT                   EVIY"
FT   gene            complement(117848..118768)
FT                   /locus_tag="Amico_0125"
FT   CDS_pept        complement(117848..118768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0125"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce9174 fruiting body developmental
FT                   protein R"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56273"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECJ1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56273.1"
FT                   /translation="MNLFATVLTNAAPSANYRGESAENRAILQKITKGRLQYAIVSPES
FT                   MRNAIREGLRSMGLPCNRSRLHDEEQLAVKFEDYPDANVYADDFFMGWLIAAGKKDREK
FT                   IKKEIKEKGRDVTLFTFKRDSVLRMNLAVALEPYRHDTVFTQSPQHLESPWKNADSSQL
FT                   LHRETIFTSFQYPFALNLEDCKEKAEWTKTLLSVIGQLGGVAGNHARSLFDMAPSSIII
FT                   RMTHKLAAGYDTYGFKTEENGTHTFPEIMEGILHDNLPGSEFLIGGKIVCDMNEIKQNA
FT                   LLEKGTTLNRNAGKILEMAGNRAFG"
FT   gene            complement(118794..120596)
FT                   /locus_tag="Amico_0126"
FT   CDS_pept        complement(118794..120596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56274"
FT                   /db_xref="InterPro:IPR030928"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECJ2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56274.1"
FT                   /translation="MKTKNAKEKNETILELEYSLDNLPSAQHKTGLAGLVLLLETMEER
FT                   EMAPLPEYKENIDGTWTFQFTRKSFQAVFDELYDGENIIVESPSKWSGASPIEIREKEV
FT                   EKNGKKKTERVFVYEITVPKGSFFKGLFSEGPEGKKRLELWRDALWSTYKGKPASRGVY
FT                   SERVQNNPCSFVEKLWSSLIRKKGGIEDLAGSLLLGAEGFNAEGIPFKGLLHENVLLHF
FT                   TPIACALFVVRNFMVKKGNRDNKGTYSVEWDENGYVFVMPEITKIKPYLGELRKWFQND
FT                   PEKETKSFRPSSSIIDLPEESGLEFLSAISGRRLETEGVFDRVEGVEYYHMTKKGNSVK
FT                   LLSSSRIPVSVPILNEYNSIVSAGGRKKPLNFLYKTLRIRNLLNGTHWHVGMEGILETY
FT                   PSEFFIWSREGSPRNIPFFGLDINKKFKEIAQKLYYIEQEAKEMEENGVNSNLIDHTER
FT                   LAAKVRNIVRNFVISELKSRPKIKIPGGKTHLEQTKEDSFLAYPEDYLAELKKICTGAF
FT                   LALRGRSGTDIAEFFTGTLCAIPQFLKNDFKNEGKDDYLLMAKSLVDPKEREKIKLFAM
FT                   LALSACSYVYYPKERQSQPEIETE"
FT   gene            complement(120626..122908)
FT                   /locus_tag="Amico_0127"
FT   CDS_pept        complement(120626..122908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0127"
FT                   /product="CRISPR-associated helicase Cas3"
FT                   /note="TIGRFAM: CRISPR-associated helicase Cas3; CRISPR-
FT                   associated HD domain protein; PFAM: helicase domain
FT                   protein; KEGG: mxa:MXAN_7264 CRISPR-associated helicase
FT                   Cas3; SMART: helicase domain protein; DEAD-like helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56275"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006474"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035011"
FT                   /db_xref="InterPro:IPR038257"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECJ3"
FT                   /inference="protein motif:TFAM:TIGR01587"
FT                   /protein_id="ADE56275.1"
FT                   /translation="MTILAKKGIAVGNVTIQKTLLEHTQDVLNASFSLFGKEHEPKHLG
FT                   EKWLSFFKIHETEFFNFSQNLKAAIVFHDIGKSNDQFQKALQGNAPQSLRHEFLGGWIL
FT                   SQELCRKFIESQGIDFHIIRASVMGHHLKLKKGILNSSDYDNPLIKILANGVQDILDLF
FT                   SSEFNSKESCLLNHAIPQRINIKEEKIALDFDSIEKELRRSFPAQEPQKLRLLRAVRTA
FT                   LILADAAGSGLAREMNQSVDVPMTRWIDNAFDKNNLLSKEKIEYDVIAPRCTQIETTGE
FT                   KKPFLFSEFQLASSTLPDRTCLLAPCGSGKTLAAWKWGSGVASRHPISRFIFLYPTRAT
FT                   ATEGFRDYVSWAPETDGTLLHGTSNYELQGMFDNPDPRSEKEFLTNDRLFAVGLWQKRL
FT                   FSATVDQFLGFMRHDYRSSCLLPLLADSAVVFDEIHSFDQTLFSALLGFLREFNVPALC
FT                   MTASLPINRLDQLREAGLKIFPESIASFPDLKEKASAMRYRVKQCKKEEALEEALKAYK
FT                   NGEKVLWVVNTVKRCQEIAMELQESFAENLLCYHSRFRLKDRQKWHKKLIEKFRDPEPM
FT                   IAITTQVCEMSLDLSASLLISEFAPVTSLIQRMGRCNRYLEICEGGRILLYPPAKNLPY
FT                   SKEDIEIAEAFVRNINNKTINQEDLQSLLEEFSPQNREMEKLLPFLNSDAFAFTFGGGI
FT                   RDGDVYTVSAILESNINNYWNLRKQFQPIDGLILPAPQNCVERGNGLPSYLYIAKGRYV
FT                   ESLGLLV"
FT   gene            complement(122913..123560)
FT                   /locus_tag="Amico_0128"
FT   CDS_pept        complement(122913..123560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0128"
FT                   /product="CRISPR-associated protein, Cas6-related protein"
FT                   /note="KEGG: scl:sce9171 hypothetical protein; TIGRFAM:
FT                   CRISPR-associated protein, Cas6-related; PFAM:
FT                   CRISPR-associated protein Cas6-related"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56276"
FT                   /db_xref="InterPro:IPR014174"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECJ4"
FT                   /inference="protein motif:TFAM:TIGR02807"
FT                   /protein_id="ADE56276.1"
FT                   /translation="MVDLEFQLHGKTIDADHGYQLYSAITDILPSIHHAEHRRNISIHP
FT                   INGAPCGERKIALNNKSRLTLRIPVDKVPDFLFLCGKFLRIGTHNVTVGIPVSRKLVPY
FT                   PILGSRLVTIKGFTEPDQFLDAVQRQLDTLNILGTPHLLLRSHLKSIEGKTDNRISSPF
FT                   IKRTLCIKDKNIVGFPLLVSKLTAEESLRLQRTGLGGRRMMGCGVFIPQRRE"
FT   gene            complement(124125..124630)
FT                   /pseudo
FT                   /locus_tag="Amico_0129"
FT   gene            125015..125725
FT                   /locus_tag="Amico_0130"
FT   CDS_pept        125015..125725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0130"
FT                   /product="GntR domain protein"
FT                   /note="KEGG: sde:Sde_1270 GntR family transcriptional
FT                   regulator; PFAM: GntR domain protein; regulatory protein
FT                   GntR HTH; SMART: regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56277"
FT                   /db_xref="GOA:D5ECJ5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECJ5"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADE56277.1"
FT                   /translation="MSLSMFEEIKTRTLQEQILEKLKDLIKDGSLKAGQFLPSERDLAK
FT                   TLGVSRIPLREALNKLQVLGVVERQHGRRTLIKGLGGIPITEIIEIISDSGDEIETVNQ
FT                   LKEIRLILEVEAAGLASQRRDKDDLKRLEELVEQMEKEYKEVEKLQVLSLRFHMAIVEA
FT                   AKNRILSLVYLFFHDLQQRSRKYSKRIHSDPIGIVKDHKEIFKAIQEKDRKLAEELMRS
FT                   HLDQVTFILPYQEK"
FT   gene            126046..127050
FT                   /locus_tag="Amico_0131"
FT   CDS_pept        126046..127050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0131"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /note="KEGG: bmj:BMULJ_05545 PTRAP-type C4-dicarboxylate
FT                   transport system periplasmic component; TIGRFAM: TRAP
FT                   dicarboxylate transporter, DctP subunit; PFAM:
FT                   Extracellular solute-binding protein, family 7, bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56278"
FT                   /db_xref="GOA:D5ECJ6"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECJ6"
FT                   /inference="protein motif:TFAM:TIGR00787"
FT                   /protein_id="ADE56278.1"
FT                   /translation="MKRFLRGLALFVVMGLIFGLVGTLGMGSAFASSDTYVFKLAIEMP
FT                   ERHPYWMGATKFNELLQEKTGGRVKIDIYPSGQLGTQKDTAEAVAMGALEFSLVSGAVL
FT                   ERYDPRAEVVQLPFVFRDLDHAHKTMFGDFGKKMGSWFEAKGIMVPSFLLNGPKHVTST
FT                   MEIGSPADMKGIKLRTQQAPTMIEFGKALGCVVSPMPYGEVYTALQLNTVDAEVQCVAN
FT                   VLFDKHYEVAKNMNDVTLFVYLEPLLMSKKVYDGLPKDIQEAILECAVEAADWQWNYYR
FT                   SNMHETFIPELTKLGVKFNAGDAAEWKKALEDAGYYNKFEQHKPLMDEIAEVK"
FT   gene            127151..127696
FT                   /locus_tag="Amico_0132"
FT   CDS_pept        127151..127696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0132"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter DctQ component"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter DctQ component; KEGG: bbr:BB3422 putative inner
FT                   membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56279"
FT                   /db_xref="GOA:D5ECJ7"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECJ7"
FT                   /inference="protein motif:PFAM:PF04290"
FT                   /protein_id="ADE56279.1"
FT                   /translation="MTKKATMGASSTRSAITYLCDGIEAVLDRFLVPLLMASLAFIVFF
FT                   QVINRFILHIPAAWTEEMGRYLFVWASLLGAVSGVRKGAHLNVEIVQNAVKGSFRRILM
FT                   LASDIFCLIFFGVLGYQGLYWVKTSGINVLADSMDIPMLYIQVIVPVSAILMLIFTAEH
FT                   IHRVIVKHNDKEAGDCKC"
FT   gene            127690..128973
FT                   /locus_tag="Amico_0133"
FT   CDS_pept        127690..128973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0133"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="KEGG: pau:PA14_68290 C4-dicarboxylate transporter;
FT                   TIGRFAM: TRAP dicarboxylate transporter, DctM subunit;
FT                   PFAM: TRAP C4-dicarboxylate transport system permease DctM
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56280"
FT                   /db_xref="GOA:D5ECJ8"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECJ8"
FT                   /inference="protein motif:TFAM:TIGR00786"
FT                   /protein_id="ADE56280.1"
FT                   /translation="MLTAWLLAILAISIAVGAPIAVSLGLTAVGYFLLKGQASFLFLVA
FT                   QRLFAGCNSFELIAIPLFVLSGDLMLDGAISKALVDLAKSMFGWVRGNLALTTTLGSML
FT                   FGAVSGSGPATASAIGSIVAEPMAEEGYPRAYTSAVIAASSPLGSLIPPSILMVVYGAA
FT                   SGASIAKMLMSGIGPGILFGVLFMVYEIHVGRRAQYGSVSPFSLSQFLVALRKGVWALI
FT                   APVIILGGIYSGIFTPTEAAAVTVFYSLFVGMVVNRTIKLKNLPSILLRSGVTSGAILF
FT                   VLGTVAAFGYVITREGIPQQLTIAATSIIKTPIMFLIVSQVILVVAGMLMNGSAAIMLL
FT                   VPLFLPTVRQYGIDPVYFGGLMVANLSIGMYTPPVAVTSYVASRIAGASFDETNRALVP
FT                   FLVVSFIAIVILLLVPGIITFLPHYLLD"
FT   gene            129064..129954
FT                   /locus_tag="Amico_0134"
FT   CDS_pept        129064..129954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0134"
FT                   /product="hydro-lyase, Fe-S type, tartrate/fumarate
FT                   subfamily, alpha subunit"
FT                   /note="KEGG: dde:Dde_1255 fumarate hydratase; TIGRFAM:
FT                   hydro-lyase, Fe-S type, tartrate/fumarate subfamily, alpha
FT                   subunit; PFAM: Fe-S type hydro-lyase tartrate/fumarate
FT                   alpha region"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56281"
FT                   /db_xref="GOA:D5ECJ9"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECJ9"
FT                   /inference="protein motif:TFAM:TIGR00722"
FT                   /protein_id="ADE56281.1"
FT                   /translation="MVRYPNLYQDVYDMIYRSTTSISSDVKEMMQAALERETNDTAKSM
FT                   MQAMLDDAKMAGEKVKPLCQSPGFPTIYVSFGDKSSPREDIKKIWANALVEGTKNHLLR
FT                   PSMVDTLTRENPGDNSGVGVPNFEFDYCPDQEYLDMLLSFKGCGAELANAMKIFTVAQL
FT                   EKDKDFAGLKRWVLDTVIKGGGKPCPPGAIGIGLGGQMDVACKLARKAVSTRRWNDVHP
FT                   DPRYAALEKELLENINSLGLGAAGTGGDTTLLAVKIAAVSTHTAIAPAAISFHCWAARR
FT                   THVRLYPDGRKEILL"
FT   gene            129970..130557
FT                   /locus_tag="Amico_0135"
FT   CDS_pept        129970..130557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0135"
FT                   /product="hydro-lyase, Fe-S type, tartrate/fumarate
FT                   subfamily, beta subunit"
FT                   /EC_number="4.2.1.2"
FT                   /note="TIGRFAM: hydro-lyase, Fe-S type, tartrate/fumarate
FT                   subfamily, beta subunit; KEGG: cco:CCC13826_1007
FT                   L(+)-tartrate dehydratase subunit beta; PFAM: Fe-S type
FT                   hydro-lyase tartrate/fumarate beta region"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56282"
FT                   /db_xref="GOA:D5ECK0"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECK0"
FT                   /inference="protein motif:TFAM:TIGR00723"
FT                   /protein_id="ADE56282.1"
FT                   /translation="MAEKLLTVPLKEEEVRELKAGDVVYLKGPIFTSRDMGHINIKQLL
FT                   EKNEKLPVDFNGSAIFHAGPVVNKKEDGTYELVVIGPTTSIRMEPYYKMVADLGVRAII
FT                   GKGGLAEDSLRQFAETGQVYLQAAPGCAVVLAEGISKIKEVHWLELGVPEALWVLDAHK
FT                   FGPLVVGMDSHGTSVYKELREKAETRNKELYG"
FT   gene            130606..132003
FT                   /locus_tag="Amico_0136"
FT   CDS_pept        130606..132003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0136"
FT                   /product="fumarate hydratase, class II"
FT                   /note="KEGG: tdn:Suden_1049 fumarate hydratase; TIGRFAM:
FT                   fumarate hydratase, class II; PFAM: fumarate lyase;
FT                   Fumarase C-like"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56283"
FT                   /db_xref="GOA:D5ECK1"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECK1"
FT                   /inference="protein motif:TFAM:TIGR00979"
FT                   /protein_id="ADE56283.1"
FT                   /translation="MEYRIEKDSMGEVKVPVDKLYGAQSQRSIDNFKIGIEKMPKEVIE
FT                   AFAILKKAAALANNKLGVLDDVRAKAIAKAADEVLEGKLEGNFGLAVWQTGSGTQSNMN
FT                   VNEVLANRANQILNDPEHKVHPNNHVNKSQSSNDTFPTAMHITAVLTLENDLLPSLKQL
FT                   KDTLHEKSVQYMDIVKTGRTHLQDATPLTLGQEISGWVRMLERSEEMILSGVSFLKDLA
FT                   LGGTAVGTGLNAAVGFDVEVAAQISALTGKNFKTAPNKFHSLTSKDELVFAHGALKALA
FT                   ADLLKIVNDIRWLAAGPRCSIGELLIPENEPGSSIMPGKVNPTQCEAVSMVVAQVMGND
FT                   VTVGFAASQGNFELNVYMPVLILNFLQSSRLLADCMRSFNDHCASGLEADEERISHFVT
FT                   NSLMNVTALNPYIGYDKSAEIAKKAHKDGSTLKEAALALGYLSEEEFDKYMDLKAMCAP
FT                   KTVKVKE"
FT   gene            132057..133385
FT                   /locus_tag="Amico_0137"
FT   CDS_pept        132057..133385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0137"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating)"
FT                   /EC_number="1.1.1.38"
FT                   /note="KEGG: malic enzyme ; K00027 malate dehydrogenase
FT                   (oxaloacetate-decarboxylating); PFAM: malic protein
FT                   NAD-binding; malic protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56284"
FT                   /db_xref="GOA:D5ECK2"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECK2"
FT                   /inference="protein motif:PRIAM:1.1.1.38"
FT                   /protein_id="ADE56284.1"
FT                   /translation="MLSKEDLLKKAKKPAEDAMKLHPFYKGKMQTSLKCCIRNVDDFAI
FT                   WYTPGVAAPCKAIKEDIDLSYEFTNRANTVAVVSDGTRVLGLGDIGPEAGMPVMEGKAL
FT                   LFKYLGGVDAVAICLDTKDPDKIIEAVRLIAPSFGGINLEDIAQPKCFYILDELRKDCK
FT                   IPVWHDDQQGTAAVNLAGLYSALKIVGKKIEEAKVRFFGAGAASVATARILISAGVKPE
FT                   NIIMSDSKGTLHKGRTELKGEFDAKWHLAQITNPEGIEGGPEVLFEGADAVYCYTKPGP
FT                   GVVKKEWVSRMAKDAILFACANPIPEIWPWEAKEAGARIVATGRSDFPNQVNNSLGFPG
FT                   IFRGTLDVQARTITDEMCIAAAQTLSKCAEKKGLSEEYLIPTMDEAWVYPEVATAVALK
FT                   AIEQGIARKVFSREELLKMATEKIQYAQNMTKCLTENNFIKMP"
FT   gene            133501..134856
FT                   /locus_tag="Amico_0138"
FT   CDS_pept        133501..134856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0138"
FT                   /product="MmgE/PrpD family protein"
FT                   /note="PFAM: MmgE/PrpD family protein; KEGG: sfu:Sfum_0172
FT                   MmgE/PrpD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56285"
FT                   /db_xref="GOA:D5ECK3"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECK3"
FT                   /inference="protein motif:PFAM:PF03972"
FT                   /protein_id="ADE56285.1"
FT                   /translation="MASITKGISRQCADFVSFLSFSDLEQKTVSITKKCIIDWLGCVLG
FT                   GSSTPAASIIESLMADMGGKSQATFIGSFNKGTTLQAAMVNAYNCHILEMDDVHKSSIS
FT                   HPAAPVISAAFSLAEYLESSGKDLIEAIVAGYDVMIRIGEAVSPSHYAIWHTTSTCGAF
FT                   GAAAATAKLLHLDEVETLYSLGNAGTQAAGFWEFATDKAMTKYLHCGKAAYNGLISSLM
FT                   SKKGFTGATRILEGDRGFFRACSTETNFSESFKDMGQNYRINETVYKPYASCRHTHGPI
FT                   NATLELRNQKGFSYEDVEDITVETYDTALRLVGNTDFSTSPAAKFCLPYCLASALVFGK
FT                   VGVTEFQEEKLKDPRIKRIVPVVKIMPTDEMNSLYPSKWASRITVKTIQGDLYSSFIEY
FT                   PKGDPENTMTDAEIEDKYLELATLKVEKSKALELLHKCRSIEDCDNLKNFFV"
FT   gene            complement(134980..135552)
FT                   /locus_tag="Amico_0139"
FT   CDS_pept        complement(134980..135552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0139"
FT                   /product="Protein of unknown function DUF1847"
FT                   /note="PFAM: Protein of unknown function DUF1847; KEGG:
FT                   ppd:Ppro_1050 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56286"
FT                   /db_xref="InterPro:IPR014997"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECK4"
FT                   /inference="protein motif:PFAM:PF08901"
FT                   /protein_id="ADE56286.1"
FT                   /translation="MKCHLCKEKSCYIGDPCKKTDSISLYDDPLDRKLLVVAAEIEALF
FT                   YKEICRVDETLEFTRRMNFKKIGIAFCLGMRKEAKILGEIFSKEFEVHSVCCKVGSIKK
FT                   DEFEMAKNPRIGEYSCNPIEQARILNNEGTEFNIVLGLCVGHDSLFYKYSKAPVTTIVT
FT                   KDRKLGHNPVAALYCPYIRSDLGKELK"
FT   gene            complement(135678..136484)
FT                   /locus_tag="Amico_0140"
FT   CDS_pept        complement(135678..136484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0140"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: tdn:Suden_1321 patatin"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56287"
FT                   /db_xref="GOA:D5ECK5"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECK5"
FT                   /inference="protein motif:PFAM:PF01734"
FT                   /protein_id="ADE56287.1"
FT                   /translation="MEKTNNMEKKHENIQEKEKNRTSPWGRRRSWRCSYRGVKSNRRVQ
FT                   HPISYIAGTSIGAIISAFYAFGKNWEEMAILLKGLNWLDISRISLSQFGLLSNKKLGKL
FT                   ITDNLGDVTFDEACIPLAMIATDITSGEKVALKNGNVAAAVMASSCIPGIFIPVEIDNR
FT                   LLVDGELVENVPITPLKDMGANFIISVDLFGKLKQKKPENIIEVLFKSFHIALETATKL
FT                   QTEESDILIRPDLSPFNTFDISKAENIIEIGYLEAKRMLGENKVVH"
FT   gene            136662..137528
FT                   /locus_tag="Amico_0141"
FT   CDS_pept        136662..137528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0141"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: sugar isomerase (SIS); helix-turn-helix
FT                   protein RpiR; KEGG: rpi:Rpic_1250 transcriptional
FT                   regulator, RpiR family"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56288"
FT                   /db_xref="GOA:D5ECK6"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECK6"
FT                   /inference="protein motif:PFAM:PF01380"
FT                   /protein_id="ADE56288.1"
FT                   /translation="MKRIKMAYPKSKGTQEKLIRFILDYPDVAAFLAIGDLAEKIGIST
FT                   SSISRAAVDMGYSGFPEMQKEIQQHLRRRILPTERMERAVTKDGNFTFRDSVRNDIENV
FT                   KKTLSRIPDTLFNDAVTLLSKANEVFVVGLGTQHPSAMYFSGVMKQIRDRVTLISHETT
FT                   EYFDCFSRISSRDVLLPICLPRYSRFTVHAAQEAEKTGCKIIAITDSEISPTGILADIV
FT                   LQVEYESMSFFNSNVAVMAVLNALATSVAMEDWEHARERVGKFSEVALNWNAFYQENSG
FT                   ESMGERL"
FT   gene            137525..138724
FT                   /locus_tag="Amico_0142"
FT   CDS_pept        137525..138724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0142"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   mes:Meso_2107 aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56289"
FT                   /db_xref="GOA:D5ECK7"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECK7"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADE56289.1"
FT                   /translation="MRISDRIARMKPSATSLMAAKAREKRSQGFKVISFTTGEPDYDSP
FT                   SEAVIAARKAMDERQTHYPPTSGITSLREAVGEYYRDHMGLIYDPSREIVVGTGAKQLI
FT                   YEALGALVNPGDEVIVFPPAWVSYVEQIRLFEGVPVEVETSDTNFIPDIERTEKAITPR
FT                   TVAMIINSPNNPTGAIYPEECLRGLAELACKKGIMIINDEIYERLVFDQEECPQILKVC
FT                   PEARNWVLNVNGVSKAFAMTGWRIGYALGPGKLIKAISDFQGHLTSGTSTISQWASVGA
FT                   LVKSQEYCETMRKGFFERRNLIVDLLSQIEYINFVKPQGAFYVFVDISSCLKRENGIYL
FT                   ENDVAFCEGLLERKNVAMVPGTAFLSPGFVRISYSCSKEDICEGVKRFIEYLEEIHAVN
FT                   "
FT   gene            138795..139763
FT                   /locus_tag="Amico_0143"
FT   CDS_pept        138795..139763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0143"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   bpt:Bpet3357 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56290"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECK8"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="ADE56290.1"
FT                   /translation="MKKILVAVVLIFLVVFSGTAFAAYPTKPVNMIVAYAAGGSTDILA
FT                   RITAKYLEAELKQPFVVVNKPGAGGSVGFTSIAKANPDGYTIGLINLSGVIVNPIVQPD
FT                   VVRYRITDFVGIANVVTDPGIFCVSPDSPIKTLEDLVKEAKANPGKLSISHEGFGAGDH
FT                   LGVAEFMKQAGVELNPVLYEGDAPAKAALLGGHIDVIAVNVSEVAEMVKAGQLHALAVQ
FT                   DTKRSAELPDVPTFSELGYPTVMQGTASRGFAAPKDIPAEALDILVEAMKKIVATPEYQ
FT                   SELKNLNMPIDFIPGEEFTTLLIEQDKLWSDLWKTSPWIKK"
FT   gene            139918..140319
FT                   /locus_tag="Amico_0144"
FT   CDS_pept        139918..140319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0144"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ebr:ECB_03720 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56291"
FT                   /db_xref="GOA:D5ECK9"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECK9"
FT                   /inference="similar to AA sequence:KEGG:ECB_03720"
FT                   /protein_id="ADE56291.1"
FT                   /translation="MFFVGIAALARALSYPAQTKMMPIIYSVALIILSFLLGLRTIRKE
FT                   NSSEENVVRTEEPLSRVFLVGSIIFAYIASIQILGFFSSTILFLLSFMFLMRAASWVVT
FT                   TLVSLVTTTVIYLFFETLLNIPIPKGIFF"
FT   gene            140330..141841
FT                   /locus_tag="Amico_0145"
FT   CDS_pept        140330..141841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0145"
FT                   /product="protein of unknown function DUF112 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF112
FT                   transmembrane; KEGG: pmr:PMI2935 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56292"
FT                   /db_xref="GOA:D5ECL0"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECL0"
FT                   /inference="protein motif:PFAM:PF01970"
FT                   /protein_id="ADE56292.1"
FT                   /translation="MTMMEYLLPALGNIFEPEAIFILFVGTIAGLIVGSLPGLSSTMGV
FT                   ALAIPLTFGMDPKMGLMLLGAVYCSSVYGGSLTAILIRTPGTDASIATTFDGFPLTQQG
FT                   LAGKAIGISTISSLVGGIISAMALLCIAPFLAKMALKFGPSEYFLVGLFGLSVIISVSS
FT                   GSYLKGLMTGAFGLLIATTGMDNFTGFPRFIFNNDSLLDGIPILPALIGLFSLSQAIKI
FT                   SVSDKTSIIDNPENLKFTDRILPEKEDMKRTWKTMLRSSIIGVIVGIMPGAGTGIAAFL
FT                   SYNEAKRASKNPESFGKGNIEGVAAPEAANNAVTGGSLVPALTLGIPGNAVTAVFIGGL
FT                   TIQGLIPGPNLFTKYGEITYTLLLSLFVANIMFAIIGLAFAKQFVKIVKTPTKVLAPII
FT                   CVLSIIGAYSIRNNFLDVWLLFGFGILGYFMERFEFSPTPIVLALILGPMVEAEFRRTL
FT                   TLFQGSLVPVLFRPISLFIIVLIIISVVFPLVRELRRERQLASEK"
FT   gene            141858..142847
FT                   /locus_tag="Amico_0146"
FT   CDS_pept        141858..142847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0146"
FT                   /product="pyruvate carboxyltransferase"
FT                   /note="PFAM: pyruvate carboxyltransferase; KEGG:
FT                   bps:BPSS1807 4-hydroxy-2-ketovalerate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56293"
FT                   /db_xref="GOA:D5ECL1"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECL1"
FT                   /inference="protein motif:PFAM:PF00682"
FT                   /protein_id="ADE56293.1"
FT                   /translation="MVELLDCTLRDGGNVVGAGFPKELTEKIMKGLIDSNIKVIEYGHP
FT                   SGLGGNKAGVKNAPLSDEEYLEIGSPYFSQAEVGMFCQPKHATISEIKLAAQKGLGFLR
FT                   VGINAGDSAKAKDLIKEIRGCGIKVRTSLMKGYILPPDELAEEARSLERYGAQAVTIMD
FT                   SAGYMLPDEVKKYVEAMIKKVSIPIGFHGHNNLGLAVANGLAALQAGATSIDCGVMGMA
FT                   RSVGNIPTEVFIAALLRSGESVEYDLFSLLSFIDKDLAQDLQHCYHNPNPPEQLILGLS
FT                   GCHSSFLPLFKGVAEASSVDLYKLIINVSAQNMKAPTKELIEEFAKRL"
FT   gene            143152..144360
FT                   /locus_tag="Amico_0147"
FT   CDS_pept        143152..144360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0147"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="TIGRFAM: S-adenosylmethionine synthetase; KEGG:
FT                   methionine adenosyltransferase; PFAM: S-adenosylmethionine
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56294"
FT                   /db_xref="GOA:D5ECL2"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECL2"
FT                   /inference="protein motif:TFAM:TIGR01034"
FT                   /protein_id="ADE56294.1"
FT                   /translation="MADRKFLITSESVTEGHPDKIADQISDGVLDAILADDPMGRVACE
FT                   TLVTTGMVMVAGEISTSTYVDIPKLARDIVKEIGYTRAKYGFDGDTCAVLTAIDEQSSD
FT                   IAQGVDTALEVRSHTEMGEAEVAKVGAGDQGMMIGYACTETEEYLPMPIALAHRLARRL
FT                   ALVRKNGTIPYLRPDGKTQVSLEYVDGQAIRAENLVVSAQHHPGATEAQIRGDIIEHVI
FT                   KPVVPEHLLRPDTTILVNPTGRFVKGGPMADTGLTGRKIIVDTYGGWVSHGGGAFSGKD
FT                   PTKVDRSGAYMTRYAAKNIVAAGLAEKCMIQIAYAIGVAEPVSLMVDTFGTGKISDEAL
FT                   TDLIERHFDFRPAAIIRDLDLRKPQYRRLAAYGHMGRIDLDPLPQWERTDRADALARDA
FT                   KRL"
FT   gene            complement(144415..145464)
FT                   /locus_tag="Amico_0148"
FT   CDS_pept        complement(144415..145464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0148"
FT                   /product="Pyrrolo-quinoline quinone"
FT                   /note="KEGG: hypothetical protein; PFAM: Pyrrolo-quinoline
FT                   quinone; SMART: Pyrrolo-quinoline quinone beta-propeller
FT                   repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56295"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECL3"
FT                   /inference="protein motif:PFAM:PF01011"
FT                   /protein_id="ADE56295.1"
FT                   /translation="MRKNHILMLAIFFLLVFTLPGLAAEKEPLWQFEAGMPLTGTPTYD
FT                   KGVVYIGDQGGAVYALNAETGELIWQYDAGTSINGAAAMNEKTIFVGGTDGRVFAIERS
FT                   SGNLLWQTLLGLDLAPGAIWGSPIYGAERLFAGSADGRIYAFDPETGVVLWTFDTGREL
FT                   RSTPLYHEGLIFVGDHIGRFHALDPKTGNRQWGGGSGGPIDTATTTWKGFIYFGSWDGL
FT                   LSCVKIKGIIPQWKYNAKSAITTSATPEDGRLFFGTQKGILHAVDAITGQMLWTYETEG
FT                   AMQATPIAFNNIVYIGTATGKVAAISAIDGNMIWEYQTDREILASPALGDGRVFLGSMD
FT                   GKVYAFSTE"
FT   gene            145645..146739
FT                   /locus_tag="Amico_0149"
FT   CDS_pept        145645..146739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0149"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dat:HRM2_44840 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56296"
FT                   /db_xref="GOA:D5ECL4"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="InterPro:IPR026366"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECL4"
FT                   /inference="similar to AA sequence:KEGG:HRM2_44840"
FT                   /protein_id="ADE56296.1"
FT                   /translation="MLKGFNSLLMSRLGPIITGGVVGLLAALLVRWGNPGNMGICVACF
FT                   TRDIAGALGLHRAAVVQYLRPEIAGFILGSFVSALVYREYVPRSGSAPVIRFFLGMFAM
FT                   IGALVFLGCPWRAYLRLAGGDWNAIAGIAGLVAGIGIGIVFLWKGFSLGRSYEAPKGTG
FT                   YFMPVAAIALLVLVIMAPAFGKDGTGPIFFSESGPGSAHAPIIISLIVGLLVGWMAQRS
FT                   RFCTVGAIRDLVMVRDSHLFNGVLAFIVIAFATNIVIGKFHPGFEGQPIAHTNTLWNFM
FT                   GMVLSGLAFTLAGGCPGRQLIMSGEGDGDAAVFVFGMLVGAAVSHNFSLASSGAGPAAF
FT                   GPSATIVGLVFCLAVGLIMRQRLN"
FT   gene            146752..146970
FT                   /locus_tag="Amico_0150"
FT   CDS_pept        146752..146970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0150"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein; KEGG: sfu:Sfum_3169 SirA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56297"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECL5"
FT                   /inference="protein motif:PFAM:PF01206"
FT                   /protein_id="ADE56297.1"
FT                   /translation="MSESIIVDARGLSCPQPVLETRKALKDLSGGQVEILVDTVTSREN
FT                   VARFARSQKWDVAIEQYEGGYKVVLTK"
FT   gene            147131..148222
FT                   /locus_tag="Amico_0151"
FT   CDS_pept        147131..148222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0151"
FT                   /product="2-nitropropane dioxygenase NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase NPD; KEGG:
FT                   glo:Glov_0358 2-nitropropane dioxygenase NPD"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56298"
FT                   /db_xref="GOA:D5ECL6"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECL6"
FT                   /inference="protein motif:PFAM:PF03060"
FT                   /protein_id="ADE56298.1"
FT                   /translation="MSRSIPVLKIGKYQPRYPLIQGGMGVGISGPNLAGNVALHGGVGT
FT                   IASVGLACNQPYYTGRNYFEANQRAVREGLIKAREIAGEKGVLAVNCMVALTDYELHVR
FT                   SACEGGVNIIISGAGLPIKLPDYTKDFPEVALVPIVSSAKAASLIARRWERLYNRLPDG
FT                   FVVETPLYAGGHLGVTKMEQVENEEFSLEKVVPEVVEYVEKELKTPTPVIAAGGIWTRE
FT                   DIEHAFDLGASGVQMGTRFACTYEGDASDRFKQAYIDATEEDVVIIQSPAGLPGRALRS
FT                   PFIDKYLREGTVGNKPCIANCLTHCRYRTERKTFCIAQALIDAFFGNWEEGLFFCGTNV
FT                   TRITKKEYVADIIAELFGPQENK"
FT   gene            148309..150618
FT                   /locus_tag="Amico_0152"
FT   CDS_pept        148309..150618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0152"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   mca:MCA1632 mechanosensitive ion channel family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56299"
FT                   /db_xref="GOA:D5ECL7"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECL7"
FT                   /inference="protein motif:PFAM:PF00924"
FT                   /protein_id="ADE56299.1"
FT                   /translation="MKKTWPARLPRAWILLLLMSIFMALPTAGCGAVLPLPGSVPLSSS
FT                   GEGVAQEESFFTPEKIKQRIVEIEKTIETLQSSQPLLTSEQVGLTEGEINSRLKGLESL
FT                   IALYQRYLSVAERAKKTQSDFEKQKAESQKDIAALVPDNPPYSLSFYENYRGRLETLSQ
FT                   EIDTVTYAIRLSESAIVSLKEKIRQNEQHLAMLKEEQTPSKFSEWVQQEVELETEKNRL
FT                   SLAFREKNVEESRLRFDMLEMERKNVTEGMKWIAQHLQYDEADLKRQVSLIKERERQLQ
FT                   EQAETLRQESEKAREEFMNAQARAESASDAENLSLYRAQQSEKETWYVYYQAAMDQAEQ
FT                   AQVWAEETREIWETRYSLLEKKLPTAELIKRRTETEMRKKDLDNVLLGLQKMQVSLQSR
FT                   LLTLDSSMASESESSPLYRVLRQESEGLKKQIELNGQYMTSLLSISMLNTRLLEELESL
FT                   LSSVTITEKVSVASLERLRAFLNFQLWSGDGFSVSVKKLILAVIIVLLGFIASRKATKG
FT                   VKQYLLRRFEMDPTAAMAIQKGLFAILVFICILAALDMVNIPLTAFAFLGGALALGVGI
FT                   GAQNIFSNLISGLILFFSKPFRVHDIVEIEDIVGTVEEIESRSTRIRTFDNVDVLVPNR
FT                   YFLENRIVNWTRTDQVIRGKVKVGVAYGSPAREVERLLLVAASSHKDILTMPEPYVIFN
FT                   DFGSSSLDFDLYFWVDMRKASRFVAQSDLRYKIIELFEERNITIAFPQLDIHFDKDVSH
FT                   NMAIVNHPQGKEASRE"
FT   gene            150615..152270
FT                   /locus_tag="Amico_0153"
FT   CDS_pept        150615..152270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0153"
FT                   /product="peptidase M20"
FT                   /note="PFAM: peptidase M20; KEGG: oan:Oant_3500 peptidase
FT                   M20"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56300"
FT                   /db_xref="GOA:D5ECL8"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR012166"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECL8"
FT                   /inference="protein motif:PFAM:PF01546"
FT                   /protein_id="ADE56300.1"
FT                   /translation="MTHPPSPERLFSLCIDLASIPSVTGLPGRENEAAYSIYRWLGDLP
FT                   YFHERPENIFLIPVQNDGLKRHCIAALVEADPPCKETIIITGHFDVVDAKGYGSLESLA
FT                   FQPQNYTERLKKEALPKDARADLESGQYLFGRGMADMKYGLALEMACMEKFSESPEKMQ
FT                   ANLLFLAVCDEEGMSAGMRSAVPWLRGLQKKKNLEYLVCINTEPSVGESAERGYLYLGT
FT                   IGKIMPLFFCVGREAHVGEYFKGISAPLIASCLMTLVEGDAESADRWKDRVFPPMACLK
FT                   LADLREQYAVTLPEMAVVFFNSLVVQKTPGQVLEYMNKRAEEALSRALALREGERQKLS
FT                   FSFDQEEKEQGVVLTIQELIQDVAGQKGCLPQDVLGPILSGIHSGKTIHDRGIEAVRLL
FT                   LRESNRRGPLIITGFLPPWYPPRCNRDASRGDRVIRMVAQEIVEESADLTEEPLEIKEV
FT                   FEGIMDLSYMGFQGEEHDMEAVAANMPLWGADYHFPAEDLLSLDVPVMNLGPIGKDVHQ
FT                   YTERINLSYALHVLPPLFVKAIERIPKVYRSLLY"
FT   gene            complement(152411..153499)
FT                   /locus_tag="Amico_0154"
FT   CDS_pept        complement(152411..153499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0154"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dde:Dde_0554 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56301"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECL9"
FT                   /inference="similar to AA sequence:KEGG:Dde_0554"
FT                   /protein_id="ADE56301.1"
FT                   /translation="MAFQLPIYVEPNFDKEPFVSAPDAGICKVEAEGVAPPGYHALSIY
FT                   PEYFKVNSQWSLVRESRMDCVPVVRNEGIIEAVEFRNLHVGDKVIVGRSEDGRYGIYLH
FT                   ATPFAMPEESGDVFSFRTGRSRETAYSRDYDNLYELMRYERDHGYIIWVLGPAVIFDHD
FT                   SKKALSELIEHGYAHALLSGNAMATHDLEGSMKRTALGQDIYTQEQRPLGHYHHLDLIN
FT                   TVLQYGSIEKFIEEENINDGVMYSAIKKGIPVILAGSIRDDGPLPTVIGNVYDAQDAMR
FT                   ACTKKATTVIALATQLHTIATGNITPCYVNREGRIRPVYFYSIDVSEFAVNKLRDRGSL
FT                   SVTPIVTNVQDFLVHLRNNLVP"
FT   gene            153635..154816
FT                   /locus_tag="Amico_0155"
FT   CDS_pept        153635..154816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0155"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   ank:AnaeK_4395 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56302"
FT                   /db_xref="GOA:D5ECM0"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECM0"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ADE56302.1"
FT                   /translation="MVKRGNIWRKGLIGFLFVALLIGVVGVTPISAQEKPIKIGYLAAL
FT                   TGDWAAYGQTEEKSAKLAVDEINAKGGVLGRKIELVVYDFRTRAEDAVNAVRRMIEEDK
FT                   VVALVGANGSGINIATAPLVNRYGVAQIGTVSTNPLVTVDEKGNVRPFSFRICFTDPYQ
FT                   GKLIAYFAAKELGRMNAAILYDVGNDYSHGLREFFMASYGGYGGTVVADLGFRGGQDVD
FT                   FRAQLTEIRDKKADVLILPNMGKEMALIMKQARELGMNEIVFVGGDGYGEFMWEIAGDA
FT                   MENSYWINHVAPEDPAMQLFFKAYKEKWNDECKEFVNGVLGYDSVYWLVDAIARAGSDD
FT                   PKAIRDALAATSNLALHHATITIDPANNTPKDKDGVVLVAKEGRGQFYKKIKP"
FT   gene            154909..155778
FT                   /locus_tag="Amico_0156"
FT   CDS_pept        154909..155778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0156"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   dma:DMR_22440 ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56303"
FT                   /db_xref="GOA:D5ECM1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECM1"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADE56303.1"
FT                   /translation="MQQVINGLSLGSVYALIAVGYSLVYSVLLFSNFAHGGFLVIGGYI
FT                   CYGALKSMGVNIWLAGMLSLAGAGIAAALTERIAYKPIRERTNVTLYLLIASMGMSIVI
FT                   ENIFVIVAGGRFRALPPVIPTYPVQLFGLATTSAFDLLSFLIALIALGCLQLFLSRTKW
FT                   GLAIRAAACDLRTAGLMGVNVNLLISIVFFTAGALAAIGGIFLSVRYTLYPQLGAITIK
FT                   AFVAAVIGGLGSLPGAVVGSLILGLAEMLAAGFISSQMRDLVVFSLLVITLLIKPSGLF
FT                   GKQMSEKI"
FT   gene            155789..156655
FT                   /locus_tag="Amico_0157"
FT   CDS_pept        155789..156655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0157"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   gem:GM21_2271 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56304"
FT                   /db_xref="GOA:D5ECM2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECM2"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADE56304.1"
FT                   /translation="MSGYTEGIITLLCINAIAAMGVSLLTGFTGIFSLGHAAYMALGAY
FT                   TSAILTVHYGVHWLPAILLGGGVAVIVAYGIGIPTLRLMGDYFAIASIGLGEAIRLILE
FT                   NWQSLTRGARGYPGIEPYTTLPVALTFFVIMALCMFNLINSRYGRAFKACRDDYVAASL
FT                   LGFHTARLRVLSLMISAFYCGVAGALLAGFLSFIQPIMFDMLKSTELTAVVVFGGLGSM
FT                   AGTMVGTLVITLVTELFRPISQYRMLIYGAVLVIIMVIRPEGIMGGLNGGGLLNKIFRR
FT                   KDNGGTA"
FT   gene            156639..157412
FT                   /locus_tag="Amico_0158"
FT   CDS_pept        156639..157412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0158"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: bba:Bd3388 branched-chain amino acid transport
FT                   system; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56305"
FT                   /db_xref="GOA:D5ECM3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECM3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADE56305.1"
FT                   /translation="MAALLELNGVDKFFGGVHAVQSMSFALNEKEIVGLIGPNGAGKTT
FT                   IFNVVTGVYDPDGGRILFDGEDITPLKTYEVIRKGIARTFQNLRLFPRSSVLENVMTAA
FT                   QQHEAYSFVEAVTHFGKWRMKETSIRDRSMELLNRVGLADRALQPAGTLPYGYQRRLEI
FT                   ARALALDPRLLLLDEPAAGMNPEEVMALNELIKSIHMEFQLAILVIEHHMDLVMEICPR
FT                   IICMNFGAKIAEGSPEEIQANSEVLKAYLGEEDEE"
FT   gene            157409..158152
FT                   /locus_tag="Amico_0159"
FT   CDS_pept        157409..158152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0159"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: dal:Dalk_3944 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56306"
FT                   /db_xref="GOA:D5ECM4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECM4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADE56306.1"
FT                   /translation="MSDVENILLDVQNLQVSYGAIRALRGISLQVKEGEIVCVIGANGA
FT                   GKSTLMNALMSEVRREKGLINFSGAPLAQRSYDVVKQGISLVPEGRRVFAPLTVYENLM
FT                   MGAFPRKEPEKVKQDLQWVFSLFPRLEERRDQYAGTLSGGEQQMLAIGRALMSRPRLLL
FT                   LDEPSLGLAPIIIRDIFKELRRINSEGVTILLVEQNARQALLLSHRGYVLQTGSIIMAG
FT                   TSEDLLNSADIRNAYLGAGRKKGLL"
FT   gene            complement(158247..159368)
FT                   /locus_tag="Amico_0160"
FT   CDS_pept        complement(158247..159368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0160"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   dal:Dalk_5023 aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56307"
FT                   /db_xref="GOA:D5ECM5"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECM5"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADE56307.1"
FT                   /translation="MKLPAFKIERYFARYEFKTEFLLCPSDCESFSLSELLQMADTESL
FT                   SLWKNLRLGYTESLGHPLLREEIAALYTGLSKEDVLLAVPEEGIFLAFNGILEPGDHVI
FT                   AISPAYQSLYSIPEGMGCEVSYWSVKEKNGEWTLDLDELEGMIRPATKMIVVNFPHNPT
FT                   GYLPEKKDFLKIVDIASRHDLYLFSDEMYRFLEFDEMSRLPSACTVYEKAVTLGGLSKA
FT                   FGLPGLRMGWLAAQDREILNITAQLKDYTTICGSSPSEILSLMSLRAKEKILQRNRALI
FT                   ASNLEEIETLFHKHDDLLHWVPPKGGSIAFPALKGNIPIEAFCQEAIDQYGVLIIPGTL
FT                   FGSKENRFRVGFGRATFSEALKQFEVFLNNRKG"
FT   gene            complement(159390..159671)
FT                   /locus_tag="Amico_0161"
FT   CDS_pept        complement(159390..159671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0161"
FT                   /product="MoaD family protein"
FT                   /note="KEGG: gsu:GSU0908 MoaD family protein; TIGRFAM: MoaD
FT                   family protein; PFAM: thiamineS protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56308"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010038"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECM6"
FT                   /inference="protein motif:TFAM:TIGR01687"
FT                   /protein_id="ADE56308.1"
FT                   /translation="MKLRVHAFLIYATGEKEFDMKAPATIRQLLEDFSNRFGEPFDKWI
FT                   WSSNEVPHRLMAGTIIMVNGKHIAHLNGLDTPLCDEDVVNIFPPVGGG"
FT   gene            159826..160242
FT                   /locus_tag="Amico_0162"
FT   CDS_pept        159826..160242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0162"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="KEGG: gur:Gura_3908 BadM/Rrf2 family transcriptional
FT                   regulator; TIGRFAM: transcriptional regulator, Rrf2 family;
FT                   PFAM: protein of unknown function UPF0074"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56309"
FT                   /db_xref="GOA:D5ECM7"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECM7"
FT                   /inference="protein motif:TFAM:TIGR00738"
FT                   /protein_id="ADE56309.1"
FT                   /translation="MKLSTKTRYGLRALLELVRQYDGRTPLSITDIASKENISERYLEQ
FT                   LFLKLRRDGLIESVRGPQGGYLLSRAPMEITVAEVVEVLEGNIQIADCLEGPECMRESA
FT                   CPARKLWLRLRDSIDNVLVSTTLKDLIEDHDLQK"
FT   gene            160271..161473
FT                   /locus_tag="Amico_0163"
FT   CDS_pept        160271..161473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0163"
FT                   /product="cysteine desulfurase NifS"
FT                   /EC_number="2.8.1.7"
FT                   /note="TIGRFAM: cysteine desulfurase NifS; KEGG:
FT                   sat:SYN_01251 cysteine desulfurase / selenocysteine lyase;
FT                   PFAM: aminotransferase class V; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56310"
FT                   /db_xref="GOA:D5ECM8"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR017772"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECM8"
FT                   /inference="protein motif:TFAM:TIGR03402"
FT                   /protein_id="ADE56310.1"
FT                   /translation="MRQVYMDHAATTPVASEVLKEMMPYFTESFGNPSSLYTLGQQNKE
FT                   VVRAAREKVAEVLNASPDEIYFTSGGTESDNWALKGVAFTYRNKGNHIITTKIEHHAVL
FT                   HSAEYLAGLGYDITYLGVDEEGRVSVDDVRKAITEKTVLVSVMFANNEIGTIQPIAEIG
FT                   RLCREKGVLFHTDAVQAVAHIPIDVKAMDIDLLSLSAHKFYGPKGTGVMYIRKGVKLDN
FT                   FIHGGGQEKGRRATTENVAGIVGLGIAIERAAGKISSEKSRLTALRDGLIEEIMARIPY
FT                   AKLNGAAGDGRLPNNVNVSLIGVEGETLLMDLDMFDIAASTGSACSSGSLDPSHVLMAI
FT                   GLTHEQAHGSLRLTLGESTTEEDVAYVVEKLAGIVERRRNMSPLWEDFLKAEERSEKNA
FT                   L"
FT   gene            161463..161906
FT                   /locus_tag="Amico_0164"
FT   CDS_pept        161463..161906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0164"
FT                   /product="FeS cluster assembly scaffold protein NifU"
FT                   /note="KEGG: dol:Dole_0755 NifU domain-containing protein;
FT                   TIGRFAM: FeS cluster assembly scaffold protein NifU; PFAM:
FT                   nitrogen-fixing NifU domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56311"
FT                   /db_xref="GOA:D5ECM9"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR017787"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECM9"
FT                   /inference="protein motif:TFAM:TIGR03419"
FT                   /protein_id="ADE56311.1"
FT                   /translation="MLYSEIVMDHFQNPRNVGEIKDADGVGEAGNPRCGDIMKIYIKVE
FT                   NDHIVDIKFKTFGCASAIASSSMATELVMGKTIEEAWNITNSAVAKALDGLPPIKMHCS
FT                   VLAEEAIHGAINDYRRRQGLEPWEDKSHDELVDEHSHHFHHQG"
FT   gene            161909..162595
FT                   /locus_tag="Amico_0165"
FT   CDS_pept        161909..162595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0165"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein; KEGG:
FT                   gur:Gura_1193 UBA/ThiF-type NAD/FAD binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56312"
FT                   /db_xref="GOA:D5ECN0"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECN0"
FT                   /inference="protein motif:PFAM:PF00899"
FT                   /protein_id="ADE56312.1"
FT                   /translation="MIPRRYDRNIASLGMEGQERLFRCHVLVAGCGGLGGVVVEILARA
FT                   GVGTLTLVDGDVFSESNLNRQLLAKEDNFGRLKAEAAEARVKEINGHVNVWAVPHMLTE
FT                   DNCQSLLAGVDLAIDALDSNLARAVLYKGCKEAKVPVIHGALGGMIGQVGRYRPWEKTH
FT                   FDVFEGSLPDAGIEVAAGTPSFTPYVIGALEAAEAIKYLAEVEEIRWGTLTLVDLAIMS
FT                   METLEL"
FT   gene            162610..163170
FT                   /locus_tag="Amico_0166"
FT   CDS_pept        162610..163170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0166"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="TIGRFAM: DNA-3-methyladenine glycosylase I; KEGG:
FT                   vfi:VF_A0815 3-methyl-adenine DNA glycosylase I,
FT                   constitutive; PFAM: methyladenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56313"
FT                   /db_xref="GOA:D5ECN1"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECN1"
FT                   /inference="protein motif:TFAM:TIGR00624"
FT                   /protein_id="ADE56313.1"
FT                   /translation="MKRCPWAETHPLLTAYHDEEWGVPQYDEERLFELLILESAQAGLS
FT                   WLTVLKKREGYRDAFAQFDVEKVAAFDQQKIEGLCQSPHIIQNRRKIAAAVNNARQFIA
FT                   IAEKHGSFSRFLWSFVDNKPITNHWKNPSDVPASTPLSARLSGELKKRGFTFVGPIICY
FT                   SYMQAVGMVNDHLIHCFCHGKSF"
FT   gene            complement(163174..164994)
FT                   /locus_tag="Amico_0167"
FT   CDS_pept        complement(163174..164994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0167"
FT                   /product="Aldehyde ferredoxin oxidoreductase"
FT                   /EC_number="1.2.7.5"
FT                   /note="PFAM: aldehyde ferredoxin oxidoreductase; Aldehyde
FT                   ferredoxin oxidoreductase; KEGG: pca:Pcar_2514
FT                   aldehyde:ferredoxin oxidoreductase; SMART: Aldehyde
FT                   ferredoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56314"
FT                   /db_xref="GOA:D5ECN2"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECN2"
FT                   /inference="protein motif:PRIAM:1.2.7.5"
FT                   /protein_id="ADE56314.1"
FT                   /translation="MKMQMVHIDLSTGTIDTFSVEEGVARRFIGGSGLGTYFYFKYSRP
FT                   EIDPLGAENPLIFMNGPFQGTGIPTSGRHQIVSKSPLTGAHGESDAGGTFGFHLLRGGF
FT                   YGLIVEGKAEKPVYIVIRNGEVSLRDASLLWGKDSFETEQMLKEEFGGACGVSCIGPAG
FT                   EKMALIAGIMHDGPHARAAGRCGLGAVMGSKNLKAIVAGGTFRPGLFDEEKVRALSKEK
FT                   HLLFSQKLAGMTRFGTAGGVSLAEEYGDLPIKNWQQGSWKPEVLSITGEAMADTILTEN
FT                   YGCVACPIRCGREVAFDNIAGAGPEYETIGMLGSNCLVNDLKDIARAADICNRYGLDTI
FT                   STGAAVAFAMELFERGIVTEKEIGFPLNWGDGKAMIRIVEAMGKREGFGAILSLGTRKA
FT                   AEIIGHGAERYAIHVKGLDLPAHDPRCYKSLAAGYATSSRGACHLSGYTYACERNATYK
FT                   DFGITEVLDRTIDDGKGELNVPFQNFMGVLDSLKICKFPILACVSIDDLLTWIHGVTGW
FT                   EMTREELEETGKRIFTLKRLFNSRCGFTKDDDTLPERILHEPRGTGGAADTLPDLQKQL
FT                   ECYYAARGWDEKGIPTYEQLKKLGIEEFAL"
FT   gene            165094..166041
FT                   /locus_tag="Amico_0168"
FT   CDS_pept        165094..166041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0168"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="KEGG: dat:HRM2_42030 hypothetical protein; TIGRFAM:
FT                   cation diffusion facilitator family transporter; PFAM:
FT                   cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56315"
FT                   /db_xref="GOA:D5ECN3"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECN3"
FT                   /inference="protein motif:TFAM:TIGR01297"
FT                   /protein_id="ADE56315.1"
FT                   /translation="MEFNRGERALLVTSVGFWINLILTIVKYAAGFTAHSGAMIADATH
FT                   SLSDLVTDVVVFFGFKVVNKPADKDHRYGHGKVETLLASLCGVVLFVAGTGILLEAAHK
FT                   IIMILRGEALPRPGMLALGAAFLSIVVKELLYRYTAHWAKNINSPALLAKAWDHRSDAF
FT                   SSIGVLFGIAGARFLGGGGRILDPIAAAAVSFFIIRVSLPIMLESLNELLEGALDRETE
FT                   ERIIALIRESKEIREVHHLRTRRVGPYIAMETHVLVDRSMSLVEAHYIASVVEDRLHQE
FT                   FGPETLISLHVEPLPERGKDHVDDHVSEHPNHPH"
FT   gene            166134..167108
FT                   /locus_tag="Amico_0169"
FT   CDS_pept        166134..167108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0169"
FT                   /product="chaperone DnaJ domain protein"
FT                   /note="KEGG: afr:AFE_3102 curved DNA-binding protein; PFAM:
FT                   chaperone DnaJ domain protein; heat shock protein DnaJ
FT                   domain protein; SMART: heat shock protein DnaJ domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56316"
FT                   /db_xref="GOA:D5ECN4"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECN4"
FT                   /inference="protein motif:PFAM:PF01556"
FT                   /protein_id="ADE56316.1"
FT                   /translation="MPVTYKDYYAVLGIDRNATQDDVRKAYRNLAKKYHPDVNKSPGSE
FT                   ERYKEINEAYEVLKDSDKRQRYDTLGNQWREGQTFTPPPEWGQGGTFRMDFGEGGGSDF
FT                   SEFFKTIFGGFGGVQGGAEDFFFRGAPRRRKGEDIEVQMELTLSDVICRDSKTISLERY
FT                   EIGADGRRIPRTQTLTINFPQGITDGSRIRLPGKGGQGMGEGPNGDLYITIKLRKDPHF
FT                   QVDQYDLTTVMRVSPWEAALGTSLSVKTLQGVVSMKLPAGTQSGQRLRLRGKGLPRRKG
FT                   AQPGNLYVIVEIAVPKSLSQKERELFEELAKVSSFNPRGMKDQ"
FT   gene            complement(167102..169312)
FT                   /locus_tag="Amico_0170"
FT   CDS_pept        complement(167102..169312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0170"
FT                   /product="penicillin-binding protein 1C"
FT                   /note="KEGG: dma:DMR_17570 penicillin-binding protein 1C;
FT                   TIGRFAM: penicillin-binding protein 1C; PFAM: glycosyl
FT                   transferase family 51; Penicillin- binding domain protein;
FT                   penicillin-binding protein transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56317"
FT                   /db_xref="GOA:D5ECN5"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR009647"
FT                   /db_xref="InterPro:IPR011815"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECN5"
FT                   /inference="protein motif:TFAM:TIGR02073"
FT                   /protein_id="ADE56317.1"
FT                   /translation="MEARSPLNKKWRKGLVLGGALLFLLWVSPLLIPLHIEKVREWPTS
FT                   PILLDEKLRPFFVSLSSSSEWCIPISYEQMGAWLPHIAVAIEDRKFWSHHGVDFFAIAR
FT                   AGLQNIRAKKVVSGASTITSQVIRLSISRPRTIPMKIAEFLQAMKLERLLSKKEILEIY
FT                   LNRAPFGSNIRGVEAASRIWFGKPAATLNVEEAALLIGMLRGPSLFRPDRNPKRAMTLR
FT                   NQILAAIADQKLISKSFAAKRAGTPLPDQTYSMPALAFHFAHQVLSQSEALVITTTLDM
FT                   QLQKRAEHVIQRTLSGLPPSITGAAMVVHNPTGAILAYVGNGRLGTKQWGSWIDCCQAL
FT                   RSPGSALKPFVYLEAFRRGLLTPSSLLVDSPLSFGGLAPRNFDLTYRGPVSARKALALS
FT                   LNVPAVRVLRTVGTETLLQTLRAAGIASLTHEPSHYGDSLILGGCETTVTQMALAYETL
FT                   ANLGIQRPLQMVKENDAPYEKRIFDEASCFLIADILRDPGRLLPVHQEGMANQNMSIAF
FT                   KTGTSYGLRDAWTAAYTPEHTIVVWFGDPAGFPHPLLTGLKIASSAAIEMIQAATKGKC
FT                   KWYMPPAALAQREVCALSGLPPTKNCPAHRMDWYIPGISRNDRCSIHQKGKGQPDIPLT
FT                   QEPQKLTITSPLPQSQFFLTPEGRGQKIALRCEGSKDILFWYLDNEFFGQSKAPKELFW
FT                   KLSPGRHSISVMDEQGRSDSISIEVLSLSSPKPQSAPLLELH"
FT   gene            complement(169287..174566)
FT                   /locus_tag="Amico_0171"
FT   CDS_pept        complement(169287..174566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0171"
FT                   /product="alpha-2-macroglobulin domain protein"
FT                   /note="PFAM: alpha-2-macroglobulin domain protein; alpha-2-
FT                   macroglobulin domain protein 2; KEGG: dma:DMR_29510
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56318"
FT                   /db_xref="GOA:D5ECN6"
FT                   /db_xref="InterPro:IPR001599"
FT                   /db_xref="InterPro:IPR002890"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR011625"
FT                   /db_xref="InterPro:IPR021868"
FT                   /db_xref="InterPro:IPR041203"
FT                   /db_xref="InterPro:IPR041246"
FT                   /db_xref="InterPro:IPR041462"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECN6"
FT                   /inference="protein motif:PFAM:PF01835"
FT                   /protein_id="ADE56318.1"
FT                   /translation="MKKKNIPLLTFVILVLFLVSGHLWAAEDFVVTDFKPQGSIEERAP
FT                   LITVVFSAPVTPSETWPLSIYPAIPAEGTWNDPQTFTLKLIKPLSSATQYTVEMKEDLR
FT                   DEKGRLLAGRHSFRFQTPSLTFVECRQIDLTEDGLATLELLFSAPVSPIRIRGFATLKD
FT                   SYGRMVPYSVSGEHPSTSITLTTRPFDGNELLLSIASGLTSEAGPLGLEKPIEQKILLS
FT                   SALAVRGSWNYLQGPNRGSIMIQTSSPIDMAKASNFISLEPKIPFTVNPEYNGFTIDGP
FT                   FQPRQRYVLTLKKELSTRTGSQLGEEFKKAFVFSDVEPSIAFPTGGMFLSPAEDSRIPL
FT                   ETVNIDEVEMSLWRLYENNIPYAVMTGINSVPRELSNLTAQKKAKIQGTPNIAERRAID
FT                   LRELAKDEKGVFLLTARNTAPNTWQEAQQVVALTDIGIMARTYSEGIMVWANSIRKLEA
FT                   LVKAEVRVYSRSNQLIAEGKTGRDGIFMLHRTAPWNDELRPFLITVEKDGDMSFLPLDR
FT                   NVVADNGFDISGRPYLRKGYEAFCFAPRNIFRPGETAQFKAIVRDGAHQAPSSFPLLLT
FT                   ITSSHGKELSRSTAKLSQEGTLLYSWEIPENIMTGAYQLALLMPGNEKTPLGTMTFYVE
FT                   EFAPPRLEVLIEESVKALKPEEELLLSFSSRYLFGAPASDLPWEGEVRAVSSSFAHPKW
FT                   KAYIFGDPEKKSEPVNEFIGQGNLDETGKGSLSYKARGELMAPSVLNFLFTIRVREEGG
FT                   RWVPQTVSIPCYPAPYMIGIEKSKDAPLPQKPYEIRVAAVIPDGTPAPLHSLTVSVSKI
FT                   MKHYTLKRYADQTRMEEQEEIGTPEVKEVALSQGIGLFTFTPQEPGEYLLQFEDQETGS
FT                   SASTRLQVWYSFGSGEGGSPLIDRVIISTDKEKYVPGETATVNIQSPFQGLLLFTVDTD
FT                   RQLIRKIEEMKSGETSLKVKITEDMVPNAYCTAWVIRSVSDKDYDAWGAHRALGTIPLF
FT                   VDKPESHLSVSIESPQEIEPGSRLPVTVWLKDFKQRPVEGYVALALVDEGILGLTGYET
FT                   PAPDTFFLGKRELSAFTNDMYDQLMPLESRKTPLLHPSGGDSAEAMYDAAMGGLLSPLL
FT                   TGRSFTILSLFEGEAGTNHEGKAVIDLDIPEFSGKGRLMAVAVAGSAFGSFAQSVVIQR
FT                   DIVVEPSLPRAVAPGDHFIMPVTLFSQGDVEQKVTLRVKEVQGMTIDDNKVVTLSVPAK
FT                   GRISTAMPVTAGAKAGTGSLDIEAQWGEKSFTLSKEITIRPPYPKITTTQSGVITEEGD
FT                   HTLPVSGGWFSGTQKGTLILSALPTANLTGAFNFVHYYPYSCLEQTVSRGWPLLVMPNL
FT                   AKHIDPLLSSKKEVEKQLESILRRLGNLQLFDGSFVSWSGEGIPHLWGSVYASHFLVET
FT                   AKKNIPLPEGLLEGALSYLRQILSLSDEEGPEKLAVRAYASYVLTLNGEPPLGWMEHLK
FT                   GHRQAMTDSGRIFLAGAYSLYQKNTAPLKELGQVLFSTEEGVGGPTYELYWRNKALLLL
FT                   MWNALDPLAPETIALASELTEQLYKETWETTQENALVLLALGRYMESTLPLQKKPFTAE
FT                   VFLSEGSPLAKISEKEEIALPLDAVSHDLILRLKGEGPLYYGLSLSGVPEAAVEAYNKG
FT                   IEVRRVVNSSASLGQKLSVELYVTPLAPTTTLVLSDLLPGGLEIESTGEIYYMPADGGE
FT                   IRAEKRDDRLILFITNLKGPLIYRYTTRAVTRGTFALPPVSVEDMYNPGIRSLSHGGTL
FT                   TIE"
FT   gene            174835..177459
FT                   /locus_tag="Amico_0172"
FT   CDS_pept        174835..177459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0172"
FT                   /product="ATP-dependent chaperone ClpB"
FT                   /note="TIGRFAM: ATP-dependent chaperone ClpB; PFAM: ATPase
FT                   AAA-2 domain protein; Clp ATPase-like; AAA ATPase central
FT                   domain protein; Torsin; ATPase associated with various
FT                   cellular activities AAA_5; Clp domain protein; KEGG:
FT                   sfu:Sfum_0263 ATPase; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56319"
FT                   /db_xref="GOA:D5ECN7"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECN7"
FT                   /inference="protein motif:TFAM:TIGR03346"
FT                   /protein_id="ADE56319.1"
FT                   /translation="MDISKFTKKSQEALSSAQDMALRWGQQEVDGEHLLLALLEQSEGL
FT                   IPRILQKMNVPVDALKKDVERELEKRPRVSGPGLEPGKIYISRRVSQILVQAQERAERL
FT                   KDEYVSVEHIFSCFLEEGSATAAGRIIAGYNITIESFLETLTAVRGSQRVSSENPEETY
FT                   EALDKYGRDLVKMARLGKLDPVIGRDEEVRRVIRILSRKTKNNPVLIGDPGVGKTAIVE
FT                   GLAQRIVRGDVPEGLKDRSIFALDMGSLVAGAKYRGEFEERLKAVLNEIKTSEGRIILF
FT                   IDELHTIVGAGAAEGAIDAGNMLKPMLARGELHCIGATTIDEYRKRIEKDAALARRFQP
FT                   VLVEQPDVEDTISILRGLKERLEVHHGVRIRDNALVGAAVLSNRYITDRFLPDKAIDLV
FT                   DEACAMIRTEIDSLPAELDAASRKVMQLEIEEAALKKEKDAASLERLSVLQKELQEARE
FT                   EADALRAQYESEKEVISKVRKMREEIDAVKREIEKAEREYDLNKAAELKHGRLPELQQQ
FT                   LKKEEGAHAAGQEGDQLLREEVTEDEIAEIVSRWTGIPVTRLMEGEREKLLKLDEILHQ
FT                   RVIGQDEAVELVADAVIRARSGIKDPRRPVGSFIFLGPTGVGKTELAKTLAEALFDSED
FT                   NMIRIDMSEYMEKFSVSRLIGAPPGYVGYEEGGQLTEAVRRRPYSVILFDEIEKAHHDV
FT                   FNVLLQILDDGRVTDSQGHVVDFKNTVIIMTSNIGAPLLLEGITGDGQIKEDAREAVMK
FT                   ELRQAFRPEFLNRVDDVVLFKPLQRHEIRQIVKLLAQELQKRLKDHRIDLELSEEAVDY
FT                   IADAGYDPVFGARPLKRFIVKQLETRMARSLVAGEVREGSKVYVTVKDKALAFQTNPPH
FT                   PDC"
FT   gene            177568..179217
FT                   /locus_tag="Amico_0173"
FT   CDS_pept        177568..179217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0173"
FT                   /product="peptidase U34 dipeptidase"
FT                   /note="PFAM: peptidase U34 dipeptidase; KEGG: sun:SUN_0886
FT                   dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56320"
FT                   /db_xref="GOA:D5ECN8"
FT                   /db_xref="InterPro:IPR005322"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECN8"
FT                   /inference="protein motif:PFAM:PF03577"
FT                   /protein_id="ADE56320.1"
FT                   /translation="MLLTLFKGADNVNRRKKCLGLAWAVPFCCLLVLVSTPSWACTAVL
FT                   VGRSASADGSVINSHTADNWYDANLRVVKGQKYSPGTMMDVYINLLGEDANPPRVIGQI
FT                   PQAEETYTYFHIGYSCFNEHQLSIGESTVGQKDELSAFLPDAKGILTIEQLEIIALQRT
FT                   KTAREAIKLMGELAETYGFLPSCVGQGEALTIADPNEAWIFEIRSVGFMWKPGSGIPGA
FT                   VWAAQRVPDDEVAVVTNGSVITEIDLSQPSYFMASKNYQDVAIQHGWYKPGSGCPFNWR
FT                   EAYSPRSGYWSMYSDWIRQRLHYLFKTLDPSKEWDPNADVSFYPFSIKPKKKISVQDVM
FT                   TMQRSTLEGTPFNMEDNPAWLVPDVNGKLVKSELATPFPDNSMRDLLNIPYHRPISAKT
FT                   SYSFVSQSRSWLPAPVGGILWFSMGHPHMGVYVPVYAGTTIIPKEWQNFKIGRFDQSSA
FT                   RWVFYLAADLVNRRYQLAFRDMEQVRVPFERELFEKQAEIEKKAVKLWSSSPELGTAYL
FT                   NEISNNGMKDAMEKWWDLCTLLISKYMWGRVW"
FT   gene            179220..181169
FT                   /locus_tag="Amico_0174"
FT   CDS_pept        179220..181169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0174"
FT                   /product="signal transduction histidine kinase regulating
FT                   citrate/malate metabolism"
FT                   /note="KEGG: maq:Maqu_2898 signal transduction histidine
FT                   kinase regulating citrate/malate metabolism; PFAM:
FT                   ATP-binding region ATPase domain protein; extracellular
FT                   solute-binding protein family 3; SMART: ATP-binding region
FT                   ATPase domain protein; extracellular solute-binding protein
FT                   family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56321"
FT                   /db_xref="GOA:D5ECN9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECN9"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADE56321.1"
FT                   /translation="MRKRFRIAAFLFTAFLIVFISLSPSRGAGAGGRVIYAVGDRALDP
FT                   FEFISETQVPTGFLVELLQSIARQKELSLNFRMVRWQEVPALLYSSHVDLLLGVADARG
FT                   NDAILPRLAPVVNIPPSSSQTDQRGVGLPNVSGKEIGQYYFSLPVLKVPYSIFTRKGLG
FT                   GSRLSDVSGKAIVVEQGSAEEEYLRLSGLASEIVLASHPVEIVHLLSSGQYDFALMNLY
FT                   QGLAICKKISIANVVATSLNLFSKDWGYTVAHGDISLAGILREGLADSRRNGTYDRLYR
FT                   KWFDEYRQDGRIDKGLIIKVVGGFAIAIILILLWNLSLKRQVTRIVRERERLIDFIRDG
FT                   ILAIDNRGRITLINRSARKLLNMTSDVEGQDVDSLVPEINLTGVLTSGETAYDLEQNVG
FT                   GTPLVINKIPVVLNNQVAGAIASFRDMSEIHAMAEEMTGVRMYVDSLRVQNHEFVNKLQ
FT                   AISGLIQLGKYERALTFIAQEQAPGQITASLIAERIKNPAVGGILLGKLGRCRELGIEC
FT                   EITPDSYCGELAAISDQALVIIIGNLMENAIEAVLNLRDRKGKISFSIFDESNQIMLCV
FT                   WDNGGKLSKEKASKIFEKGFSTKARPRTSGYGLYNIRRMVDALGGDISLDFSFDEFTEF
FT                   IVTLPNREGGDFFE"
FT   gene            181162..181842
FT                   /locus_tag="Amico_0175"
FT   CDS_pept        181162..181842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0175"
FT                   /product="response regulator receiver and unknown domain
FT                   protein"
FT                   /note="KEGG: sfu:Sfum_3992 response regulator
FT                   receiver/unknown domain-containing protein; PFAM: response
FT                   regulator receiver; SMART: response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56322"
FT                   /db_xref="GOA:D5ECP0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECP0"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADE56322.1"
FT                   /translation="MNKIEVLVVEDDPMVAEIHQNFINSLEDFRVVAVAGDGAKALELL
FT                   DVLPIRLLILDIFLPGLDGLNTLRKIRELQKNVDVIIVSASRDVSTVNEAIQAGAFDYI
FT                   VKPFVYERLKASLESFRQMEVKLKRGPRDVDQADIDSLFQVKSYKNYQSSLPKGLNPEM
FT                   LKKVESLLRRTSDSLSAVEVAESLNVSRITARRYLEYFVASGKAIMKREYQDVGRPINK
FT                   YKLI"
FT   gene            182086..182676
FT                   /locus_tag="Amico_0176"
FT   CDS_pept        182086..182676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56323"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECP1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56323.1"
FT                   /translation="MKLKTMNPKSFLLFGVVFLSAALFFAGAASAAEMPAVEAPVIVTT
FT                   CGQSPGAVMVKMSLMQSQITPAENKNTIIASDLAGKGYKTLIVTTGTSGKGMGAAGTDV
FT                   NKEIARCKELIEAAKAEGIVVITAHVEGMARRTDSADQASIDEIMPLGDAILIVAGSNP
FT                   DGYFTKLAQDNDKPLIEAKDALSIGSSLKELNK"
FT   gene            182747..184075
FT                   /locus_tag="Amico_0177"
FT   CDS_pept        182747..184075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0177"
FT                   /product="TRAP C4-dicarboxylate transport system permease
FT                   DctM subunit"
FT                   /note="PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; KEGG: aha:AHA_2628
FT                   arginine/ornithine antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56324"
FT                   /db_xref="GOA:D5ECP2"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECP2"
FT                   /inference="protein motif:PFAM:PF06808"
FT                   /protein_id="ADE56324.1"
FT                   /translation="MFIHAEVILLVIAVAFFLPKAMKLSTELSMFVAALAGAAAHSVML
FT                   RVTGSPHNPVSILPIRHIVEGAFTYFDVCLIFLTATFFMALLRESGGVAFIVRKIVSTF
FT                   HKRRTICLLLLTFVLLLPGALTGSGATTVLTVGALVGAVLSAMGVDETKRAAIIFLGAA
FT                   MSAAAPPINLWAMMAAAGANMPYVGFGKPLLVLSVAGALFSMFWLAGRGEGQVDLDKAL
FT                   ANLPEVQEGQSWFRVTFPFALLLALVLAGRIWPFSMPVLGLPLLFMIASFAVVLLSPKR
FT                   LHVWSVACATVHNLTTLVGIMVVVGILIQIMALSGARGLISLAVVTLPLGVLFATLFII
FT                   LPLSEGLVQYAVAPLIGVPLIMLFNMRGLDPIIALSAMAVIWPLGDCLPPTAVVGRATV
FT                   MELGYTGRYFQDFVKACLVPMAFIAMLGTLFLIFSTRLSFLGG"
FT   gene            184082..184246
FT                   /locus_tag="Amico_0178"
FT   CDS_pept        184082..184246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0178"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56325"
FT                   /db_xref="GOA:D5ECP3"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECP3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56325.1"
FT                   /translation="MILTNTIVMYLYYAITLFFGGAIVYNLIKTEKAQDAVLYCIILMP
FT                   FVLRLLRLK"
FT   gene            184263..185432
FT                   /locus_tag="Amico_0179"
FT   CDS_pept        184263..185432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0179"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mlo:mlr6093 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56326"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECP4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56326.1"
FT                   /translation="MKNNLKIIKIISLVIALAFAAIAGRDFYEHRHFMEPVVPSPSLTE
FT                   VKKLSDYEPSLKGTVNDSNVYVFDSGVPGGTALLIGGSHPEEPAANLTASLVAENVKVE
FT                   QGRLFVIIRSSRSASTCTRMGEAYPDFYHVKTPWGDKRFRMGDRCTNPLDSWPDPEVYL
FT                   HYPSRQMLAYMDIRNLNRTWPGRPNGAITERTTWAMTQLIRREKVDMAVDLHEAELEYP
FT                   VENTIVTHEKGQSVAAMTSMVLTAELFEVPLSMEFSPQALHGLSHREIGDHTDAMSLLV
FT                   EVAEPMIDRIRGITDEYLLMTGRDEFVMKAGEHKLLYAPIDERGWPIDVRVGRHSSTFQ
FT                   KMLEFYSLESPDRPIVISGVPGYTEVIENTLGAYLYNPEEAPEHKVFYD"
FT   gene            185568..187184
FT                   /locus_tag="Amico_0180"
FT   CDS_pept        185568..187184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0180"
FT                   /product="peptidase U34 dipeptidase"
FT                   /note="PFAM: peptidase U34 dipeptidase; KEGG: dal:Dalk_1471
FT                   peptidase U34 dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56327"
FT                   /db_xref="GOA:D5ECP5"
FT                   /db_xref="InterPro:IPR005322"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECP5"
FT                   /inference="protein motif:PFAM:PF03577"
FT                   /protein_id="ADE56327.1"
FT                   /translation="MKKLRHGMLVVFSFLLIALMAMSAWGCTDIVVGKDASADGSVITS
FT                   HTADGAFYDARVRTIPGKTFPAGSKVDVFWNIGMDEDFEPVKIGEIPQVEKTYTYFHVG
FT                   YPFMNEHGVAIGESTIGQKDELKTFRPDAKALLTIEQLEVFALQRAKTAREAITVIGEL
FT                   AEKHGFLPSCGTEGESLTITDAEEAWLFEIRSAGFMWTPESGKPGAVWVAQRVPDDGVV
FT                   VIPNMSRIREIDVNDKKNFMASKDYMQLAIDNGWYDPNSGKPFIWQEAYSPLTGNEDWS
FT                   LSSMWIRNRLYTLYSQLDPSREWDPYAETMSYPFAVKPQKKLSVQDVMTMLRGHMAGTP
FT                   FDMEAENAWNVREGDNMVKSPLATPFATKDVRNLLGIPYNRPISKWDCAYSFVSQVRSG
FT                   YPAPVRTVLWFGYDNPHTTCYVPIYSGVLETKKSWRTFDRNTFSLDSAQWAFILADDLV
FT                   NHRYQEAMEDLKAVRDPLEQGFAKQVLEADKKALELAKKDPAKAQEYLTKFTSDCMEKA
FT                   EKAWWQLNWDLISKYNNNKKK"
FT   gene            187297..187623
FT                   /locus_tag="Amico_0181"
FT   CDS_pept        187297..187623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0181"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   rpa:RPA1299 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56328"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECP6"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ADE56328.1"
FT                   /translation="MIENGNLYNRAARFLDKEITETLISQGAVRIERIISTGQCSPNNF
FT                   WYDQAENEWVCVLQGEGVIEWQNGSRNILKPGDWVFVPPHEKHRVHSTTSKPPCIWLAF
FT                   FWQK"
FT   gene            187703..188884
FT                   /locus_tag="Amico_0182"
FT   CDS_pept        187703..188884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0182"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   dat:HRM2_21780 Fsr"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56329"
FT                   /db_xref="GOA:D5ECP7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECP7"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADE56329.1"
FT                   /translation="MSERSVTVADRPNFKLSLLSIGHFFNDLYAAFLPTFVPTIISRLG
FT                   ITMAQAGALNSVVGVMHIFLQPLLGYVSDRTARSYLIMWGPILTCLGATFLPGSPTYGM
FT                   ALFFVGLWGIGSATFHPQGHGGVGHVVPRDKLTVSLAVFAVAGNIGVTVSPLFAVALTK
FT                   IVGIEKIPYIAIIPVLILAFAIYRYMPVLSDEVTEFPKDQGGLFHSIFSVFAVIYPVWI
FT                   VSMARDATSQGIRFFLPIRIVAEGGDIGMVGTVLFIVMLGSTIAMLISGKLSDRWGKVR
FT                   VLTLILIAGPAIMIPATYVKGNMSLVLYILGTSLINSSMPITAAVAQEQVPNSRGVASS
FT                   IVMGLSWGVANLLTGPLGKVADVFGIPTTMLFIALLPLLALPVVFLKTFRGAQ"
FT   gene            188893..189171
FT                   /locus_tag="Amico_0183"
FT   CDS_pept        188893..189171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0183"
FT                   /product="acylphosphatase"
FT                   /note="PFAM: acylphosphatase; KEGG: sat:SYN_02936
FT                   acylphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56330"
FT                   /db_xref="GOA:D5ECP8"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR020456"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECP8"
FT                   /inference="protein motif:PFAM:PF00708"
FT                   /protein_id="ADE56330.1"
FT                   /translation="MKKQVRVLITGHVQGIGFRTSVRRAARRLHVTGWVKNNIDGSVEA
FT                   LFQGELTDVNSLLEWCEKGPFLSCVENVESIWQPLLKEFEDFSIHFE"
FT   gene            complement(189187..189372)
FT                   /locus_tag="Amico_0184"
FT   CDS_pept        complement(189187..189372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0184"
FT                   /product="histone deacetylase superfamily protein"
FT                   /note="KEGG: tdn:Suden_1813 histone deacetylase superfamily
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56331"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECP9"
FT                   /inference="similar to AA sequence:KEGG:Suden_1813"
FT                   /protein_id="ADE56331.1"
FT                   /translation="MFRIRRIYDNTLHINKEAVVQVQAILKQQFPGLTRDEIEALPFPI
FT                   RDQQLPGLGNARSFLV"
FT   gene            complement(189375..190676)
FT                   /locus_tag="Amico_0185"
FT   CDS_pept        complement(189375..190676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0185"
FT                   /product="lysine 2,3-aminomutase YodO family protein"
FT                   /EC_number="5.4.3.2"
FT                   /note="TIGRFAM: lysine 2,3-aminomutase YodO family protein;
FT                   KEGG: dde:Dde_0189 L-lysine 2,3-aminomutase; PFAM: Radical
FT                   SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56332"
FT                   /db_xref="GOA:D5ECQ0"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022459"
FT                   /db_xref="InterPro:IPR025895"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECQ0"
FT                   /inference="protein motif:TFAM:TIGR00238"
FT                   /protein_id="ADE56332.1"
FT                   /translation="MERKPFPLPKVRDLREEAGEELWNNWHWQMANRITEAKHLEQVVD
FT                   LTKSELAMIKRSLNVLRMAITPYFASLINRNDPSCPIRKQCIPTLQETLIVQSDQLDPL
FT                   HEEVDSPVPGLTHRYPDRCLLLVTDQCSMYCRHCTRRRFAGQTDLPRSEKEIEACIDYI
FT                   RKTPVIRDVLISGGDPLTLSDDRIEGILREIRAIPHVEIIRIGTRVPVVMPMRITDNLC
FT                   SMLKKYHPLWMNLQFNHPREITPESADACQKLANAGIPLGNQSVLLKGINDCPYIFREL
FT                   NQQLLKIRVRPYYIYQCDLSQGIEHFRTSIGKGVEIMEFLRGHTSGLAVPTFVVDAPGG
FT                   GGKIPVMPNYVVSRSDRKTVLRNFEGVLTVYTEPDDNQSRCNRQCLSLCNRQKEFSSGG
FT                   VAALFEREGASMEPENLPRKKRRGEWPSQKEEGI"
FT   gene            complement(190678..191151)
FT                   /locus_tag="Amico_0186"
FT   CDS_pept        complement(190678..191151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0186"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   mxa:MXAN_5952 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56333"
FT                   /db_xref="GOA:D5ECQ1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECQ1"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADE56333.1"
FT                   /translation="MRTTDYTIGEHLSIARDTKAFSSEECSVLEEVLFEWQENPSKDYF
FT                   LLEERRNGTLSGFIIYGPTPMTEFAWDLYWIIVNPRSQRQGIGLKLQKKMEEEMLQNNK
FT                   QAVIRVETSGKSGYAGQRHFYEVAGYSENGRIQDFYGEGDDLVIYTKKIKAAR"
FT   gene            complement(191138..192190)
FT                   /locus_tag="Amico_0187"
FT   CDS_pept        complement(191138..192190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0187"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="KEGG: scl:sce2763 putative D-alanine--D-alanine
FT                   ligase A; PFAM: D-alanine--D-alanine ligase domain protein;
FT                   protein of unknown function DUF201"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56334"
FT                   /db_xref="GOA:D5ECQ2"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECQ2"
FT                   /inference="protein motif:PRIAM:6.3.2.4"
FT                   /protein_id="ADE56334.1"
FT                   /translation="MTSKEQPTEPPGSGQRPVLIAAAKEYTHRQDLLDCLICREDVGCV
FT                   LSSQGYSIYNLDIFPADLADPKHLVQRINEYQPLCVFNLFEGFGSEPWLEASFCEILEK
FT                   NNLTFTGNPSGALRLCIDKHTLHQQLKTAGIPVPLSYFLKGKETLGTLENISFPLFIKP
FT                   CREDGSVGIDKKSLVFNEEELQESVTEKLAKFPDGILIQEFLSGPEYCVSFVDNGPFSP
FT                   VGLWTLDYSRYPECPAYLSYDAKWNENSPEWNLWPEEIDLDYSLKETILHMASRAALVA
FT                   GCKGYFRVDLRENQGHLFVMDINPNPALTRDSGMARQYMQKGKTYEQLVMKILQLAILN
FT                   YKKRDDHENN"
FT   gene            complement(192193..193296)
FT                   /locus_tag="Amico_0188"
FT   CDS_pept        complement(192193..193296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0188"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="KEGG: mxa:MXAN_4097 D-alanine-D-alanine ligase
FT                   family protein; PFAM: D-alanine--D-alanine ligase domain
FT                   protein; protein of unknown function DUF201"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56335"
FT                   /db_xref="GOA:D5ECQ3"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECQ3"
FT                   /inference="protein motif:PRIAM:6.3.2.4"
FT                   /protein_id="ADE56335.1"
FT                   /translation="MERRHEEERENPLPLKKRKKEVQVIGITYNLRKDAQADEPDDIYE
FT                   EYDCLETVEALSNEIASLGFQVFLFEQNELLLQKLDSIAPDFVLNIAEGLGNYRGRESQ
FT                   VPCILESLNIPFSGSDSASLAIALDKVLTSHVLRASNIPAPKNYVAKLPQDTTEKKVIF
FT                   NTCQKYIIKPRWEGSSKGIFLDSIADTPEKVKTCIKRIWERYNQPAIVEEFLPGIEITA
FT                   GVAGNTQPKCIGMMSITPVTENSSFLYSLEEKRNYLERIRYSGPDSMSPQLRKKIGDLA
FT                   VRAFKALELRDIARIDFRLDDKGQPRVIDINPLPGLSPAYSDLPILYRLSGGEYSELIQ
FT                   TILREAFSRYGLCAPCLNKPELVREKA"
FT   gene            complement(193543..194691)
FT                   /locus_tag="Amico_0189"
FT   CDS_pept        complement(193543..194691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0189"
FT                   /product="putative cytoplasmic protein"
FT                   /note="KEGG: sat:SYN_02193 putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56336"
FT                   /db_xref="InterPro:IPR040837"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECQ4"
FT                   /inference="similar to AA sequence:KEGG:SYN_02193"
FT                   /protein_id="ADE56336.1"
FT                   /translation="MEILTREVLKELLEKGQGPCLSLYMTNPSSGDPRQAQIRFKSLLQ
FT                   DGEKALKDLGMKEQEAEAFLEQAKKLLVNSVFWQNLENGLALFLSSNIFKIYNEPFSFS
FT                   DLVVVAERFHLKPLFPLLSGEGKFFILGISQKGVRLLEGTRTSTREIDVDNLPKNVSDA
FT                   LGFDTPQRQLQYHVAGSGTSGMKGTVVRGQVMGAEVEKKYILKYFQTIDKGITDLLEGE
FT                   QSPLILAGVDYLHSIYREANTYPHLLNEGIYGNPDAYSPKELGEKGWEIVFPHLKKEEQ
FT                   IWAERYIDMRGTGKTSCDIEETVTAAFTGKVDTVFVAVGEQVWGLFDEKTFKATVHPEK
FT                   QPGDIDLLDFIASHTLLRGGRVYVLTPDHMPDVTNVASLFRF"
FT   gene            complement(194751..195557)
FT                   /locus_tag="Amico_0190"
FT   CDS_pept        complement(194751..195557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0190"
FT                   /product="Linocin_M18 bacteriocin protein"
FT                   /note="PFAM: Linocin_M18 bacteriocin protein; KEGG:
FT                   dma:DMR_17160 putative bacteriocin"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56337"
FT                   /db_xref="GOA:D5ECQ5"
FT                   /db_xref="InterPro:IPR007544"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECQ5"
FT                   /inference="protein motif:PFAM:PF04454"
FT                   /protein_id="ADE56337.1"
FT                   /translation="MDILRRSTVMVSSEAWHEMDEQAKRVLESHLSARKFIDVIGPKGW
FT                   DYAAHPCGRLDIPHETSEGNVAYGIHQVLPLVESRVTFDLDLWELDNITRGLKNPDLSP
FT                   LDEAARRIAAFEEKAVYEGLPSAGIEGLWETAKDRTLKIRDTSSARGVMEVISSGIYRF
FT                   QQDAIEGPYALVASPTLWKSLYSLSECYPLFKNVKEVLEGPVILSTHEKESFLVSMRGG
FT                   DMELVVGQDLSLGFIGNDSRKGTFFLTESFTFRVINSEAIIPLALS"
FT   gene            complement(195597..195995)
FT                   /locus_tag="Amico_0191"
FT   CDS_pept        complement(195597..195995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0191"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dma:DMR_17170 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56338"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR030907"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECQ6"
FT                   /inference="similar to AA sequence:KEGG:DMR_17170"
FT                   /protein_id="ADE56338.1"
FT                   /translation="MACPPFLSLEGSETMQYTEPVEHLDDLTRRCAMALKSMQEELEAI
FT                   NWYNQRVAATEDKDLKALLGHNRDEEIEHAVMLIEWLRRNMPGWDKELRQYLFTESSLL
FT                   AMEEAATEDSTEKSEILSGSLNIGSLKE"
FT   gene            complement(196015..196506)
FT                   /locus_tag="Amico_0192"
FT   CDS_pept        complement(196015..196506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0192"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: gsu:GSU0538
FT                   HSP20 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56339"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECQ7"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ADE56339.1"
FT                   /translation="MRRFLARRPIERMFPVTPFATPMETMMKNMMRGFDEMMSSFPWSE
FT                   EPYEAAMSPRGDMYRKDGKIIAELELPGIDPSQMDLKIYPDRLVITAEKKDERQIEEEN
FT                   YYRTERYYGNISRILQFPEEVDPGTAKASYKKGILTIEVTEKKQPEECKVLEIKNEDLE
FT                   "
FT   gene            196744..197316
FT                   /locus_tag="Amico_0193"
FT   CDS_pept        196744..197316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0193"
FT                   /product="flavin reductase domain protein FMN-binding
FT                   protein"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: gme:Gmet_0805 flavin reductase-like, FMN- binding"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56340"
FT                   /db_xref="GOA:D5ECQ8"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECQ8"
FT                   /inference="protein motif:PFAM:PF01613"
FT                   /protein_id="ADE56340.1"
FT                   /translation="MKKSIGIHMPVYPAPVLIIGNYDEKGKPNVMAAAWGGICCSVPPC
FT                   ITISLQKIRYSYNNIVDRKAFTVNIPSEKYVKESDYFGMVSGREHDKLSITNLTPMRGE
FT                   KVDAPYIEEFPVSIECKLLQTIELGTHVMLVGKVVNTLADEECLTCDNYPDPEKVRPII
FT                   FTPKYRRYYALGADLGEAFHMGRFFMK"
FT   gene            197401..199227
FT                   /locus_tag="Amico_0194"
FT   CDS_pept        197401..199227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0194"
FT                   /product="oligoendopeptidase F"
FT                   /note="KEGG: probabale oligoendopeptidase F ; K08602
FT                   oligoendopeptidase F; TIGRFAM: oligoendopeptidase F; PFAM:
FT                   peptidase M3A and M3B thimet/oligopeptidase F;
FT                   Oligopeptidase F"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56341"
FT                   /db_xref="GOA:D5ECQ9"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR004438"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR042088"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECQ9"
FT                   /inference="protein motif:TFAM:TIGR00181"
FT                   /protein_id="ADE56341.1"
FT                   /translation="MRHQQEKNPDVPTALPKREEIDSAYIWRLEDIYPSIDEWEKDFDG
FT                   LEKLLPRFQAYQGCLLESAATLLDGIRLMENAEIIMGKLYAYAVMKSHEDTSKEFYQAL
FT                   ADRVGYLLTKLTAAISFYTPEILSGGKGVIDGFLGQSEDLKQYAFFFENILRMAPHTLT
FT                   PSEEELLARSGEVARGPENIFSLFTNADMVFPEVFDEDGNTIELSEERYTRLIRSQDRQ
FT                   VRREAYEGLFGTYSKYRNSLAAMYSSSVKGDLFYAMSRKYGSCLEAALDSDHIPLSVYD
FT                   SVVDTVRFNLKPLHEYVALRKEILNVPELCMYDLYVPLANEIKKNITYEEALAMVVKGL
FT                   EPLGEEYISVLKHGFEAGWIDVYENQGKRKGAYSWGSYGTHPYVLLNYNGTIQDVFTIA
FT                   HEMGHAIHTWYSHGHQPFIYADYTIFLAEVASTTNEALLLDHLLESSLDRQSRLYLLNY
FT                   SLEQIRTTVYRQAMFADFERQVHNMAEAGEPLTAERLSALWHGLNVTYYGPEISVDAHI
FT                   DIEWARIPHFYTAFYVYKYVTGYAAATSLSQRIVGDGIAARKSYLDFLKQGGAAYSIDI
FT                   LKNAGVDMATPQPLQDTLNLFKEKLGELKDLL"
FT   gene            complement(199441..200355)
FT                   /locus_tag="Amico_0195"
FT   CDS_pept        complement(199441..200355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0195"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: aeh:Mlg_1449 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56342"
FT                   /db_xref="GOA:D5ECR0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECR0"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADE56342.1"
FT                   /translation="MNLNQLRVFCAIVEEGSFRQAGEKLFLSQPSVSQYIAALEKNYDV
FT                   KLFLRRGRSISLTPEGRTLYILAQDLFKLVDAVPEKFREMQLLKYGELCIGTTPTCGKT
FT                   FLPLIMSEYRHKFPHIKVQIKTANEETLLTMIEKDEIELAFFGHNPLLSPSSTLTMQSL
FT                   GRSSFALIAPPDHPWAQWKIISPAQLLEENFISYSKDTAHYCFVNDFFLNNKLKTPRLT
FT                   QVDNEELLLQLVTQGFGMGIAMEIAVRKEVKQKEVIILPLQNLAGISREIFLAHSTIKG
FT                   LTYAGWEMGKIAEQITFSFLNQG"
FT   gene            200465..201658
FT                   /locus_tag="Amico_0196"
FT   CDS_pept        200465..201658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0196"
FT                   /product="peptidase dimerization domain protein"
FT                   /note="PFAM: peptidase dimerisation domain protein;
FT                   peptidase M20; KEGG: dde:Dde_1267 peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56343"
FT                   /db_xref="GOA:D5ECR1"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017706"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECR1"
FT                   /inference="protein motif:PFAM:PF07687"
FT                   /protein_id="ADE56343.1"
FT                   /translation="MVLNGKRQSDLVRICQELIRRPSPSGKEREVATFIADTMRSIGYD
FT                   EVSIDLYGNVIGRQFFATPGKRLLLESQMDHIDPGTLTDWSYYPYGAFIKDGCIYGRGA
FT                   SDQKGCLAAMILAGAELKNNFYNKLKGELVVAGTVFQERFEGVASRTVASAFPPDFVVL
FT                   GEATELKIKRGQRGRAEIVIETQGRMTHSSNPEFGSNAADAMISILSSIHQSYSPSFKP
FT                   FFGENILVLTTLRTYPDLGTGLVPEICRAIFDLRVFPDDTPESVVRKFKGLIERAKDSL
FT                   RGIKVKIFISETEDRTYTGASIRGTHFARAWALPEESDYLKRALRAVETLGMEGGVSDS
FT                   PGFGTNGCYYAGELGIPTIVFGPSGRRLVHSIDEYIEINDLFLAFQGYEGIAKEVLT"
FT   gene            201794..203050
FT                   /locus_tag="Amico_0197"
FT   CDS_pept        201794..203050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0197"
FT                   /product="Glycine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="KEGG: gbm:Gbem_3102 glycine
FT                   hydroxymethyltransferase; PFAM: glycine
FT                   hydroxymethyltransferase; Orn/Lys/Arg decarboxylase major
FT                   region; aromatic amino acid beta- eliminating
FT                   lyase/threonine aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56344"
FT                   /db_xref="GOA:D5ECR2"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECR2"
FT                   /inference="protein motif:PRIAM:2.1.2.1"
FT                   /protein_id="ADE56344.1"
FT                   /translation="MFEKAWEELEKTDRAIADVITRERERQEHGIELIASENFVSPAVM
FT                   CAMGSVLTNKYAEGYPAHRYYGGCHVVDEAENLARDRAKQLFGCDHVNVQPHSGSQANM
FT                   AVYFTCLEPGDTILAMNLSHGGHLTHGSPVNFSGQLYNIIPYGVSKDTETIDFAEVERL
FT                   ALAHRPKLIVCGGSAYPREIDAEKFREIADKAGSLLMFDIAHIAGLVAAKLHKDPIPFC
FT                   DFVTTTTHKTLRGPRGGMIMCREAFAKGVDKSIFPGMQGGPLMHIIASKAVAFEEALQP
FT                   SFKEYQGRIVKNAASLAEALLKHDFHLVSGGTDNHLILINLTSRGVTGKALETALDKAG
FT                   ITVNKNTVPFDTQSPFITSGVRIGTPAVTTRGFGSSEMEQIASWMDEVAKNVENDKVLS
FT                   RIRAEVLDLCGKYPLYAGM"
FT   gene            203084..204553
FT                   /locus_tag="Amico_0198"
FT   CDS_pept        203084..204553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0198"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: Pyridoxal-phosphate dependent enzyme family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56345"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECR3"
FT                   /inference="protein motif:PFAM:PF00291"
FT                   /protein_id="ADE56345.1"
FT                   /translation="MIDLTIHEKGLKKAIERAKERNVIIPTFKQMKDPDRYTPDKIKER
FT                   LKNTGLWDVDPVNLFRITWKNEPKKQGGLFGKTNYVEIPREVTGVNARIVAIVGKWFPT
FT                   GAHKVGASFGCLAPRLVTGQFDPTAQKAVWPSTGNYCRGGAYNAQLLGCESIAILPEGM
FT                   SPERFEWLKTVAGEVIGTPGTESNVKEIYDKVWELRKTRDNIMIFNQFEEFGNHLWHYE
FT                   VTGNAMYDVLQEVCGEKDRYFGVVITSGSGGTLASGDFLKKKYPLSKIAVGEALQCPTL
FT                   LWNGFGAHRLEGIGDKHVPWIHNVKNTDMVIDVDDADSMAMIRLFNEDSGHEYLRKNGV
FT                   SEEFIESLPLIGISGAANILMAIKMAKYYELGKNDVIMTVLTDSMEMYGSRVKEMADET
FT                   GPYTEMMASVDHNRHVLGVGIDAMEELSYYARKRVHNLKYYTWIEQQGRTSEELNAQWY
FT                   DYDEYWGSIQGMADAIDERIDEFNRLTGLLV"
FT   gene            204777..205859
FT                   /locus_tag="Amico_0199"
FT   CDS_pept        204777..205859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0199"
FT                   /product="Extracellular solute-binding protein, family 7"
FT                   /note="PFAM: Extracellular solute-binding protein, family
FT                   7, bacteria; KEGG: dvm:DvMF_1932 TRAP dicarboxylate
FT                   transporter, DctP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56346"
FT                   /db_xref="GOA:D5ECR4"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECR4"
FT                   /inference="protein motif:PFAM:PF03480"
FT                   /protein_id="ADE56346.1"
FT                   /translation="MMSRVGFLRKCLVLMLVVLFLSSAIAASAKAPEYKWRFGQTSVRA
FT                   SQGESYKLFCELIEKYSDGRIQVEFFPDNQLGTLDEIFHAVQDGEVEICGVAPYVNLVP
FT                   GGMFNWMPWTVESWEECKMAFSRPNGCLYVPMEEAMNEVGMHVLFTVSQGSYGIGNNTR
FT                   PIKTPEDFKNLKLRVSSSLGCVRGLQNMASGTGMTVETVPWGELYNALSRGVVDGCWSM
FT                   WPSLVEERHYEVLKYYTSLDWMWDANQVVINKDIWDGLSDDLKAAIEKAALEAEEHQYA
FT                   IQERMADEFQDFLKKQANFEIYYPTDEERTAFREKANMLSVWEELCTPWLDKHYPGQNM
FT                   TQKILDELAANREKVLAGKK"
FT   gene            206028..206552
FT                   /locus_tag="Amico_0200"
FT   CDS_pept        206028..206552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0200"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dps:DP1511 DctQ (C4-dicarboxylate permease,
FT                   small subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56347"
FT                   /db_xref="GOA:D5ECR5"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECR5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56347.1"
FT                   /translation="MKKFFSHVEKIEFILGSIGLLTAIVLTFCQVVNRYWLHFEIMWIA
FT                   DFALYIFIFTIYIAIPYGAALKTHIAVDILPDHFCGDDRAKRAIFDIVKSSVTILMVLS
FT                   ISSPVMRVAKRAYRYPEYATLVRWFNMSWLIYAMAVMIVLVILHYGWHVACDVYELKQL
FT                   RWISVNEGEAK"
FT   gene            206553..207887
FT                   /locus_tag="Amico_0201"
FT   CDS_pept        206553..207887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0201"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="KEGG: dat:HRM2_42860 DctM9; TIGRFAM: TRAP
FT                   dicarboxylate transporter, DctM subunit; PFAM: TRAP
FT                   C4-dicarboxylate transport system permease DctM subunit;
FT                   Citrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56348"
FT                   /db_xref="GOA:D5ECR6"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECR6"
FT                   /inference="protein motif:TFAM:TIGR00786"
FT                   /protein_id="ADE56348.1"
FT                   /translation="MLDLGTVTTLIAFLVGIVLGFPIGWLFIGSTALGLFVMGSPTVFM
FT                   ANAFFHSLDSSTIMAIAFFVFSGALISEAGLADRIVNFSYSLVGRLRGGLTGVGIVATL
FT                   FLSALTGSSVPCIAALIPLLVPRLEKFGYRRVYTTALLCSSSYLGYLIPPSVPAMIYCL
FT                   LAGQSVAALFLATVFPGILLAIGYGMLNYFMVGRYTFESTEKPLLPTTFEESVKDILHT
FT                   GKIAIPALGCPVLILVGIYGGIFTPNEAGGIAAVYCLLIGWFVYRELTNAKLKKALSST
FT                   IGTFGMTTLLLAGGTILTRYLTRQGVAQEVANFMLNMFENKYLILLMLNFFLLILGMFL
FT                   DGIPILILVVPLALPLMQELGINLVHLGAIMVVNVGIGVMTPPFAMSIFVGSRLAEVPA
FT                   AELTKTMLPFLFLVSIPVLLLTTYIPALSCWLPEILLGSSIVGPW"
FT   gene            207927..209513
FT                   /locus_tag="Amico_0202"
FT   CDS_pept        207927..209513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0202"
FT                   /product="N-acyl-D-aspartate deacylase"
FT                   /EC_number="3.5.1.83"
FT                   /note="KEGG: dde:Dde_1269 N-acyl-D-amino-acid deacylase;
FT                   PFAM: D-aminoacylase domain protein; Amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56349"
FT                   /db_xref="GOA:D5ECR7"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECR7"
FT                   /inference="protein motif:PRIAM:3.5.1.83"
FT                   /protein_id="ADE56349.1"
FT                   /translation="MFDILIKNGTCYAGDGKPGFVSDVAIEAGVIAAIGNLQNAEAKRV
FT                   IDARNLAVAPGFIDTHSHSDLVALVEPEIANKTTQGITTDIIGQDGMSLAPVKTEYVGT
FT                   WKKVMAGLEGQYEVEWDWLSSSDYLSRLDDQPLGPNLGYLAPYGNIRMCAVGLDNRPAT
FT                   KDEIAKMQNLLEEAILNGAMGLSTGLIYPPCSYASEDEIAELTKVLTKYGLPLVIHQRS
FT                   EADYILESMDEVIRISRKSGCPIHFSHFKLCGKKNAHLFDAVMEKLEIASREISVSFDQ
FT                   YPYTAGSTTFSVILPPWVHDGGADKALARLADPVARERMKQDIHNGIPGWDNFIDFAGM
FT                   ENISVTFVKTDKNADVVGKNMIEIGKLRGKDPLDAAFDVLLEEEMVVGLVDFYGYEEHI
FT                   EKILAHPLQNVCTDGILGAHPHPRVYGSFPRVLGSYVRERKILDLPTAIHKMTGRPASI
FT                   FKMKNRGFLKEGYAADITIFDPETVIDTATYENPKQFSKGIPYVMVGGKLAVDDEVVMK
FT                   GKSGRVVRFEG"
FT   gene            209562..210743
FT                   /locus_tag="Amico_0203"
FT   CDS_pept        209562..210743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0203"
FT                   /product="peptidase M20"
FT                   /note="PFAM: peptidase M20; peptidase dimerisation domain
FT                   protein; KEGG: dde:Dde_1267 peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56350"
FT                   /db_xref="GOA:D5ECR8"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017706"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECR8"
FT                   /inference="protein motif:PFAM:PF01546"
FT                   /protein_id="ADE56350.1"
FT                   /translation="MAMEWSESLVSLCREMIRRPSLSGQEKEMADFVEQRMIELGFDSV
FT                   ERDHYGNVSGRIVLGSGGRRILFEGHMDHVDIVDPSKWTHDPFGAEVVDGRIYGRATSD
FT                   MKGNLAASIMAAALIKKEKADLNGEIIVAGSVHEECFEGVASEAIGKRWNPDCVVIGEA
FT                   SSLNLKRGQRGRAEVVLETYGKSAHSSNPEVGLNAVKAMVPLLSAIENEFEPKEQPVLG
FT                   KGILELTDIISSPYPGASVVPERCRVTYDRRLLVGETDTEVLAQIQKIIDEEKGRNPQL
FT                   KANVSLAVGRETCYTGDSIEATRYAPGWLFPEDNWFVAAAMRGLREAGLNPELSHYAFC
FT                   TNGSYYAGKAGIPTIGFGGSLESLAHVVDEYIEIDQLEKACLGYMGIIRSVLG"
FT   gene            211186..212133
FT                   /locus_tag="Amico_0204"
FT   CDS_pept        211186..212133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0204"
FT                   /product="carbamate kinase"
FT                   /EC_number="2.7.2.2"
FT                   /note="TIGRFAM: carbamate kinase; KEGG: Carbamate kinase ;
FT                   K00926 carbamate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56351"
FT                   /db_xref="GOA:D5ECR9"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECR9"
FT                   /inference="protein motif:TFAM:TIGR00746"
FT                   /protein_id="ADE56351.1"
FT                   /translation="MGKRILVALGGNAILQPGQKGTSAEQVTNIDKTVKQLIDVVEKGY
FT                   ELVLTHGNGPQVGAILIQHEMAKEAIPAMPLDFCGAESQGLIGYMLCQSIRNECAGRGL
FT                   KKEAVCIVTQVEVDPHDKAFRNPTKPVGPFYTQAEAEQNMAERGERWIEDAGRGWRKVV
FT                   PSPEPKEIVEKEVIRALVDQGTVVIASGGGGIPVCRNDQGQLYGVEAVIDKDLAGERLA
FT                   LDVGADIFVILTDVSHAILHYNTPQQKPLKKVTLEEMKKYIEEGHFRAGSMGPKVRAAL
FT                   NFVKKGGGRAIIARLDQVIPALKGEVGTQIESTL"
FT   gene            212275..213861
FT                   /locus_tag="Amico_0205"
FT   CDS_pept        212275..213861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0205"
FT                   /product="N-acyl-D-glutamate deacylase"
FT                   /EC_number="3.5.1.82"
FT                   /note="KEGG: dde:Dde_1269 N-acyl-D-amino-acid deacylase;
FT                   PFAM: D-aminoacylase domain protein; Amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56352"
FT                   /db_xref="GOA:D5ECS0"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECS0"
FT                   /inference="protein motif:PRIAM:3.5.1.82"
FT                   /protein_id="ADE56352.1"
FT                   /translation="MYFDVVIKGGLCYLGDGGDPVRSDVGIVGSRIEAIGDLNDAQTGL
FT                   SVDAAGKVVCPGFVDTHSHSDLVVLKEPAVENKVMQGVTTELIGQDGMSLAPIIPEYRE
FT                   PWKKTMGSLEGHYDVPWDWQTAEEYFERIDSQDLGPNIAYLVPHGNIRLCVMGLDDREA
FT                   TDDEMAKMSRLLAKILEAGAYGMSTGMIYPPCCYAPTQEFVELCKVLKDADGLFVTHQR
FT                   NESDYILEAMDEIFEIGAKSGCRVHFSHFKVGGKRNWDKLDTVLAKLDEANLSGIPLSF
FT                   DQYPYIAGSTMLGVILPPWVHNGGTEKALERLADKNKREQMKTDIAKGIPGWDNFVSAN
FT                   GVENIYVTFVKTDKNSKYVGKTLLEIGKMANKDPLDATFDLLYEEEMTAGLVHFYGKEE
FT                   HISKIMQREEQNFCTDGILGAHPHPRVYGTYPRVLGKYVRENKDLTMSQAIHKMTGKPA
FT                   SVLRLEKRGLLKEGYYADVVVFDPETVIDKATYDNPKQYPEGIEHVFVNGVQVVEKGVC
FT                   KPAKAGRLLRK"
FT   gene            complement(213942..215504)
FT                   /locus_tag="Amico_0206"
FT   CDS_pept        complement(213942..215504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0206"
FT                   /product="transcriptional regulator, PucR family"
FT                   /note="PFAM: purine catabolism PurC domain protein; KEGG:
FT                   ppu:PP_3188 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56353"
FT                   /db_xref="InterPro:IPR012914"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECS1"
FT                   /inference="protein motif:PFAM:PF07905"
FT                   /protein_id="ADE56353.1"
FT                   /translation="MASFLKITQFNSFKLVAGKSGITRDIKTVTVIDNLSGWENWLYGG
FT                   ELVLSSGFFWRDNPEELEYFIRKLYTHNAACLCIKIGRFLDHIPSNVIKVSDELSIPII
FT                   THPINYGFVDILIPTLSTILKNRELELLKSYKINKSLTNMVANGASISQIIDALQIMTN
FT                   VDFAFVSPSNNECFHSSLDDNFKNNITKLPLEENLRLYNCEELKFGRNTYGYLFQNTFK
FT                   KDTHSTPLFLKNSLIHGCTILKLNLQQKVSNRNIERRYKDELFFDLLLNRSSIKEVSTL
FT                   LKNFFEWTPEDKFFVSIIRVESNDVTLTSKDDFDNITNVVSLKITKNIKELYGNAFSAT
FT                   LAHSIITISSSEKELSLNLRKKLEEQLSQLFNEIELEFGIKLIMGVGGVYDDADKIRKS
FT                   YKEAQEALNLGHHSSIVFFDELGVQKLLHSLPLNELRSFFNNYLEEVLDYDKKHNLDLL
FT                   KTLAKLVENNWNYRRTAKILGTHHNTVKYRVDTIQKLSGLSLDDHEDRLNIALSMRIYL
FT                   NHL"
FT   gene            215715..216008
FT                   /pseudo
FT                   /locus_tag="Amico_0207"
FT   gene            216082..217155
FT                   /locus_tag="Amico_0208"
FT   CDS_pept        216082..217155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0208"
FT                   /product="Extracellular solute-binding protein, family 7"
FT                   /note="PFAM: Extracellular solute-binding protein, family
FT                   7, bacteria; KEGG: dde:Dde_1275 TRAP dicarboxylate
FT                   transporter, DctP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56354"
FT                   /db_xref="GOA:D5ECS2"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECS2"
FT                   /inference="protein motif:PFAM:PF03480"
FT                   /protein_id="ADE56354.1"
FT                   /translation="MRRNIFLGALVLLCVFSLLVGGEAFAKAEYEWSFTQPWSRPLSNK
FT                   GYEFFCDKVKEYSGGRIEIKFYSDGLLGNHDESYHAVQEGSIAMGVFSPYVNLVPGGML
FT                   NWMPWTVENFDEARLAYSPAGGILFKVMEDAWAEVGFKILFNVAQGPYGIANSKRPIRT
FT                   PEDFKNLKLRVSSSLGFVKCLANMGEGTGMTLETVPWSELYNAMARKVVDGCWTMWPSL
FT                   VDERHYEVAPYFTDLKWAWDAQNIAMNKKLWDSLPDDLKEAIKKAALEAEEYLLQIQEA
FT                   AQEDYIATLEKQEGFEIIRLTDEERQVFRDKARMSGIWEELCTPWLEKKYPGQNMTQVI
FT                   LDELDRIHEEVAAKAKK"
FT   gene            217338..217877
FT                   /locus_tag="Amico_0209"
FT   CDS_pept        217338..217877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0209"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hch:HCH_06606 TRAP-type C4-dicarboxylate
FT                   transport system, small permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56355"
FT                   /db_xref="GOA:D5ECS3"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECS3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56355.1"
FT                   /translation="MKNLYLRFVRLIEIFENTICAAGLVLTTVLVFAQVVNRYWLHFEI
FT                   MWLSDLALYFFTFFMLLAIALTTRVEGHTSVDVFLETFFKGEHMAKSRAIYIMILNLIS
FT                   IVIMFAFLPVVLKFTLRAITYPEYGTLVRWFNTSWLVECMFMMLVLSIFHSIHNVVVKF
FT                   IDYRRQYVIPVSQEGK"
FT   gene            217878..219215
FT                   /locus_tag="Amico_0210"
FT   CDS_pept        217878..219215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0210"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="KEGG: dps:DP0487 DctM (C4-dicarboxylate permease,
FT                   large subunit); TIGRFAM: TRAP dicarboxylate transporter,
FT                   DctM subunit; PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56356"
FT                   /db_xref="GOA:D5ECS4"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECS4"
FT                   /inference="protein motif:TFAM:TIGR00786"
FT                   /protein_id="ADE56356.1"
FT                   /translation="MALGLTVSLVFFFLGLFGGVALGWLFIGSSLIGLSVAGMPLSFTA
FT                   GTFYHSLFSEVLMAIGFFVYAGSLISEAGLADRIVRFSYALVGRIRGGMEIVSIVATLF
FT                   LSALTGSSVPCISALIPLLVPRLAKYGYEPQYTTAILCSSSFLGYLIPPSVPALVYCLV
FT                   AQQSVTAVFLATVVPGLLIALGYGVLNFYLCPKYMNMAIASEHELPPAAFSERMKEIMS
FT                   STWGALPALGCPLIILVGIYGGIFTPNEAGAIATIYCIFVGLFAYRELTKKGFWNATLS
FT                   SLVSIGVIAVLIAAGTVFARYLIRLGVAQEVANWMLGLFESKIMIMLMVNILLLIMGMF
FT                   IDGIPILILAVPLILPLMKELDVNLVHLGAIVILNVGLGVITPPFAMSIFVGSRLSGCS
FT                   YGELVPIMMKFLLLVGIPVLLLTTYIPALSCWLPTVILGPNVVGPW"
FT   gene            219300..220895
FT                   /locus_tag="Amico_0211"
FT   CDS_pept        219300..220895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0211"
FT                   /product="N-acyl-D-amino-acid deacylase"
FT                   /EC_number="3.5.1.81"
FT                   /note="KEGG: geo:Geob_0285 N-acyl-D-aspartate deacylase;
FT                   PFAM: D-aminoacylase domain protein; amidohydrolase;
FT                   Amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56357"
FT                   /db_xref="GOA:D5ECS5"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECS5"
FT                   /inference="protein motif:PRIAM:3.5.1.81"
FT                   /protein_id="ADE56357.1"
FT                   /translation="MNFDVIIRNAIVVDGTNSPWFKADVGISNGRIDFVGKVPLDATGK
FT                   EEVDAEGKVLCPGFIDGHTHADFVLLQDPLMLSKLKQGVTTQIIGQCGISPAPVTDDKV
FT                   EMLDQYVGFFKGGTTLDWTWRSFGGWLDKLETLSLGTNIGACVGQGTVRLAVMGFENRQ
FT                   PTQDEMEKMRAYVEEAIDSGAFGLTSGLIYPPGVYSSHEELCALTTALKKKNALYLSHM
FT                   RSESGAVVESVMETIDIGHKNDIPVQISHHKAAGKMYWGLVQTTLQKVDEARANGVDVT
FT                   LDLYPYDYSSTTLRAILPAWIQEGGLQKLNERLADPSVRKQVMGEIKTDVSWDNYYLLG
FT                   GGSEGITLLYTPKTPECEGKTLSEVGKLMGKSPIEAAFDIIVANGGSDTVCYNAMSEDD
FT                   VQYVMKHPAAMFVSDSIFGASGGKSHPRTFGTNPRVLCKYVREEKVLTIEQAVWKMTGF
FT                   PAARYGLQTKGIIREGMDADIVIFDPETVRDKATIENPQQDPEGIEYVFVNGVKTVEKG
FT                   VCTGKTAGRVLRKK"
FT   gene            220932..222056
FT                   /locus_tag="Amico_0212"
FT   CDS_pept        220932..222056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0212"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="TIGRFAM: alanine racemase; KEGG: sat:SYN_01482
FT                   alanine racemase; PFAM: alanine racemase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56358"
FT                   /db_xref="GOA:D5ECS6"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECS6"
FT                   /inference="protein motif:TFAM:TIGR00492"
FT                   /protein_id="ADE56358.1"
FT                   /translation="MSWRPTRLEVDLEKVRNNYRAIRKHVGESVRIFGVVKGDAYNLGA
FT                   DKIGRVLADMGVDFFAVATGDEAISLRESGIESPILVLGPSPYGIAEEYVRLGIRAAIN
FT                   DKGIAKALSDASVRLQKPAYGHVKIDSGMGRIGFFPHEAADAVEEISHLPGLNLEGIFT
FT                   HFAISDARDLTYTYEQHSTFVKVIGELEKRGITFSIKHCCNSGATLALPQFVMDGVRPG
FT                   QLVVGMYPSKEVVRSIAIEPVFEFKTAISAIRTVPAGKKLSYGLTYETTADERIAVIPV
FT                   GYHDGYSRELSGKGTEVLIHGKRCPIVGRICMDQALVDVSVLQNPQIGDEVVLLGKQGE
FT                   ETITGDEIADKIGTIFTTLPNMIGKRVPRVYLNE"
FT   gene            222213..223475
FT                   /locus_tag="Amico_0213"
FT   CDS_pept        222213..223475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0213"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   azo:azo2084 putative membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56359"
FT                   /db_xref="GOA:D5ECS7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECS7"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADE56359.1"
FT                   /translation="MDPQKDLKTVRNAHFIFAIILLAYFMSYFFRIAPAVVMPLYAAPL
FT                   GLSAAMTGFIASFYFYAYGAMQPVCGVLLDKFGPMRVASTGLFITALGGFMMVFKPTVF
FT                   TLSLWRLLMGLGFSPLFMGALVFQAAAFPLTLYAFYSGITLATGNMGTVVGVAPLGTAI
FT                   DTWGMPVVSTFLAIFCLFLSSLLFLKRKDDPVYSKERFLSHSLLQNFKEAFRFVTGSPV
FT                   GRSISLLWSLSMASILSLQALWAVSWFAAVYERPFADCRGWASLIGVGVVMGTLLSGFL
FT                   GRSEKIRNFLLYAFSIVFSLSLALITGLLFFHFPIYLAASAGFLLGMCTGGGAVCYAAK
FT                   INEVAPSHLRGAVMGVVNTFIYLSVIIYQWGTGAILDFFPGVEPGSYAKEGYAAAYIIV
FT                   FGVSTLVFYALWVLHRHKRER"
FT   gene            complement(223478..225217)
FT                   /locus_tag="Amico_0214"
FT   CDS_pept        complement(223478..225217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0214"
FT                   /product="small GTP-binding protein"
FT                   /note="KEGG: gsu:GSU1380 ferrous iron transport protein B;
FT                   TIGRFAM: small GTP-binding protein; PFAM: GTP-binding
FT                   protein HSR1-related; nucleoside recognition domain
FT                   protein; Ferrous iron transport B domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56360"
FT                   /db_xref="GOA:D5ECS8"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECS8"
FT                   /inference="protein motif:TFAM:TIGR00231"
FT                   /protein_id="ADE56360.1"
FT                   /translation="MGPENPAQKTLLLIGNPNVGKSVIFSRLTGVRAISSNYPGTTVGF
FT                   LEGWLRYNSEVYRIIDVPGAYTLDPTNEAEQVARRMVDEGADLAIIVLDATALERNLYL
FT                   AFQAMERGIHTIVALNMVDEARHRGISIDVEKLEKLLGVPVVPTVALSGQGINRIIQRI
FT                   PEARKGHIPPLTSEERWKRIGLIIEQTQKLTHRHHTLRDKLEDLSVDSFWGGVIGVLVI
FT                   ALSFYVIRLIGEGLINTLLNPITERVWIPALMKFSPILGKHPILHQLLIGTLIHGTVDM
FT                   EQSFGLLSTGLYVPLVMVLPYVLSFYLALSFLEDVGYLPRFAVLFDALFHHLGLHGYAI
FT                   VPALLGLGCNVPGILATRVLESERERFIAATLISIAIPCAGLQAMIVGVIGHLGGKYVI
FT                   ITYGVLFSAWVVIGRILHALLPGHSPELIVEIPPYRIPSVRDLFFKLWFRLKGFIMEAI
FT                   PLVMGGVLLINLLYMTGVINGITRFFRPVFTGLLGLPAEAAGPIIMGLLRKDVAVGMLS
FT                   TLNLTPQQLIVATVTLAMTFPCIATFIVLWKELGGKKLAGSLAIMIFSALTAGSLLRIV
FT                   LNL"
FT   gene            complement(225207..225467)
FT                   /locus_tag="Amico_0215"
FT   CDS_pept        complement(225207..225467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0215"
FT                   /product="FeoA family protein"
FT                   /note="PFAM: FeoA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56361"
FT                   /db_xref="GOA:D5ECS9"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECS9"
FT                   /inference="protein motif:PFAM:PF04023"
FT                   /protein_id="ADE56361.1"
FT                   /translation="MKKVHVYNLKDLQNGVTAQIVQMPSGECRCRLEALGLREGKIIEK
FT                   VSGMPFHGPITIIVDGRQIAIGWRISSRVIVKPLREFGHGA"
FT   gene            complement(225445..226488)
FT                   /locus_tag="Amico_0216"
FT   CDS_pept        complement(225445..226488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0216"
FT                   /product="radical SAM enzyme, Cfr family"
FT                   /note="KEGG: maq:Maqu_1124 radical SAM protein; TIGRFAM:
FT                   radical SAM enzyme, Cfr family; PFAM: Radical SAM domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56362"
FT                   /db_xref="GOA:D5ECT0"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECT0"
FT                   /inference="protein motif:TFAM:TIGR00048"
FT                   /protein_id="ADE56362.1"
FT                   /translation="MSEAVVALEMNYDEWLEFCTEKLGLQRYRTDQICQWIYEKKVFNI
FT                   YDMTNLGKDLREDLAYKILILPPSLVKQETSKDGTRKFLWQLQDGQRIESVLLSHGNHN
FT                   TACISSQVGCPLACAFCATGKGGFVRNLTPGEIVGQFLAMEKAAGQNITNIVFMGMGEP
FT                   LLNQEALFKSIKILNHPKMRGLGARHMTISTAGIVPGIRALTELEIPVRLSVSLHGTND
FT                   MLRNKLMPINQQYPLGSLIEALRDYQQKTGDRVTIEYVMIDRVNDNTEQAYELAALMNG
FT                   LSIYVNLIPYNPVDATYRRSSQERIKAFGKILSELNIEYEIRREKGSDINAACGQLRRQ
FT                   NEKSSRL"
FT   gene            226795..227862
FT                   /locus_tag="Amico_0217"
FT   CDS_pept        226795..227862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0217"
FT                   /product="Extracellular solute-binding protein, family 7"
FT                   /note="PFAM: Extracellular solute-binding protein, family
FT                   7, bacteria; KEGG: dde:Dde_1275 TRAP dicarboxylate
FT                   transporter, DctP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56363"
FT                   /db_xref="GOA:D5ECT1"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECT1"
FT                   /inference="protein motif:PFAM:PF03480"
FT                   /protein_id="ADE56363.1"
FT                   /translation="MKKVVLFWALILCVFSLLVGGEAFAKAEYEWSFTQPWSRPLSNKG
FT                   YEFFCDKVKEYSGGRIEIKFYPDGLLGNHDESYHAVQEGSIAIGTFSPYVNLVPGGMLN
FT                   WMPWTVENFDEARLAYSPAGGILFKVMEDAWEEVGFHVLFNVAQGPYGIANSKRPIRTP
FT                   EDFKNLKLRVSSSLGFVRCLANMGEGTGMTLETIPWSELYNAMARKVVDGCWTMWPSLV
FT                   DERHYEVAPYYTDLQFAWDAQNIVMNKKLWDSLPDDLKEAVSKAALEADEYLLQIQEAA
FT                   QKDYIATLEKQEGFEIIRLTDEERQVFRDKARMSGIWEELCTPWLEKKYPGQNMTQVIL
FT                   DELDRIHEEVAAKKK"
FT   gene            complement(227999..228292)
FT                   /locus_tag="Amico_0218"
FT   CDS_pept        complement(227999..228292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0218"
FT                   /product="formate dehydrogenase subunit gamma"
FT                   /note="KEGG: pfl:PFL_0331 formate dehydrogenase subunit
FT                   gamma"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56364"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECT2"
FT                   /inference="similar to AA sequence:KEGG:PFL_0331"
FT                   /protein_id="ADE56364.1"
FT                   /translation="MKKILFLFVLGVFFFVPSLSVQAAEEFLYICGPCSRNFVPIAEDV
FT                   IQELALEDNVHIKLVSCLGACTASPVVEFKGEIYGHMTKEKLFALLRSYFTL"
FT   gene            228413..229225
FT                   /locus_tag="Amico_0219"
FT   CDS_pept        228413..229225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0219"
FT                   /product="zinc/iron permease"
FT                   /note="PFAM: zinc/iron permease; KEGG: pca:Pcar_1977
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56365"
FT                   /db_xref="GOA:D5ECT3"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECT3"
FT                   /inference="protein motif:PFAM:PF02535"
FT                   /protein_id="ADE56365.1"
FT                   /translation="MGDFFASAGPIVQTLIGTLFTWGLTALGAAAVFVRKDPSKKMLDV
FT                   MLGFAAGVMIAASYWSLLAPAIEMSAEMGMWPWFPPAVGFLLGGVFLRIVDRILPHLHL
FT                   GQLREEAEGIETTWKRTTLLVMAITLHNIPEGMAVGVAFGAVASGIPSASLAGAMALVL
FT                   GIGIQNFPEGMAVSLPLRRDGVSPMRSFWYGQLSGIVEPISGVIGAVAVVMARPILPYA
FT                   LAFAAGAMIFVVVEEVIPESQQGGYGDQATMGVILGFIVMMILDVALG"
FT   gene            229262..229816
FT                   /locus_tag="Amico_0220"
FT   CDS_pept        229262..229816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0220"
FT                   /product="protein of unknown function DUF204"
FT                   /note="PFAM: protein of unknown function DUF204; KEGG:
FT                   pca:Pcar_2070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56366"
FT                   /db_xref="GOA:D5ECT4"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR022929"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECT4"
FT                   /inference="protein motif:PFAM:PF02659"
FT                   /protein_id="ADE56366.1"
FT                   /translation="MSVIELFLTAAALSMDAFAVSLGVGACLPLLTPGAAFRMGIACGS
FT                   FQFLMPLAGWMAGIRLLSLIEAYDHWVAFLLLFFLGVNMIRESRKEEACERRDNTWGLT
FT                   LLSLAVATSIDALAAGIGVAALKGSVMFLAVPAGIITACLSAAGVCLGFQAGRFLGKYV
FT                   EIAGGVVLCFIGLKILLVSII"
FT   gene            229774..230811
FT                   /locus_tag="Amico_0221"
FT   CDS_pept        229774..230811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0221"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ilo:IL2400 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56367"
FT                   /db_xref="GOA:D5ECT5"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECT5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56367.1"
FT                   /translation="MFYRVENPSCVHYMKQLQIVVTGSRGKSSVVRLLFYALSACGIKT
FT                   WARITGVIPRELSPGGEKPILRSAGGHVEEMKWWLRVIPVDAEAVVLENSAVAPDLQEL
FT                   PSKWLKDPIFVITNVRPDHQDAWGPGEEGALGAIMRGIPQRSTVFIPETTASSLALLDG
FT                   LEKKQCKVHVAPLSSKGYSVWREENMAVVREILNFMGLDSKKGEDAASSLVSDVADFQV
FT                   IPLGDSELAAAFSANDLATTKLLFASLEWKMEETTILFNSRRDRPERLKAFLPWLRQPG
FT                   WKRVLFMGARPLYPRKGIKYISISSIADVEELLKREKKVFGCGNVAGMPLAFLIDYALK
FT                   GGNHA"
FT   gene            230804..231247
FT                   /locus_tag="Amico_0222"
FT   CDS_pept        230804..231247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0222"
FT                   /product="capsule biosynthesis protein CapC"
FT                   /note="KEGG: ftm:FTM_1027 capsule biosynthesis protein
FT                   CapC"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56368"
FT                   /db_xref="GOA:D5ECT6"
FT                   /db_xref="InterPro:IPR008338"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECT6"
FT                   /inference="similar to AA sequence:KEGG:FTM_1027"
FT                   /protein_id="ADE56368.1"
FT                   /translation="MHSVQLGTIGLGIVLGMFFYNRTGRSCGGIITPGFIALQIGSPSS
FT                   IAMALASAVVLSFVLEGVVRVTGIYGRQRIALAMLLALGCKFMLDLFFPVSSLWLGWVL
FT                   PGLVAADMQRQGLVETLTGTVIVSLLTVMSLEVLVFLGHFVGR"
FT   gene            231255..232343
FT                   /locus_tag="Amico_0223"
FT   CDS_pept        231255..232343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0223"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ilo:IL2402 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56369"
FT                   /db_xref="GOA:D5ECT7"
FT                   /db_xref="InterPro:IPR027602"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECT7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56369.1"
FT                   /translation="MEEKHITSLIEYQKKQREFVRKGRFRLVFLAIVLFCLWLIPRQRG
FT                   FSAEEGRLWDDVRQAEIFLWEWREERGDSSGIDADPWKLGLIGLEWSPLTTTLGSLEAK
FT                   RTACHPSWSVAILREFDAMGLKEGDSVAILSSSSFPGLLLNTLKAAEYRHLKVLLILSL
FT                   GSSTWGANVPGAPWPVLAEQLRERGLLHTKADYYTLGGDDENGGGIAPEGVALMIDMAK
FT                   GEGVPLLREGTLEGMISKKMEIVQKFSPRLVMSIGGSHANMGEDESILALPGGLHFPSA
FT                   DMVSGDGVIGQALSAGYSVFHLLNIHDLSLRYGIPYNANPSKAISSRKSLISSVAGIFL
FT                   SGWILLSHKRWMFCCGGGGSKP"
FT   gene            232340..232975
FT                   /locus_tag="Amico_0224"
FT   CDS_pept        232340..232975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0224"
FT                   /product="response regulator receiver and unknown domain
FT                   protein"
FT                   /note="KEGG: sdn:Sden_1917 response regulator receiver;
FT                   PFAM: response regulator receiver; SMART: response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56370"
FT                   /db_xref="GOA:D5ECT8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECT8"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADE56370.1"
FT                   /translation="MTLHIGVIDDDRKVLYQLEKMAEAEEWRFLATVDPEEVLGWVRDD
FT                   EIDILLVDVWMPVVSGYQLVQKARNISEKIVLIALAENEREDTASRLFLAGADDFVVKP
FT                   LQLLDFRARLRLHEKLANYREQLNWDVRKKGISVDTMREVIYCIKRHQGAMDCDEVAAK
FT                   TGLAYVTAHRYLDFLASRGMVVRLSAALDGRPGRPKTFYEWKGGLKTP"
FT   gene            232972..234240
FT                   /locus_tag="Amico_0225"
FT   CDS_pept        232972..234240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0225"
FT                   /product="Protein of unknown function DUF2088"
FT                   /note="PFAM: Protein of unknown function DUF2088; KEGG:
FT                   dat:HRM2_08470 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56371"
FT                   /db_xref="GOA:D5ECT9"
FT                   /db_xref="InterPro:IPR018657"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECT9"
FT                   /inference="protein motif:PFAM:PF09861"
FT                   /protein_id="ADE56371.1"
FT                   /translation="MTFCCTFASGRRTIDLFLDRRVTIAETSKETPLPNRPEDALAAPC
FT                   ESPLLRFLAREVSDIVVILPDATRAWQNVPLMAQALRREIREGGRMSVKWVIGGGQHRL
FT                   PTAKEIKMLLEDIPLRGDSILCHNSAEGVRTKEITSRGTPVILHKAVARADLIVSAGGI
FT                   AYHDLAGFSGGRKSILPGASGSEAIQHNHALSLKGSNFDPAVGCGYLKGNPVAEDMAEY
FT                   QSLVLAERKGFLLNVIPDGKGNPYCYTAGDPVRAWLQGTVWAQELQTLWVSEKASLVAV
FT                   SCGGYPYDIDLYQATKSISAVLHALEPKGGLLLFAELEDGAGPGSFGEDFRLAIEQPEA
FT                   ALGKLQDDFTIPAYIATKMASDLKSHPAALVTDRTDMVFPGKIFADGSKALQWLEKQIP
FT                   PGPVLCVPAGNCVTIKAKERNTI"
FT   gene            complement(234292..235044)
FT                   /locus_tag="Amico_0226"
FT   CDS_pept        complement(234292..235044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0226"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="KEGG: cha:CHAB381_0434 arginine-binding periplasmic
FT                   protein 1; PFAM: extracellular solute-binding protein
FT                   family 3; SMART: extracellular solute-binding protein
FT                   family 3; ionotropic glutamate receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56372"
FT                   /db_xref="GOA:D5ECU0"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="InterPro:IPR037297"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECU0"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ADE56372.1"
FT                   /translation="MKKITGFLLLLCLFMALSSSAYAGALDKGTIIVGTESTYPPYEFR
FT                   DEKNNLQGFDIELMNTIAEKLGKELEWVDMPFDSLIPALLAQKIDIVAAGMSATPERAK
FT                   RVAFSTPYEVSMSAFIVKKDNIALKSLDDMKSKTIAVQLGTVQETFSRTVEGAKVKTFQ
FT                   KFDDCVREVMLGRADASLMDIPVAKKFLEQKDFDGKIAVAFEQEITGAGKALAMNLEEK
FT                   AFAEAISSVLDEMQKSGELETLRNKWFK"
FT   gene            235168..236361
FT                   /locus_tag="Amico_0227"
FT   CDS_pept        235168..236361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0227"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   cti:RALTA_B1645 putative amino transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56373"
FT                   /db_xref="GOA:D5ECU1"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECU1"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADE56373.1"
FT                   /translation="MFWESLLNARAHRLQPSGIQEMMVYASRPGAISFAAGQPSEDLYP
FT                   IEEITHGFEEAMKDTSVLAYPYTEGDSMLRQWISNWMVEEGLASSVPGSERILLTTGSQ
FT                   EGLNIISQLFLKDGDVVVVENPSYPEAMLTFGKEGVRFVTVSMDEEGPVVSELEAALAK
FT                   EKVAFFYTIPTFQNPSGHSTSLARKKEILSLLKKYNVVLVEDEPYRQLWFDEKPAKTYF
FT                   SLAKEEPVLYLGSFSKIIAPGLRCGWMVLPPIIMEKAVQLRLTFELGVSALLQRMIFYV
FT                   VSRRNFEAHLSHLRHEYRERRDAMAEAISKHLAPLGFSFPTPKGGFFFWGSRDGLNGTD
FT                   FARFAAKNFGVALIPGEIFFALPQKGQNFVRFSFAKVDREETNKGMERLAKAFREFC"
FT   gene            236700..237992
FT                   /locus_tag="Amico_0228"
FT   CDS_pept        236700..237992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0228"
FT                   /product="diaminopimelate decarboxylase"
FT                   /note="KEGG: saz:Sama_3250 diaminopimelate decarboxylase;
FT                   TIGRFAM: diaminopimelate decarboxylase; PFAM: Orn/DAP/Arg
FT                   decarboxylase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56374"
FT                   /db_xref="GOA:D5ECU2"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECU2"
FT                   /inference="protein motif:TFAM:TIGR01048"
FT                   /protein_id="ADE56374.1"
FT                   /translation="MGSSKHLFWDGCDTVQLAQNYGTPLYVLSETAVRERCREVKKDFL
FT                   CKYPNTRAVYASKAFLTMAMVRIIASEGLGLDVVSGGEIYTAYRAGFPMEKTIFHGNNK
FT                   TLEELQLALETGVGRIVADSESELDIIEDAARRRGKRATLLLRVAPGVDAATHQYMATG
FT                   HTASKFGFPLAGESISRTIQRIKGSENLVLKGFHFHVGSQLQSNRSHCLAVDALIKEMV
FT                   LFSSDLGFVTEELNVGGGYGVPEHEGEERKPLKYFTEGIMERVIAGCEQAGIPVPAIII
FT                   EPGRWIVSEAGITLYKVGSIKEIPGVMTYVSVDGGMTDNPRPALYGAKYWGVVANRADE
FT                   LAGKKVTIVGKCCESGDVLMKDVMVTDQITRDDILAVFNTGAYNFSMANNYNRLPRPAV
FT                   VLVREGNAYVIVNRQDYEDLLSGEVIPDHLR"
FT   gene            238034..239692
FT                   /locus_tag="Amico_0229"
FT   CDS_pept        238034..239692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0229"
FT                   /product="Na+/H+ antiporter NhaC-like protein"
FT                   /note="PFAM: Na+/H+ antiporter NhaC-like; KEGG:
FT                   dde:Dde_0208 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56375"
FT                   /db_xref="GOA:D5ECU3"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECU3"
FT                   /inference="protein motif:PFAM:PF03553"
FT                   /protein_id="ADE56375.1"
FT                   /translation="MYGRRSGKKILNLTIMAALSLLVMTGIAWATEGEAKPDFGILSLL
FT                   PPLIAIGLCIFTKEVIPSLFIGAWFAGTMVAGWNPILGFGKAVGLVADNLGDPWGARIV
FT                   LTSLVMGGLVGIMQIGGGIEAIVRWITKKIQSVRGAMLVTELAGFIIFFEDYVNSLVVG
FT                   TTMSPITDRYRISKEKLSYIVDSTSAPIACIAGISSWVAYMVGQIGTQFNALEIGYSPY
FT                   LAYLRSIPYVFYNIIALVLLTFVIFSQRDMGPMLHAERRARQTGKVLREGAKPLIVTSH
FT                   ANFEPSEETPRRVINFLVPLGFMVGLIFLMLVVTGGWPSVSLATAIGEGDSSQALVLGS
FT                   FGSVFLTLVFFRAQKLATWNRLFAGFMQGMNSIFFGTLILIFAWAIGAAIKEVGTAQYI
FT                   VRIAGNVLSPAWIPLLTFFTGAIISFCTGTSYGTMGVLMPIVIPLVYNVTAVHDAGFIE
FT                   ILLPTIGAVFAGAVWGDHCSPISDTTIMSSMFSGADHVDHVNSQMPYAFVAAAGAVAGY
FT                   VFIGFGLPVLFSLILGAITTCLLFYFVSQPIEVRA"
FT   gene            239787..240632
FT                   /locus_tag="Amico_0230"
FT   CDS_pept        239787..240632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0230"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="TIGRFAM: diaminopimelate epimerase; KEGG:
FT                   sat:SYN_00169 diaminopimelate epimerase; PFAM:
FT                   diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56376"
FT                   /db_xref="GOA:D5ECU4"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECU4"
FT                   /inference="protein motif:TFAM:TIGR00652"
FT                   /protein_id="ADE56376.1"
FT                   /translation="MLEFTKIQGNGNDFIVIDNREGSMTSPDLSRLAASICERRQSVGA
FT                   DGLLVVEMSERENFTMRLFNNDGSEGEMCGNGARCIARYAWEKKIAGEKMSFETLAGPI
FT                   HGVVTAPFVELDMGETNLSQGFWGQSLKVEGETFPFVYLVVGVPHCVLFVDNLEDFSHD
FT                   SLRDIGRTVRYDTHRFPKGTNVNFVQRSGERTLKVVTYERGVEDLTLSCGTGSTASAIA
FT                   ASIVWEMAAPIQVQNPGGDNWVTVSFNETRSICKTYLTGKTVMIAEGRLYDEALPKDIE
FT                   "
FT   gene            240666..244040
FT                   /locus_tag="Amico_0231"
FT   CDS_pept        240666..244040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0231"
FT                   /product="AsmA family protein"
FT                   /note="PFAM: AsmA family protein; KEGG: rlt:Rleg2_3627
FT                   protein of unknown function DUF490"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56377"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECU5"
FT                   /inference="protein motif:PFAM:PF05170"
FT                   /protein_id="ADE56377.1"
FT                   /translation="MKRSRKMTLALFIAIGIVGLLLIIGSMNVGGDIVRREAAKAVAEV
FT                   LGADLTIQGVTGNPIRGYRLSDISLKKKEDVLLSAGALGVKVNLMSVFSGNPRLSQVTI
FT                   DGIEADGEKLAREIAALDLKGEGGEIPVEAVTIRNGKVRTPWGEASIAKTDLVLKADSV
FT                   KADLDIAMNNVPIKGPINLRKGKDDLELKGLDLKVGDGRISAKGAILPSLSLKGEMEKL
FT                   DVGQVVQFWPQLPVDGYKGLFSSTISIGGLWNDPVLEGRLSFSGTSLAGYPVQAIDSDW
FT                   KYGAFRLSLENLKAKALALPLSGRAAFAFAPGKVPSMDILMEGKDASLEELKGTVPALA
FT                   SVKGRVDSFSVAVKGTLATLSGNIDLKADQVEAYGQQLKNTVAHVVFKGSGATIQGSSS
FT                   LEGGSLALSGSVDQLQRAPRLNVLLKARSIDVGKIIASLPKPPKITPKGSVSADIGVKG
FT                   SMADPRVDGTVWSDRMAYGEEALNDLNTAFVFHKDRVTLSSARGRWRNIPITGRGTIAG
FT                   VSKAAPSLDLSFQAAGVNPENFESFFPDLKSYELRGSITAVAQVEGTTAAPEIKLSIQS
FT                   PRLNFMEQGHVANLSLSTDLALKEGVPKEVNLALKAATAGFAGVGAENLTARIDATKDV
FT                   VTLSQARASLGKGEIAGTGTVKLHPEASADLDLSFEMKEGDLAAIAKAGKLPYSLGGSL
FT                   SGKVSVKGKSDNPSIAADFSSPKAVFSGFTFSNLSGALEGNMERMALKKFTASAGGGTI
FT                   TTSGSFNLKKEAPEAILSLTGKGLDVASLTAGLPEAAKFKPSGAFDVNFDGTIAGSASE
FT                   GKGAVTASSLSIAGLKMTNISYPFTLQGMNLSIANAHASFYGGTVAGKGDMNLAKGAFS
FT                   QNITVENVDIDPLLQDAAGGLEGHIVGKAKGNLSLTGTMTKGLAFSGKGELHVGEGAVT
FT                   DFKAVKTAASLYGQSSIRFASVEAPFRLETKRVILENGKATAFPEDSLYKILKASGPIG
FT                   FDTTLALQCQGNVNIQVLNALFGGVAGALGAGTATSLEDILKGALTGAKSGLEKADFRD
FT                   VSFNLGGTIEKPSVSNVKIAPAPQAIQQTTPSGTAPTAVEEATAPPKEATGETQKKPEN
FT                   LLEGVIQEGLKNILKKE"
FT   gene            complement(244086..245537)
FT                   /locus_tag="Amico_0232"
FT   CDS_pept        complement(244086..245537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0232"
FT                   /product="glycogen/starch synthase, ADP-glucose type"
FT                   /EC_number="2.4.1.21"
FT                   /note="TIGRFAM: glycogen/starch synthase, ADP-glucose type;
FT                   KEGG: geo:Geob_1010 glycogen/starch synthase, ADP- glucose
FT                   type; PFAM: Starch synthase catalytic domain protein;
FT                   glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56378"
FT                   /db_xref="GOA:D5ECU6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECU6"
FT                   /inference="protein motif:TFAM:TIGR02095"
FT                   /protein_id="ADE56378.1"
FT                   /translation="MKVLHVASEVAPLSKVGGLGDVAGSLPKALRKLGIDARIVTPAWP
FT                   GVLDKANELGGNLVRLPPLLHISLQWHVMSSKIWKTIIDDVPIYILENSDLFENLPIYP
FT                   EELTGESALPFAFFSLSALDLEQKNRWAPDIIHCHDWPSALVPISLKWHRFYRDKNPRP
FT                   MTFFTIHNVAHQGIFPFHVLDEWGIDTRSFTIDGLEFYGHVNLLKGALITSNCITTVSS
FT                   RYGKEILTPEMGYGLDGVLRKEKSKLHCVLNGLDPGWSPVHDPYIPFPFSAENLEGKKH
FT                   CRSVLLQHLGWKDNMAPIFLSISRLTMQKGYDILLPALDALREIGVRCLFIGSGNPIFT
FT                   SALYEAADRHPDNFAFKHGFHEEFSHLAYAGSDMLIMPSLFEPCGLTQLIALQYGTVPV
FT                   VRETGGLADTVRDADDHPDGYGFTFIPYTTEALLKGVRRALNAYRDPFRWDGIIKRGMS
FT                   KDFSWKVSSQHYQDLYHRTLENKRR"
FT   gene            complement(245572..247305)
FT                   /locus_tag="Amico_0233"
FT   CDS_pept        complement(245572..247305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0233"
FT                   /product="alpha-glucan phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /note="TIGRFAM: alpha-glucan phosphorylase; KEGG:
FT                   pca:Pcar_1731 glucan phosphorylase; PFAM: glycosyl
FT                   transferase family 35"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56379"
FT                   /db_xref="GOA:D5ECU7"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011834"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECU7"
FT                   /inference="protein motif:TFAM:TIGR02094"
FT                   /protein_id="ADE56379.1"
FT                   /translation="MLFHPQSSLGRSLQDLLEQDPSFRTVAYFSMEVGIKTSIPTYAGG
FT                   LGILAGDILKSAADLGVPMIGTTLLYRKGYFEQEFNKEKWQIEKPALWQPEQELTLLPN
FT                   KVSVAIKNRDVHIRTWVYELSGLSGYSIPIYFLDTDIESNHPEDRQLSWYLYGGDNLYR
FT                   LCQEIVLGVGGLRMLRDLGYNNIETFHLNEGHAGFLTLELMREMGYYDPEKVREHVVFT
FT                   THTPVAAGHDFFKYDLIEKIMSSDALATLKRMIPSEGVSMTELGLRYSRFVNGVSKKHA
FT                   EVSRKLFSAPTIQSVTNGIHPTTWVSPGMRKLLSRHIPGWENDPARLIQALSLPSEDLW
FT                   AVHQASKMRLFAYILEETGVPLQSDVLTIGFARRAATYKRADLIFSNLKKLIEIGGGKI
FT                   QLVFSGKAHPKDDGGKALIQKIINTSDKIKDSIPMVYLENQTMELGRLITQGVDVWLNT
FT                   PLRPREASGTSGMKCTINGVMNFSVLDGWWIEGWIEDVTGWAIGPTPSDTDLHSYDESK
FT                   DALDLYEKLEKKIIPAYYNDKGHWHTMMKNAIAMNGSYFHTHRVVAEYCEKAYGVKFRG
FT                   I"
FT   gene            complement(247325..248818)
FT                   /locus_tag="Amico_0234"
FT   CDS_pept        complement(247325..248818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0234"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /note="TIGRFAM: 4-alpha-glucanotransferase; KEGG:
FT                   sfu:Sfum_3452 4-alpha-glucanotransferase; PFAM: glycoside
FT                   hydrolase family 77"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56380"
FT                   /db_xref="GOA:D5ECU8"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECU8"
FT                   /inference="protein motif:TFAM:TIGR00217"
FT                   /protein_id="ADE56380.1"
FT                   /translation="MIRQSGILLPVFSLPSPWAIGDIGARARNFVDWLAAAGQNCWQML
FT                   PLTCTKEILGNSPYDSISAFACSPLLISIEDLAEEELISNKEISSLNRVSSGRVDYSAA
FT                   KKIKMPLLKKAFQRFMSRTNTDPLYRFWEGQSWWLDDFSLFSAISCRMGDDRWNTWPSS
FT                   LKIRDKVALDTVRTEEKDHILFTVFIQYEAFTQIQRLRKHSLDRGIQLIGDLPIYVSYE
FT                   SADVWSHPEMFQLDRDLTPKAVAGVPPDYFSSTGQRWGNPLYRWDYAKGMEFHWWLKRI
FT                   AHSLQLYDMTRLDHFRGFLEYWAIPYTEKTAIYGRWEEGPGDSFFSALEKNFPSMPFLA
FT                   ENLGIITPDITRAMKKYDLPGMLVLLFAFDESMPRNPYILHNHEPRNIVYTGTHDNNTV
FT                   RGWFDDEGSPQDKERVSRYMNMPFTRDNAATVLTRMALMSVAERAVIPLQDYLNIGGEG
FT                   RINKPSTLEGNWQWMAEEKALTEDLASSLHSLMKTYGRL"
FT   gene            248928..250829
FT                   /locus_tag="Amico_0235"
FT   CDS_pept        248928..250829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0235"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /note="TIGRFAM: 1,4-alpha-glucan branching enzyme; PFAM:
FT                   alpha amylase all-beta; glycoside hydrolase family 13
FT                   domain protein; alpha amylase catalytic region; KEGG:
FT                   sfu:Sfum_3451 glycogen branching enzyme; SMART: alpha
FT                   amylase catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56381"
FT                   /db_xref="GOA:D5ECU9"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECU9"
FT                   /inference="protein motif:TFAM:TIGR01515"
FT                   /protein_id="ADE56381.1"
FT                   /translation="MKNFKVCPSLFSDLDTYLFKEGTHLKLYEKMGAHPLCSGETQGVY
FT                   FALWAPNASQVSVIGDFNLWNPEAAPLSCRPDESGIWEGFVSSAFIGDRYKYRVVSKRG
FT                   EAFDKGDPFAFAWEELPGTASIIASLHYQWNDHLWAEKRKKTNWFSYPLSIYEVHLGSW
FT                   MRKEGKFLSYREIAEQLTCYVKKMGFTAVEIMPLMEHPFYGSWGYQITGFFAPTSRYGS
FT                   PQDLMFLIDTLHQADIAVFLDWVPSHFPSDEHGLAYLDGTALFEHADPRQKIHPEWRSY
FT                   IFNYGRTEVREFLINSALFWLDYYHVDGLRFDGVASMLYLDYARKEGEWVPNRYGGREN
FT                   IEAVSFLRRLNEAAHLCFPHIVTIAEESSAWPLVTRPSYVGGLGFGMKWNMGWMHDILK
FT                   YMELDPLYRQYHHNDLTFSLMYAFSENYVLPFSHDEVVYGKRSLLEKMPGTLWQKFAQL
FT                   RLLLGFMYAHPGKKLLFMGSDIAQRAEWNHEESLHWNLLKDPFHSGMQLWVRDINRVYF
FT                   EEKALHEKDFSSEGFQWIDCSDSKASVLGFIRRDGEEGKVLAIFNFTPVVRHNYLVGVP
FT                   EAGYWRELLNSDGEIYGGMGEGNMGGKEAMEEPLQRQPCCLSLTLPSFGALFFRKEG"
FT   gene            250834..253227
FT                   /locus_tag="Amico_0236"
FT   CDS_pept        250834..253227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0236"
FT                   /product="glycoside hydrolase family 57"
FT                   /note="PFAM: glycoside hydrolase family 57; KEGG:
FT                   sfu:Sfum_2350 glycoside hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56382"
FT                   /db_xref="GOA:D5ECV0"
FT                   /db_xref="InterPro:IPR004300"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR021923"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECV0"
FT                   /inference="protein motif:PFAM:PF03065"
FT                   /protein_id="ADE56382.1"
FT                   /translation="MKYVCVHGHFYQPPRENPWLGDVELQESAAPWHDWNERITAECYA
FT                   PNMAARILGEDGKIVKIISNYERMSFNVGPTLLQWMERHAPETYDGLLEADHRGKERFS
FT                   NHGPALAQVYNHMIMPLASKRDKITQVLWGLQDFSSRFGRFPEGMWLPETAVDIETLEV
FT                   LASEGLRFTILAPHQAKAWKMISESWWHETDQRPMETCYPYLCNLPSGRSLAIFFYDDL
FT                   LAKDIAFGPLLKNGALLAQRLLLSIEKNSEENPLAHVATDGETFGHHHKYGDMALAWCL
FT                   DHIEHGENARLTVYGEYLEKFPPRREVRIRQNTSWSCVHGVKRWYEDCGCHSGLHPGWN
FT                   QKWRQPLRAALDWLREKIDGFYEKEGAFLFSDPWKTRDLYVQCFFYDSTTGRHEFLRSS
FT                   SLRNLSTEEKVRALKLLEMERSAMFMYTSCGWFFDEISGLEALQILLYAYHALTSLEEL
FT                   SGEKIKDDFIDLLERAPSNIEEFKNGGRIFDFFVAPSHVDFLRVGGHYAVQALFQEKVT
FT                   ESESFSLCNYRIKPERSLFLEEGRENLVMGEASLSHVLTGEDKRVFFSACHRGDHKVLC
FT                   GVRAASDQEEISTWERSIQTHFPQKIESVFVELFGHRTYSLRHLFKDGQRQIMHFVMER
FT                   DVARIENYLKSVVRDYDDLLTFMGLIRMPLPEALSGAAEVVLNGDLRRIIWEAEPDLEQ
FT                   VEKRLDQAFAWQVEINIGELQHHLRGRIEKEMAFLSEQAERNLQQGYLVRIEKMLGFVR
FT                   RHHWDVNLWKAQNIYASISDPNILEHPVFKHIGNLLNMRLGLHK"
FT   gene            253280..254386
FT                   /locus_tag="Amico_0237"
FT   CDS_pept        253280..254386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0237"
FT                   /product="glutamate 5-kinase"
FT                   /note="TIGRFAM: glutamate 5-kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; PUA domain containing
FT                   protein; KEGG: fph:Fphi_0609 gamma-glutamyl kinase; SMART:
FT                   PUA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56383"
FT                   /db_xref="GOA:D5ECV1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECV1"
FT                   /inference="protein motif:TFAM:TIGR01027"
FT                   /protein_id="ADE56383.1"
FT                   /translation="MKLCKRVVIKVGTSTVTHSTGKLNLLRMETLAREIADLQSSGREV
FT                   CLISSGAVGAGVGKINFPDRPKTLPEKQALAAIGQGRLVHMYEKFFSEYGKTVAQVLLT
FT                   RDVFSNRLRYLHARHTLSTLFDFGVIPIINENDTVAVDEIKFGDNDTLSAMLACLIDAD
FT                   LLIILSDIDGLFSDDPRINPEARLLPLVEEVSKDLLARSRTKGSKLSSGGMFTKLAAAR
FT                   IVMTSGIPMIIANNKEPNILRRLLDGEELGTLFVPSGSPVQARKQWIAFGSSPHGRIVI
FT                   DDGAAEAIRKRGKSLLPSGIVKVEGKFSRGEVVSIVDQDEVEIARGMVNFSSDEIGIIA
FT                   GHHTDEIEKLLGSTDYDEVVHRNNLALV"
FT   gene            254403..255659
FT                   /locus_tag="Amico_0238"
FT   CDS_pept        254403..255659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0238"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /note="KEGG: ppd:Ppro_3508 gamma-glutamyl phosphate
FT                   reductase; TIGRFAM: gamma-glutamyl phosphate reductase;
FT                   PFAM: Aldehyde Dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56384"
FT                   /db_xref="GOA:D5ECV2"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECV2"
FT                   /inference="protein motif:TFAM:TIGR00407"
FT                   /protein_id="ADE56384.1"
FT                   /translation="MNIKEKVRQMGIQAKKASRFLAVASSEQKNKALYAMARALRDHCK
FT                   EILEANEKDLEEGRQAGLSYALLERLTLNEKRVEAMAVGLEEIAAFRDPVGEVLGMWSG
FT                   QGGIRIGRVRVPLGVIGIIYESRPNVTADAAGLCLKAGNSVILRGGKEALHSNRVIAQV
FT                   ISEGATGAGVPEGAINIIDNPDREATMALMKMNDYLDVLIPRGGKGLKKAVQENATVPF
FT                   IMTGMGNCHIFVDETADMEKAVPIILNAKTQRPSTCNSVETLLVHSNIASQFIPQAMAA
FT                   LHEKGVEIRGDKTVCALDAQALPATDEDWATEYSDLILAVKIAESLDEAINHIAAYSTG
FT                   HSDAILTESYSNAQKFLNGVDSAAVYVNASTRFTDGGVFGFGAEIGISTQKLHARGPMG
FT                   VEQLTSTKFIIYGNGQIRE"
FT   gene            255665..255781
FT                   /pseudo
FT                   /locus_tag="Amico_0239"
FT   gene            complement(255778..256485)
FT                   /locus_tag="Amico_0240"
FT   CDS_pept        complement(255778..256485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0240"
FT                   /product="protein of unknown function DUF554"
FT                   /note="PFAM: protein of unknown function DUF554; KEGG:
FT                   dvm:DvMF_3049 protein of unknown function DUF554"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56385"
FT                   /db_xref="GOA:D5ECV3"
FT                   /db_xref="InterPro:IPR007563"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECV3"
FT                   /inference="protein motif:PFAM:PF04474"
FT                   /protein_id="ADE56385.1"
FT                   /translation="MNFFIGNIPASGSIVNCLAVIVGSTLGLLFRSRLPQRYINMAFQV
FT                   LGLFTLFLGFLMAQKTANFLILVFSMVGGGMIGEALDLDGRFSRFSEKVSQRFKTSGQS
FT                   FAEGFLTSTLLFCIGSMAILGAIEEGLGLYPNLLITKSLLDGVSSLALATSLGGGVLLS
FT                   AFSVLFYQGGLTLLASSLQPILSESVINEISAAGGLMLIALGLSLLEIKRFKVTNMLPA
FT                   LVIAAILGSFFVH"
FT   gene            complement(256534..257463)
FT                   /locus_tag="Amico_0241"
FT   CDS_pept        complement(256534..257463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0241"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   dvl:Dvul_1925 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56386"
FT                   /db_xref="GOA:D5ECV4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECV4"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADE56386.1"
FT                   /translation="MEMLIPILAAAVRSGTPILYATLGEIITEKAGILNLGLEGIMLVG
FT                   AYTGFAATYKTGNPWIGVIAAFLIGGLMAAIHAFITITLKGNQVVSGLALTMFGTGASS
FT                   LLGRSYIGFTIKGLDKIPLPILSDIPVIGPVLFNNDALIYVSFVLVLLLYMFFSRTRNG
FT                   LYLRAVGDNPRAADAMGINVDRTRYIYTLIGGGIVAVGGAYMSIAYTKMWAELMTAGRG
FT                   WISVALVIFAIWNPFRAAFGAYLFGGVEAFQLRLQAAGTSIPTPLLMMLPYIMTILVLF
FT                   FISVSQGKGILFGAPASLGQPFFREERD"
FT   gene            complement(257465..258535)
FT                   /locus_tag="Amico_0242"
FT   CDS_pept        complement(257465..258535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0242"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   dde:Dde_0138 branched-chain amino acid ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56387"
FT                   /db_xref="GOA:D5ECV5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECV5"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADE56387.1"
FT                   /translation="MKYLKVERRLITPAWFTVAIPLFAIILALVTGAVFLYFMGVSPLQ
FT                   TYTSMFKASFGDTYGLTETIVKAIPLAMAGIAVTLSFKMLIWNIGAEGQILMGALATAA
FT                   AVRYFFVDQPFIMFWIMFAAAATAGGIWAAFAGYLKARWNVNEIITTLMLNYIVLNMVD
FT                   YFVYGPWRDPASLGFPMTAPFPNAARLPLLGDTRIHTGLFLAIFLAFFFWALLKWTRWG
FT                   YEIRVIGENPKAATFAGMNYLRNAVMVMFVSGAIAGLAGMCEIAGLQGRLQHGSSAGYG
FT                   YTAIIVAWLARLNPLTVLFVAFLIGALFVGGDTLQIVMRLPLSSILVLQGLLLFFVLGG
FT                   EFFRRYRIRIIWRGDN"
FT   gene            complement(258532..260136)
FT                   /locus_tag="Amico_0243"
FT   CDS_pept        complement(258532..260136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0243"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: dat:HRM2_06320 RbsA1; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56388"
FT                   /db_xref="GOA:D5ECV6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECV6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADE56388.1"
FT                   /translation="MRPFFLKKIAMKGNVAMEKAKTASPLVQMQEITKEFAGIVANHNI
FT                   DFDVNRGEVHALLGENGAGKSTLMNILYGLYNPDRGHILIDGKKVSFSSPKDAIAAGIG
FT                   MVHQHFMLIPSQTVWENMILGLEGLPQLLPKKEIHQQIIDISRQYGLEVDPDAKIWQLS
FT                   IGEQQRVAILQMLYRKAQVLILDEPTAVLTPQEALRLFSTIQQMTAEGHGIVFISHKLD
FT                   EVLSLSDRISILRKGEKTGTVQTAATSKEQLAELMMGRKVSFTVARKSSAPGKQILQSK
FT                   KITVLGDRGIPVVKDLSIDVREREILGLAGIAGNGQQELCEALAGLRPLKEGRIMIDDE
FT                   ELTHQPPKQFIARGVRYIPADRKGTGLVPNMDIKENSILKKYWNKPVARGPMIDWKAVF
FT                   SHAINLVKKYSVSTPSIETPVKNLSGGNLQKLMLGRELCDAPKALIAVHPTWGLDVAAT
FT                   QFVREQLLLERDRGAAVFLVSEDLEELLSLSDRLAVIFKGEIMGILDHPEEATPEMLGL
FT                   MMAGTPLSSIKEGAIAR"
FT   gene            complement(260167..261249)
FT                   /locus_tag="Amico_0244"
FT   CDS_pept        complement(260167..261249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0244"
FT                   /product="basic membrane lipoprotein"
FT                   /note="PFAM: basic membrane lipoprotein; KEGG: dps:DP0677
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56389"
FT                   /db_xref="GOA:D5ECV7"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECV7"
FT                   /inference="protein motif:PFAM:PF02608"
FT                   /protein_id="ADE56389.1"
FT                   /translation="MKRSLIVLFVALSVALCGTAFAMEAIPAEKINCGFVYIGPVGDGG
FT                   WTYMHDQGRLEMESAFPGLKSSYVESVPEGPDSARVMETFVRNGSKVIFATSFGYMDFV
FT                   QDVAKRYPDVVFMHCSGYKRADNVGIYFGRMYQARYLSGLVAGKMTKNNVIGFVAAHPI
FT                   PEVIRGINAFTQGVRKANPEAEVKVVWLFSWFDPGKEKEATKALIDSGADVISMHADSG
FT                   AAPQTAEEAGVYVVGYNNDMSQYAPTKHLTAPIWDWGIVYKRVIEQVTMGTWKSEDIWW
FT                   GLKEGMVGLSKYGKDVPEEVKKLVEEEKTRIISGEWDVFDGPIKDQSGTIKVEAGQSLS
FT                   DGDKLSMNWFVEGVKGDIPK"
FT   gene            261448..261927
FT                   /locus_tag="Amico_0245"
FT   CDS_pept        261448..261927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0245"
FT                   /product="Xanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.22"
FT                   /note="KEGG: dde:Dde_1506 xanthine-guanine
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56390"
FT                   /db_xref="GOA:D5ECV8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023747"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECV8"
FT                   /inference="protein motif:PRIAM:2.4.2.22"
FT                   /protein_id="ADE56390.1"
FT                   /translation="MGSEDRYHKTYPVSWDQLHRDCKALAWQLLPRKWEKIIGIARGGL
FT                   IPAAIIARELNIRLVDTVCISSYTIRTQGEANILKGINGDGENCLIIDDLVDTGKTARV
FT                   VRKMLPKAYFATVYAKPEGSPFVDTYITQVSQDTWILFPWDSETAYSTPLVDRKE"
FT   gene            261978..262454
FT                   /locus_tag="Amico_0246"
FT   CDS_pept        261978..262454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56391"
FT                   /db_xref="GOA:D5ECV9"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECV9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56391.1"
FT                   /translation="MLYIKFALPFALWAWVLSSSYARYILPRISSVYGLLKGLESKEAH
FT                   SASSFHVRGTSFLVKIVMLFSQMYALAAWSAYSVLRTMRFARLPETRGWIYYLTAFIIC
FT                   EGALGVIARKEEYNGFLSILHSIMAMGAFVIFAFNPHLMGSMYSWLIRLVGVEL"
FT   gene            complement(262530..263048)
FT                   /locus_tag="Amico_0247"
FT   CDS_pept        complement(262530..263048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0247"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG: cbc:CbuK_0648
FT                   protease I"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56392"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECW0"
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /protein_id="ADE56392.1"
FT                   /translation="MTGREIIILVEENFHDLEFWYPYYRLIEDGYEPIVVAPVAPRHYT
FT                   GKFGTIVEAAYTPQSLSENLPRGVVIPGGWAPDKLRMSGEIVSLVAQIYRSNGVVASIC
FT                   HGGSLLVSAGILKGKQVTSFASIKDDMELAGAIWVDEPVVTSEKLITSRKPSDLPFFTK
FT                   ALLEALQKK"
FT   gene            263160..265097
FT                   /locus_tag="Amico_0248"
FT   CDS_pept        263160..265097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0248"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   sfu:Sfum_2348 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56393"
FT                   /db_xref="GOA:D5ECW1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECW1"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADE56393.1"
FT                   /translation="MSSYQSRETFRFKECTLLPISTGIQARNLRELREGIEEVAPSCLY
FT                   YHFWGRLLSPQFPESEYVNDFASWAKVYLHEDALSERLSALDLNHRNDIEDIREELLDL
FT                   LDETLSREYFISWKEADRTFHFTRAHLIVVETALSADSPRTLPRAIASSSRGSIFFHFI
FT                   EAKRRNREDRQDDYSKWLGFFGEETAEAREELTNLDPYLHSLTDLRERLVHILEIAFVL
FT                   GGGESFMTQLLQNYGVLAGEQVISSLYRFATFLQGKKVVHVNSTREGGGVAEILRCMIP
FT                   LMNELGIETHWEVIVGSEAFYTATKSIHNALQGKDLPFTESYHEVYMETNRLNAERLRP
FT                   LLEEADFVFIHDPQPAPLLSLCPNRKGKWIWRCHIDASVPNRNIWRMLRRFVSEYDASI
FT                   FSLADFTQRLPHPQYLIPPSIDPLSEKNIVLSEREIDETCLRFNLDRERPLVVQVSRFD
FT                   VFKDPIGVIKSYRMARKHADMQIVLAGGGAADDPEGAAILEQVKNAASDDPDIHVIELP
FT                   SNAHRTINGLQSAADIIMQKSTKEGFGLTVTEGMWKYKPVIGGDVGGIRLQIINRFNGF
FT                   RVQTPEGAALRLRYLLAWGRQRKRMGQNAHKYVRENFLITTHLRTVLALMINLSQNGGE
FT                   DLEAQMSQKL"
FT   gene            265152..266693
FT                   /locus_tag="Amico_0249"
FT   CDS_pept        265152..266693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0249"
FT                   /product="Alpha,alpha-trehalose-phosphate synthase
FT                   (UDP-forming)"
FT                   /EC_number="2.4.1.15"
FT                   /note="KEGG: sat:SYN_02628 alpha,alpha-trehalose-phosphate
FT                   synthase (UDP-forming); PFAM: glycosyl transferase family
FT                   20; glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56394"
FT                   /db_xref="GOA:D5ECW2"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECW2"
FT                   /inference="protein motif:PRIAM:2.4.1.15"
FT                   /protein_id="ADE56394.1"
FT                   /translation="MADKERMIVVSNRLPIILKKRKQKWSVEPGAGGLVTALSPVLKDR
FT                   GGMWIGWPGTRGRINLSGLRKILGPISEETGFRIVPILLENGEIDNYYYGFSNSIIWPL
FT                   FHDLEALCRFQPQYWEAYVRVSDKFAAVIAKHSTEKDIIWVNDYQLILLAGSLERLGVK
FT                   RHCVFFLHIPFPSPDLFIKLPWRKQIIDELLRFSFLCFQTHRDRRNFIDCARSFYPACR
FT                   VVGRGAIVELEIKGHTIQIGSLPISIDYKRFRSMASAKEAALRSREIRKDITADFLVLG
FT                   IDRLDYTKGIPEKLRAFARALEKYPHLQGKISLFQLIIPSREGVAEYGALRDEIQKLIS
FT                   EINGRFSTTAWVPILYRYGTVDQKELVAMYRAADAGFVSSLKDGMNLVCKEYCACQTDY
FT                   KGVLILSEFAGAAYQLRSGAILINPYDVEATADALYYSIFMKEEEKKNRMRRMCKSIRE
FT                   RDVYWWVNNFLRAAAGKELKDFPEAELPEFWPGLRKKVFVFKDKKGGENDGVKRE"
FT   gene            266674..267201
FT                   /locus_tag="Amico_0250"
FT   CDS_pept        266674..267201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0250"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: dds:Ddes_1158
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56395"
FT                   /db_xref="GOA:D5ECW3"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECW3"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ADE56395.1"
FT                   /translation="MALKENEAIRAILGRRSIRRFEEKAVEKEKIELLVECGSAAPSAA
FT                   NSRPCHFIVVTDRDLLNRLGEDHPYGKMLFEAPLGIVVCGNPEKSDFARRYWEEDCSAA
FT                   MQNILIAAHAIGLDGVWLGVRHAEGCEEAVRKIISIPEHIAVLGIAAIGYGKEKKEPHK
FT                   GIDEGTLHLNRW"
FT   gene            267258..267785
FT                   /locus_tag="Amico_0251"
FT   CDS_pept        267258..267785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0251"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: dds:Ddes_1158
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56396"
FT                   /db_xref="GOA:D5ECW4"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECW4"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ADE56396.1"
FT                   /translation="MDKREHPVIKAILGRRSIRKFTTAPVEKEIIDILLECAFAAPSAH
FT                   NQRPCHFIVIQERNILNRLAAAHDSGKMLAQAPLAIAVCADTSFYPKEDLAWMEDAAAA
FT                   LENILLGARAFGIEGVWLKVMGRHPREERVCPILEVPDHIKVTGIAALGYPAEEKAPHK
FT                   GINDKALHKERW"
FT   gene            267936..270389
FT                   /locus_tag="Amico_0252"
FT   CDS_pept        267936..270389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0252"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA gyrase/topoisomerase IV subunit A;
FT                   TIGRFAM: DNA gyrase, A subunit; KEGG: nis:NIS_0489 DNA
FT                   gyrase subunit A; PFAM: DNA gyrase/topoisomerase IV subunit
FT                   A; DNA gyrase repeat beta-propeller"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56397"
FT                   /db_xref="GOA:D5ECW5"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/Swiss-Prot:D5ECW5"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ADE56397.1"
FT                   /translation="MEEKKGEPLFGKVVPLPLVEEIKHSYLDYAMSVIVGRALPDARDG
FT                   LKPVQRRILYAMMELGLRHNTAYKKSARVVGETMGKYHPHGDSAIYDTMVRMAQDFSMR
FT                   YPLVDGQGNFGSIDGDPAAAMRYTEARLYEIGELMLADIDQDTVDWGPNFDESLQEPLC
FT                   LPAMLPNLLINGSSGIAVGMATNIPPHNLVEVVDALCYLIDTEPEQVDIGEILFRMPGP
FT                   DFPTGGLILGRDGIIDAYRTGRGKITMRGRTHIEEGKRGKTFIVITEIPYMVNKTNLIE
FT                   TIAKNVQDKTIDGVMDLRDESDREGLRIVIEVNRDTDPNLVLRQLYRRTQLQSTFGVIN
FT                   LALIDGYPKELSIEEMLNIFLNHRRSVVRRRTQFRLEKAEARAHIVEGLVKALDIIDEV
FT                   IALIRGSATTEEAKEGLISKLDFSEAQAQAILEMRLQRLTGLEREKLEAELAQLLSDIE
FT                   RYQTILGNPKVLDSVIKEELLEVKRRFGNERKTEIIDAVEDVSIEDLIPESDIVVVLSR
FT                   DGYLRRKDLQEYTLQGRGGKGRKGTALQEEDEVALVAVTSTHRDIYLFTSKGRVLALKG
FT                   YVIPESKTGRGKLINRFVALEEGERVVTMHGRAVDGAKYAFFITLRGTAKRLDLSELEN
FT                   LTRAGRRVMGLDEGDEISQIVLTSGDDHLLIVTAQGQALRTHESEFRPMGRTARGVRGI
FT                   RLRKNDYVIGCDVVANGRWPLLLSENGFGKRTKYDEFSLRHRGGSGVIVMNLSDRTGLI
FT                   VGCWSVAEGDEIVAITSRGRMIRLAVSESPVLGRTAMGSIMMRLDEGDTVATASVVSTE
FT                   DGEDD"
FT   gene            270389..271024
FT                   /locus_tag="Amico_0253"
FT   CDS_pept        270389..271024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0253"
FT                   /product="phosphatidylserine decarboxylase related protein"
FT                   /EC_number="4.1.1.65"
FT                   /note="TIGRFAM: phosphatidylserine decarboxylase related
FT                   protein; KEGG: reu:Reut_A0950 phosphatidylserine
FT                   decarboxylase; PFAM: phosphatidylserine
FT                   decarboxylase-related"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56398"
FT                   /db_xref="GOA:D5ECW6"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033175"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECW6"
FT                   /inference="protein motif:TFAM:TIGR00164"
FT                   /protein_id="ADE56398.1"
FT                   /translation="MIARDGWPLIIFVAFLTGGSMFISPWMAAIMSVFLAIVVWFFRDP
FT                   ERELPVDPEVWVSPADGKVVEIEKASCSYVGEAIKVGIFMSPFDVHVNRVPYDGIVDYL
FT                   EYVPGKKWMAFAPKASEENERMLVGLETAHGRILLVQIAGFLARRIVCRLKKGDRLCRG
FT                   QRFGMIKLGSKVDVYLPLSVKCSVTIDQKVKAGKSVLGVTASHEKKNR"
FT   gene            271005..271739
FT                   /locus_tag="Amico_0254"
FT   CDS_pept        271005..271739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0254"
FT                   /product="CDP-diacylglycerol/serineO-phosphatidyl
FT                   transferase"
FT                   /note="KEGG: wsu:WS0623 phosphatidyltransferase; TIGRFAM:
FT                   CDP-diacylglycerol/serine O- phosphatidyltransferase; PFAM:
FT                   CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56399"
FT                   /db_xref="GOA:D5ECW7"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECW7"
FT                   /inference="protein motif:TFAM:TIGR00473"
FT                   /protein_id="ADE56399.1"
FT                   /translation="MRKKIGKRHLSFREIAPNMVTSGNLLCGMLSLILTFHGRFLPAAW
FT                   LIFFAVFFDFMDGKVARSLGGGTQFGLEYDSLADVVSFGVAPAILVYANYLQGFAGVTG
FT                   ALAVCFFALCGALRLARFNIVHVPGPFQGLPIPAGGLFLASFVIGGISVPAALAAFFSV
FT                   GTGALMISSVPYGNLKGLRKGNTNKKKFLFLCMVTVGLIIVLHGTAPLAAISIYVISGL
FT                   LRFDWGKWLSLEEDEDTLNEGV"
FT   misc_binding    271761..271867
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam(RF
FT                   00059), score 57.61"
FT   gene            271920..272765
FT                   /locus_tag="Amico_0255"
FT   CDS_pept        271920..272765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0255"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /note="KEGG: msu:MS0677 phosphomethylpyrimidine kinase;
FT                   TIGRFAM: phosphomethylpyrimidine kinase; PFAM:
FT                   Phosphomethylpyrimidine kinase type-1"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56400"
FT                   /db_xref="GOA:D5ECW8"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECW8"
FT                   /inference="protein motif:TFAM:TIGR00097"
FT                   /protein_id="ADE56400.1"
FT                   /translation="MALYRGNALTIAGSDSGGGAGIQADLKTFAALHIFGMSVITAVTA
FT                   QNSLTVKDIHDIPPKSITAQLDAVLSDFRVDAAKTGMLSRPETIHVVCEALKNYQLSNL
FT                   VVDPVMISQSGVSLISESAVQALKEQLLPLALLVTPNMPEAEKLSGVEVQSLEDMKNAA
FT                   RLISGLGPKAVLVKGGHMDVEKSKEKVVDVLYCEGKITIFEDPRVDTENTHGTGCTLSA
FT                   AIAAELSAGRDLEEAVSYGRQYLRMGLLHSFKPGHGYGPLGHAVTPEWVKEYESGDNEI
FT                   "
FT   gene            272740..273594
FT                   /locus_tag="Amico_0256"
FT   CDS_pept        272740..273594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0256"
FT                   /product="Hydroxyethylthiazole kinase"
FT                   /EC_number="2.7.1.50"
FT                   /note="KEGG: hypothetical protein; PFAM:
FT                   hydroxyethylthiazole kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56401"
FT                   /db_xref="GOA:D5ECW9"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECW9"
FT                   /inference="protein motif:PRIAM:2.7.1.50"
FT                   /protein_id="ADE56401.1"
FT                   /translation="MNLETMRYKDIQIAEVWEDIRHYRPLVYQLTNMVAANFQANISLA
FT                   AGASPLMSINAEEASFLASRADSILINTGTPSDESIRSIKEILPVIRKEKKPLVLDPVG
FT                   YGASPLRISLVEEILRSEAVTTVKGNRGEMGLLGGEEGTVQGVDGYNCKDLEKALSNIV
FT                   SSYGVVAVATGKEDSVAIPVPPSCFFLVLGGGSPLLPAITASGCAVGSLIAACSAVTAD
FT                   YGLAAITALVAVSLASEKAAGRENVYGPGTFGNVFIDEVSSLVKSDFYGYEERLNRKEE
FT                   WRE"
FT   gene            273591..274214
FT                   /locus_tag="Amico_0257"
FT   CDS_pept        273591..274214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0257"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="TIGRFAM: thiamine-phosphate pyrophosphorylase; KEGG:
FT                   hypothetical protein; PFAM: thiamine monophosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56402"
FT                   /db_xref="GOA:D5ECX0"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECX0"
FT                   /inference="protein motif:TFAM:TIGR00693"
FT                   /protein_id="ADE56402.1"
FT                   /translation="MNIRHMLKLYVIPDRQIGAPRTLLEQTEEVLKGGATVIQLRDKQS
FT                   GGRELLETALAMKRLCYDYNVPLIINDRLDVALAAQADGVHLGQKDLPLEAVRPFLPRG
FT                   FIVGVSAHTVDQARIALKSGASYIGIGAAFPTGSKEDAHVVGLSRIREIMEAVPIPAVA
FT                   IGGINEENVAEAMKTGVNGVAVISAIVGAPHIKKAARHFLSLIS"
FT   gene            complement(274277..274807)
FT                   /locus_tag="Amico_0258"
FT   CDS_pept        complement(274277..274807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0258"
FT                   /product="thiW protein"
FT                   /note="KEGG: dal:Dalk_0377 BioY protein; TIGRFAM: thiW
FT                   protein; PFAM: ThiW family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56403"
FT                   /db_xref="GOA:D5ECX1"
FT                   /db_xref="InterPro:IPR012652"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECX1"
FT                   /inference="protein motif:TFAM:TIGR02359"
FT                   /protein_id="ADE56403.1"
FT                   /translation="MPFSGTENNASISSSRLHIKKLTVAGLLAGAGVLLSGIYIPVGPT
FT                   KCFPFQHTINVLAGILLGPWWGASIAFVTSFIRNMMGTGSLFAFPGSIPGVLMVGFAYR
FT                   LFKKDWAALVEPLGTGPIGATLSALVIGPAIGKTPALGALQFAFLASSIPGALLGFALV
FT                   IMTKRMGILKDLS"
FT   gene            complement(274782..275726)
FT                   /locus_tag="Amico_0259"
FT   CDS_pept        complement(274782..275726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0259"
FT                   /product="NMT1/THI5 like domain protein"
FT                   /note="PFAM: NMT1/THI5 like domain protein; KEGG:
FT                   dat:HRM2_04300 ABC-type transporter, substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56404"
FT                   /db_xref="GOA:D5ECX2"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECX2"
FT                   /inference="protein motif:PFAM:PF09084"
FT                   /protein_id="ADE56404.1"
FT                   /translation="MKKIVVILCLALSIFCFSANSLFAVDKLSLMLDWFPNIDHLPLFV
FT                   AKEKGIFERHGLELSILSPSETADPLKLAASSHIDLAIAYEPQTIIAASSGIEIKGVGR
FT                   LIGHPLTTLLFIGGKNIEKPSDLEGKKIGYTVPGMMDLLTDGFAKENGFQKYELINVGF
FT                   TIIPSLTTGKVDAIMGPYKNYEVVELEQHGYTPGYFELEKYGIPDYDELVFVTGATTLK
FT                   DKERLIRRFRKAIQEAIEMTRKTPEEALEVYLKAVPEAPRELETAAFARTLDLYAHTQD
FT                   FSVEKWQKFADFAASIGMIDKEVLVHAILWNGK"
FT   gene            complement(275755..276501)
FT                   /locus_tag="Amico_0260"
FT   CDS_pept        complement(275755..276501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0260"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: dat:HRM2_04310 ABC-type
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56405"
FT                   /db_xref="GOA:D5ECX3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECX3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADE56405.1"
FT                   /translation="MSFVKRTVVSTGLLLLLFLLWEGACRLANIPIFILPAPSRVLFVA
FT                   VTQAPLLAYHAAMTGIEIILGIFFSITAAIPLAVVMFVYPSVEQAFSPLLVASQAIPVF
FT                   ALAPLLIVWFGYGIWSKVFMAAIIIFFPIVVNLLEGLKSCDSDYRKLFHLMGAPFFQSF
FT                   RYLYWPWALPYFLAGLKVGVSVATIGAVIGEWVGAQRGLGYLMIQSNARLRVDLVFASI
FT                   LWLTAIGIFLWILVGAIEKRTLTWTR"
FT   gene            complement(276498..277235)
FT                   /locus_tag="Amico_0261"
FT   CDS_pept        complement(276498..277235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0261"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: dat:HRM2_04320 ABC-type transporter, ATP-
FT                   binding protein; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56406"
FT                   /db_xref="GOA:D5ECX4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECX4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADE56406.1"
FT                   /translation="MLRLSHLGKKYNGLPVIDQFDLDIEKGSFSVLIGPSGCGKSTLFD
FT                   LLTGTIEREYGTMEWIGEAVPHLGQIAAYMQQKDLLLPWLSLMQNAMLPQVFSKEKHLR
FT                   KNKKAKGLFERFGLNGFEDYLPGAVSGGMKQRCALIRTLMFEREIVLLDEPLSALDAIT
FT                   RRSLQSLLLSLQKDFKKTVLMITHDIDEALYLADTVLVLTQAPMKIRDRITLPSEKPRN
FT                   LDSSEYIAIKKRILSELEEEMQL"
FT   gene            complement(277262..277765)
FT                   /locus_tag="Amico_0262"
FT   CDS_pept        complement(277262..277765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0262"
FT                   /product="proton-coupled thiamine transporter YuaJ"
FT                   /note="TIGRFAM: proton-coupled thiamine transporter YuaJ;
FT                   PFAM: thiamine transporter YuaJ"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56407"
FT                   /db_xref="GOA:D5ECX5"
FT                   /db_xref="InterPro:IPR012651"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECX5"
FT                   /inference="protein motif:TFAM:TIGR02357"
FT                   /protein_id="ADE56407.1"
FT                   /translation="MRNKTRVLVEGALAVAMTVAFSYIRLWRMPQGGSVTLENVPLLIF
FT                   ALRHGLKYGVGAGFVAGIIQLTLGGYVVHPVQALLDYPLAFAALGLAAFVRKPLWGGLT
FT                   LGTISRLFCHVLSGVIFFGSYAPEGTNVWLYSIIYNGSYMVPNLILGIFVTYLVWGRLS
FT                   RIGQ"
FT   misc_binding    complement(277820..277928)
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam(RF
FT                   00059), score 73.07"
FT   gene            278042..278857
FT                   /locus_tag="Amico_0263"
FT   CDS_pept        278042..278857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56408"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECX6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56408.1"
FT                   /translation="MEKEVFTLKGAYGDEKVFVSRLSPKDSVGKVIVLFHGVHGCASVH
FT                   EGNKYAVLARMLLPLGLTVYLTETSRLRRDRDSFKEDRDRWARTAFQGKTYGMDLYDVC
FT                   VALSEIEKRHPTEEIYLWGFSLGGIHSLMIAGGGYQTKLREGGFPQPVFSVSPSGIIVS
FT                   GSGDSIDKDDVSTTLRLPILDTIGDNALLYKSVRSIKTGWFVSFYGENDNTFSEEACRR
FT                   LFDAADIPEKQFIIIPGADHAFRRLYGLPSIEPLKRMVSYLGPFFDNRN"
FT   gene            complement(278854..279534)
FT                   /locus_tag="Amico_0264"
FT   CDS_pept        complement(278854..279534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0264"
FT                   /product="peptidase A24A prepilin type IV"
FT                   /note="PFAM: peptidase A24A prepilin type IV; KEGG:
FT                   aha:AHA_3871 prepilin peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56409"
FT                   /db_xref="GOA:D5ECX7"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECX7"
FT                   /inference="protein motif:PFAM:PF01478"
FT                   /protein_id="ADE56409.1"
FT                   /translation="MKKILLIPLCILFFILGALIEKFARNLTRDLCLSETSRFRSFFSR
FT                   PWIPGAFFVVSGLLLFYVWGVSFSFFMAFLLTVGLFFSALTDLYSGYIFDAVPAVMGVG
FT                   SFIFRWAAGTSPLLDGIMGALAGIVIMAFVRWISRGGMGIGDIKLIGGMGLGLGLPLTL
FT                   YGLYIGILVGGIVAGWLLLTCRVHRKQPIPFGPFIALGGIIALATAPFLGTYFNIVLVW
FT                   PWGC"
FT   gene            279624..280082
FT                   /locus_tag="Amico_0265"
FT   CDS_pept        279624..280082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0265"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: geo:Geob_3533 UspA
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56410"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECX8"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ADE56410.1"
FT                   /translation="MLKKILVAVDLSKVSEEVFAYGCSLALRLGVHASFIHVMPHPTLW
FT                   KGYEPWLPPEIDMEISEIARKKLEYYFKKAKERMPELANVKYDMIVKEGSPSDVIIDYA
FT                   REGEYNLIVIGYRGQSTIERLVVGSTAANVARYAHCSVLIYRPGLDIL"
FT   gene            280349..280750
FT                   /locus_tag="Amico_0266"
FT   CDS_pept        280349..280750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0266"
FT                   /product="methylmalonyl-CoA epimerase"
FT                   /note="KEGG: dol:Dole_0080 glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; TIGRFAM: methylmalonyl-CoA epimerase;
FT                   PFAM: Glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56411"
FT                   /db_xref="InterPro:IPR017515"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECX9"
FT                   /inference="protein motif:TFAM:TIGR03081"
FT                   /protein_id="ADE56411.1"
FT                   /translation="MKVTRIDHIGIAVKSIEESLKVWEVALGIACTGVEEVEEQKVKTA
FT                   FLPVKDTEIELLEATGDDSPIAKFIEKKGEGLHHISLRVENLEKALSELKEKGVRLIDE
FT                   TPRYGAGGAKIAFVHPKSTGGVLLELSER"
FT   gene            280766..282325
FT                   /locus_tag="Amico_0267"
FT   CDS_pept        280766..282325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0267"
FT                   /product="carboxyl transferase"
FT                   /note="PFAM: carboxyl transferase; KEGG: dal:Dalk_3780
FT                   propionyl-CoA carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56412"
FT                   /db_xref="GOA:D5ECY0"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECY0"
FT                   /inference="protein motif:PFAM:PF01039"
FT                   /protein_id="ADE56412.1"
FT                   /translation="MTNRSIDELCADLERKRAQAREGGGPKSIEKQRGKGKGTARDRIA
FT                   GLLDEGTFVELDEQVVHRCGRFGLGETSFPGDGVVTGFGEIDGRRVYVFSQDFTVLGGS
FT                   LGEMHAGKICKVMDLAMKNGSPVVGINDSGGARIQEAVDALNGYGDIFFRNTIASGVVP
FT                   QLSVIMGPTAGGAVYSPALTDYIFMVEKTGIMHITGPAVIKAVTGEEVTSEALGGSQAH
FT                   NTKSGNAHFTARSEEECFVQVRKLLSYLPSNNVDDAPWKEPSDDPLRLVPELRNVVPTN
FT                   PNKGYRVHDVIGKVVDDGDFFEVQALWAMNMVTGYGRVGGQVVGIIANQASTLAGCLDI
FT                   NASDKASRFIRHCDAFNIPLLTFVDVPGYLPGTEQEWGGIIRHGAKLLYAYSEATVPMV
FT                   TVVLRKAYGGAYLGMCSKALGADMVLAWPQAEIAVMGAEGAANIVFRKEIEKAEDQMSE
FT                   RNKKIEEYREAFANPYVAAERGFVDRVILPEETRREIYLALQGTANKRELRPRRKHGVM
FT                   PH"
FT   gene            282344..282751
FT                   /locus_tag="Amico_0268"
FT   CDS_pept        282344..282751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0268"
FT                   /product="sodium pump decarboxylase gamma subunit"
FT                   /note="PFAM: sodium pump decarboxylase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56413"
FT                   /db_xref="GOA:D5ECY1"
FT                   /db_xref="InterPro:IPR005899"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECY1"
FT                   /inference="protein motif:PFAM:PF04277"
FT                   /protein_id="ADE56413.1"
FT                   /translation="MTNLHTYFETGFSGPLTLCFIAFSAVFMVLGGLTAIIYAIKYFGG
FT                   VKKASPPSQPPAPREKAPAAPAVTGAETGDKGKIVAAIAAALLEATGQPCRITEIRPAS
FT                   GPHRRPVLSLWRSSAIMEGLESLNNTNWSSR"
FT   gene            282829..283233
FT                   /locus_tag="Amico_0269"
FT   CDS_pept        282829..283233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0269"
FT                   /product="biotin/lipoyl attachment domain-containing
FT                   protein"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; KEGG: sfu:Sfum_0461 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56414"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECY2"
FT                   /inference="protein motif:PFAM:PF00364"
FT                   /protein_id="ADE56414.1"
FT                   /translation="MSKRYRVTVDGTSYDVTVEDLGGASAPVSVAAPAPSAAPAAPAPV
FT                   APAPAPAPVAAAPAPSAEGGTVIAAPMPGKILRVSVSVGTAVNAGDVLLILEAMKMENE
FT                   ISAPSAGTVKEVRAREGDSVNSGDALVVLG"
FT   gene            283256..284377
FT                   /locus_tag="Amico_0270"
FT   CDS_pept        283256..284377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0270"
FT                   /product="sodium ion-translocating decarboxylase, beta
FT                   subunit"
FT                   /EC_number="4.1.1.70"
FT                   /note="TIGRFAM: sodium ion-translocating decarboxylase,
FT                   beta subunit; KEGG: mca:MCA2479 oxaloacetate decarboxylase,
FT                   beta subunit; PFAM: Na+transporting methylmalonyl-
FT                   CoA/oxaloacetate decarboxylase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56415"
FT                   /db_xref="GOA:D5ECY3"
FT                   /db_xref="InterPro:IPR005661"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECY3"
FT                   /inference="protein motif:TFAM:TIGR01109"
FT                   /protein_id="ADE56415.1"
FT                   /translation="MEIYANSLGMILRSSGFAGLTWGNMVMLLVAFIMLYLAIVKGFEP
FT                   LLLVPIGFGCLLVNLPLSGIMDEGGFLRYVFFGTEHEIYPVIIFMGIGALTDFAPLLAN
FT                   PITFLLGAAAQLGVFIALFGALLLGFNVKEAASIAIIGGADGPTSIYLTVKLAPQILGA
FT                   VAVAAYSYMSLVPLIQPPVIRLLTTKADRGIRMDQLRPVSKLERVLFPIVCTVSAGLLL
FT                   PSSVPLIGTLMFGNLLRECGVTERLNQAAQNEILNATTIFLGLSVGATMSAEYFLTMGT
FT                   IKIIVLGLVAFVFSTAGGVVLGQAMKVISGGKINPMIGAAGVSAVPMAARVVQRMCQKE
FT                   HPGNFLLMHAMGPNVAGVIGTAVAAAVMLTLLS"
FT   gene            284449..284940
FT                   /locus_tag="Amico_0271"
FT   CDS_pept        284449..284940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0271"
FT                   /product="Putative ammonia monooxygenase-like protein"
FT                   /note="KEGG: sdy:SDY_0650 putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56416"
FT                   /db_xref="GOA:D5ECY4"
FT                   /db_xref="InterPro:IPR007820"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECY4"
FT                   /inference="protein motif:COG:COG3180"
FT                   /protein_id="ADE56416.1"
FT                   /translation="MANINLCVAVLIGGVVGYTLKIPSGALVGGMLGGLFAKSFMGLET
FT                   LRLPYLSFCSQLLVAFVIVAQADVASVRQIPRFIPVAIIYSLVILVFSVFMACFVSKLC
FT                   KMDLMTAVFSMAPGGLSGLGLAAVESGANASLALVFHVIRVSIVLIAIPFIALLLEKMS
FT                   "
FT   gene            284965..286068
FT                   /locus_tag="Amico_0272"
FT   CDS_pept        284965..286068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0272"
FT                   /product="sugar fermentation stimulation protein"
FT                   /note="KEGG: sat:SYN_02078 transcriptional regulator;
FT                   TIGRFAM: sugar fermentation stimulation protein; PFAM:
FT                   sugar fermentation stimulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56417"
FT                   /db_xref="GOA:D5ECY5"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECY5"
FT                   /inference="protein motif:TFAM:TIGR00230"
FT                   /protein_id="ADE56417.1"
FT                   /translation="MSEMFRIAGKQPLLEATFLARPNRFLVECLHGDQKVQAFLPNPGR
FT                   LWEVLLPDTLIYLHKDPHVNPSRKTEFTVIGAMTEHGPVMLHTHKTNDVAAWLFDGGLV
FT                   PGLENFRVVKREVSRGNSRFDLLVSDGTDQMLIEVKSCTLFGRKIAMFPDAPSLRAVKH
FT                   LQELCEINRKEMAAGILFIVQSGDPEFFIPDFHIDYEFATKLYHSQIETSDSKKLAVKA
FT                   LKVAWSSDFSFSGEVREIPTPWNVVAQEAGENTIDLYINTFAEEGFYHIFVSSSSEPSK
FT                   IRTLQRSYAKGGASSRTITIRTQQNIEGMVKKQLSMLCDRVETARDQTVFIFKDNPLKR
FT                   RSFVQFLIHTRIDRLEPMIPSNLFVRQ"
FT   gene            complement(286058..286864)
FT                   /locus_tag="Amico_0273"
FT   CDS_pept        complement(286058..286864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0273"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: bbr:BB4537 putative
FT                   universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56418"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECY6"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ADE56418.1"
FT                   /translation="MLRRILFPMDMSPFSKEALLWLSKRALQRQSDLLVVHVVSPAAGL
FT                   NTPHLVQETEVALNEFCQKNLPEELFYKVIVATGDPLEIIPEYASKEKCTFAVIPIQEA
FT                   EEIAPLVKQLAIPQLILRSRNGHFPEGDIYNNITVAVDLSPERTDMMLSELRDILQQVD
FT                   TVPSITLVHGIPLEDAEDSQTLLNAAEGALEIVAQEVSTWNPNTSIHIVSGQPEIELTQ
FT                   WIEETAPSLLVVGLSTHREMWQLILGTTAEALIEGTTCPVLVFPTA"
FT   gene            286976..287863
FT                   /locus_tag="Amico_0274"
FT   CDS_pept        286976..287863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0274"
FT                   /product="lipid A biosynthesis acyltransferase"
FT                   /note="PFAM: lipid A biosynthesis acyltransferase; KEGG:
FT                   mxa:MXAN_1057 lipid A biosynthesis acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56419"
FT                   /db_xref="GOA:D5ECY7"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECY7"
FT                   /inference="protein motif:PFAM:PF03279"
FT                   /protein_id="ADE56419.1"
FT                   /translation="MGLSKDTTWKIIKYAQKTFNALPHSLAVSFGGFLGVVLWAFSKRR
FT                   VDSAERRCVRALGVGVTTARKIVKGSYANMGRSVAEFTCLPKNIHTLDSLVTIHGEEHL
FT                   RRAYEKGRGVIFITGHIGNWEMAAASLVRKGYPVNAIGAEQRDERITDLIIDYRRDCGV
FT                   LTISKGFSLKAAMTCLKKGEILGVLIDQDARDKGIVAPFLGLPASTPYGPIKMSLKYGS
FT                   PMLPIVMIRRPDHIHHDLYILPPFEDESSEKFGENMWEAVASCNNFISSWISQYPDQWL
FT                   WLYPRWASTLGHSS"
FT   gene            287860..288324
FT                   /locus_tag="Amico_0275"
FT   CDS_pept        287860..288324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56420"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECY8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56420.1"
FT                   /translation="MILGIDPGKDKIGWAFADSKGALLFSGIVNKEELSSFWEVFMQKQ
FT                   WHNLLPWLKEREKEPLLSESELTIVVGNGTTCKEVLLFLKERGLDAQVVEEYGTTLEAR
FT                   KVYWRLHPPQGVWKFIPKSLRVPNRDVDDLAAFVIIRRYLASKTRGQVKE"
FT   gene            288327..289715
FT                   /locus_tag="Amico_0276"
FT   CDS_pept        288327..289715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0276"
FT                   /product="Cl-channel voltage-gated family protein"
FT                   /note="PFAM: Cl- channel voltage-gated family protein;
FT                   KEGG: gbm:Gbem_0292 chloride channel core protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56421"
FT                   /db_xref="GOA:D5ECY9"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECY9"
FT                   /inference="protein motif:PFAM:PF00654"
FT                   /protein_id="ADE56421.1"
FT                   /translation="MLREGEWSRLFKEEFALFYSVFKWLVLAVVIGVFVGTAVSTFMLA
FT                   LEKCSKGVGSLPPWRILLLPLGLLASVSMVRYLKVADSTQGTESVVEAVHHHQGRIDVY
FT                   TVIVKVIAAVITISTGGSLGQEGPSAQIGSAVSNVFATGFRLNDIDRRKLVVCGVSAGM
FT                   ASVFGAPVAGAVFGLEVLYVGQVFYDVLLPCIVSGMVSYQVSLNLGMAYIYQPLLYIPK
FT                   MTGPHVLLWVVLAGVFFGLVALLFIEVLHLARRGYRKLAFHPLFSAFCGGLFLVLLSSV
FT                   VGPRYVGLGSQTITDAITGQEIPKLAFFWKSLFTGLTKGAGGSGGVVTPTLFIGAASGA
FT                   TFASIFSLDPVLFSCIGFVAVLAGAANTPIAATILAAELFGSRVASLAAIASVIAFVVS
FT                   GYRSIYPDQIVKCPKSPLLDICDEYRRVGEYEFDPMLLKLPMVRLVVRNYRLWRKQRKI
FT                   ARKQ"
FT   gene            complement(289769..291055)
FT                   /locus_tag="Amico_0277"
FT   CDS_pept        complement(289769..291055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0277"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   dat:HRM2_45810 proton/sodium-glutamate symport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56422"
FT                   /db_xref="GOA:D5ECZ0"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECZ0"
FT                   /inference="protein motif:PFAM:PF00375"
FT                   /protein_id="ADE56422.1"
FT                   /translation="MENEKKGMFDWYFKSNLLIRILIGLVLGAIVGLVAGNSILWVRPL
FT                   GDIFVRLLKMIVTPIILTTLVVGSASISPAELGKVGVKIVIYYLFTSAVAVAIGLLMGN
FT                   VFRPGLGLDLGSIGEAAGKALEKPSLANTFLNIIPTNPFASLSGGDVLPIIFFAILFGL
FT                   GISYLKISKDSRIREAGELLFKFFDGAAEAMYKIVGWVLQYAPIGVFALISVVFAQQGA
FT                   KAIGPLWGVTLACFLGYILHLIVVYGGALSLYKLSFSTFLKGSKEAMITAFVTRSSGGT
FT                   LPITMRNADENLGIAKNVYSFTLPLGATINMDGTAIYQGVCALFIGFAVGLPLNFSQQI
FT                   TVILTAVLASIGTAGVPGAGAIMLLLVLDSIGLPIEQGSPVAAAYAMILGIDAILDMGR
FT                   TCLNVTGDMVGSAIVAKSENLLDLSKWGK"
FT   gene            291253..293343
FT                   /locus_tag="Amico_0278"
FT   CDS_pept        291253..293343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0278"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: lch:Lcho_0391 patatin"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56423"
FT                   /db_xref="GOA:D5ECZ1"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECZ1"
FT                   /inference="protein motif:PFAM:PF01734"
FT                   /protein_id="ADE56423.1"
FT                   /translation="MLNFRRLWAGLVLLVCFWGNGSAWAAASHGGIVLALSGGGTKGLA
FT                   HIGVLQVLEEYNIPVAGIVGTSMGAIIGGLASSGYKGIELEEAVNNIDLGSLLSERASP
FT                   MFLPLGEREGDAVPWISIIHGRGASGSLGGFSGVKLLEKFAQMASRVQIVHFNELPIPF
FT                   AAVATDLETGKKVVLTNGSLASAMRASMAIPGLFEPWAVGGRLLVDGGLVSNLPVKTAK
FT                   ELFPGYPIIAVNVTKTLKSREDLRTVVDVIDQSITVLTQQNVETEERDADLLLVPDVGK
FT                   MPLFDASRSEEVIEAGREVAMAHLKEIQQLSEGAPLPLYHKKESPEIVTDVCLEGLPDT
FT                   ECRDFREKYRSWIGKPVNTLNVMKASKEISKRIDVLAVDYRLEEKDAGTAIIFTAQRRP
FT                   LSEFRIGGYTTNLHPYRWLFINSIYRDIYNEGDSIKLNLKVGKQWAADLGYLSSPEVSR
FT                   AWELHLSGQKWEVTPGNSSEKSWERYSAGVVRHFTLGKMQGGAGLGFENVHSGGMDENA
FT                   LGPTFYVAYNTLDDLLDPTRGSSVKIALWWPDYDELLYRVNVFHAMSLSENWRLYLRGG
FT                   YAEGDVTEASHAVYLGAAEELYSYANYPIEAERMAWFNLALRRIFLRSWWGNLSAEFFG
FT                   GAGWAYDDRGERADSVWETGISLSAPGRFFDGRLMFLYNDRNDFKVGFFIGKPIWGHHP
FT                   LP"
FT   gene            293387..294826
FT                   /locus_tag="Amico_0279"
FT   CDS_pept        293387..294826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0279"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /note="TIGRFAM: prolyl-tRNA synthetase; KEGG: mxa:MXAN_6655
FT                   prolyl-tRNA synthetase; PFAM: Prolyl-tRNA synthetase, class
FT                   II-like; tRNA synthetase class II (G H P and S);
FT                   Anticodon-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56424"
FT                   /db_xref="GOA:D5ECZ2"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="InterPro:IPR033721"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECZ2"
FT                   /inference="protein motif:TFAM:TIGR00408"
FT                   /protein_id="ADE56424.1"
FT                   /translation="MARNITPKETDYSQWYLDIIKVAELADYAPVRGCMVIRPTGYSLW
FT                   ESIQKHFDDAFKETGHVNAYFPVLIPNSFLEKEAEHVEGFSPECAVVTHAGGELLEEPL
FT                   VVRPTSETVIGHMYSKWIQSWRDLPILINQWANVMRWEKRPRLFLRTSEFLWQEGHTAH
FT                   ATEEEAMEETLKMLEVYRRIMTEILAIPVIVGEKTAGERFPGAVNTYTCEAMMSDKKAL
FT                   QAGTSHFLGQNFSRAFDIQFQNQKGEQEYAWTTSWGVSTRLIGALIMTHSDNDGLILPP
FT                   RVAPVQVAILPISTNDSVMEEQLLPRALEFSDKLDQMLGGRFTFVDKQFHMRPGDRFFY
FT                   HLQKGVPLRLELGEKDLAAGTVRAVRRDTGSKEDIPFENVPLRVKALLEDIHKNLYTRA
FT                   LDFRIANTFSASTLEELKVIVEEKGGFVETYFAGTPEEEKKIREETGATPRCMPLNDTC
FT                   TGTCFLTGKPHARKTIFAKAY"
FT   gene            294924..295883
FT                   /locus_tag="Amico_0280"
FT   CDS_pept        294924..295883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0280"
FT                   /product="Ppx/GppA phosphatase"
FT                   /note="PFAM: Ppx/GppA phosphatase; KEGG: afw:Anae109_0702
FT                   Ppx/GppA phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56425"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECZ3"
FT                   /inference="protein motif:PFAM:PF02541"
FT                   /protein_id="ADE56425.1"
FT                   /translation="MDKKERLAVIDVGSNSVKLFVAEKAHQKISTLFERTEITRLSEGL
FT                   TKNGVLQNVPMERNIFMVETMIHQAKALEVEGVIIVGTMALRIAQNREVFIDRLAKKTG
FT                   FTLSVLSGEEEGELAFLGALSGLFGFSPLQEVTLFDIGGGSTEFVRGKGREVLDKCSIA
FT                   LGSVPLTERYLQISPVSDELLQRTRSIIKEQLEQVPPVFKLGPLLGIGGTITTLASVHL
FT                   ELEAYSGNRVHGMTLTKRDVNEQILQYASRTIADRCKIKGLSPGRADIILAGACIADEI
FT                   LGLANEESFVVSDRGLRHGVAIHYFEESSGRDEPLLLP"
FT   gene            295910..297577
FT                   /locus_tag="Amico_0281"
FT   CDS_pept        295910..297577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0281"
FT                   /product="Na+/Picotransporter"
FT                   /note="PFAM: Na+/Picotransporter; KEGG: bav:BAV2385
FT                   Na+/Pi-cotransporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56426"
FT                   /db_xref="GOA:D5ECZ4"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECZ4"
FT                   /inference="protein motif:PFAM:PF02690"
FT                   /protein_id="ADE56426.1"
FT                   /translation="MRSTLASYALMLAGIVILLHGLEESNKAFRKHLGSRGKELLTTMG
FT                   EKNSSAFTLGVLLSAVAQSGTAATAFAVGLVDIHALPYEGAILVMMGAGVGSTLVAPLL
FT                   ALDIIAFAPFFLALGFFLSHGRSDKIRKIGAIMKSLAFVLTGMLLLKVGFSPLIEKPEF
FT                   GTFIAHIVTRPALLAVVAFLLSSLTQGSSAIIAIGIALISSGVASAEAFYPLVLGARLG
FT                   TPIIVLFFSMGTRVNARRLAWLSLAYRCLGVVAGLALAPFLFKAVAISIPDPEMKLAAY
FT                   QVGLSVINVIVFLPLVRRAAVMSGNWFSKEVAKDPGEAIYLDESLTDFPPLAVPLLEKE
FT                   ITRMANYIETFIYMLFFAPGYREQIYKLQKGIPSLLEQCSDYMFAIPAPIDNAAEMEKY
FT                   SAISYSLISMADIVEVATGKLYTLWNEGIEQRLSSELRQEEWQDYLLVATDIVRFSLRA
FT                   FALDDAASVQKATELSKKFRSHDQLLRQIMVFRGRLFNCRQDVLLWSLLATLRVIVTAS
FT                   LEVARGGRFRKRGDEGDGLWEEEKGNYGTDTGNDTLLE"
FT   gene            297558..298259
FT                   /locus_tag="Amico_0282"
FT   CDS_pept        297558..298259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0282"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /note="KEGG: mxa:MXAN_4792 phosphate transport system
FT                   regulatory protein PhoU; TIGRFAM: phosphate transport
FT                   system regulatory protein PhoU; PFAM: PhoU family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56427"
FT                   /db_xref="GOA:D5ECZ5"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECZ5"
FT                   /inference="protein motif:TFAM:TIGR02135"
FT                   /protein_id="ADE56427.1"
FT                   /translation="MILYSSDKKRILSMVHNMGEEAVDAVYKAIEALVERDNALARHVV
FT                   ENDDVIDRLEVEIDQECLGSIAMRQPVRENLRFVFTVAKIITDLERIGDEAVNIAERAL
FT                   FLNQHPLLKPLIDIPKMRNISIEMLRNALNAFETNDPALAEEVYLKDQELDVLYYNIFE
FT                   ELIQIIAQKPKGDKVTAQCAAALMWIGRHLERVGDHASNVAEKSYFIITGKRLKQIMEA
FT                   KQRLAEMGRND"
FT   gene            298413..298808
FT                   /locus_tag="Amico_0283"
FT   CDS_pept        298413..298808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0283"
FT                   /product="Rhodanese domain protein"
FT                   /note="KEGG: geo:Geob_0482 rhodanese domain protein; PFAM:
FT                   Rhodanese domain protein; SMART: Rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56428"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECZ6"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ADE56428.1"
FT                   /translation="MKTISEVVARYFEDLKKGCNNLISCDQLGELMRKENVYILDIRKP
FT                   EDYEEEHLEGAVNIFWSEVGDHLKEIPKDKKVVVCCYSGQSAGQVVSLMRILGFNACSL
FT                   KGGMKCDLAHMPIEARCCDNQPEVCDS"
FT   gene            complement(298942..299481)
FT                   /locus_tag="Amico_0284"
FT   CDS_pept        complement(298942..299481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0284"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: pca:Pcar_0509
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56429"
FT                   /db_xref="GOA:D5ECZ7"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECZ7"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ADE56429.1"
FT                   /translation="MDFADLIRKRYSMRDYSSQPVPQSVIDTCLEAARLAPSACNSQPW
FT                   SFIVAHTPEKVASLAQAAFNGIYAMNSFAAKAPVLIVVITERSRYSSALGGLFRGVQFS
FT                   LMDIAIACEHFCLQATDLGLGTCMLGWINERGIKKELGLPESVKIDIMISMGYPKDIRF
FT                   LPPKTRKSIDDIRRFL"
FT   gene            299848..301367
FT                   /locus_tag="Amico_R0001"
FT   rRNA            299848..301367
FT                   /locus_tag="Amico_R0001"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            301496..304472
FT                   /locus_tag="Amico_R0002"
FT   rRNA            301496..304472
FT                   /locus_tag="Amico_R0002"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            304537..304651
FT                   /locus_tag="Amico_R0003"
FT   rRNA            304537..304651
FT                   /locus_tag="Amico_R0003"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            complement(304745..305506)
FT                   /locus_tag="Amico_0285"
FT   CDS_pept        complement(304745..305506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56430"
FT                   /db_xref="GOA:D5ECZ8"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECZ8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56430.1"
FT                   /translation="MATDLQLLSEKAHRRAALAEAGLGKSLPFHILSEKMCYLSYYDIF
FT                   YEKQFEKSYRLCIENNIHTFFIPPVLLPFVLDYFAGTKLRIGTIIDYPYSGLPPSIKGD
FT                   LIRWAEDNGVEEIIVTLRADVMHENKGREKVRQALLSYGKCLGSNIPLYFAFDGHFLSE
FT                   GQIITFVRYSEMAGVSGVICLNLRRRLNILRDVAVVRSATPNSMSVGVLGNIKTWQEVE
FT                   TLSAAGADITVTMCDLEDFRYPLGFRKSDQV"
FT   gene            complement(305528..305896)
FT                   /locus_tag="Amico_0286"
FT   CDS_pept        complement(305528..305896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0286"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afe:Lferr_0194 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56431"
FT                   /db_xref="UniProtKB/TrEMBL:D5ECZ9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56431.1"
FT                   /translation="MSEEVSQATLLKELKKLIESSSLATARLIEAVSLNSQLASSTTPE
FT                   MRELFTQWLNCVSGEVMNSIEEKGIICLEDISKNIGISETTTLSLLLYLQRQGAIIVKE
FT                   VTIKKGRGENQELCHCLR"
FT   gene            306052..307095
FT                   /locus_tag="Amico_0287"
FT   CDS_pept        306052..307095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0287"
FT                   /product="Homoserine dehydrogenase"
FT                   /EC_number="1.1.1.3"
FT                   /note="KEGG: acp:A2cp1_4072 homoserine dehydrogenase; PFAM:
FT                   homoserine dehydrogenase; homoserine dehydrogenase
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56432"
FT                   /db_xref="GOA:D5ED00"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR022697"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED00"
FT                   /inference="protein motif:PRIAM:1.1.1.3"
FT                   /protein_id="ADE56432.1"
FT                   /translation="MKISVLLLGFGNVGREFCSLLERKGDKIFSEYGCTIQIKGISTQR
FT                   RGNLYSEEGLHMPSVFRAEEETGRIDCLRSNGLYISPTLEDLLNNGDYHILVDTTFSSL
FT                   ETGEPARTYMEKALSRGKSVVTCNKSPVFLWYHSLSSLARERGAKFLFEGTVMCGTPLF
FT                   SLFRHGLPATEVLSFEGVLNGTCNYILELMRQGSTLDDALLDAQRRGYAEPDPSVDIDG
FT                   WDSAYKAMIVAQAIMGAPRLTKDMIEVRGIREVTPEMLNMTRIKGGVVRLLSKIERKQN
FT                   SFKIEVAPTALPANHPLVTLYGVTNGAVLCTDTMGEICIEGAGAGSRFAAFALLQDVLS
FT                   IANSMRR"
FT   gene            307102..307620
FT                   /locus_tag="Amico_0288"
FT   CDS_pept        307102..307620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0288"
FT                   /product="phosphodiesterase, MJ0936 family"
FT                   /note="KEGG: ppr:PBPRA2808 phosphodiesterase; TIGRFAM:
FT                   phosphodiesterase, MJ0936 family; PFAM:
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56433"
FT                   /db_xref="GOA:D5ED01"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041802"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED01"
FT                   /inference="protein motif:TFAM:TIGR00040"
FT                   /protein_id="ADE56433.1"
FT                   /translation="MSQRLGVIADTHGHADAWEKALKIWGDVEAILHAGDVLKSGIDTG
FT                   LADLINISSVPVLIAKGNSDFPKDQESLNWPILSPYVMIWWHGKLILLSHGSHFSQVRE
FT                   LALRSRADLVITGHTHVGSLVREGRTWFLNPGGASLPRGRDPASVALIEESIIQIITLD
FT                   GELLHYEIW"
FT   gene            307646..308473
FT                   /locus_tag="Amico_0289"
FT   CDS_pept        307646..308473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0289"
FT                   /product="PHP domain protein"
FT                   /note="KEGG: dal:Dalk_2742 ribonuclease III; PFAM: PHP
FT                   domain protein; SMART: phosphoesterase PHP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56434"
FT                   /db_xref="GOA:D5ED02"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED02"
FT                   /inference="protein motif:PFAM:PF02811"
FT                   /protein_id="ADE56434.1"
FT                   /translation="MIFIDLHLHSTCSDGTITPRALAFKAKSQGLSVASLTDHDTTEGV
FT                   KAFLKTCARREVRGVAGVELSADFHSVMHILGYRIDVDSPLFQKHMKHLREGRDERNYK
FT                   ICQKLQRLGLSISIEEVQAEAQGEVIARPHIARVLIRKGYVQSMGAAFERYLGREAPAY
FT                   VPRYRLSPQQCIETIHQAGGVAVLAHPVQTTDDYGELVDILSSLKELGLWGMECLAPSH
FT                   APQQVFQYLRIAKEMGLFPTAGSDFHGTNRPGVSMGIRVKFDFLPWARLGISL"
FT   gene            308537..309577
FT                   /locus_tag="Amico_0290"
FT   CDS_pept        308537..309577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0290"
FT                   /product="Threonine aldolase"
FT                   /EC_number="4.1.2.5"
FT                   /note="KEGG: sfu:Sfum_0699 threonine aldolase; PFAM:
FT                   aromatic amino acid beta-eliminating lyase/threonine
FT                   aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56435"
FT                   /db_xref="GOA:D5ED03"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR023603"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED03"
FT                   /inference="protein motif:PRIAM:4.1.2.5"
FT                   /protein_id="ADE56435.1"
FT                   /translation="MYFPIDLKSDTVTKPSEEMRRAMYEAEVGDDVYSEDPTVLRLEEK
FT                   AAEITGKEAALFAVSGTMGNLVSLLSHCNRGDGVIIGTYSHINNYEGGGLSALGGLFPM
FT                   LVDDSSGIPSPESIGEKCLPKNVHYAPARLLCLENTHNKCGGIAVSPERFAETVEKAKD
FT                   MGLPVHLDGARLFNAALAWGADISVYTSRVDSVQLCLSKGLGAPVGSVICASSDFIDRA
FT                   RHWRKRVGGGMRQAGVIAAAGLYALDHNIDRMIEDHENAKRIAYILQDGGLAVEEKGRQ
FT                   TNMVFFSIPENGPTASTLIDSCARRGVYFTAMGERRVRLVTHLDVSKEQAVKAAEIIVE
FT                   EVKKPE"
FT   gene            309574..310932
FT                   /locus_tag="Amico_0291"
FT   CDS_pept        309574..310932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0291"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   gur:Gura_1709 peptidase U62, modulator of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56436"
FT                   /db_xref="GOA:D5ED04"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED04"
FT                   /inference="protein motif:PFAM:PF01523"
FT                   /protein_id="ADE56436.1"
FT                   /translation="MIVPDRDEVESYAELAIKEALEKGACGADILFYFGSSHSLSLRDE
FT                   KPEQNNSGFSVGVGIRTLDRDGRQGVAHINTFNRSSLQQLVEWSWHNCANLEPDPWTVL
FT                   YNGKSSYAKNLELKDEKISAILPEQRQEWCAEMTHLAKKKDSRVLSVRSASWNDGEGAT
FT                   FYMASTGVKGWYDGSGVAAGLSLVMSDGVNMEMGGYGEDFRFLEDISLQRIVEKAVTQT
FT                   ACTLGGRPIQTKRYTLVLSPEVSASLLSVIGELFCASNVHKNRSLYKGKLGKKVASPLL
FT                   SLVDDGLMPRKLGTVPFDGEGVPSQRTVLMKEGIVEGYLYNLKHAQKDGVESTGNAARS
FT                   ISSLPDVDISNFYMEPGNISSEEIFVSVQSGIYITEFLGLHTVNPVSGDFSLGIKGVSL
FT                   SGGLFAQPVAGMTIAGNLLDLLNRIVFIGNDLSFFGDTGGCTMVIDNVTAAGL"
FT   gene            310910..312592
FT                   /locus_tag="Amico_0292"
FT   CDS_pept        310910..312592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0292"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /note="PFAM: cell wall hydrolase/autolysin; KEGG:
FT                   ppg:PputGB1_4949 N-acetylmuramoyl-L-alanine amidase; SMART:
FT                   cell wall hydrolase/autolysin"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56437"
FT                   /db_xref="GOA:D5ED05"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED05"
FT                   /inference="protein motif:PRIAM:3.5.1.28"
FT                   /protein_id="ADE56437.1"
FT                   /translation="MLQRPGYKKFIFSFLLILCLFLSVTPVMADSAWNLALDGRILGGV
FT                   PVRDNGRMTMVSIGVMGRLLQLKLEHKDDTLLIFYKNNKLQLVNKATAVWLDVQLVPMA
FT                   SAPVFEGGNWWLDSRSAIKILQALYQAAGSAASLSWAGDAVEASSLNKNVKNPEKKQDE
FT                   AEAAILPASIPVVPSSTPASLVSSGGMRPCELKALRWGRYDDKIRAVFDYQGETEPQSS
FT                   QTGQNVSIAFTEGSLSKTETLSPFPTDVLIETASSEGKYIITLSSIKGGELKVFTLPNP
FT                   ARLVVDIYNPKNEVLPAPVAVSNLKPAPKPVAEQASEPKEPVFVPAKVVPRKSAPLVVI
FT                   DAGHGGKDPGAVANGYREKDLNLQYARQLAECVKKRGFRVRLTRDTDVYLKLGERTDLA
FT                   NKWEADMFISIHANALPKGRHANGTEIYIMALPTDKDAMELALIENRELTGDNGSESSA
FT                   QVDKKTKMLLNILGNMQQNAKISDSTEVAEHLFKSGQKQKINMRRVAQAPFFVLRGATM
FT                   PAVLIETGFLTERSEAKKLATPSFQKQFAEAIAQGVETYFNGR"
FT   gene            312613..313365
FT                   /locus_tag="Amico_0293"
FT   CDS_pept        312613..313365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0293"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56438"
FT                   /db_xref="GOA:D5ED06"
FT                   /db_xref="InterPro:IPR019606"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED06"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56438.1"
FT                   /translation="MCGAFALYEMVRREDDFIDDFEDDLTIRKEIDEQVEESKTIHKPK
FT                   PRSRRGRRYADKQSSKKAPLALRAIAWVALLFLFFGVGYWGTSFTLKVLNKKNLVRQEE
FT                   IVQNQQELSELVASETNAGRKVTFPLYIPMNGDVVRKDIVVLSSLMEDDMERLILKLFE
FT                   ECGDSLRGVNILHIFRNGDTAYVDISGGFMSALNALGEETSTLLITGVVRTLKENFSPV
FT                   SKVRFLVEGKIPQSGAPVNLSVPWELRS"
FT   gene            313384..314166
FT                   /locus_tag="Amico_0294"
FT   CDS_pept        313384..314166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0294"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="TIGRFAM: ribonuclease PH; KEGG: ppd:Ppro_2311
FT                   ribonuclease PH; PFAM: 3' exoribonuclease; Exoribonuclease,
FT                   phosphorolytic domain 2"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56439"
FT                   /db_xref="GOA:D5ED07"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED07"
FT                   /inference="protein motif:TFAM:TIGR01966"
FT                   /protein_id="ADE56439.1"
FT                   /translation="MEDTLLRSDGRKFNEIRPISFQRHFTCYAEGAVLACFGDTKVICT
FT                   ASVEDRVPPFLRGSGQGWISAEYAMLPRATAERTSRMTSKGAISGRSHEIQRLIGRSLR
FT                   ASADLSLLGERTIWLDCDVIQADGGTRTAAISGAFVALFDAMRCLKAQDVIEKIPVKSF
FT                   VAAVSVGKIEGSLLLDLCYEEDSCADVDCNVVMNGDKQLIEIQGTGERGTFARDEFDAM
FT                   LDLAEDGIQTIMFSQAEVLQISEEERHACVGKICSFCK"
FT   gene            314129..314719
FT                   /locus_tag="Amico_0295"
FT   CDS_pept        314129..314719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0295"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family"
FT                   /note="KEGG: fph:Fphi_1207 HAM1 protein; TIGRFAM:
FT                   non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family;
FT                   PFAM: Ham1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56440"
FT                   /db_xref="GOA:D5ED08"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED08"
FT                   /inference="protein motif:TFAM:TIGR00042"
FT                   /protein_id="ADE56440.1"
FT                   /translation="MLASGKSVVFASSNRNKYEEVAELLAPLQIHLIFGPECQAIDVEE
FT                   TAQTYMGNAYIKAVTWAKKTGIPALADDSGLEVRALGWKPGIFSARVAPSTDGRNEWLL
FT                   KSLEGIEDRVAKYVASFALCLPENGLVLITEGECWGRIAHERSGRGGFGYDPLFIPHGY
FT                   ERPFADLPDKIKARISHRAIASYQLIHIIHQQI"
FT   gene            314783..315007
FT                   /locus_tag="Amico_0296"
FT   CDS_pept        314783..315007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0296"
FT                   /product="preprotein translocase, SecG subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecG subunit; PFAM:
FT                   Preprotein translocase SecG subunit; KEGG: aci:ACIAD0364
FT                   preprotein translocase subunit SecG"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56441"
FT                   /db_xref="GOA:D5ED09"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED09"
FT                   /inference="protein motif:TFAM:TIGR00810"
FT                   /protein_id="ADE56441.1"
FT                   /translation="MFIGVVHMVLSIALIGIVLLQQRKEGGFSGIFGGGTQADMGGSQW
FT                   QRLSGLTKITVVLTSLFMLTSLVLVMMSK"
FT   gene            315020..316063
FT                   /locus_tag="Amico_0297"
FT   CDS_pept        315020..316063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0297"
FT                   /product="Quinolinate phosphoribosyl transferase"
FT                   /note="PFAM: Quinolinate phosphoribosyl transferase; KEGG:
FT                   dma:DMR_20580 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56442"
FT                   /db_xref="GOA:D5ED10"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR035809"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED10"
FT                   /inference="protein motif:PFAM:PF01729"
FT                   /protein_id="ADE56442.1"
FT                   /translation="MVKNGNLDSLEDISSITVDMDRLYSATHEEIMSGLTTDVYFLKTR
FT                   DVLRRAGKINTPVVAEFFARGNGVYAGLTEAMQILRHKNVSVYSLNEGDTFTPKEVVMR
FT                   ISGPYSEFGLYETVLLGFLASSSGWATAARQCVEAADGKPVLCFGARHVHPAIAPVMER
FT                   VAMEAGGCSGASCMLGAKLAGHNPMGTVPHAAVLIVGDTVELARFYDEEIPEGEPRIVL
FT                   IDTFKDEAEESLRVAQALGNRLYGVRLDTPGERGGVTAELVREVRYRLDIAGFSHVKII
FT                   ASGGLNPERIRVLSEAGVDSFGVGSYIAHGTPRDMTMDLKVVDGIPIAKRGRLPGIIEN
FT                   PRLKRVK"
FT   gene            316223..316654
FT                   /locus_tag="Amico_0298"
FT   CDS_pept        316223..316654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0298"
FT                   /product="ribosomal protein L13"
FT                   /note="KEGG: esa:ESA_03617 50S ribosomal protein L13;
FT                   TIGRFAM: ribosomal protein L13; PFAM: ribosomal protein
FT                   L13"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56443"
FT                   /db_xref="GOA:D5ED11"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED11"
FT                   /inference="protein motif:TFAM:TIGR01066"
FT                   /protein_id="ADE56443.1"
FT                   /translation="MASNRTYMATREKVVREWYVVDATDKPMGRLAVKVARILMGKHKA
FT                   TYTPHVDCGDFVIVINAEKVKLTGNKLMNTRRYHHTGHPGGIKSQTYGEMIAKKPERLM
FT                   ELVVKGMLPKSRLNFQRKLKVYAGDHHPHSAQQPVALDI"
FT   gene            316676..317071
FT                   /locus_tag="Amico_0299"
FT   CDS_pept        316676..317071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0299"
FT                   /product="ribosomal protein S9"
FT                   /note="PFAM: ribosomal protein S9; KEGG: ank:AnaeK_3453
FT                   ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56444"
FT                   /db_xref="GOA:D5ED12"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED12"
FT                   /inference="protein motif:PFAM:PF00380"
FT                   /protein_id="ADE56444.1"
FT                   /translation="MPTPSYFWGTGRRKNAIARVRVCPGDGSIEINERTVEDYFPREVW
FT                   QSQALAPLKVAGIEGRVNVFVRANGGGLTGQAGAVRLGIARALLKLNPELRPALKKAGL
FT                   LTRDPRMVERKKFGQKGARGLRQFSKR"
FT   gene            317340..318692
FT                   /locus_tag="Amico_0300"
FT   CDS_pept        317340..318692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0300"
FT                   /product="magnesium transporter"
FT                   /note="TIGRFAM: magnesium transporter; PFAM: MgtE integral
FT                   membrane region; MgtE intracellular region; CBS domain
FT                   containing protein; KEGG: aeh:Mlg_0824 magnesium
FT                   transporter; SMART: CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56445"
FT                   /db_xref="GOA:D5ED13"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED13"
FT                   /inference="protein motif:TFAM:TIGR00400"
FT                   /protein_id="ADE56445.1"
FT                   /translation="MNDLHHKFLESIDKLFQAKKFKSLKELLSTMEPADIAEIMGEKPP
FT                   VERVFLFRLLAKDLAIEVFEFMDSTEIEEMLAHFSDSEVSEIMEEMSDDDRTALFDELP
FT                   AKTVKKLLLRLSPDERKVANMLLNYSPSSAGRIMTPEYIDLKEEMTTEEAVGRIRRNAR
FT                   SKETIYTCFVVDTQRYLKGVVDLETLIMAEPHTLVGAVMDDPVYATTTTDQEEVAQVMS
FT                   KYDLQAIPIVDTEKRLVGIITFDDVLDIIEEEATEDFERMAGIQPVEESYLDASVFTLA
FT                   RKRFMWLFICILTEAVTSVVLKRYSFALQSVVALTFFIPLLIGTGGNAGTQASTLVIRG
FT                   LTLGDIEWEDIGKVIFREILTGILLGGALAIFGLGRAYMLHTGYGVALTVAFAIIAVVL
FT                   LGNMAGTLLPFIAQMLHIDPAIMSGPFITTIVDVFGLIVYFEIARNILSLS"
FT   gene            318811..319419
FT                   /locus_tag="Amico_0301"
FT   CDS_pept        318811..319419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0301"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: kpu:KP1_1321
FT                   acrAB operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56446"
FT                   /db_xref="GOA:D5ED14"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED14"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADE56446.1"
FT                   /translation="MKDSGQDTKALIISIAREHFAEKGFYGTSIDALVKEAGLSKGALY
FT                   WHFPGKLDLYRAVIKEEVERIRHIMVPEQPEKPEEREGLFIARGEQLIDAVMKDRLWRM
FT                   FSVHMALESIRGNKEIQDLNRLISLSFVEEFESILMRMYPSLKYGAGGLSLKELIQIFE
FT                   NFIAGLVSNVGTTLSVDEAKRSWKFLVTRVLKGGAPYAP"
FT   gene            319409..320740
FT                   /locus_tag="Amico_0302"
FT   CDS_pept        319409..320740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0302"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   sat:SYN_02462 type I secretion outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56447"
FT                   /db_xref="GOA:D5ED15"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR028351"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED15"
FT                   /inference="protein motif:PFAM:PF02321"
FT                   /protein_id="ADE56447.1"
FT                   /translation="MRHRKYFYVIAIIALFACLFSKKQILLAQERESLTEALVLELAEE
FT                   NNPILAAEAERVNQAQARYLGSKSAQKPQLAASLTYQQLGEEPRYPVIPTGGEAIAGFE
FT                   KTYRAALSLDYLLYSSGAVENSVRSQKLALEGAKAQETRVSQTVESNVLASYYNLQRAR
FT                   AKLAVAEDVLDLTKEHLKQVESFYHHGVVAKNEVLRIRVDVSEAELNRIKAANGVDVAW
FT                   SALERAVGVSLHSQYALPDPDQSRPDVPIIEDPFTLALEIRPELQALDHAVQASLSLSK
FT                   AAAAQSKPQVILQAESYVADNTFFPSEKDDWKISLTALWRFYDGGASQAKGQEAKATAN
FT                   EFLFRTEDLKKQINLEVSVAKLNLESASQRISVAADQVQSAEEDYRMALKRYSSQVGTN
FT                   IDVLDARVALTNARTQLVDAIYDTHISKTELLYAVGLPLSTAEE"
FT   gene            320759..321850
FT                   /locus_tag="Amico_0303"
FT   CDS_pept        320759..321850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0303"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="KEGG: mms:mma_0021 membrane fusion protein; TIGRFAM:
FT                   efflux transporter, RND family, MFP subunit; PFAM:
FT                   secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56448"
FT                   /db_xref="GOA:D5ED16"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED16"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ADE56448.1"
FT                   /translation="MKKSLMLFSVVIIFIALIGFRAYQQHQIESTVGEIERIKVEVVSP
FT                   AQRTFVDTVRFVATLEPEEEAAVISKVPGKTVLQVLVHEGDKVQQGDVLAILDTSLIKQ
FT                   QINQAQASLAKAEVYKQTASNDYRRFSQLYKEEVISRQQYDHVEGEYKTSVKQVAEVRA
FT                   VLEQLKITMGYHRIEAPISGTIIARNVDAGDTTSSYPAFVIAKQEQVKAVGVVPEKLYS
FT                   KVKRGQETQISLDAFPGRSFKAKVSRISPVLDPLTRTGKVEVAVDALSLMKPGMYARVE
FT                   IQVGTHEGLGIPLEAVVKMPGTGMPICYISTKEGTAKTKHITLGGEGPDAVEVIEGISP
FT                   SDNIIVTRSEKLSEGAPIEVVQR"
FT   gene            321847..324951
FT                   /locus_tag="Amico_0304"
FT   CDS_pept        321847..324951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0304"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   dde:Dde_0965 AcrB/AcrD/AcrF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56449"
FT                   /db_xref="GOA:D5ED17"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED17"
FT                   /inference="protein motif:PFAM:PF00873"
FT                   /protein_id="ADE56449.1"
FT                   /translation="MNLPEFSVKRRVTTLMIFLVVMLLGGIVFTSLKVDLLPEIEPPVI
FT                   NILTSWPGASASDVEQRVSKIVENHIAMIEGVDTILSKSQDNISVVSVKFDWGEDLDVK
FT                   IGDVRDAVNFAKRDLPSDAEEPILLRITSGTVPVLVMSLTADESLPGLYHYANKTISET
FT                   ISRISGVGQVLIYGGDRREIQVQLNIDKIEAYGLAPQAVVQVLERENINIPSGSLKDGQ
FT                   IEYYLRVPGRFQSVEDMHKVIVGVSKNRPIYLSDVATISDSFKDPDIQGYHAGKQSVIL
FT                   IVLKNSDANTVEVSQAVLKKMEDMKNREFPGDVEYHVGLDAADFIQDSVRNLSFSLFMG
FT                   ILLVFLVTWAFLKRLPASLIICGAIPFSLVITFIIMGWLDYTINIFTLSALAVASGMVV
FT                   DNSIVATDQIVYHLELGERRNVASILGAQEVQSALFASTLTTAVVLLPLAFISGLVGVF
FT                   FSALTIVMVVAVMASLFVSLTFVPMMGSRFFKREEDRLKMHQYTERLLVWLEQSYKNIL
FT                   SWSLFNRKKVIAAAILLLVLTLTGFRFIGTELTPEPDTGDISITFTLSEGIRIEKTEEL
FT                   LKEIMAYAEKTVPEATNIFAYDGRDEKGYAVAVGQEAGPNVGTVGLKLVEKKKRERSAF
FT                   EVANELRNWLQTKPGIEKMTVVVTSPIKAMLLGSKPLNIEVYGDNLDHVIETANTIKNS
FT                   LMKIPGAVDVTLSQKQNRPEVWVQVDREKAALTGVSTASVAQTLRTYYYGYETGESYWE
FT                   GDDDYPIRVRLNTDERNSREVLNRLMVPNVNGELIRLSTVAQLNDTVGPPEIQRKNKQR
FT                   YVVVEANVHGRSLGQLTQDARATIEKMDIPQDIRIDFGGEVEEKDKAFRQMGYLVLLGV
FT                   LLVYMVMAGQYEAYLDPFVIMFSIPFALTGVAFAYLLTGMYLSLQALLGVIMLVGIVVN
FT                   NAIVLVDYINLLRARGLKLRESLLEAGERRLRPVLMTTLTTFFGMLPMAISQDQGAELW
FT                   RPLAISVMGGLLVSTIVTLVIVPVIYSLFEEKLRRKKRFAEAEEV"
FT   gene            324957..325256
FT                   /locus_tag="Amico_0305"
FT   CDS_pept        324957..325256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56450"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED18"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56450.1"
FT                   /translation="MKMFWIFCNESVAEDLMDVLNKNGITGYFVWKNVLFRDNESGKTH
FT                   WDDAIYPGKDWAFMVFCDDEDVLVLKEKLEHLEEEPYIKQAGIKAFIAEAKKVM"
FT   gene            325323..325398
FT                   /locus_tag="Amico_R0004"
FT                   /note="tRNA-Thr1"
FT   tRNA            325323..325398
FT                   /locus_tag="Amico_R0004"
FT                   /product="tRNA-Thr"
FT   gene            325414..325499
FT                   /locus_tag="Amico_R0005"
FT                   /note="tRNA-Tyr1"
FT   tRNA            325414..325499
FT                   /locus_tag="Amico_R0005"
FT                   /product="tRNA-Tyr"
FT   gene            325516..325591
FT                   /locus_tag="Amico_R0006"
FT                   /note="tRNA-Thr2"
FT   tRNA            325516..325591
FT                   /locus_tag="Amico_R0006"
FT                   /product="tRNA-Thr"
FT   gene            complement(326239..326442)
FT                   /pseudo
FT                   /locus_tag="Amico_0306"
FT   gene            326585..326974
FT                   /locus_tag="Amico_0307"
FT   CDS_pept        326585..326974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0307"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sat:SYN_01915 putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56451"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED19"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56451.1"
FT                   /translation="MGFVANTLEKVCRLTRVLHFIEKDPFLYKSLGFKGGTAINLVIFE
FT                   CPRLSVDIDLDFCLETSRGEMLEARRDQLKASGYRWNVEEKIWQRSMIADNFNFKEFYS
FT                   QPWVQTGICIKVYSEDGDQMYVHRG"
FT   gene            complement(327008..328441)
FT                   /locus_tag="Amico_0308"
FT   CDS_pept        complement(327008..328441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0308"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR; KEGG: dvm:DvMF_1023 transcriptional
FT                   regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56452"
FT                   /db_xref="GOA:D5ED20"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED20"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ADE56452.1"
FT                   /translation="MKTPYDKDKYFLFLIIVGLGLTTAWSWGTFQEGHLFIQFPQLLSI
FT                   SPEHAFFFFPLFNAIFFTLMAKYTFFFNGNKFFKQLLLFSVFSLFLLLPRTPSHLSIWM
FT                   DFASISIASAALALFDGGWMWLGTNLSPQKAVLVFSAANMLASLIMAVHPWFPPSFLLL
FT                   ITGAFPLVSALFWGKSFNFSFSSSEPPHLRPQTSFKGKWLAPLHFGLAIRIFLFFLACS
FT                   IFHHHILSSSGTETISHFFFSELMYGAGALTAALLVYKIPKIKLRHIYILAQILIGTGF
FT                   LLISPFYGFSGWISILPITLLQFGFGCFGAYAWATLVGLASRAPKEHALSVASKGLALI
FT                   AGSVFIGQNLIFLLNRVSGTWNIPNNQLLWVAGVISLLLAGLFFHDNPETFANENLDKQ
FT                   EKHGLAPLSQTERHHLLLLPYDLTKQETKIALLLAENLNNSEICDSLNISENTLKTHLR
FT                   NIYRKTKASGREDVQRIFS"
FT   gene            328586..329020
FT                   /locus_tag="Amico_0309"
FT   CDS_pept        328586..329020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0309"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56453"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED21"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56453.1"
FT                   /translation="MRRKFCVFGLLLLVLFFAGSACGAEEKFVWIYKDDGFDMYLHKGT
FT                   LNKNKDEISCWVKSVYSEKGKAWVLKNMPSKYRKKPIEYGMDFFVLNTKTGKYQIKVSI
FT                   VHSPNGDGIYREGSKAWLPVKQGTLAALIANKLPEELKNK"
FT   gene            329037..330302
FT                   /locus_tag="Amico_0310"
FT   CDS_pept        329037..330302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0310"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bra:BRADO3379 PE-PGRS family protein
FT                   (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56454"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED22"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56454.1"
FT                   /translation="MKNTKIIKRLSAVLTVIVCLQGIVGVADAALRSRYEQKIGDIPGA
FT                   SVPVTIAPAAPVPPPAAPAQALAPAPQSPQKNGELVASCGIPAIYVKAMAKEHENFREA
FT                   FIRAELSLRYYIRKGKERQEPSSQQLKNLRFQITQNLKALESSANRYSRNIRYAKLAML
FT                   QMDEEERSIFAEALASLYGTPAWASSQGVPMSANLAPMDVMNRLENTMTNVGVASGTAQ
FT                   LAIDQRSLVETTGAWEAFKSSYGAQVLASGAKLGATVAGTIGGAALGVIAIGSLPVTAT
FT                   GAAIVGVAGLGVGILGGTISIIGATDDFVKAVKDDTSSGIDAGEREKLENLGNAVSAVN
FT                   ITVGLPGLAQSSSTAEFVQGGLSSVSDAMGFWGEEENRNDEKANEINRELDSVMKEGGS
FT                   GGGNDSGGGSGGGCGGGCSGSF"
FT   gene            330583..331785
FT                   /locus_tag="Amico_0311"
FT   CDS_pept        330583..331785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0311"
FT                   /product="translation elongation factor Tu"
FT                   /note="KEGG: ade:Adeh_1947 elongation factor Tu; TIGRFAM:
FT                   translation elongation factor Tu; small GTP-binding
FT                   protein; PFAM: protein synthesis factor GTP-binding;
FT                   elongation factor Tu domain protein; elongation factor Tu
FT                   domain 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56455"
FT                   /db_xref="GOA:D5ED23"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED23"
FT                   /inference="protein motif:TFAM:TIGR00485"
FT                   /protein_id="ADE56455.1"
FT                   /translation="MAKEKFERAKPHLNVGTIGHIDHGKTTLTAAITKCLSTKGWSNFE
FT                   AYDMIDKAPEERERGITINISHVEYQTENRHYAHIDCPGHADYIKNMITGAAQMDGAIL
FT                   VVSAADGPMPQTREHVLLARQVNVPAVVVFMNKTDQVDDDELLDLVEMEIRELLSKYDF
FT                   PGDDVPIIRGSALKVLEEGTGEENDPVSKCIWELMAACDSYIPAPQRETDKPFLMPIED
FT                   VFTITGRGTVVTGRVERGMIKSGEEVEIVGMKADTTKTVATSLEMFRKILDEAIAGDNV
FT                   GILLRGIDKEDVERGQVLAKPGSITPHTKFKAEVYVLKKEEGGRHTPFFAGYKPQFYFR
FT                   TTDVTGGIKLPEGVEMVMPGDNATFEVDLIVPIAMEAGLRFAVREGGHTVGAGVVTEIL
FT                   G"
FT   gene            331806..331955
FT                   /locus_tag="Amico_0312"
FT   CDS_pept        331806..331955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0312"
FT                   /product="ribosomal protein L33"
FT                   /note="KEGG: gem:GM21_3342 ribosomal protein L33; TIGRFAM:
FT                   ribosomal protein L33; PFAM: ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56456"
FT                   /db_xref="GOA:D5ED24"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED24"
FT                   /inference="protein motif:TFAM:TIGR01023"
FT                   /protein_id="ADE56456.1"
FT                   /translation="MADIVGLQCTECKRRNYSTTVNKKKQAKKLELSKYCKWCDKHTLH
FT                   KETK"
FT   gene            331977..332052
FT                   /locus_tag="Amico_R0007"
FT                   /note="tRNA-Trp1"
FT   tRNA            331977..332052
FT                   /locus_tag="Amico_R0007"
FT                   /product="tRNA-Trp"
FT   gene            332085..332267
FT                   /locus_tag="Amico_0313"
FT   CDS_pept        332085..332267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0313"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecE subunit; PFAM:
FT                   protein secE/sec61-gamma protein; KEGG: dvl:Dvul_0445
FT                   preprotein translocase subunit SecE"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56457"
FT                   /db_xref="GOA:D5ED25"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED25"
FT                   /inference="protein motif:TFAM:TIGR00964"
FT                   /protein_id="ADE56457.1"
FT                   /translation="MDKILSFVREAKAELKKVTWPGKKQVWYSTLVVIAFTLFVAAYLG
FT                   IVDLALTGIFTKIIS"
FT   gene            332348..332893
FT                   /locus_tag="Amico_0314"
FT   CDS_pept        332348..332893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0314"
FT                   /product="NusG antitermination factor"
FT                   /note="TIGRFAM: transcription termination/antitermination
FT                   factor NusG; PFAM: NGN domain protein; KOW domain protein;
FT                   KEGG: pca:Pcar_0689 transcription
FT                   termination/antitermination factor NusG; SMART: NGN domain
FT                   protein; KOW domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56458"
FT                   /db_xref="GOA:D5ED26"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED26"
FT                   /inference="protein motif:TFAM:TIGR00922"
FT                   /protein_id="ADE56458.1"
FT                   /translation="MMESSSERRWYIVQTYAGYENRVKANLEQRIATMGMEEEIFSVLV
FT                   PVEERVFVKDGKSKKVTRKLYPSYVLVEMKLNDQSWYVVRHTPGVTGFVGAGNHPIPLS
FT                   EKEIKEIMSKIGKDHAKPKIEMNLKPGDIVKVKSGPFEGQVGPVVEIVPEKGKVKFTIT
FT                   VFGRETVVETDYTELDKL"
FT   gene            332980..333405
FT                   /locus_tag="Amico_0315"
FT   CDS_pept        332980..333405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0315"
FT                   /product="ribosomal protein L11"
FT                   /note="TIGRFAM: ribosomal protein L11; PFAM: ribosomal
FT                   protein L11; KEGG: dma:DMR_31200 50S ribosomal protein L11;
FT                   SMART: ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56459"
FT                   /db_xref="GOA:D5ED27"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED27"
FT                   /inference="protein motif:TFAM:TIGR01632"
FT                   /protein_id="ADE56459.1"
FT                   /translation="MAKKVIAQIKLQLPAGKATPAPPVGPALGQHGVNIMEFCKQFNAK
FT                   TSDQAGMIIPAVLTVYADRSFTFILKTPPASVLLKKAAGLDRASGEPNKVKVGKVSREK
FT                   VREIAELKKEDLNANDVEAAMRMIEGTARSMGIDIVD"
FT   gene            333480..334190
FT                   /locus_tag="Amico_0316"
FT   CDS_pept        333480..334190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0316"
FT                   /product="ribosomal protein L1"
FT                   /note="KEGG: gme:Gmet_0616 50S ribosomal protein L1;
FT                   TIGRFAM: ribosomal protein L1; PFAM: ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56460"
FT                   /db_xref="GOA:D5ED28"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED28"
FT                   /inference="protein motif:TFAM:TIGR01169"
FT                   /protein_id="ADE56460.1"
FT                   /translation="MAKKSKRYSEIAAKVDSTKLYGLREAVDLYKEVATAKFDESLEVH
FT                   IRLGVDPRHADQQVRGTIVLPHGTGITKRVLVLAVGEKVKEAEDAGADIVGGDDLIQKI
FT                   STGWLDFDAVIATPDMMKSVGRLGKILGPRGLMPSAKAGTVTFDVADAIKEIKAGRVEF
FT                   RVDKTAIIHNMVGKKSFEAEKLFENLKVLYRAILKARPASAKGTYVRSFYIAPTMGVGI
FT                   KIDPVAASKEVAEA"
FT   gene            334381..334911
FT                   /locus_tag="Amico_0317"
FT   CDS_pept        334381..334911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0317"
FT                   /product="ribosomal protein L10"
FT                   /note="PFAM: ribosomal protein L10; KEGG: glo:Glov_1337 50S
FT                   ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56461"
FT                   /db_xref="GOA:D5ED29"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED29"
FT                   /inference="protein motif:PFAM:PF00466"
FT                   /protein_id="ADE56461.1"
FT                   /translation="MPANVKYERVNELKEMLDKSEAVFVAEYRGLTVAKITELRAKVRQ
FT                   AGGEMKVAKNTLFKIALQEKDMPVPEDIMAGPNVYTVVYDDPVAVAKVFAEFSRDKSNK
FT                   AFVMKGGIMGTSILDAAQVGALADLPSREVLIAQVVSTIAAPLSGLVTVLSGSIRGLAT
FT                   CLSQIKEKKEQAA"
FT   gene            334985..335365
FT                   /locus_tag="Amico_0318"
FT   CDS_pept        334985..335365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0318"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="KEGG: bte:BTH_I3077 50S ribosomal protein L7/L12;
FT                   TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal protein
FT                   L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56462"
FT                   /db_xref="GOA:D5ED30"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED30"
FT                   /inference="protein motif:TFAM:TIGR00855"
FT                   /protein_id="ADE56462.1"
FT                   /translation="MTHEEIIQAIEGMTVLELSELVKALEDKFGVSASAPAMAMPMMMP
FT                   GAGAAVAAEEEKTEFDVVLKGPGSNKIATIKVVRELTGLGLKEAKELVDNAPKPVKEAV
FT                   SKEEADEIKAKLEEAGAEVEVK"
FT   gene            335441..336130
FT                   /locus_tag="Amico_0319"
FT   CDS_pept        335441..336130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0319"
FT                   /product="Deoxyribonuclease V"
FT                   /EC_number="3.1.21.7"
FT                   /note="KEGG: pca:Pcar_0602 endonuclease V (deoxyinosine
FT                   3'endoduclease); PFAM: Endonuclease V"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56463"
FT                   /db_xref="GOA:D5ED31"
FT                   /db_xref="InterPro:IPR007581"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED31"
FT                   /inference="protein motif:PRIAM:3.1.21.7"
FT                   /protein_id="ADE56463.1"
FT                   /translation="MEFKIPQSYKAAIAEQRKLAQNVCIEDEEILLKIVAGVDVAYSRR
FT                   GKEAWAIVGIVTMEWETFQPIEFVHAICPVSFPYLTGLLSYRELPVLIEALNKLQSAPD
FT                   LWMFDGAGIAHPRKIGLASHFGVLTNSVTIGVAKSRLVGEYEEPAIEKGSVSPLYFNSE
FT                   QVGVVLRSRRAVKPLFISPGHRISIEKAALLVLKACVRYRLPEPTRAAHCYVTEVRRKF
FT                   VERGVEA"
FT   gene            336127..336969
FT                   /locus_tag="Amico_0320"
FT   CDS_pept        336127..336969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0320"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: dat:HRM2_10900
FT                   putative metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56464"
FT                   /db_xref="GOA:D5ED32"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED32"
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /protein_id="ADE56464.1"
FT                   /translation="MIIDTHVHVYPPDVIRDFEKISEREGYFKLLCHGKIHKWATYEDV
FT                   IEQMDKDGIEKSWIFGFAFKDLGLCRHCNNYVIEAVKKHPNRFQGLAVVPPLSLGADEE
FT                   IARCAEEGLIGVGELFPGGQGFDIDDVRQTWRLVGTTQEAGMVLLFHTAEPVGHDYPGK
FT                   GNVGPREGAQFCMNHPEAKVVFAHFGGGLWLYELMPEMKRYLRNARYDTAALPWLYTPH
FT                   ILQAMKSADVLEKLFYGSDFPILSFGRYERAIKGVLEMGKDISDLLGHNVEKFLVPRG"
FT   gene            337023..337097
FT                   /locus_tag="Amico_R0008"
FT                   /note="tRNA-Val1"
FT   tRNA            337023..337097
FT                   /locus_tag="Amico_R0008"
FT                   /product="tRNA-Val"
FT   gene            337139..337215
FT                   /locus_tag="Amico_R0009"
FT                   /note="tRNA-Asp1"
FT   tRNA            337139..337215
FT                   /locus_tag="Amico_R0009"
FT                   /product="tRNA-Asp"
FT   gene            337231..337306
FT                   /locus_tag="Amico_R0010"
FT                   /note="tRNA-Phe1"
FT   tRNA            337231..337306
FT                   /locus_tag="Amico_R0010"
FT                   /product="tRNA-Phe"
FT   gene            337322..337396
FT                   /locus_tag="Amico_R0011"
FT                   /note="tRNA-Gly1"
FT   tRNA            337322..337396
FT                   /locus_tag="Amico_R0011"
FT                   /product="tRNA-Gly"
FT   gene            337413..337486
FT                   /locus_tag="Amico_R0012"
FT                   /note="tRNA-Cys1"
FT   tRNA            337413..337486
FT                   /locus_tag="Amico_R0012"
FT                   /product="tRNA-Cys"
FT   gene            337509..337584
FT                   /locus_tag="Amico_R0013"
FT                   /note="tRNA-Asn1"
FT   tRNA            337509..337584
FT                   /locus_tag="Amico_R0013"
FT                   /product="tRNA-Asn"
FT   gene            complement(337908..338102)
FT                   /locus_tag="Amico_0321"
FT   CDS_pept        complement(337908..338102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0321"
FT                   /product="Protein of unknown function DUF2196"
FT                   /note="PFAM: Protein of unknown function DUF2196; KEGG:
FT                   ppr:PBPRB1930 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56465"
FT                   /db_xref="InterPro:IPR019240"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED33"
FT                   /inference="protein motif:PFAM:PF09962"
FT                   /protein_id="ADE56465.1"
FT                   /translation="MSGTIRKDIKVGLRVNIVQKQHQKTGQLTEGIVKDLLTKSPTHPH
FT                   GIKVRLESGIIGRVQEILE"
FT   gene            338269..338869
FT                   /pseudo
FT                   /locus_tag="Amico_0322"
FT   gene            338866..341454
FT                   /locus_tag="Amico_0323"
FT   CDS_pept        338866..341454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0323"
FT                   /product="protein of unknown function DUF470"
FT                   /note="PFAM: protein of unknown function DUF470; protein of
FT                   unknown function DUF472; protein of unknown function
FT                   DUF471; KEGG: ade:Adeh_2257 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56466"
FT                   /db_xref="GOA:D5ED34"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="InterPro:IPR024320"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED34"
FT                   /inference="protein motif:PFAM:PF04329"
FT                   /protein_id="ADE56466.1"
FT                   /translation="MNKKKSQVRRLSWLRFVASVFKGIIFVAALVVIAHELEGVRLHDV
FT                   FIQLRRIGRWHLVGAVVLTALSYILMIGYDDLGLRYLDHRLGFMQISFTSFLGYAFNNN
FT                   LGTLLGAGTVRVRIYGAWGLSNKQILSLILFSSSCVWLGLATLTGSVLLIHPIPSNVNL
FT                   PLFVDSISLWGFALMALVAGYLGMCLWWRKIIHIWRWSFQLPSIRLAVIQILIGSLDWF
FT                   LVALVLYVLLIYITDVPFITFLAVFLLAQFAGIVSNVPGGLGVFETVLLVMLSAQVEHQ
FT                   AILRALVLFRAIYYLLPLAIAGLSLGGLELLRHRRSLGMAYSVYQRFARPVVPLAMAVL
FT                   VFVAGLSMLFAGVLPTSYTRLHLLHDWLPLTAIEISHLLGSVVGTLLLFLAIALYRRIN
FT                   VAYGLGITLLGAGMVLSLLRGLHWEVALTQGIVLMALLPCRSCFYRRARLLEPRTSSSW
FT                   LAAVGLAVGASIALGLFAFRHVPYRNELWWQVSLTGDVPRFLRAALASVLVVLAFSVVW
FT                   LLRPTRIVPLWPGKYELDIAQRIAGGFPHTYAHLALLGDKQLLFNPQRNGFIMYGVQGG
FT                   SLIAMGDPVAADRQQEELAWQFRELCDRYGMRCVFYQVDGANLPLYVDMGLFLVNLGEE
FT                   ARVPLKDFSLEGSKRKSLRQDVNRAVKAGCSFEVVPAEQVALLIPYLKTISDAWLTLKH
FT                   GQEKGFSLGFFNEDYLSRLSIAAVRHEGKIVAFANLWLGGDEELSPDLIRHLPDAPPGT
FT                   MDFLITQLLLWGKEKQYQWFNLGGAPFSGLEDRTLAPLWHRLGTQLYRHGEHFYNFKGL
FT                   RQFKEKFDPVWEPKYLATSAGLSLPAVLVDLTLLIGKHAVRNNGGIKLPK"
FT   gene            complement(341470..341820)
FT                   /locus_tag="Amico_0324"
FT   CDS_pept        complement(341470..341820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0324"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56467"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED35"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56467.1"
FT                   /translation="MKHERIRVTKMAGELINDFLTFLKCNKISLVIQEDPDAFRIEISG
FT                   TYNHLTDERLERLKNLLCQPRNYELEEMYWSLSGESDTDAELHLVGIMTDEVTIERDEE
FT                   NRRLTIHLVRKK"
FT   gene            complement(341817..343091)
FT                   /locus_tag="Amico_0325"
FT   CDS_pept        complement(341817..343091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0325"
FT                   /product="protein of unknown function DUF1576"
FT                   /note="PFAM: protein of unknown function DUF1576"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56468"
FT                   /db_xref="GOA:D5ED36"
FT                   /db_xref="InterPro:IPR011470"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED36"
FT                   /inference="protein motif:PFAM:PF07613"
FT                   /protein_id="ADE56468.1"
FT                   /translation="MFKFAKKKQPLMQMRYGPYIGLCAFCFLFIIFPFIISSPREIFSG
FT                   LWSIILDPDYLISDYVGVGGLGAAFFNSGLLTLSMTGILFLSGTQITGISISALLTVAG
FT                   FALFGKNILNVWPILAGVYLFAKYRKEPFSRYIYIALFGTALSPLVSLMLFGNLLPFGP
FT                   FNLFAGILVGLSIGMILPPLSTAFLRFHQGYSLYNVGFVTGTIGTVYVSLLKSFGLLVE
FT                   SRMIWTTGNNLLLAIFLYISFAALVLFSLFLPRWNKFKWIMGYSGRAVSDFVILEGWGA
FT                   TLFNMGIMGVITTSYILFIGGDLNGPTIGGILTVVGFSAFGKHPRNIIPVILGIMLGAI
FT                   TKRWGLAEPSIQLAALFGTTLAPISGEFGWKYGLIAGFVHSSVVLNVGMLHSGFNLYNN
FT                   GFSGGLVAAFLLPLIETFARGGNNR"
FT   gene            complement(343084..344394)
FT                   /locus_tag="Amico_0326"
FT   CDS_pept        complement(343084..344394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0326"
FT                   /product="Radical SAM domain protein"
FT                   /note="KEGG: sat:SYN_02176 Fe-S oxidoreductase; PFAM:
FT                   Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56469"
FT                   /db_xref="GOA:D5ED37"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED37"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADE56469.1"
FT                   /translation="MSDYSLYLKSLHNKTILGINPPVFDFAYFDFWAKPLGLLYILETL
FT                   REQKNSVYLIDCIYEGRETPKTFGRYKPLRRKVEKPACYSHIPRKYYHFGMEEEDFLER
FT                   LKKTPTPDVILLTSGMTYWYPGIQWCLDRVKRIFPHTPVLLGGFYAQLCPEHARTIGAN
FT                   GVQTAPLCLESPYPALDLYNQPEYGVIMTSWGCPLHCQYCASKLLWPCFRQREVEEIIH
FT                   EISFQERIPTVRDMAFYDDALLINKEFHFYPLCGRLRKSFSHLRFHTPNGLHVREIDEK
FT                   CARVLFDTGFKTIRLSLESTDPIIQKASSEKVSEHQYVKAVTHLLRAGYSQEDIETYIL
FT                   IGLPGQRFESVKNAIEFVHSLGAVAKTAEYSPIPGTMMFEASAQKHPQLTTEPLLQNNT
FT                   AYCGYISKEISPEELQILKNMAHHIHNPLETGGKNIV"
FT   gene            344461..345366
FT                   /locus_tag="Amico_0327"
FT   CDS_pept        344461..345366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0327"
FT                   /product="RarD protein, DMT superfamily transporter"
FT                   /note="KEGG: dat:HRM2_08160 RarD; TIGRFAM: RarD protein,
FT                   DMT superfamily transporter; PFAM: protein of unknown
FT                   function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56470"
FT                   /db_xref="GOA:D5ED38"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED38"
FT                   /inference="protein motif:TFAM:TIGR00688"
FT                   /protein_id="ADE56470.1"
FT                   /translation="MGKTEFEKGFLAALAAFGAWGLLPAYWKQLDNLQPLQILCHRIVW
FT                   SLLFVAMVLTVQRRWGSVVKAIKTRKTLGLLLLSGLAIGVNWFIYIWAVNSGKVIETSL
FT                   GYFINPLVSVLFAVLFLREKLSTLQWSAIVLAGLAILYQVILVGRVPFAALSIAVSFAL
FT                   YALIRKVAEVESFPGLFIETLLLVFPALFYLFVGLPEEPFLAGETAQQKIWLLSSGIVT
FT                   SLPLICFAYGARRLPLSMLGIMEYLAPTLSFLLGFFVYKEPFDRVQLLTFVCVWVALAL
FT                   FTGEKLLRWRRMQHPDKDLV"
FT   gene            345438..345896
FT                   /locus_tag="Amico_0328"
FT   CDS_pept        345438..345896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0328"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56471"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED39"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56471.1"
FT                   /translation="MKRPLLILAICMAIFAALGVSAADASDFSLFEIREIAVKGSKLHI
FT                   RGDADLPEGAMLNIALHFPGFDGKPGNKKDIKVHVNKNHFFIQVRLPKDRKDCPWIGIL
FT                   RAIFRPSLQEEKIKKQVGPKGEHLKGIKVRFENGENIFFDERDFSLEL"
FT   gene            complement(345893..346978)
FT                   /locus_tag="Amico_0329"
FT   CDS_pept        complement(345893..346978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0329"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /note="TIGRFAM: A/G-specific adenine glycosylase; PFAM:
FT                   HhH-GPD family protein; iron-sulfur cluster loop; KEGG:
FT                   dds:Ddes_0064 A/G-specific adenine glycosylase; SMART:
FT                   HhH-GPD family protein; iron-sulfur cluster loop"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56472"
FT                   /db_xref="GOA:D5ED40"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED40"
FT                   /inference="protein motif:TFAM:TIGR01084"
FT                   /protein_id="ADE56472.1"
FT                   /translation="MISKILLEWFYCHKRNLPWRHSYNPYEVWISEIMLQQTQIDRVIP
FT                   FFNHWMERFPNLAELTEASEEEILKLWEGLGYYSRARNILKAAKQLVHMGYSTVPPDEA
FT                   VLRKLPGIGAYTAGAILSIAYNLPFPAVDGNVRRVFARLFNIDMPVISGMGLDLLNNYV
FT                   LSTLPSENARDFNQSVMELGALVCIPRSPRCPLCPLQKFCQAFQEGEQNNRPITNKKAG
FT                   IQKKKAVAGIFYCDKFILLRQRETDGSWGGLWEFPWGFEHDDLAAEEVLMKEIDKVLGT
FT                   ASFTLRSLGRVRHSIMNTQIDLNGYVASLPSLVHVETPFKWVMPKELSKLPLQGGSAKL
FT                   LHLFIKKSRPSSIKGLPHEDI"
FT   gene            complement(346956..347108)
FT                   /locus_tag="Amico_0330"
FT   CDS_pept        complement(346956..347108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56473"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED41"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56473.1"
FT                   /translation="MYKKPLSILFRERREQPAKKAASSSIIIDYLTKHLASFGRGMGYD
FT                   LKNIA"
FT   gene            347184..347852
FT                   /locus_tag="Amico_0331"
FT   CDS_pept        347184..347852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0331"
FT                   /product="protein-L-isoaspartate O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /note="TIGRFAM: protein-L-isoaspartate O-
FT                   methyltransferase; KEGG: gme:Gmet_1420
FT                   protein-L-isoaspartate(D- aspartate) O-methyltransferase;
FT                   PFAM: protein-L-isoaspartate(D-aspartate) O-
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56474"
FT                   /db_xref="GOA:D5ED42"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED42"
FT                   /inference="protein motif:TFAM:TIGR00080"
FT                   /protein_id="ADE56474.1"
FT                   /translation="MDLEKWQDFAWLMVKTQIESRGVEDERVLQAMKKVPRHLFVAEEY
FT                   QSLAYVDAPLPIGESQTISQPYMVALMTELLQVSPGMKILEIGTGSGYQAAVLAEIGAK
FT                   VFSIERISSLAKKARNVLSKAGYEVVVVTADGREGYAQEAPYNGIIVTAAADRVEEAWR
FT                   DQLSIGGRLVVPLSVDVGLQRLVVLLKKKNQWIDTWHDYCRFVPVMPGTRTEKREGADG
FT                   "
FT   gene            347852..348217
FT                   /locus_tag="Amico_0332"
FT   CDS_pept        347852..348217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0332"
FT                   /product="protein of unknown function DUF369"
FT                   /note="PFAM: protein of unknown function DUF369; KEGG:
FT                   sfu:Sfum_3204 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56475"
FT                   /db_xref="InterPro:IPR007256"
FT                   /db_xref="InterPro:IPR025658"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED43"
FT                   /inference="protein motif:PFAM:PF04126"
FT                   /protein_id="ADE56475.1"
FT                   /translation="MDIRIRTGEIEINAALNNSVTASRILKILPIKSRANTWGEEIYFM
FT                   IPLIADLEDGKEVVEAGDIAFWPTGSAFCIFFGPTPASKGDEIRPASAVTVVGKIKGNL
FT                   EILKTVKNGDPIIIERA"
FT   gene            complement(348280..350112)
FT                   /locus_tag="Amico_0333"
FT   CDS_pept        complement(348280..350112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0333"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: pca:Pcar_2970 TonB-dependent receptor
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56476"
FT                   /db_xref="GOA:D5ED44"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED44"
FT                   /inference="protein motif:PFAM:PF00593"
FT                   /protein_id="ADE56476.1"
FT                   /translation="MIQKKRLIMLSMVLLLAFFATSATGTEKVYEVPEELVTGSRLATS
FT                   LEEVPAPTYVITRGQIDQSGSKDLATVLEKHVPGMFVKQKSGFSNASQVTIRGFLTEIL
FT                   VLVDGIPYYRSSHGAGAATVDFRSFPISNIEEIHVVKGAGSAVYGSMAAGGVINIITKK
FT                   GAQGGFLEGEIGPNDWRRYAIQGNAADNGLNAGLWYSRKEEGRHRLLKDTFSMEDFYAL
FT                   KYREDAYGFTFSGKNWFLKSEIGEYKNEYETPGWFTPVDINSEKGQYQRYALRYAGSNY
FT                   YILMGYDDQRYYILQNPDNYYKDRAFTTEFAKQKQWGETLASWGLFFRREESTFRGSSF
FT                   DPEVEQNRTNYAPFAEFSRPIGDFIGTLGLRYEIWRQDDAENHNELMPKLTLQYPLDNG
FT                   STWYLSAGRFFAMPSIYELYAKGPWGTVGNPNLKPEKGWSYDLGIKGADHSGSWNLGLF
FT                   YSDMEDKIIWRNSTYENVDQFKSYGLEALRRWDITSKWTLSLSGTWMKAQEKSNDEWVN
FT                   SYGFPEWLLKTSAEYHSGPWTAGVDFSYLANRNGYPSGDDYFQTDVFAEWRSGDHTLRL
FT                   SCYNLFDEEFMYDSAGWEYYGPERSIYITWKYSF"
FT   misc_binding    complement(350233..350420)
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam(RF00174),
FT                   score 101.06"
FT   gene            350509..351648
FT                   /locus_tag="Amico_0334"
FT   CDS_pept        350509..351648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0334"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG: unknown
FT                   periplasmic-binding protein of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56477"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED45"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ADE56477.1"
FT                   /translation="MIKRISLLFLFFFVITPSVWGSPHPFPEVSLQYAHGFRVECGNGY
FT                   YVVTVDRPCSDAADSQSYLLLSKGGSVPEAHKDLPVIYIPVKRIITTSMTMLPFIERLT
FT                   DKSSLVGVGGKRYVYSEDIRNLNLLDVASDAGSGLRIDVEKILSLQPDVVFVYTYTATE
FT                   KEAAERLAALGVPIVIASDYLEETPLGMAEWIKFVALFLGEEKKAEIFFRGVSERYNCL
FT                   KELANKAEARPTVMVNAAIGGMWYVSGGRSWPALLIRDAGGEYLWSEVDLPGSIPIDFE
FT                   KVLERALNSDFWINPTTWRNLDEGRGQDSRYTAFRPFREKKVYNNNARINGAGANDYYQ
FT                   QGVMRPDLILADLISIFHPTLLPNHELYFYRLLEEGTGK"
FT   gene            351645..352649
FT                   /locus_tag="Amico_0335"
FT   CDS_pept        351645..352649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0335"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   ppd:Ppro_1257 transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56478"
FT                   /db_xref="GOA:D5ED46"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED46"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ADE56478.1"
FT                   /translation="MRRYPFIFFIAVSFLGIFFAALSLSLGSVSIPFYELWNVIFNHGG
FT                   IENGWRIIVLELRLPRILTSLAAGSALSVAGLGMQTLFQNPLAGPFVLGINAGASLGVA
FT                   LATLLTGALASLGLAASSWLGSSLVLFVMIGIAGRLKNNITLLILGLMFGYGVSALVSV
FT                   LIHFSSPEQIQQFVLWSFGSFSSVTWQQLSLFVPVSLSGVMAMFFLAKPLNALLLGESY
FT                   ASTMGVSVRHIRLALVFVTAILAGTVTAFCGPIAFLGMAVPHLCRHFLKSGDHRLLIPA
FT                   SALSGGVLALAADFFAHLPGSALVLPLNAVTSLVGAPVVVWVILRSPYGAKVS"
FT   gene            352646..353677
FT                   /locus_tag="Amico_0336"
FT   CDS_pept        352646..353677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0336"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: ppd:Ppro_1258 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56479"
FT                   /db_xref="GOA:D5ED47"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED47"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADE56479.1"
FT                   /translation="MSLKRPLLATQDLSIGYGPKKGTTLVAGPIATSLYEGELVCLIGP
FT                   NGVGKTTLLKTLAGTQNPLGGEIRVLESSLAELSHKKRAQLLSFVISGRPAIQGFSVFE
FT                   LVALGRHPYTNWKGELEDRDIKAVEKALVEVNAWHLSGRDFAKLSDGESQRVLIARALA
FT                   QDTPILLLDEPTAFLDLPRKVELLSLLRQYAWKMNKGVLMSVHDIDLALRFADRIWVMS
FT                   PSHSFTVGIPEDLVLSGVIEEVFSSETIRFDKEKGGWKLKETPGMGIWIEGDPVAVIWT
FT                   GRALERKGYKLLSELERSIQSWHASIKVTVDPDPLWVLSFPSGQVAHAASLEEALALLS
FT                   YYL"
FT   gene            complement(353681..354433)
FT                   /locus_tag="Amico_0337"
FT   CDS_pept        complement(353681..354433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0337"
FT                   /product="TonB family protein"
FT                   /note="TIGRFAM: TonB family protein; KEGG: vfm:VFMJ11_1305
FT                   TonB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56480"
FT                   /db_xref="GOA:D5ED48"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED48"
FT                   /inference="protein motif:TFAM:TIGR01352"
FT                   /protein_id="ADE56480.1"
FT                   /translation="MKRFMLPFICSFFLHICLLIGLSVLATGATAPFAPPQKTMTLRLV
FT                   SVPFPKSERPKDNSSLYDTPRENYKEETKPTQKTETKIKEEKPAKSIPKAKTKPSELSE
FT                   KKDVSQKKTTTQRQTPVKQKSANVLNAAANETQGSTAKKMSMNKSRAPLPQHQESNLAI
FT                   EPVDVASLSIKKREKPLYPLLSRRKGEEGKGIFIAIVEKGKVITIETEQSCGYDRLDKA
FT                   AYRALKTWLFSEDFTGKVRIPVIFSLKD"
FT   gene            complement(354437..354826)
FT                   /locus_tag="Amico_0338"
FT   CDS_pept        complement(354437..354826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0338"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   lip:LI0694 biopolymer transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56481"
FT                   /db_xref="GOA:D5ED49"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED49"
FT                   /inference="protein motif:PFAM:PF02472"
FT                   /protein_id="ADE56481.1"
FT                   /translation="MASRPTRSKLPEIDITPLVDILFILIIFFVLTTTFGQSQLQVQLP
FT                   QGKADALESDQDIYITLKIDGTLLWENEPISEEKLALRAIEAEKNNRTILLAADREVPY
FT                   GTVAAFLSRLHEKGLIQIALMLQEE"
FT   gene            complement(354829..355458)
FT                   /locus_tag="Amico_0339"
FT   CDS_pept        complement(354829..355458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0339"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   pca:Pcar_1505 MotA/TolQ/ExbB proton channel family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56482"
FT                   /db_xref="GOA:D5ED50"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED50"
FT                   /inference="protein motif:PFAM:PF01618"
FT                   /protein_id="ADE56482.1"
FT                   /translation="MGIMRAGGPIMWVIFVLSIIALGVFIERVLFFRRSSTDPEKLELA
FT                   LSEALYENDAEKATQIAKSGDSSLHRLFIAAVAHWQVDTEAFKLLLEQQIRRELFRWIK
FT                   GLTLLGTISRVAPLLGLLGTVLGMVEIFRGLPQASQSPMIALSGGIWQALLTTVAGLSI
FT                   AVPTVLAYTYLNAKIDDQEETLYRGADFLIREKLTAGTKAPHGKDK"
FT   gene            355683..357089
FT                   /locus_tag="Amico_0340"
FT   CDS_pept        355683..357089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0340"
FT                   /product="sodium:neurotransmitter symporter"
FT                   /note="PFAM: sodium:neurotransmitter symporter; KEGG:
FT                   dde:Dde_2371 sodium-dependent symporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56483"
FT                   /db_xref="GOA:D5ED51"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED51"
FT                   /inference="protein motif:PFAM:PF00209"
FT                   /protein_id="ADE56483.1"
FT                   /translation="MEKSTSPREGFSSGLAVFLAALGSAVGLGNIWKFPYLTGANGGGA
FT                   FLFVYFICVLFVGIPVLLCEWYVGRYTRRNAVGAFESLKPGSAWKGIGVMGVLASYLIM
FT                   FFYTCVAGWVYFYCFKAFTGSFASVTANTVEELFGQVIGVGTAGKSFFSKDVLSPIFWQ
FT                   VIVLCVVGTGISMGVRSGIERITKTLMPLLFMLIIICDIRALTLPGAGEGIRFLFHIDF
FT                   SQITPAVVLSALGLAFFKLSLAMGVMITYGSYFTEDVHLFKTAGKIAFSDTLVSMLAGI
FT                   AIFPTVFSFGMEPSAGPGLLFMTIPLVFSKMPLGAFLLAAFFLLTSFAATTALLSLMEV
FT                   PVAFWTEEFNISRKKATFLNCLFIGLVGVTAALSVDSSSLLGGYKLWGRGFFDFFDHLS
FT                   SNIIMPLGGLLIAIFVGYFAKKDDVACELSNHGSLQNDTYVSFFNFVIRYVSPALLVII
FT                   FLNTIGVISF"
FT   gene            complement(357135..357986)
FT                   /locus_tag="Amico_0341"
FT   CDS_pept        complement(357135..357986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0341"
FT                   /product="spermidine synthase"
FT                   /note="KEGG: hypothetical protein; K00797 spermidine
FT                   synthase; TIGRFAM: spermidine synthase; PFAM: Spermine
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56484"
FT                   /db_xref="GOA:D5ED52"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED52"
FT                   /inference="protein motif:TFAM:TIGR00417"
FT                   /protein_id="ADE56484.1"
FT                   /translation="MERRAKRYNELWVTEEQTSNMKLSLRINQILINKKSEYQDILLVE
FT                   TFEYGRMLILDGAIQIAERDEFCYSEMMAHIVLCAHPSPKRVLIVGGGDGGVLREVLRH
FT                   KEVEKATLIDIDKEVINASKKYLPTISCAMDDPRADVQSMDALAYISSVSNEFDVAIID
FT                   STDPVDFAAGLFEADFYSDVKRALKEDGMMLAQTESPFSDSNVVVGAFQEIKKVYPITS
FT                   LCWGAMPTYPTGIWTYTIGSKKLDPSVPRCPAPEGTKYYTTEIHKAAFVLPPFLKKLLD
FT                   KA"
FT   gene            complement(358016..359203)
FT                   /locus_tag="Amico_0342"
FT   CDS_pept        complement(358016..359203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0342"
FT                   /product="Orn/DAP/Arg decarboxylase 2"
FT                   /note="PFAM: Orn/DAP/Arg decarboxylase 2; KEGG:
FT                   psa:PST_0994 ornithine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56485"
FT                   /db_xref="GOA:D5ED53"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002433"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED53"
FT                   /inference="protein motif:PFAM:PF00278"
FT                   /protein_id="ADE56485.1"
FT                   /translation="METSHHYEFDLERFMTREKFERIKAFAADKETPCLIIDLDVIEKQ
FT                   YDSLKKGMPFAKIYYAVKANPLDDVVKLLVEKGSCFDIASVYELNQVLALGATPDRISY
FT                   GNTIKKAKDIAYAYEKGVRLFATDSESDLYKLAKHAPGSKVFFRILTDGSGADWPLSRK
FT                   FGAHPDTLYKLILMSKELGLEPYGVSFHVGSQQRDLGQWDHAISTCKYLFDSVAEKGIR
FT                   LKMINLGGGFPSQYIYPTVGAEVYGTEITRYLKEDFGENLPEIILEPGRYMAGDAGVMV
FT                   TEVVLISRKSEFGQYRWIYLDAGKFGGLIETLDESIKYPIYVEKKGIVQEAIIAGPTCD
FT                   SMDILYEQYKYELPLTLEEGDRVYILTTGAYTQSYSSVYFNGFPPLAAYILPREE"
FT   gene            359405..360370
FT                   /locus_tag="Amico_0343"
FT   CDS_pept        359405..360370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0343"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   geo:Geob_1169 beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56486"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR037482"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED54"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ADE56486.1"
FT                   /translation="MLNIHSFYQSKFPHLAAEFEGGSLYLIDLPIARPGFEKFISAWLI
FT                   RDQTRNRTLLIDPGPASTLPRLYGALEELGTPSIDYVLLTHVHMDHAGGMGDFMDTFPK
FT                   AKIVAPSNGIKHLVDPSKLLAASLETLRDMVEVYGEMEAISEDAFADPGDVEGVRFFMT
FT                   PGHAAHHQAIFYDLEEDFPILFAGEAAGTYIGDVEGKTFYMRPATPPRFFFHSAEESIE
FT                   FLIKSSFSMLCYAHYGWVRDGKRFLLKALEQMRLWRNFVEKHSGTREELIDIVLDKDAN
FT                   LKGFFEFSTEMQRRERYFIDNSLKGFIEGAISEKRKKAIP"
FT   gene            360474..361463
FT                   /locus_tag="Amico_0344"
FT   CDS_pept        360474..361463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0344"
FT                   /product="Glucokinase"
FT                   /EC_number="2.7.1.2"
FT                   /note="KEGG: dde:Dde_1461 glucokinase; PFAM: Glucokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56487"
FT                   /db_xref="GOA:D5ED55"
FT                   /db_xref="InterPro:IPR003836"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED55"
FT                   /inference="protein motif:PRIAM:2.7.1.2"
FT                   /protein_id="ADE56487.1"
FT                   /translation="MHILTADIGGTTSRFALFSVRDKKVFLEKIIRKATARYASFFEIL
FT                   EEIRMEDGRFSFDEVLFSVLALPGPVRKQDDIALTNVTWPIPIASLRRAYSQAPLLVVN
FT                   DFIAQAYGCLTLHKGDYFTVNEGQMDPEGHVAVIGAGTGLGCGVLVPYAFQKYAPLPSE
FT                   GGHTTFAFLKEEQSFEVFLRKRTSASYITKEMVVSGKGLSLLYEFLTGHSLTPLEVAEK
FT                   ISPSSLTAMLFATFYARACRDFALTVTPSRGLFISGGVAISNPWIVDNDIFKKEFTFSS
FT                   SHSAFLNTIPVLLLKNVDNGLWGAVHYGIHCLPEFEQTMGVEDSFSYL"
FT   gene            complement(361403..362200)
FT                   /locus_tag="Amico_0345"
FT   CDS_pept        complement(361403..362200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56488"
FT                   /db_xref="InterPro:IPR021373"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED56"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56488.1"
FT                   /translation="MMKRSLICLVSIILIFFSNPLWGGQAEIMTPSQRLQHHFIKELDP
FT                   EKMTIIFDEEPDESGYIRDIYMNLEGAIIGGVRIDNLSLRAMGVQLTPMRDWGEKGPEA
FT                   DYIMNILAKGIIDEDDINRNLIQKEFGNDDHWHNIQLDIHPEGIYAKGYYLVRLLFKLD
FT                   ILIEIESRLKIVDFQQIWLDNYKVRVNRVDVPEFITEKAVSQIQPLLDLSKFVFPLKLT
FT                   SISYSDTSITLSSAKEPEPFEGVVYKYEKESSTPIVCSNSGKQ"
FT   gene            complement(362252..362836)
FT                   /locus_tag="Amico_0346"
FT   CDS_pept        complement(362252..362836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0346"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: pay:PAU_03884 ubiquinone/menaquinone
FT                   biosynthesis methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56489"
FT                   /db_xref="GOA:D5ED57"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED57"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADE56489.1"
FT                   /translation="MKKDQDPFKKLAPYYDLFMIKAGLYKTNTILKMVPLEPEQRILDL
FT                   GGGTGYLARKLLGEKREIHVLDTSPHMTRFLQNTPVITTLGDGRATPYKEDFFHGVILS
FT                   DTYHHIEEQNMLLQEIDRILAPGGFLLIHDFDKNSILTALIGCLEKLFISPVFYTTPQH
FT                   LKEKILKRNYVLDKETYGLYWFIHVYKKLTL"
FT   gene            complement(362833..364806)
FT                   /locus_tag="Amico_0347"
FT   CDS_pept        complement(362833..364806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0347"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: sat:SYN_00466 ABC transporter ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56490"
FT                   /db_xref="GOA:D5ED58"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED58"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADE56490.1"
FT                   /translation="MIQLVNITHFYGEQGLYNSLNWSITHGSKTGLIGSNGTGKTTLFK
FT                   IIMGLVEPREGNVYFPKGIRIGYLSQDLVEIEDTVLLHYLKKQAGIALVEKELRATEED
FT                   IARAAKNEEEYHSLLKRHDHLSHRYEQLGGYEFAAMAQKVMKGLGFSDGDGQRYTSTFS
FT                   GGWKMRISLAAMLLSSPDILLLDEPTNHLDTESMEWLEDWLLNFNGTLIAISHDRHFLD
FT                   KICTSTAELSQGAISLYKGNFSWFLEEKARRNEERERIARKQRTEMDKNLAFIERFRYK
FT                   ATKATQVQSRIKKLERMSLVDTDSSEKAVAIHFPQCPRSGQEVISVKDVKKTYGDNLIF
FT                   KDISFSVHRGEKIALVGVNGAGKSTLSRLISQSEVPTEGNISYGYNVKMGFFSQESAQN
FT                   LNYNRTIWEEISNTGYLGTDTEKRGLLGAFLFSGDDIYKLISVLSGGEKSRVALLKLLL
FT                   EETNLLILDEPTNHLDMRTRDIFQQALTEYHGTIIIVSHDRYFLDKLVSRVIEIREGKI
FT                   LEYPGNYSYFIQKRAERLETEKLSLTEESSRENATPSKNDEKERRRQEAEVRNLLYREK
FT                   QKIMKDLTPLETIIEELEEEKLQIETSLCDPSFLENTLEVQKIMMRHNEIMGLLVTYMK
FT                   EWEMLMEQIETVEEKVKQKSSS"
FT   gene            364916..366244
FT                   /locus_tag="Amico_0348"
FT   CDS_pept        364916..366244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0348"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; General
FT                   substrate transporter; KEGG: tgr:Tgr7_0101 major
FT                   facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56491"
FT                   /db_xref="GOA:D5ED59"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED59"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADE56491.1"
FT                   /translation="MLVVREVLYVGKDEEMERGLRYRWIVWGVMVLSYVVVFFHRLAAG
FT                   VVRNDLVEAFGLSGAAFGTLASLYFYAYMMMQIPVGLLVDSLGARITISVGTLIAGVGA
FT                   LFFGYAPTASVLFLGRFLVGIGVATVFVSILKVQSQWFREREFATLSGMTSLIGNGGGL
FT                   LAQTPLALAVAFLTWRTTFAAIGVFSVFLAGVCYLFVRNSPQDMGFPSINESERKRNES
FT                   SDKSIGGKISLKEGFKQVVRVRHLWPVIFFFSFNQGASLSFTSAWGVAYMESVYGLPTT
FT                   SASSYIAVILIGLMVGSLFSGWFSDRMGRRKWPMLFLASLNVATWAILVFYNGGQPPLA
FT                   ILKPLFFIMGFTATGYVVSWALAREVTPSNFTGIAISLMNTACFLSIGLFTTLLGKILD
FT                   RYGNLLQGPLLFQRVLFPCFAAVLLSFVCALFVPETKGENIYR"
FT   gene            366391..366591
FT                   /locus_tag="Amico_0349"
FT   CDS_pept        366391..366591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0349"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="KEGG: dal:Dalk_0501 cold-shock DNA-binding domain
FT                   protein; PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56492"
FT                   /db_xref="GOA:D5ED60"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED60"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ADE56492.1"
FT                   /translation="MAQGTVKWFNDSKGYGFITTDEGKDVFVHYSAIMGDGFKTLAENQ
FT                   RVSFDVTQGEKGPQAANVQKL"
FT   gene            complement(366658..368325)
FT                   /locus_tag="Amico_0350"
FT   CDS_pept        complement(366658..368325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0350"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="KEGG: atc:AGR_L_1362 inducible ATP-independent RNA
FT                   helicase; PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; SMART: DEAD-like helicase ;
FT                   helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56493"
FT                   /db_xref="GOA:D5ED61"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED61"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ADE56493.1"
FT                   /translation="MEQNNFEQYELRAELLKALAEKGFSTPTPVQDRVLSEKIFEKDII
FT                   VRAKTGSGKTLAFLLPLLQKITAGERESKVLILSPTRELSQQIWKEAKWFGNYINVSAA
FT                   SLVGGMDMSQQIRSLRDGSAVVTGTPGRVLDHIRRGTLDTSGIKIVVLDEGDHMLDLGF
FT                   KEELEAILDSLPNCQRVWLFSATMPAEIKNLAKRYLKTPVFISLTEEGEAHEDITHEVY
FT                   LVPTRHKEEGLINVLLWEKPSRAIVFCHTRAETVELTRRLHDENFQAMCLHGEMSQRER
FT                   NMALSQFRSGRTPLLVATNVAARGLDVEGVSHVIQMGLPDNRETFVHRSGRTGRAGHEG
FT                   RNLLVLSPKEATGFKSMVKTSTIPITWKNVPDPKDIRKKQRISYEERVFAAEHYETPEN
FT                   LEWADSLLECNESRAMIARLLGLLFSRKNAGYELTADLEQDLKRGRTPRRSRSKESGSA
FT                   GSSLQTTIRIERGRDQGWDVGKILRVICSTLNIDKSGVGAIRLQNDHAQVELLPSIEKD
FT                   FERFGHRLIERGLITEGRKSYKAVEKRGKKPFRQRKKR"
FT   gene            368675..369748
FT                   /locus_tag="Amico_0351"
FT   CDS_pept        368675..369748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0351"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; KEGG: shl:Shal_2495 RND family efflux transporter
FT                   MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56494"
FT                   /db_xref="GOA:D5ED62"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED62"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ADE56494.1"
FT                   /translation="MKTRKEVMFLLLVIILLGIGCIFFFSQKREEQKSQTSMKEEIAAA
FT                   GIPVTSYVVERAYWDYWKTYYGKIKAASEQSITAYVREFVSSVHVDVGDMVIPGDILCE
FT                   LEKVTQTSVLTSQQTEFENARRDLERKKHLYQAGGISKQEVEQAVALLNERKARLQEAR
FT                   TVFQRTAIRSSTKGVVLSKNIHVGEIAEPGMELFRLASLEDLELEVMIASSDALHIDVG
FT                   VPCRVLYSETVTRGVIKRIDPEAQAETGMYKGVISLERTLNLYPGTFVEVQIRMDSRRN
FT                   AIVIPDDLLRRERNEAYVFVIIEDKAFRRKINPGKSQDGLLEVRGELDEGEVLVREGVD
FT                   RVYDGATVVVIQKGQKP"
FT   gene            369758..372811
FT                   /locus_tag="Amico_0352"
FT   CDS_pept        369758..372811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0352"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   gme:Gmet_2518 acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56495"
FT                   /db_xref="GOA:D5ED63"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED63"
FT                   /inference="protein motif:PFAM:PF00873"
FT                   /protein_id="ADE56495.1"
FT                   /translation="MFGMKFLRVFICRPVFTSVTVLMAIVLGVYSYLNLGIALVPDVDI
FT                   PVISVTTTYLGAGPSEIELLVSKPIEDAVSQVEGVKRIRSYSLEGISFVVVEFEYDINI
FT                   SEATMDVSNRVKAISGTLPEDSKDPITEKFDINAFPFMTIAISSNLPPEYAFDIVEDRI
FT                   QRRLTQLQGLARAEIIGGLKREIHVYLDPVELHQYQISPDKIIQVLQRNNFNDPSGHIV
FT                   QGRKELSVRVLGEVEDPLELENIRIPLHGSTSIRLGDIGKVADTTEERRGYARYEGKEA
FT                   ILLDCIATPGSNIVEVSDRIKEELEDIKLLLPEGFEVTITDDISTFVRESIRNVFRDMV
FT                   VGILLTGLVLFLFLQRISLTFVVAVAMPTAIISTFIPMFVSGITMNMMSTLGIAISVGI
FT                   LVNNSILVLENIYRYREMGEGPFEASEKGTADIALSVFSTTATNLGVFIPVVFMKGIAG
FT                   QFLRDFALTIVFATIFSLWVAMTLTPMVAARIRYGSKPSVFSQKATAWWSWMYDKFDKA
FT                   HDILVRKAIDSRYLTLALFLFAFIASLFLLPMLGTEFIPRVDRGLMEISMELSSASSLS
FT                   YTEEVTEAVEKHVRSLPGVAAIEVAVGGSRADVGVNQSRLRIILSDDPRRPTSFALAEQ
FT                   LREYFKMIPDVNASITASVSGGGSPGKPIQILVSGENIEELNKIASQVVATMRSVRGVV
FT                   DVDTNWRLGRPEFQVIPEPWRLGILGVSVKDVADTVRNYITGKKAGVFRLEGREYDILT
FT                   LLDPGHISQMSDVEEFPVATSAGFVPLSSMSEFTHGVGPTSILRSDRTRAITIEGDVNG
FT                   RSVGSAFEEIQVKLKEVTLPRGYRFSYAGEVEDIKENFYYLFVAFAMAIVLTFLMIAAI
FT                   LESYIYAFIIMVTLPLSAIGVLPFLYITNTAISLYGLLGVVMLVGLVVNNAIVIIDYAE
FT                   KKRKEGVSPREAIREACSVRLRPIVMADLTSIIAMIPLALGEGAGGPYRAPMAIVVIGG
FT                   LLAGGTLALFVVPPVYGILHRRTWHDDG"
FT   gene            372938..373603
FT                   /locus_tag="Amico_0353"
FT   CDS_pept        372938..373603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0353"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   pne:Pnec_0365 lytic transglycosylase catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56496"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED64"
FT                   /inference="protein motif:PFAM:PF01464"
FT                   /protein_id="ADE56496.1"
FT                   /translation="MAWRFLRVTFFLALTLFCMEVRGASPSWAEGQYLTLPSEIHAHHE
FT                   NFQREKERTVVVQKRRQKEAEHQVRKEAIAEFFQEKNKHLESERAESYAHYVLEAAHTF
FT                   GVDPFLIAAIIIKESRVRDSAKSRVAYGLMQINWKVHRHNIGKAFSHIRTLTEMMKPKN
FT                   NILVGTYIFSCYLSSSNGDLGRALLKYYGGKNVKYVNKIYSYRHELDKRFAKKLNSFY"
FT   gene            373624..374508
FT                   /locus_tag="Amico_0354"
FT   CDS_pept        373624..374508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0354"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: dvl:Dvul_2528 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56497"
FT                   /db_xref="GOA:D5ED65"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED65"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADE56497.1"
FT                   /translation="MTSSTHPRLKVLLAVLFWGGSYTATKIAVSRVSPVAVLWLRFGIG
FT                   AAVLGLVLFLKKRLQLLPLHQMTELCFLGFFGVFLHNYIQAWGLRTAAAGISALIIACT
FT                   PVIIALLSAFLLKEKLVQRQSLGIIMAAFGVLFILSKGNLAFLKEGNYSFGELLVVCSA
FT                   FTWALFSVFSRKALKTIPPALAMFYVILSGWFFSSIPFLFQGVREISKLDMAGWGSTLF
FT                   LGVFCSALAYVFWYDALKLLPASEVGVFLYISPIVAVAVAWIFLGEPLLLSSIIGGGLV
FT                   LTGVSIVNYRKKS"
FT   gene            complement(374490..375692)
FT                   /locus_tag="Amico_0355"
FT   CDS_pept        complement(374490..375692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0355"
FT                   /product="transcriptional regulator, CdaR"
FT                   /note="PFAM: sugar diacid recognition domain protein; KEGG:
FT                   tau:Tola_2578 transcriptional regulator, CdaR"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56498"
FT                   /db_xref="InterPro:IPR008599"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED66"
FT                   /inference="protein motif:PFAM:PF05651"
FT                   /protein_id="ADE56498.1"
FT                   /translation="MLEKIAQKIASSTAELINIDLIITDEKGIIIGASDPSRKGSLHEP
FT                   SLEAIQTGKISIQRENEVTHLTGVKPGVTLPIEFTGKRIGTIALTGSPARVTQFGLLVK
FT                   KHTELILSEKLFSEVFFIRSRAIQTLMEQIASFNPERDDESSLYVSARGLGFELQIPRI
FT                   AVAAELLYSRPADKVTDVGTAPYTQMDVLMAIRTAFNRPQDISTMMDSDRYEILRAANS
FT                   LLNEKEVVERTRKECEVLQGLLQEKGLHIVIGIGSLAQNLSRLPASHRDAWKAVTIGKN
FT                   IYQKPGIYSIGDMMLEDLLTTASRDVAERYRNSHLAPLRKASDSQELIHTFRVWCEHRF
FT                   SPSAAAQALNIHKNTLNYRINKIESICGLDSQNFKEIFSLYTAIIIHELSDRGDSQLFL
FT                   R"
FT   gene            375878..376024
FT                   /locus_tag="Amico_0356"
FT   CDS_pept        375878..376024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56499"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED67"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56499.1"
FT                   /translation="MQKLQVMGLVEVIREIEESYEEWPGRAIKNKFPLSHGRTKMSSRL
FT                   FFI"
FT   gene            376160..377530
FT                   /locus_tag="Amico_0357"
FT   CDS_pept        376160..377530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0357"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56500"
FT                   /db_xref="InterPro:IPR024258"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED68"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56500.1"
FT                   /translation="MNKQKLIVLVIVLLVAVGGWMMMGNKPQEQAPAPQPQAEQPAEPA
FT                   PAEKPAEAPAEAPAEQPAEEKPAEAPAPAEKPAEAPAEKAAFHIGICTGTVSQSEDDLR
FT                   GAERLIEEYGSVSDGGMIQHITYPDNFMVEMETTIAQISGLADDPLMKAIIVNQAIPGT
FT                   TEAFRRVREKRSDILLFAGEAHEDPGVIESAADLVINCDNIARGYLIVDAAKKMGAKEF
FT                   VHISFPRHMSYELLSRRRNIMEEACNDLGIGFHFETAPDPTSDVGVAGAQQFILEKVPA
FT                   WLEKYGKDTAFFCTNDAHTEPLLKRIAEEGGYFVEADLPSPLMGYPGALGIELSDVKGD
FT                   WPAILKRVEEAVDAKGGAKRMGTWAYSYGYTTTAALGEFARRVLEGAVEVENMEALFEC
FT                   YGKYTPGAKWNGSLYTDIATGVVKNNHILVYQDTYVFGLGYLGMTEVEVPEKYFSIK"
FT   gene            377665..379275
FT                   /locus_tag="Amico_0358"
FT   CDS_pept        377665..379275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0358"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: pay:PAU_00052 ribose transport atp-binding
FT                   protein RbsA; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56501"
FT                   /db_xref="GOA:D5ED69"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED69"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADE56501.1"
FT                   /translation="MALSEPLLKMENIGKAYFGNRVLKDVSFTLEKGQILGLVGENGAG
FT                   KSTLMNILFGMPVIQETGGYEGKFFINGQEAQFKSPFDALDAGIGMVHQEFSLIPGFTA
FT                   AENIVLNRESTQYNFLVESFGDRLRTLNTEEMRQRGENAIEKLNVVISPDTLVSEMPVG
FT                   HKQFTEIAREIDKKKTQLLVLDEPTAVLTESEAEILLASMRKLAALGIAIVFISHRLHE
FT                   VIDVCDKIVVLRDGQVVHETTPAKTNVMEIATHMVGRSIEAAFARDETERSLAGNILKV
FT                   EHLWVDMPGETVRDVSFTVKEGEIFGIGGLAGQGKLGIANGIMGMYPSGGTVTFDETPI
FT                   ILNDPRSPLSVGIASVSEDRRGVGLLLEEPISWNVIFTALQMQQKYLKPVLGGLFKIRD
FT                   EEAIREVTKKYIDTLEIKCTGDYQRVQELSGGNQQKVCLAKAFALHPKLLFVSEPTRGI
FT                   DVGAKRVVLDTLREYNQKRGTTIVMISSELEELRSICDRIAIVNEGKIAGTRPATCPST
FT                   EFGLLMLGEIKNGAEKVSV"
FT   gene            379272..380318
FT                   /locus_tag="Amico_0359"
FT   CDS_pept        379272..380318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0359"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   dda:Dd703_0982 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56502"
FT                   /db_xref="GOA:D5ED70"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED70"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADE56502.1"
FT                   /translation="MMNSLRNFVEKAGWPRVIIGLFLIGLFVMAPFVRVRVDTSISDTL
FT                   VRFGMNGVMVLAMVPMIQAGCGLNFGLPLGIIAGLLGAVTSIEIGITGLMGVLTAMAIA
FT                   APIAVVLGWLYGQLLNRVKGGEMMIATYVGFSSVAFMCIMWLVLPYKSPNMVWGYAGTG
FT                   LRTTISVDGYWNRAISDILSFKLGNFFYCPTGMILFFALLCFVMWLFMKTRVGTAMTTV
FT                   GSNPEYAKAAGVDVNKMRTLSVILSTVLGAIGIIIYEQSFGFIQLYMGPFYMAFPAVAA
FT                   ILIGGASVNKASIFNVVVGTILFQGILTMTPSVINSLIETDMSEVIRIIVSNGMILYAL
FT                   TRAVKVKS"
FT   gene            380315..381421
FT                   /locus_tag="Amico_0360"
FT   CDS_pept        380315..381421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0360"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   atc:AGR_L_3222 ribose ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56503"
FT                   /db_xref="GOA:D5ED71"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED71"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADE56503.1"
FT                   /translation="MMTKKTSFQDNLIHFLISNAVPIIFIALSAVAIPISRFSPQYLVQ
FT                   EMLVRLARDSFLVLSLLIPIMAGMGLNFGMVLGAMAGEIGLILITDWNVVGIPGMLLAM
FT                   IISTPLAIFLGWMCGVILNKAKGREMVTSFILGFFMNGVYQLIVLYGFGSVFPIKSPDL
FT                   VLSRGFGIRNVTNLENIRKCLDNFIPLTIGGVSIPVATFLVIAVFCIFVVWFRKTKLGQ
FT                   DMRAVGQDMEVADSAGIPVERTRIISIVISTVLACYGQILFLQNIGTMNTYNSHEQAGM
FT                   FAIAALLVGGASVTKATIPNVFLGVVLFHLMFVVSPMAGKYLIGEAQLGEYFRVFVSYG
FT                   IIAIALVLHAWRRQRDKERARRALRGNA"
FT   gene            381447..381827
FT                   /locus_tag="Amico_0361"
FT   CDS_pept        381447..381827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0361"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: BGAL10; BGAL10 (beta-galactosidase 10); beta-
FT                   galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56504"
FT                   /db_xref="GOA:D5ED72"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED72"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56504.1"
FT                   /translation="MRRMTVNVGLIIFFVIFSIFLYNAGKGYNLLIDNKAITMDGKDLA
FT                   PYPWVRVNISTARKPVFLKAGGRDVLFVVGKSHTIHVEIMDEKKNVVKEIEKKFKLTRQ
FT                   SGDFLSIPALGEDMPQWIQKRS"
FT   gene            complement(381882..382481)
FT                   /locus_tag="Amico_0362"
FT   CDS_pept        complement(381882..382481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0362"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: mfa:Mfla_1829
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56505"
FT                   /db_xref="GOA:D5ED73"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED73"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ADE56505.1"
FT                   /translation="MMEKRAKTEYPIHELLCSRWSPRAFTKQIPSKDQLLSLFEAARWA
FT                   PSCYNDQPWFFIIATKENIKEFEVMLSCLVEQNQVWAQHVPVLVIGIARTVFALNGKIN
FT                   HYAFHDLGMAIQNMALQATAMGLAVHPMAGFSKSCIRKTYNIPEEYDPMTAIAIGYPGT
FT                   PDELPELLKQEELEPRERKRVREFVFTRAWGKKFTD"
FT   gene            complement(382506..383873)
FT                   /locus_tag="Amico_0363"
FT   CDS_pept        complement(382506..383873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0363"
FT                   /product="tRNA modification GTPase TrmE"
FT                   /note="KEGG: sat:SYN_01016 tRNA synthase; TIGRFAM: tRNA
FT                   modification GTPase TrmE; small GTP- binding protein; PFAM:
FT                   GTP-binding protein TrmE-like; GTP-binding protein
FT                   HSR1-related; Miro domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56506"
FT                   /db_xref="GOA:D5ED74"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED74"
FT                   /inference="protein motif:TFAM:TIGR00450"
FT                   /protein_id="ADE56506.1"
FT                   /translation="MSEDIIAAISTAWGEAGIAIVRLSGFNSRELADEVVHGIRPLSET
FT                   PPRVLRNGYLLDEKKEPIDQVLFSWFRAPKSYTGEEMVEISTHGGTLVAQKCLESLIGK
FT                   GARLAEPGEFTRRAFLNGKIDLSQAEAVLGIIRSKSEEALRAATRTLRGELSSFAKDIY
FT                   NEMLTISSSIEVGLDFPEEDIPFIENEGVESALYTLKQGLEDLLDRCNTGFLLREGIRV
FT                   ALVGRPNVGKSSLLNALLKESRAIVTAIPGTTRDLIEEVLTYRGIPIRLVDTAGIGAPG
FT                   DEIEAMGIARAEKAMMEADVRIWVIDGSEPLTPADLALVQKISATNHIVTINKADLPLV
FT                   ISEEMINGLLPQSPVFVISAEKREGIEALKDAIVTNIAGGGTLTSGLNASSRQVEEIRK
FT                   AIQALGQGISALNEGMGQDVVAACLYDGRTCMERLLGLSVDDALLETIFSQFCVGK"
FT   gene            complement(384085..385308)
FT                   /locus_tag="Amico_0364"
FT   CDS_pept        complement(384085..385308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0364"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   mxa:MXAN_0212 aminotransferase, class I and II family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56507"
FT                   /db_xref="GOA:D5ED75"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED75"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADE56507.1"
FT                   /translation="MSKVWEENFSYNAKNVRPSPVREMLAVIKQPGMISFAGGMPAPEI
FT                   FPVDEFYEGVHILKEDGKNLLQYGTTEGYPPLKEFLAEWTSPRMGKVAALDEMLITTGS
FT                   QQALDLFSWAIIDRGDFVITEDPTYLAALSTFYNHGAEFLGVPCDGEGMQVDLLPEIIE
FT                   KARKEGKKVKFIYTIVNFQNPGGSTMTLERRKKLVEISHKYSIPIFEDDPYGYVRFDGE
FT                   HLPSIFSLDDAGGVIYAGSFSKILSPGSRIGWVTGSKEIIRKMTVFKQTADLCTSTIAQ
FT                   ALVAEYCRNGHLDKHIPVIIDNYRVKRDAMQESFKRHLEPLGVSWVKPEGGFFYWLNFP
FT                   QINTKDLFKKAIEKKVAFVIGEPFCTKPGSGIHNARLCYTFPSPEVTEEGVKRLAEAVQ
FT                   ELAQIATV"
FT   gene            complement(385495..386124)
FT                   /locus_tag="Amico_0365"
FT   CDS_pept        complement(385495..386124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0365"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: ypg:YpAngola_A3351
FT                   M48 family peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56508"
FT                   /db_xref="GOA:D5ED76"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED76"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ADE56508.1"
FT                   /translation="MRKHLAIKILSLFIALLLIVGSAHAALSPQKANLAWERISKAAGL
FT                   KTDPITIEDKKEPNAWVRFSGDSYSVHVTTGLLKILDTEDQIAGILAHETGHIKLNHYG
FT                   STVGRNLLWSLLYKSLKGNQSNELLAGLGITLAESGFSREQEVEADDYGIKLSVEAGYS
FT                   AWGLVQALEKMKEAGYETSPSGFNSHPPTERRLEHARATARAYSQK"
FT   gene            386356..388323
FT                   /locus_tag="Amico_0366"
FT   CDS_pept        386356..388323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0366"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   gbm:Gbem_2602 lytic transglycosylase catalytic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56509"
FT                   /db_xref="GOA:D5ED77"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED77"
FT                   /inference="protein motif:PFAM:PF01464"
FT                   /protein_id="ADE56509.1"
FT                   /translation="MLIRKLHVLAIVLLFLSVSAGMAVGSPDTSQPPSVEEAFWKREWK
FT                   TIDEFLKLDHAALSPRELTLGANALWLQKRWGEALALLQKIDEADFPSALVPYRDMMIV
FT                   LALERTGEKQKAYERAQGLLNKVPEELGFYVAYALSRLSDDNETRRCWLETMLTKATNQ
FT                   AQTIQTLNELLRTAGDNLAYALQLLKFEPMNSQALSCLGKSPRPYGGPVANALGYAAYL
FT                   RGEYAKAIPLFLEVPLDSADGLKSRYYRAVSLYRLERYEEALKLWEWLALNGKSYGESS
FT                   VRRLGILAGQGEREKTLESLQRIADRGNSTVRPRALYSLYTLVPEEQKEFLKKELIDKY
FT                   AMTEGTQAILWDDAWQAWKKGNTREALRIWEHFFSLSNGAMRERLLYWTARGYEKLEQK
FT                   GKAEELFHTLISDYPLSIYSFLASPGGPSFTGETPSELEREKCELEEWGFVFYARLRLL
FT                   KEGSSSAYYRAAILSEWLEDEPGAYSAASTLASALLKKNPLPKKGICFLYPRPYRGHVL
FT                   QSAERFGVEPNLIWSVMKQESAFDADVNSWVGAIGLMQLMPATGKEEAKLLGMEKVDLW
FT                   QPETNILLAASHLGRLQKRFRRLEWAIAAYNAGGGAVGRWIKEGEERPFDEWMEDIPYN
FT                   ETRNYVRKVMGNLFVYRMLY"
FT   gene            complement(388378..390498)
FT                   /locus_tag="Amico_0367"
FT   CDS_pept        complement(388378..390498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0367"
FT                   /product="AAA family ATPase, CDC48 subfamily"
FT                   /EC_number="3.6.1.3"
FT                   /note="SMART: AAA ATPase; TIGRFAM: AAA family ATPase, CDC48
FT                   subfamily; KEGG: gur:Gura_2842 AAA family ATPase, CDC48
FT                   subfamily protein; PFAM: AAA ATPase central domain protein;
FT                   cell division protein 48 CDC48 domain 2; ATPase associated
FT                   with various cellular activities AAA_5; AAA ATPase VAT
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56510"
FT                   /db_xref="GOA:D5ED78"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR005938"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029067"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED78"
FT                   /inference="protein motif:TFAM:TIGR01243"
FT                   /protein_id="ADE56510.1"
FT                   /translation="MPLRVKEALSKDVGRCIARIDPEDIKRYGLSEGQIIELEGKRKTP
FT                   ARLLACDSGDMGQKAIQIDGITRENAQVGLDEKISIHKVDHHFAGSITLRPLTSTPLLE
FT                   KERDSVYLSNLLEGLPVIEGDRIRANLYGTRTCDFLVTDTTPKGIVLISNATYINVEKQ
FT                   LSQEQKTSRISYEDIGGLGPQIQRVREMIELPLRFPQVFDRLGVQPPKGVLLYGPPGTG
FT                   KTVIARAVANETDVYFTHISGPEIIGKFYGESEERLRNVFDEAQAHAPAIIFIDEIDAI
FT                   APKREEMGGEKQVERRVVAQLLALMDGLESRGQVIVIGATNIPNTLDPALRRPGRFDRE
FT                   ISIPIPDRNGRFEILQIHTRGMPLAEDVDLMRLSDITHGFVGADLEALAKEAAMSSLRE
FT                   LLPCIDYEQAVIPYEKLLSMNVTMENFLDALKEVEPSAIREVFVEVPDVTWSDIGGLEA
FT                   IKEELIEAVQWPLKYNSVYEKFNITPPQGILLHGPSGTGKTLLVRALAHESGVNFIPVK
FT                   GPALMSKYVGESERAIREVFKKAKQASPSILYFDEIESLVPIRGRDSGAGASFTERVIS
FT                   QFLAEMSGIEELKGVTVLATTNRIDLIDPALLSSGRFDVVLELPMPDAKARLEIFQIHL
FT                   QKKPLAEDVHLEELVRSTEGHSGGDIHFICRKASALAIRDFLKIGEKGAPCIEKHHFEI
FT                   ALSLLKSNRSLQ"
FT   gene            complement(390618..391829)
FT                   /locus_tag="Amico_0368"
FT   CDS_pept        complement(390618..391829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0368"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   ftm:FTM_0473 aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56511"
FT                   /db_xref="GOA:D5ED79"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED79"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADE56511.1"
FT                   /translation="MRFSNRIMAMQSSPIRRLIPYADEAKAKGKKVYHLNIGQPDIKTP
FT                   PSFLQAIKDFAQEVIAYSTSQGSNELRDAMRRYYEGYDIHFERDHILVTNGGSEAIMFA
FT                   VMATCDPGEEILIPEPFYANYNAFSKCVNVNIVPITTKAEEGFHLPPSEKIEAVITPKT
FT                   RCILISNPGNPTGTIYTADEMRMLADLAKKHDLYIIADEVYREFVYDGLKYTSFGNLSD
FT                   VEDRVIIIDSVSKRYSACGARIGCVASKNEELMKQILKLCQGRLCVPTLEQVGATALYN
FT                   TPVSYLEEVNKEYQSRRDTLYKALQSMPGVVCEQPKGAFYVVVKMPVDDAEKFVIWMLQ
FT                   NFDINGETMMAAPAEGFYATPGLGKNEARLAYVLKNEDLVKAMDILKAALKAYPGRVEP
FT                   VSAQ"
FT   gene            391983..393194
FT                   /locus_tag="Amico_0369"
FT   CDS_pept        391983..393194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0369"
FT                   /product="phosphonopyruvate decarboxylase-related protein"
FT                   /EC_number="5.4.2.-"
FT                   /note="TIGRFAM: phosphonopyruvate decarboxylase-related
FT                   protein; KEGG: sat:SYN_02641 cofactor-independent
FT                   phosphoglycerate mutase; PFAM:
FT                   2,3-bisphosphoglycerate-independent phosphoglycerate
FT                   mutase; metalloenzyme domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56512"
FT                   /db_xref="GOA:D5ED80"
FT                   /db_xref="InterPro:IPR004456"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR042253"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED80"
FT                   /inference="protein motif:TFAM:TIGR00306"
FT                   /protein_id="ADE56512.1"
FT                   /translation="MHSRMSLLHSLATDNEKKMVLLVMDGLGGVQGADGLTELEKAQTP
FT                   LMDRLAAESELGLLSMVDVGITPGSGPGHLSLFGYDPLSWSIGRGILEALGVGAHVGAG
FT                   DICARGNFCTVGSEGIIVDRRAGRIPTEESAKVVKKLQDAIRSIDDVQVTFYPGLEHRF
FT                   VVVFSGEGLCEEVNDADPQKEGLPMRWAVAQNEKARRTEEIINAFIKEVWDVLNDEHPA
FT                   NGCLLRGFSSAPHIPSLGELYKIKPVALATYPMYRGLASLVGMDVRDAGETLEQLFHAV
FT                   GTYWDDYNFFYVHVKYTDSRGEDGNFSEKVRVIEDVDRLLPKILDLRPDVLAITGDHST
FT                   PAILAGHSWHDVPLLLWSPYARRSGAAEFGEKSCAQGNIGHMQGEKLMGLMLAHSLKLN
FT                   KYGA"
FT   gene            393219..394313
FT                   /locus_tag="Amico_0370"
FT   CDS_pept        393219..394313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0370"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="TIGRFAM: metal dependent phophohydrolase; PFAM:
FT                   metal-dependent phosphohydrolase HD sub domain; KEGG:
FT                   glo:Glov_0049 metal dependent phosphohydrolase; SMART:
FT                   metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56513"
FT                   /db_xref="GOA:D5ED81"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED81"
FT                   /inference="protein motif:TFAM:TIGR00277"
FT                   /protein_id="ADE56513.1"
FT                   /translation="MAEAETLKKMTETVKKQNVLGTGAVKKLPRDSKFYCLGVVSKLAS
FT                   KKDKNNKTYWELSLMDKEGTIEGKIWGNAEWWDCRPEGQNETGSHEAAESKKKIDPLTW
FT                   ECMSDLQGQTVGLLGQVAEFRGQPQYNFNAIYYVDQNKYPPYTFVQRSPFPLEEMKNEF
FT                   FGLVESCQPPIKDFLAFVFSGDFWRQFENWPAAVSHHHAYVSGLLEHTLGVARLACGMV
FT                   DASTSSGYGANRDLVVAGALLHDIGKIDSYRLSPAPEMTVEGTVIDHIVLGYNRFSRLA
FT                   EDFGLDEKYAAALGHIIVSHHGCKEFGSPVVPATPEAMIVSAADELDFKLYCWRDAVDQ
FT                   IDEGKEISEWNYSAQRRFWKWELE"
FT   gene            394314..395258
FT                   /locus_tag="Amico_0371"
FT   CDS_pept        394314..395258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0371"
FT                   /product="pseudouridine synthase, RluA family"
FT                   /note="KEGG: reu:Reut_A2274 ribosomal large subunit
FT                   pseudouridine synthase C; TIGRFAM: pseudouridine synthase,
FT                   RluA family; PFAM: pseudouridine synthase; RNA-binding S4
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56514"
FT                   /db_xref="GOA:D5ED82"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED82"
FT                   /inference="protein motif:TFAM:TIGR00005"
FT                   /protein_id="ADE56514.1"
FT                   /translation="MSYTFKVSEHHAGRRLDKVIRTLWPNLPLGAMMRGIRKGLVRVDG
FT                   RKTSCSVRLEDGQSVYVPWEEPELIEKSVKTKRTGALSIVYKDHYIMVLNKEAGLIIQP
FT                   DQSGEESLIERVWLEVEPEGDFRACAVHRLDRNTTGLVVVALHGQSLRELQRAFRDNDV
FT                   DKTYLVAVRGQTPLEGDITAPLQKDRDHNIVTASPDGLPAHTHYEKIAGDDECSLLKVS
FT                   LLTGRSHQIRVHLAISGYPVIGDVKYGDFALNKQWYHRIRLDHPLLHAWKISFRRLNPP
FT                   LSYIERREFSAPPDRLFLKFLRTKGWQTYLEGV"
FT   gene            395292..395390
FT                   /locus_tag="Amico_0372"
FT   CDS_pept        395292..395390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56515"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED83"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56515.1"
FT                   /translation="MRNLKISVSDKAFERLSKMGEGHLVERTIGGG"
FT   gene            395412..395615
FT                   /locus_tag="Amico_0373"
FT   CDS_pept        395412..395615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56516"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED84"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56516.1"
FT                   /translation="MESGKAPVTEGYSAYETEGVTLWIPDFMAFKNDEVIIDLKGFLWA
FT                   ANLVVVSALLGQGSGCGSCSCH"
FT   gene            395886..397166
FT                   /locus_tag="Amico_0374"
FT   CDS_pept        395886..397166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0374"
FT                   /product="Glu/Leu/Phe/Val dehydrogenase"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase ;
FT                   Glu/Leu/Phe/Val dehydrogenase dimerisation region; KEGG:
FT                   nme:NMB1476 glutamate dehydrogenase, NAD- specific"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56517"
FT                   /db_xref="GOA:D5ED85"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED85"
FT                   /inference="protein motif:PFAM:PF00208"
FT                   /protein_id="ADE56517.1"
FT                   /translation="MSVVKRTSSNVLLDTALKNFYAAAEEMGLEDGLIDILSHSERKLA
FT                   VSIPVEMDDGTVKVFEGYRVQHSTAIGPAKGGVRFHPEVCLDECEALSMMMTWKCSLAG
FT                   IPYGGGKGGVSCDPLEMSKREKERVARTYAARIEPFVDAWTDVPAPDLGTGAPEMVWFM
FT                   DTISKMRGRLEPAIFTGKPIGLWGSKGRTAATGYGVATCALELFKALKKDVKGATFAIQ
FT                   GFGNVGTYSAKTLQDAGGKVVGISDITGTYYCKDGIDVDKAMNYVQNIHPKRLLEGYEQ
FT                   PGLEKMGLSDILFLDVDLFIPAALEGVINANNADKVRAKYIVEAANGPLTPEGDAILDE
FT                   KGVLIVPDFLANSGGVIGSYFEWAQNLSGFFWSIEEYNERLIRIMKDNFAKVWDYSQEK
FT                   NVKMRRAAFMAAIQRVSDAVRMRGVFL"
FT   gene            complement(397310..398614)
FT                   /locus_tag="Amico_0375"
FT   CDS_pept        complement(397310..398614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0375"
FT                   /product="asparaginyl-tRNA synthetase"
FT                   /note="KEGG: afw:Anae109_2720 asparaginyl-tRNA synthetase;
FT                   TIGRFAM: asparaginyl-tRNA synthetase; PFAM: tRNA synthetase
FT                   class II (D K and N); nucleic acid binding OB-fold
FT                   tRNA/helicase-type"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56518"
FT                   /db_xref="GOA:D5ED86"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED86"
FT                   /inference="protein motif:TFAM:TIGR00457"
FT                   /protein_id="ADE56518.1"
FT                   /translation="MSAPWIYIHNLAQHEGESVTIKGWMYNKRSSGKIHFLQLRDGTGT
FT                   VQGVMVKREVSEEAFENAKRLWLEASVEVEGTVRLDERAPSGVELTVTGLKVIQNPDEE
FT                   YPIGKKDHGIDFLLDNRHLWLRSSRQQAIMRIRERVIWAAREYLHNEGFMLIDSPILTG
FT                   SIGEGASGLFELDYFENDKAYLAQTGQLYAEAAAAAFGKVYCFGPTFRAEKSKTRRHLT
FT                   EFWMLEPEVAFYDHDLNIKLQENLVAYIVEHVLLHCKNELESLGRDLSKLEKVKPPFYR
FT                   ITYDKAIEMLHELGSSTPYGDDFGNEDETILTQQFDKPIFVECYPKKVKAFYMKEHPEN
FT                   PDLVLCDDLLAPEGYGEIIGGSQREDDMKRLIARIKEEGLNEKSYDWYLDLRKFGTFVH
FT                   SGFGMGIERVIAWICGLEHIREASPWPRTIYRIKP"
FT   gene            398899..400380
FT                   /locus_tag="Amico_0376"
FT   CDS_pept        398899..400380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0376"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   vsa:VSAL_I2699 AMP-binding enzyme, putative long chain
FT                   fatty acid Co-A ligase, acetyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56519"
FT                   /db_xref="GOA:D5ED87"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED87"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADE56519.1"
FT                   /translation="MEKNLGDVVKDFSREAPDRDYIWWNGEWWSRKRFQDTVESIEKVL
FT                   IEAGFKAGQRVVTLLPNCPLLLALSAACWRQQGAVVPLNMLAGPQSLARSIAHAEPFVI
FT                   VVSEGVTPLGMETLKKVAVPVIAGNLLGTLPSFSGICQTPCDEDVAVLFYTSGTTGLPK
FT                   AVPLTHGNIYSNIEAAAQHFSAFKPEECVMLNALPNFHTLGYSTSGLLPLLKGARQVVI
FT                   PSFMPPERALQAISAAGVNFIIGVPAMIALLVAAAAKGRIEVPRHISTIVSGGDRFPVS
FT                   LDERVRSTFGVNVMEGYGLTECSPVVAVNPDSLRRKIGTVGTFLPGFEYELRDENNNPV
FT                   PGKKEGILWLKGPSVVREYFRDPENTALKFQNGWFDTGDLVRIDDEGYVTIVDRVSDII
FT                   IVGGFNVYPQEVEEILTNYPGVKEAAVVGVSHSVSGQIVKAYIIRSNPDITIKELMSYC
FT                   KGQLAHYKVPRIYKFVDDFPRNSLGKVLRRQLREG"
FT   gene            400385..401428
FT                   /locus_tag="Amico_0377"
FT   CDS_pept        400385..401428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0377"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: gsu:GSU2085
FT                   ADP-heptose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56520"
FT                   /db_xref="GOA:D5ED88"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED88"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ADE56520.1"
FT                   /translation="MELLNILSNLFKNVHVVVIGDAMLDHYIWGGVSRLSPEAPVPIVV
FT                   VGKDEYRAGGAANVAVNIVALGGKVTLLSPIGADYAGNILLDAIKEKGVNVKTSLIRPH
FT                   VPTTVKTRVLALNQQVVRIDREKKISLTLNEEGDILGFLDAISPLPSIVVFSDYAKGTV
FT                   TSTLARNIIRWGDEHRVPVIADPKPPHCRRFRGATLITPNVAEAGKLIGRGLVDQEAIE
FT                   AGARELREKLSLKGVLVTQGSDGMTYASAQQTFHLPALSMEVYDVSGAGDTVVAAISLA
FT                   LGGDFPIEEACRFANMAAGMAVQKRGTSIVSLSEILTGCYARDMSEMALRLKSTFFDQI
FT                   EKKEPLR"
FT   gene            complement(401385..402233)
FT                   /locus_tag="Amico_0378"
FT   CDS_pept        complement(401385..402233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0378"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56521"
FT                   /db_xref="GOA:D5ED89"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED89"
FT                   /inference="protein motif:PFAM:PF00702"
FT                   /protein_id="ADE56521.1"
FT                   /translation="MPFTLEEKADLLIFDVDGVLIDTSLSFPMVVKDSIQWIWQNILNY
FT                   TMDGTGFTLDHFYAAKQHEAFNDDYDIAWAFLCAILSQETKNFKDAVPPVNQWERLLIR
FT                   CDGNNVTEWVIKEFGERISRSMVRRICEEFYFGSEDVMSITGRSPLFIKSSKGYWKREK
FT                   PQISCHWKKLPLPSGIYTGRSKDEMNLALSLLGWEDFPNERIVTPESGITKPSPKGIEF
FT                   LCSLFNASYPLYFGDAESDRKSLESFGKGVFIAIGPTLLGQEFTFSTTAEALSFLFGQK
FT                   R"
FT   gene            402327..403334
FT                   /locus_tag="Amico_0379"
FT   CDS_pept        402327..403334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0379"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56522"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED90"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56522.1"
FT                   /translation="MTGDAMVLLLFDRHHPCWDDEAVALMGEDPGSLKRLCDEGLLKRN
FT                   ETIYSLTPRGMEVFKEYCSQSFCESVPGESPDNSYGQAYLLWRTKFKNLLDQSFTARWG
FT                   VKEFHVDTYLEYAPALPKEELYHIDHPPHVTWTYDSHPAVERMKEDFPILGLKARDSTP
FT                   PSLEAIESWHSKNEVVKGSLYVDLLLLNRCDFAYYMHHPKHPNDVLGLVNADRFYCFRT
FT                   LPPFDQSCKKYIDIIGKIHLFLLNQRRLYIPGYVDVDSADQDSLNWVVWVVDTEKEAIS
FT                   MHGLLAPMGESLIGPAHPMDVWVISLEALRSVEKKYELIYDLFPNVAHPIVRSI"
FT   gene            403431..404825
FT                   /locus_tag="Amico_0380"
FT   CDS_pept        403431..404825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0380"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="KEGG: bxe:Bxe_B2934 GntR family transcriptional
FT                   regulator; PFAM: regulatory protein GntR HTH;
FT                   aminotransferase class I and II; SMART: regulatory protein
FT                   GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56523"
FT                   /db_xref="GOA:D5ED91"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED91"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADE56523.1"
FT                   /translation="MKGKIDMIEIPLDYDSDIPLYRQITFHLKKMIEKEALPPGLKLPG
FT                   SRQLAKDLGVGRVTVIEAYRLLADYGYVVERGRSGTYVAQRKTCNENREQKIETNWDLD
FT                   CVRPSSDLIPATELSRIARDVLAFWGPQALCEAPLAGLDTLRQVLVEHGASRGIPAFWK
FT                   DVFVTAGGRHGLALSLGALRRCGVEKMWVEELTYPDAIAIAQSEGLSIGILPPLEEIAE
FT                   TWYESLSGADVLYLVPSFQNPTGQTISVAVRQMILQGSIRYGFWILEDDAYGELRYGDT
FT                   SISALKAMDGADKVVYLGSFSQVLFPGLRIGYSLVPEQLEDSFICIQARKWGPVSSLDQ
FT                   LVVQKFIEGKGLESALELARGAIESRMKALTGALMEKLPKAQFLMPEGGIYLWLRLPGL
FT                   DGWDAAQKARKQGVLVTPGNIFSLDSKRVEAVRLSVCGVPSEHITSIVGCLDKAWNASL
FT                   FPLRHF"
FT   gene            complement(404835..405026)
FT                   /locus_tag="Amico_0381"
FT   CDS_pept        complement(404835..405026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56524"
FT                   /db_xref="GOA:D5ED92"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED92"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56524.1"
FT                   /translation="MRFGVLLLSITTLVLYGYALAGLGGFLWGKGNTFYICFGLLGGTA
FT                   SALLALWLWKKYLDSLTQ"
FT   gene            405227..405886
FT                   /locus_tag="Amico_0382"
FT   CDS_pept        405227..405886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0382"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: ara:Arad_8835 transcriptional regulator
FT                   (activator) protein; PFAM: GntR domain protein; regulatory
FT                   protein GntR HTH; SMART: regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56525"
FT                   /db_xref="GOA:D5ED93"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED93"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADE56525.1"
FT                   /translation="MREARLYTTSADYAYQELRHKIITKQLKPGQRLPEVNIAVQMGVS
FT                   RTPVREALRRLASEGLVIIIPNSGARLAAPTAREIEDTFLVRDQLETLAIRLAAERIGD
FT                   RHLRRLEEAMIEEGRAIEEKDLEKYLEVNEAFHKAIADASGNRVLAEYVENILARTNAY
FT                   IVFYDPFYQLETMPSIDAHREILVALRHHDAEKCVKLLRGHLQEAIMGLRKAREEA"
FT   gene            406066..407205
FT                   /locus_tag="Amico_0383"
FT   CDS_pept        406066..407205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0383"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /note="PFAM: DegT/DnrJ/EryC1/StrS aminotransferase;
FT                   aromatic amino acid beta-eliminating lyase/threonine
FT                   aldolase; aminotransferase class V; KEGG: dol:Dole_1884
FT                   DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56526"
FT                   /db_xref="GOA:D5ED94"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED94"
FT                   /inference="protein motif:PFAM:PF01041"
FT                   /protein_id="ADE56526.1"
FT                   /translation="MERKIPTLDLKRNYTRIKEEIQVALNEVLESQYFILGPSVKNFED
FT                   EVSSYLEGAQAISCASGSDALYLALMALGIKEGDEVITTPYSFFATVSCITRLGAKPVF
FT                   VDIDPCTYNFDLDQVREKLTPKTRAIIAVHLFGQMVPLEGIVEDLEERGIVIVEDAAQA
FT                   FGSWRKVSNDIKRAGAWGTMGCYSFFPTKNLGGYGDGGMVVSSNEALASRVKTLRVHGA
FT                   GTTYIHEEVGLNSRLDALQAAVLRVKLRHLDEWNEERRLVADRYKTLFAEYDLLDKIQP
FT                   PYELDGNYHIYHQYVPRVMQKREELSEYLATKGITTRVYYPLCLHLQQCFAFLNHKEGD
FT                   FPVAEGLSRESLALPIFPELTEDEQVYIASAIRDFFRQK"
FT   gene            407312..408007
FT                   /locus_tag="Amico_0384"
FT   CDS_pept        407312..408007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0384"
FT                   /product="peptidase membrane zinc metallopeptidase
FT                   putative"
FT                   /note="PFAM: peptidase membrane zinc metallopeptidase
FT                   putative; KEGG: tgr:Tgr7_3069 peptidase, membrane zinc
FT                   metallopeptidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56527"
FT                   /db_xref="GOA:D5ED95"
FT                   /db_xref="InterPro:IPR007395"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED95"
FT                   /inference="protein motif:PFAM:PF04298"
FT                   /protein_id="ADE56527.1"
FT                   /translation="MFPLFFDPTFVLLIPAVILAFWAQMKVKTAYSEYSRVLSRKGISG
FT                   AQAARALLDQFGMYNVPIQRVAGNLTDHYDPRDRTLHLSEGVFNSTSIAAIGVAAHEVG
FT                   HAVQHQKNYAPLKFRNAVVPVVGVGSSLAFPLFFLGLLFRGPLLMDIGILLFVGVIIFH
FT                   LVTLPVEFDASTRAVKLLGDTGILGSDEITGAKAVLNAAALTYVAAAVMAFAQLARLLF
FT                   LRGMFGHRD"
FT   gene            408102..408797
FT                   /locus_tag="Amico_0385"
FT   CDS_pept        408102..408797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56528"
FT                   /db_xref="GOA:D5ED96"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED96"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56528.1"
FT                   /translation="MPFLFLLLMFFIAPWLGMVALLFFLVFFIVLLPLGFAASSFMWLI
FT                   VGPTQLFRVLFNKKVRKNHALEHGTIHILEESLGQCNIEGMSYDNGFSLRGLVEPAAAL
FT                   YAARVALERMNRGESSLAIHPRCGTTVVVINTLSSLLFILLLLATGSLSLLNVIIALIA
FT                   AHVLGPVMSSVVQRYVTTDSDVQGLEITGIEVRAANRGFGGVYVYGPSQLFIRTRQKSN
FT                   VIEPEVLFS"
FT   gene            408794..410122
FT                   /locus_tag="Amico_0386"
FT   CDS_pept        408794..410122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0386"
FT                   /product="Fmu (Sun) domain protein"
FT                   /note="PFAM: Fmu (Sun) domain protein; KEGG: dal:Dalk_0554
FT                   sun protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56529"
FT                   /db_xref="GOA:D5ED97"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED97"
FT                   /inference="protein motif:PFAM:PF01189"
FT                   /protein_id="ADE56529.1"
FT                   /translation="MRGIEAALYVLTEVSKGRFASESLRKVSDRMTEGDRILASSLVYA
FT                   ALRRQTLWKKVCENFLRFPFDSLSWCTRHALVIGAAGIIELRHFAPMVLVSALVDEIKK
FT                   RGLEKEARIVNAVLHRVEERGKFIVDEMKKSSSFQDKALLGGIPLFVAYQWKDTWGQAE
FT                   TLKLINLFRIRPYASLRVLPKDHIPSLVKGLKQDHIYGWPSPLLECSVRTASFAFPPNL
FT                   PGFNEGKVTVQSESSMLAGEMVTRLWKDGLILDMCAGRGIKTGQIATLLPHAKIEAWEL
FT                   SKGRCAAARRELKRLSISQRVIIRQGDSLSMSPQSTPNLVFLDAPCSGSGTWSRHPESR
FT                   WALTKEKMEELVQLQKGLLRKAVDLVAPGGLILYSTCSLLRQENEQVIAEVLADNHNLI
FT                   EMSLPLSGRHVRKGRPWGTYIWPLLPWLDGFYMMAILKRNQEV"
FT   gene            410127..411296
FT                   /locus_tag="Amico_0387"
FT   CDS_pept        410127..411296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0387"
FT                   /product="PASTA domain containing protein"
FT                   /note="KEGG: dal:Dalk_0555 PASTA domain containing protein;
FT                   PFAM: PASTA domain containing protein; SMART: PASTA domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56530"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED98"
FT                   /inference="protein motif:PFAM:PF03793"
FT                   /protein_id="ADE56530.1"
FT                   /translation="MGRMYKWVMFLILLVIVVSGGMAVLTIWSGGKGLAVPPLKEMSVV
FT                   EAVDEAQRLGLKLKIEQIESTLPGGTVLSQWPEPGAKIKKDATVILKVSKGGNRIALPD
FT                   VRGLEYSQALKKLEESGFQAGDTLRVSDDTRAAGVVIAQSPSAPVMLESTRKIDLLVSQ
FT                   GQVSQNGLIQVPEVLQREEQIARKLVEESGLVVANVEYVYTQNSPEGMVISIRPKVGTS
FT                   LKRGQGVVLQVASLKKPPSQEKAEVSQAGTVLASAVSGTAEKVSGQTEATSKSQLPSGG
FT                   TLIPVKPPSSKPSTATAPVTKPSTQLAATPKSAPVPAGSKVAKIRYQVPPLTKQMPLKI
FT                   EIVDGSGTRVLLNREVKGGEYVSLEAPYIEEGVVTIFLGGEFVWQDRYR"
FT   gene            411275..412006
FT                   /locus_tag="Amico_0388"
FT   CDS_pept        411275..412006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0388"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="TIGRFAM: ribulose-phosphate 3-epimerase; KEGG:
FT                   dal:Dalk_0556 ribulose-phosphate 3-epimerase; PFAM:
FT                   ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56531"
FT                   /db_xref="GOA:D5ED99"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:D5ED99"
FT                   /inference="protein motif:TFAM:TIGR01163"
FT                   /protein_id="ADE56531.1"
FT                   /translation="MARSLPLEKEPGAFLVAPSLLSADILNMEKSITLLQGTHDWLHLD
FT                   IMDGHFVPNLSYGPGLAKALRSSYPSTVIDAHLMVVPPEDFIDAFAAAKPDYLTVHVEA
FT                   TPHLHRVLSRIRDLGCRPGVALNPATPVEWIYPVLPMVDLVLVMSVNPGFGGQSFISET
FT                   LQKTVDLYRHRVAHNLSFLIQMDGGIGRETIREVVSSGCDVVVMGSSIFGTPDPAETIR
FT                   ELRACVKGAVVGEKGTTPSNS"
FT   gene            411975..412859
FT                   /locus_tag="Amico_0389"
FT   CDS_pept        411975..412859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0389"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dds:Ddes_0913 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56532"
FT                   /db_xref="GOA:D5EDA0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR025194"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDA0"
FT                   /inference="protein motif:COG:COG1426"
FT                   /protein_id="ADE56532.1"
FT                   /translation="MKRERRQVTLEELGRAIKARREEKGLSLQNVADITKIRIHFIEYI
FT                   ENGHFEKFHGIVYARGFVRSVLKVIESEDLWEYYKPLLYDAPGRDEKESKLTGACTPPT
FT                   RGFKPASRFWVILILLFTVVGTGWYAWFSWKEGGLNIEQVAQGGGGNNGAIETSVVSED
FT                   IKSGDVKSEDLIVVFEGVVSPDAEKKILDDGEMAEETAEAPEPVPQFPTLEIEGTGACW
FT                   LKVRTKEATIHQGILEKGQKYTLEVKEEVTVTYGRASDVQVTWNGEELGRPGSGGRVVH
FT                   IFYSSDGKTGRVN"
FT   gene            412859..414148
FT                   /locus_tag="Amico_0390"
FT   CDS_pept        412859..414148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0390"
FT                   /product="MiaB-like tRNA modifying enzyme YliG"
FT                   /note="TIGRFAM: MiaB-like tRNA modifying enzyme YliG; RNA
FT                   modification enzyme, MiaB family; PFAM: Protein of unknown
FT                   function UPF0004 ; Radical SAM domain protein; KEGG:
FT                   gsu:GSU3205 MiaB-like tRNA modifying enzyme YliG; SMART:
FT                   Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56533"
FT                   /db_xref="GOA:D5EDA1"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="InterPro:IPR041582"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDA1"
FT                   /inference="protein motif:TFAM:TIGR01125"
FT                   /protein_id="ADE56533.1"
FT                   /translation="MNIYIISLGCAKNSVDSENLIGMLRAAGFRVVDSIDEAQVAIVNT
FT                   CGFIQPAVEENVDIILDLERLKEEGRLQKIGVVGCLVNRYGEELKKELPSVDIWSQAEE
FT                   WESVVRQLGAKPSNWQRGMLPGTRPWSRYLKVGEGCDSFCSYCTIPSIRGWARSYPIEV
FT                   LTSEASRLVEEGAREICLVGQDLTVYGRDVYGKPSLIALLDSLTASLPQEVWLRLLYLH
FT                   PARVDERFIDYISSSKSVLPYLDIPIQHVEGDLLRRMNRKENEESLRTLFGYIRKKNPL
FT                   FALRTTFIVGFPGETEEQFEKVLDFAEDMEIDRVGAFAYCAEEGTIAATLPGQLSSKIK
FT                   EERYNRLMELQSEISLRRQSLFVGRELTVLVETIDNEDNIAWGRSYRDAPEVDGLVGIM
FT                   EGAHLKEGAFVKVKITEAEEYDLLGVEVVS"
FT   gene            414145..414612
FT                   /locus_tag="Amico_0391"
FT   CDS_pept        414145..414612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0391"
FT                   /product="phosphatidylglycerophosphatase A"
FT                   /note="PFAM: phosphatidylglycerophosphatase A; KEGG:
FT                   dol:Dole_1265 phosphatidylglycerophosphatase A"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56534"
FT                   /db_xref="GOA:D5EDA2"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDA2"
FT                   /inference="protein motif:PFAM:PF04608"
FT                   /protein_id="ADE56534.1"
FT                   /translation="MKRNLSIAGKISTLAGLGFFTSMPGTLGSGVAFALYLLWAVPWWG
FT                   IIAVMLLGIWAADLYGKETCQKDPKEVVIDEVVGTWISMYGLPAGFWVPALFLFRIIDI
FT                   IKPIPVSTVEKLPGGLGIVADDVVGGIMTNLLLWGIYWLYCGGGLQILLGR"
FT   gene            414619..415848
FT                   /locus_tag="Amico_0392"
FT   CDS_pept        414619..415848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0392"
FT                   /product="competence/damage-inducible protein CinA"
FT                   /note="KEGG: gbm:Gbem_3628 competence/damage-inducible
FT                   protein CinA; TIGRFAM: competence/damage-inducible protein
FT                   CinA; PFAM: CinA domain protein; molybdopterin binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56535"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008135"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDA3"
FT                   /inference="protein motif:TFAM:TIGR00200"
FT                   /protein_id="ADE56535.1"
FT                   /translation="MKRAVLLAIGDELLSGSRRDINCSWLASKFADAGWEVRKIEFLPD
FT                   ENAPIVQALDHWAGQTEIVVLSGGLGPTHDDKTRQALADFLSVPLIIDHKAYNKIAERY
FT                   NPAEQEGIERSRSTQGAIPEGTTAVHNSKGSALGISFHHKQTVFFSFPGVPDEFQKMAE
FT                   ECVIPILQNEFAARRSFFVTGWAESLLKDHLASVFKRRDLHISILPSVNLIELALSGEE
FT                   SIVNEVASDILSLLPHDCLPSGCRSLPEAIYYEATKKNLSVSAAESCTGGMIGAALTGI
FT                   SGVSKVFYGSAVCYSNDAKKDLLAVPSFIIEKYGAVSSECAIVMAERAQKMFKTDIAIS
FT                   VTGIAGPDGATAEKPVGMVWFGLASSEHSCTFRKFFSGDRDRVRKRATAAALEYLWRSL
FT                   KGEEIVCPYS"
FT   gene            415833..416405
FT                   /locus_tag="Amico_0393"
FT   CDS_pept        415833..416405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0393"
FT                   /product="2'-5' RNA ligase"
FT                   /note="KEGG: sfu:Sfum_2529 2'-5' RNA ligase; TIGRFAM: 2'-5'
FT                   RNA ligase; PFAM: Phosphoesterase HXTX"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56536"
FT                   /db_xref="GOA:D5EDA4"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDA4"
FT                   /inference="protein motif:TFAM:TIGR02258"
FT                   /protein_id="ADE56536.1"
FT                   /translation="MSLFIRTFVCVELPEQHRRTLAVTLKSLKKNFSEIKWVSPQTLHL
FT                   TLKFCGEQSEDTIGCFSSYIKEELQLRRLDPFLITLGSAGAFPSLKRPRTLWIGVTEGG
FT                   DPLLSLVELVEKAGLRAGVEKEKRIFHPHLTLARIRPGTFVSPQLEEELGRQNFNSLSW
FT                   KVSSIVLMKSELRPEGAQHTPLETYSL"
FT   gene            416470..417582
FT                   /locus_tag="Amico_0394"
FT   CDS_pept        416470..417582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0394"
FT                   /product="recA protein"
FT                   /note="TIGRFAM: recA protein; PFAM: RecA domain protein;
FT                   KEGG: aeh:Mlg_1483 recombinase A; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56537"
FT                   /db_xref="GOA:D5EDA5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDA5"
FT                   /inference="protein motif:TFAM:TIGR02012"
FT                   /protein_id="ADE56537.1"
FT                   /translation="MAKKKNPQTREDILELAIDDIRSKFGEGSIMRLGDPFKVQVEVIS
FT                   TGILPLDVALGIGGLPKGRIVEIFGPEGSGKTTVALHGIAEAQKAGGIAAFIDAEHALD
FT                   PRLAASLGVDVQSLYVAQPDSGEQALYVLDTLVRSGAVDLVVVDSVAALTPQAEIDGKI
FT                   GDSQLGLQARLMSYALRRLTSAISRSNCVVVFINQLRAKISTGYSSGPQETTTGGRALK
FT                   FYSSVRVEVKRGKSINKGEDAIGHELWMKVVKNKQAPPFRTAHASLIYGKGVPKGMSLL
FT                   DMAIDLEVMKKKGSWLAYKGETIGQGKDNVAQYLEDHPELMEELTTEIMSKVAEGLGFV
FT                   LGEDEDDDGGNIEKEEDLPIEEGILELDEE"
FT   gene            417874..419393
FT                   /locus_tag="Amico_R0014"
FT   rRNA            417874..419393
FT                   /locus_tag="Amico_R0014"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            419522..422498
FT                   /locus_tag="Amico_R0015"
FT   rRNA            419522..422498
FT                   /locus_tag="Amico_R0015"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            422563..422677
FT                   /locus_tag="Amico_R0016"
FT   rRNA            422563..422677
FT                   /locus_tag="Amico_R0016"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            complement(422850..423638)
FT                   /locus_tag="Amico_0395"
FT   CDS_pept        complement(422850..423638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0395"
FT                   /product="Silent information regulator protein Sir2"
FT                   /note="PFAM: Silent information regulator protein Sir2;
FT                   KEGG: pca:Pcar_0631 Sir2 family NAD-dependent protein
FT                   deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56538"
FT                   /db_xref="GOA:D5EDA6"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDA6"
FT                   /inference="protein motif:PFAM:PF02146"
FT                   /protein_id="ADE56538.1"
FT                   /translation="MDKDFMFDVKRCAEVLLSSRKVVLLSGAGMSTNAGIPDFRGPNGI
FT                   YRKKMKTDPELIFDIDYFYQNPSFFYEFHREFLKTINEIQPTFSHYFFSNMEKGGLLKG
FT                   IITQNIDALHQKAGSEKVFEIHGSMWQSFCTRCGQEYDYKTSFHKVLKEKVPLCDICKG
FT                   VIKPDVVFFGENVKYLNECQTLIKNADILFVVGSSLTVTPAAYLPSMCSGKIVVINKGE
FT                   ISHDYLSPGRIFIHGKYDIDEFFNALEVELSNIEGNPKRK"
FT   gene            423758..425128
FT                   /locus_tag="Amico_0396"
FT   CDS_pept        423758..425128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0396"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; KEGG:
FT                   similar to predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56539"
FT                   /db_xref="GOA:D5EDA7"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDA7"
FT                   /inference="protein motif:PFAM:PF00860"
FT                   /protein_id="ADE56539.1"
FT                   /translation="MASKNLIYGVDDKPPFPIMVLAGFQHVLTLFGATTLVPLIFGPAM
FT                   GMTTAEIGFFISCVYLAMGIATLIQTHPRLGSGLPIVQGSSFSFIPPIMTIIAAYGAAG
FT                   PAAVMQHVGGALIAGGILLSIIGYSRIVGVIRKVITPIVIGPTIMAIGFSLAPVAIQGN
FT                   AANYWPISLIVVVCVFFFSLMSKNKYFNIFAILASISIAYLAALAGSLLGFFPSEHPAF
FT                   INLASVADAPWFRFTGIMPWGLPKFDILSFGAIIAGFFAVMIESIGDYHSCSYVAGLPD
FT                   PAPATINRGIGAEGLNCAIAGALGAVATTSYTENIGLIGLTGVASRWVVRTGAILLILM
FT                   SFVGKIGALIATIPSPVIGGAYIALFGIIGALGIQILLRADMTSQRNVLIVGFAFLMAL
FT                   GLPGWVEAQKDAFFSIGIIGQVLWAIMKTPMAVAGICAAFWDNVIPGTLKERGLSAQ"
FT   gene            425457..426737
FT                   /locus_tag="Amico_0397"
FT   CDS_pept        425457..426737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0397"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="KEGG: dde:Dde_0671 secretion protein HlyD; TIGRFAM:
FT                   efflux transporter, RND family, MFP subunit; PFAM:
FT                   secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56540"
FT                   /db_xref="GOA:D5EDA8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDA8"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ADE56540.1"
FT                   /translation="MRFKRLWGVAAILIVVGGFFLLSNRKEEQKEKVVEKIARPVKYIT
FT                   LSAPDVVLRRVFPGKVLASKTADLSFRVSGPLIELPVKKGEPINKGDLVAQIDPRDFKV
FT                   QLMNAQSALNNAKAQLSAMRAGARREEISALSSQVASAKAKLAEAEADYKRMERLFKEG
FT                   VVAQVDLERSKTTYEVAKGEVNAASQELQKAKSGARAEDIAAMEATIQGLESQVQAAQS
FT                   ALDDTELKAPFKGIIAARYVDNFQSVQKDQPIVSLQNLEEVEIVISIPEQDIMKFRLNT
FT                   SLGVSSSFEAAPNTQYSLVFKEISTEADPQTQTYAVTFTMPYPKDIVVLPGMTANVEFT
FT                   GQNGAHEVKGFAVPSIAVVPGEGTTHFLWIINEETMTVHKVEVYIHSYQGDMVIVGGNI
FT                   TVGNRVVTAGVNYLAEGDPVTFLSPNE"
FT   gene            426747..429791
FT                   /locus_tag="Amico_0398"
FT   CDS_pept        426747..429791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0398"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   vsp:VS_1986 cation/multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56541"
FT                   /db_xref="GOA:D5EDA9"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDA9"
FT                   /inference="protein motif:PFAM:PF00873"
FT                   /protein_id="ADE56541.1"
FT                   /translation="MNIAEYSIQKRYVTWFFTVFLIIGGVFAYKGLGKLEDPAFTIKTA
FT                   VVTTAYPGATPKEVEEEVTEVIERAAQQMGQVDKVRSLSQEGVSLVYVDIKDTYTAKDL
FT                   PQIWDELRRKINDVQEHLPPGTSRSLVNDDYGDVYGVYFALTGEGYSYRELEDFADYLR
FT                   RELLLVPGVASVEVTGIQKEAIYVEISRTKLSQLGISMGELFQVLKAQNFVVPSGKVRA
FT                   GAEYIRITPTGEFSSVEQVGALLLASSSRVLIRLDDIATVTRNYIEPTRAIMRYNGSPA
FT                   VGIGISNVEGGNVIAMGEAIKKRLKELEPQTPIGMNLGLIYYQSDTVQKAINNFLLNLL
FT                   EALSIVIAILLIFMGFRSGMLIGGVLLLTIFATFIAMKLVRIDLHSISLGALIVALGML
FT                   VDNAIVVADGLLVRIQSGEDRISSAVGVVTQTQWPLLGATFIAVIAFAPIGLSPDSTGE
FT                   FCQSLFQVVGISLIISWVLAVTVTPVAGVRFLKTSAKAEIPYDTKLYRVYRRFLKACIR
FT                   KRKVTILVMVCLLGSALIGFTFVDQSFFPSSSSPLFTVEFWRPRGAYIEETQREVEKVE
FT                   AFILKQPETVSVASYVGQGALRFILTYTPSDSSDSYGHLIVEAKDLKSAESLRRKLGNF
FT                   MNIEMPDIDPRVRSFSKGTGGGAKIQARFTGDDPRVLRRLGEEAFYMMRNAPDSMNIRS
FT                   DWGERVKVIRPVLDEVRTRQAGLTRQDVASALEMSFSGIQAGLYRERDKLLPIIARLPK
FT                   ADRARLGALPEVEVWSPLMRKYIALTQITKSIDTIAEDPVIYRRNRMRTFSVECDSRSG
FT                   KTGLLFARIKPELENISLPLGYSLSRGGEYESSQKAQGGLVGMIPIAFLAMVAILVVLF
FT                   NGFKQPIMILLCLPLSIIGVTAGLLLFHKSFDFMALLGFLSLAGMLIKNAIVLIDQIDL
FT                   EIREGKEGFSAIVDSAMSRARPVLMAAITTVLGMIPLYFDILFSALAVTIMFGLAFATV
FT                   LTLIIVPVLYSVFLKIPVFKDENVR"
FT   gene            429975..430340
FT                   /locus_tag="Amico_0399"
FT   CDS_pept        429975..430340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0399"
FT                   /product="desulfoferrodoxin"
FT                   /note="KEGG: sfu:Sfum_3891 desulfoferrodoxin; TIGRFAM:
FT                   desulfoferrodoxin; PFAM: Desulfoferrodoxin ferrous
FT                   iron-binding region; Desulfoferrodoxin Dfx domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56542"
FT                   /db_xref="GOA:D5EDB0"
FT                   /db_xref="InterPro:IPR002742"
FT                   /db_xref="InterPro:IPR004462"
FT                   /db_xref="InterPro:IPR004793"
FT                   /db_xref="InterPro:IPR036073"
FT                   /db_xref="InterPro:IPR038094"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDB0"
FT                   /inference="protein motif:TFAM:TIGR00320"
FT                   /protein_id="ADE56542.1"
FT                   /translation="MTKRLEVYKCDLCGNVVEVLHAGAGQLVCCNQPMKLLEEQTADAS
FT                   TEKHVPVIEGSKVKVGSVPHPMKPEHYIEWIEVISGDKIYRQFLNPGDAPEAEFHEITP
FT                   ELSREYCNIHGLWKAGK"
FT   gene            430344..430862
FT                   /locus_tag="Amico_0400"
FT   CDS_pept        430344..430862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0400"
FT                   /product="Ferroxidase"
FT                   /EC_number="1.16.3.1"
FT                   /note="KEGG: dma:DMR_17620 ferritin; PFAM: Ferritin Dps
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56543"
FT                   /db_xref="GOA:D5EDB1"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR041719"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDB1"
FT                   /inference="protein motif:PRIAM:1.16.3.1"
FT                   /protein_id="ADE56543.1"
FT                   /translation="MISKKMQDAINDQINAELYSGYLYLAMAAYFEEQNLMGMANWMHV
FT                   QAFEEQTHAMKFYHYVVERGGRVKLQAIAEPPFEWKSPMDVFKGALDHERYVTRRINDL
FT                   VDLAIEERDHASQIFLQWYVTEQVEEEAHAEEIIHKLEFVSDSKHGLYMLDKELGARGQ
FT                   TPFSTESED"
FT   gene            430960..431484
FT                   /locus_tag="Amico_0401"
FT   CDS_pept        430960..431484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0401"
FT                   /product="flavin reductase domain protein FMN-binding
FT                   protein"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: sat:SYN_02123 ferric-chelate reductase / rubredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56544"
FT                   /db_xref="GOA:D5EDB2"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDB2"
FT                   /inference="protein motif:PFAM:PF01613"
FT                   /protein_id="ADE56544.1"
FT                   /translation="MNSIDPRALFSLSYGVYILSTEFEGKKNGQIINALIQVTSDPICI
FT                   AACLHKDNYTTELVEKSRRFSVSVLEESVPLKFIGIFGFHCGRDFDKFNACSYITGSTG
FT                   LPVVTDFTLASVEAKVLSVIDVYTHKLFIAQVEAAKALKEGKPLLYADYHSIKKGKSPE
FT                   KAPSSIFNVLK"
FT   gene            431526..432734
FT                   /locus_tag="Amico_0402"
FT   CDS_pept        431526..432734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0402"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein;
FT                   flavodoxin/nitric oxide synthase; KEGG: sfu:Sfum_3253
FT                   flavodoxin/nitric oxide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56545"
FT                   /db_xref="GOA:D5EDB3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR016440"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDB3"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ADE56545.1"
FT                   /translation="MIPLEIKPGVFWTGVLDWTLRDFHGYSTEKGSTYNAYIVKGCDKV
FT                   ALFDTVKTTHYEEFIERIEEVTNLEEIDYIIVSHAEMDHSGSLPMVVDRVRPEKIFLSK
FT                   PCKDALIEHFGDIVKSWPLHVVATGDEISLGGKTVSFIEARMLHWPDSMFSYIKEDRLL
FT                   ISNDGFGQHYSTSARFDDEAEWGELMDQTAKYYANILLPYSSLMLKKLDEIAGMNIEID
FT                   MIAPDHGIIWRSRVPEVLSAYRRWAEGLCKDKAVVAYDTMWHSTETMARYVAEGLMNKG
FT                   IETVVMDLRVVHHSDVMTEILEGRGLVLGSPTLNTGFLPRMADLICYAKGLRPINKVGA
FT                   AFGSYGWAGESVRLLNQELEAMKIKIAHPGIKVKYVPRKEDLKECYAMGEAIAEKIYET
FT                   NKI"
FT   gene            432715..433584
FT                   /locus_tag="Amico_0403"
FT   CDS_pept        432715..433584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0403"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   sfu:Sfum_0347 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56546"
FT                   /db_xref="InterPro:IPR014127"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDB4"
FT                   /inference="protein motif:PFAM:PF09674"
FT                   /protein_id="ADE56546.1"
FT                   /translation="MKQTKYKTVAPAFGGPFSPECYRQVLEEIYITYTRPDLIHPDPVE
FT                   FPRRYSDKVDREIAALIASSLAYGRVQQIHRSVERVLSPMEHAPGSFLLSASQDALEEL
FT                   YYDFRHRFTSGRELISFLKGVKRLLIRFGSLEECLAHCIAAQNERNVFKGITAFAENLK
FT                   EAAGGASSLLASPADGSACKRFFLFLKWMVRHDSVDPGGWTVLLPKDICVPVDTHMHKI
FT                   GRSLNFTIRKQADLKTVMEITRAFQIISPLDPARYDFALTRFGIRAELEISDLIKRCSD
FT                   GVSIHHQG"
FT   gene            complement(433565..434430)
FT                   /pseudo
FT                   /locus_tag="Amico_0404"
FT   gene            complement(434455..435741)
FT                   /locus_tag="Amico_0405"
FT   CDS_pept        complement(434455..435741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0405"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   dal:Dalk_1952 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56547"
FT                   /db_xref="GOA:D5EDB5"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR024671"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDB5"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADE56547.1"
FT                   /translation="MEKFRLIIPRDRKVASWCLYDVGNSAFATTIMAAVLPVYFREIAA
FT                   PFLKGSLPTAFWGYTSASALLCCAVAAPFLGAIGDMVRKKKMMLTIFTLLGVLASAGLF
FT                   FVDYGHWQSALVLMALGTIGFSASMIFYDSLLPHIVPLDQVDMVSSQGYAFGYLGGGVL
FT                   LAINLAMIWLLPGTLGPRLSFLSVALWWGAFSLPILIFIPEPPAKTLLVRRRKSIAGEA
FT                   ILRLRETFSEIRQYQDLFRFLVAFWFYNDGVGTMIRMAAIYGANVGISMAHLVGALLLT
FT                   QFVGVPFSLFFGRLAARIGSKKTILMGLAGYTAISFGAFFLSQAWHFWILAFAVGTVQG
FT                   GTQAMSRSLYASLLPPSRSAEFFGFYDISSKFAGVIGPAIFGLITHITGSSRMGVAVVA
FT                   TTFIVGGLLLIKVDVHRGIKNVSQQNSLQ"
FT   gene            435870..436376
FT                   /locus_tag="Amico_0406"
FT   CDS_pept        435870..436376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0406"
FT                   /product="CMP/dCMP deaminase zinc-binding protein"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   gur:Gura_2185 dCMP deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56548"
FT                   /db_xref="GOA:D5EDB6"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="InterPro:IPR035105"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDB6"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ADE56548.1"
FT                   /translation="MTFIRPDWDSYFMMIAAVAATRGTCLRRKVGAVIVRDLQIISTGY
FT                   NGAPKGLPHCSEVGCLRDKLGIPSGERHEICRGSHAEINAIAQAAAVGTRTEGAVLYCT
FT                   HEPCSFCTKAIINAGIRRIVFVYPYPDALASEMRSQASLEVCQLSEKVFQEMDLALKAF
FT                   LQQRG"
FT   gene            436399..436974
FT                   /locus_tag="Amico_0407"
FT   CDS_pept        436399..436974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0407"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="TIGRFAM: metal dependent phophohydrolase; KEGG:
FT                   gbm:Gbem_0692 metal dependent phophohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56549"
FT                   /db_xref="GOA:D5EDB7"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDB7"
FT                   /inference="protein motif:TFAM:TIGR00277"
FT                   /protein_id="ADE56549.1"
FT                   /translation="MKFTREQALAHLREYNKDESHIKHALAVEAAMKYFARQSQEDEEK
FT                   WGIVGLLHDIDWEHTEQAPEKHTHLAALWLKEKGYADDIIRAVQAHGWGLTSDVEPHTL
FT                   MEKTLFAVDELTGLIIAAALVRPSKSLQDLQVKSVKKKWKDKAFARGVDRDVIQKGVDM
FT                   LDMSLDEMIDGVLEALRPIEEELGLGIE"
FT   gene            437066..437701
FT                   /locus_tag="Amico_0408"
FT   CDS_pept        437066..437701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0408"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="KEGG: scl:sce5431 two-component system response
FT                   regulator; PFAM: response regulator receiver; regulatory
FT                   protein LuxR; Bacterio-opsin activator HTH domain protein;
FT                   SMART: response regulator receiver; regulatory protein
FT                   LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56550"
FT                   /db_xref="GOA:D5EDB8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDB8"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADE56550.1"
FT                   /translation="MTIRVVLADDHPLTRAGLSAYLQQENSIELVGEAEDGEKAWELIV
FT                   DLKPDVALLDIRMPGEDGVSIARRIKEEKLPVIPVMLTSYDAHQYVVASLRAGARGFIL
FT                   KTSTPQDLIRAIQTVVQGGLYLDSEVATVVGDRELVPESLSAREREVLVLASKGLSSKE
FT                   VAAELFISERTVQTHLASIYDKLGARNKTEALLLALKYGVVTLEELLE"
FT   gene            437698..439110
FT                   /locus_tag="Amico_0409"
FT   CDS_pept        437698..439110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0409"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: pfs:PFLU2939 putative two-component system
FT                   sensor kinase; PFAM: ATP-binding region ATPase domain
FT                   protein; histidine kinase dimerisation and phosphoacceptor
FT                   region; histidine kinase HAMP region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56551"
FT                   /db_xref="GOA:D5EDB9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDB9"
FT                   /inference="protein motif:PRIAM:2.7.13.3"
FT                   /protein_id="ADE56551.1"
FT                   /translation="MRRHLLLVLVLAVTLPTMAVLIVSSFAMIHQEWAMEAVTRSYVED
FT                   LAENVASWLNLDTPMWGGDSFASLIKKLRVFSWGPSLPGWVAVVTADGKILMASPGVSN
FT                   LAAIWDPRIPIGKAVEVRDRKGDRYTIAVYPLDGGNHLVIAAVAWRQLIGPMLRFGHIW
FT                   PVLIVLMTLTSLIAVWAMWRWLILPLKKMVTEVDILAWGKELPEADDPQAVFELGRLRR
FT                   ALYRLAKTAIERDDLRNRYVHDVVSVQEEEKKRIARDIHDGPLQDITAMIQQMRLFNMN
FT                   HHCPPKESRHLKLAEEAAQIAVRDLRELCDELSPPWLDLGLEHALTELADRLARHNGIE
FT                   ITVEVEEQLFMPSEVVLAFFRIFQEAVSNAVRHGKATEVHGDVSLIDSSTVSFEIRDNG
FT                   KGFEPYKSYEELRIQGHRGLANIMERLTTLHGEFEVKSAPGKGAVLRCLVPIPKDNEEN
FT                   QEGRQPRSGRTK"
FT   gene            439107..440717
FT                   /locus_tag="Amico_0410"
FT   CDS_pept        439107..440717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0410"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; RNA-
FT                   metabolising metallo-beta-lactamase; KEGG: dal:Dalk_2789
FT                   RNA-metabolising metallo-beta- lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56552"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDC0"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ADE56552.1"
FT                   /translation="MRLKVLGAAGEVTGSNYLIECGTSRILVDCGIYQGKGDDEKNRAQ
FT                   FDFVPSSLNAVVLTHAHMDHSGRVPLLVQQGFKGKVWATLPTVELVNVLWQDSVRLMKE
FT                   EAEWKTRKNERKGLPPVEPLYREEDAQKAAQLLTAATYDDKIEVAPGISVRFRDAGHIL
FT                   GSAIIEIWAQEDGKEVKIVFSGDLGPQETVMERNPAIISRADYVVIESTYGDRLHKSNK
FT                   ETREEFRQVIAHALKSRAKVMIPTFVVDRAQRLLYELMLLQKDGILRNNIPIFFDSPMG
FT                   VKATEIYNKHLSLFSREIQQHVKEGYDPFTPEQLHYVESVADSRRINDIKHAIVMAGSG
FT                   MCNGGRIVHHLKHGVWDPSNRIIFVGYQAKGTLGRRMVDGEKTLRIAGEEVTVNAQLHT
FT                   INGFSAHGDRDDLLTWADNFETDPVFFVTHGEPKSSQALALALQKKNHRAVVPIAGEEF
FT                   ELTPQKDITTSVIAPVYLEKRGYEELNTLLSNISGLAASIRTKTDSVENPDLLVPLLES
FT                   TIILLETASQKAGVVEEKE"
FT   gene            440801..442282
FT                   /locus_tag="Amico_0411"
FT   CDS_pept        440801..442282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56553"
FT                   /db_xref="GOA:D5EDC1"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDC1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56553.1"
FT                   /translation="MRKGLFFWGGFILCFAIIGLAIFFMGKQPEQRAITEPIPIPEPSA
FT                   PYVYLEGKGDVFDFDLPEELVKETSQARPFLLAVQGFSPVLSYSQQGASLITWESNQPH
FT                   LYGSALFSLATTQSLEKGEFPQEWKEIEEQISITKEEDGSVVLMGSSGMPPLYVHIDGG
FT                   LTLLSTSREGLNLMKDVLNNTKDKLDMSWKVSADWASHFRFYDGGIFSQLLSLDGVEVS
FT                   LVPFTFDAAWNENEEKGELRWKTTGIEGVIPAPILERLSPIRWDNRIVVPEPLMLAGGL
FT                   NVPDVAHMDIEQDLTEEIPEGFPFSSEEILELLKGPLCVTVGGSSKFIFFSLPGILLQL
FT                   PDRGVAGVKLVNEFWSQEWRVLVPSIQGLEGFHAGGTSDVPLTVVGAAREDLAIFGVMQ
FT                   KDEIQVEKKISSTVPALKNNSEAFAWLYAHGARLADAFDVVARASAMASKLGSDIGVNV
FT                   EELARGAEKIRNIGEISLVMPSINEGYIRWTAPEL"
FT   gene            442321..443604
FT                   /locus_tag="Amico_0412"
FT   CDS_pept        442321..443604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0412"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="TIGRFAM: tyrosyl-tRNA synthetase; KEGG:
FT                   acp:A2cp1_1171 tyrosyl-tRNA synthetase; PFAM:
FT                   aminoacyl-tRNA synthetase class Ib; RNA- binding S4 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56554"
FT                   /db_xref="GOA:D5EDC2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDC2"
FT                   /inference="protein motif:TFAM:TIGR00234"
FT                   /protein_id="ADE56554.1"
FT                   /translation="MVNAFRALQERGLVEWCSHPEELDEFFEKEEMITAYIGFDPTADS
FT                   LHVGHLIPIMTLSWLQRMGHRPICLAGGGTGMIGDPSGKSKERNLLSPEAVRENIRGVR
FT                   NQLEHFMNFNCGKNSALIVNNYDWLKDISFLDFLREVGKFFTINYMVNKEHVKSRLNDP
FT                   EKSISYTEFSYTLLQAYDFMHLLEKYGCKIQMGGNDQQGNIVSGIDLIRKRKGDQAYGW
FT                   TNPLLLTSSGTKFGKTEGGAVWLDPKRTSPYRFYQFWINTEDEMVEKLLKFFTFLPLEE
FT                   IEEIMSKHLAAPEKREAQKRLAWEVTSLVHSPHAADTVARASEILFGGEITHEDMSEEM
FT                   MEMLAEEVPYGTISTALPRSLVDVLVSVEACKSKGEARRLIRGGGVYVNGDRIEDENGT
FT                   IEKTLLIGGRHLFVRLGKKRFNLIEIKE"
FT   gene            443667..444608
FT                   /locus_tag="Amico_0413"
FT   CDS_pept        443667..444608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0413"
FT                   /product="lipid A biosynthesis acyltransferase"
FT                   /note="PFAM: lipid A biosynthesis acyltransferase; KEGG:
FT                   acp:A2cp1_2793 lipid A biosynthesis acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56555"
FT                   /db_xref="GOA:D5EDC3"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDC3"
FT                   /inference="protein motif:PFAM:PF03279"
FT                   /protein_id="ADE56555.1"
FT                   /translation="MDLFEGLRYEAPFRFFCFLFFMRTVYKVSAGSFLLQIFQKFVAPG
FT                   WRASLSAAIFDNLLCLIGPRKKVALENMKNTVFPDSEEWRQKTLAGVYRHIAWMLAEYL
FT                   VLVKDPSSVLDWVVEVEGEHILEQLVQEKKGAIILTGHLGNWELLAAWLCQKGYPLYAV
FT                   VRDPDDKDVAKLIESYRCRVGLRTLKKKSIMKESVRLAQNGAFLGLLSDQDGGHTGLPS
FT                   LFLGKECSTVNGPAAISLMAHVPIVPVISYRIAPFRHQIIISSPLTFSGVGKKKEQLEG
FT                   MTRSVDMTLEKMVIRHPEQWLWLHRRWRSRFP"
FT   gene            444658..445578
FT                   /locus_tag="Amico_0414"
FT   CDS_pept        444658..445578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0414"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56556"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDC4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56556.1"
FT                   /translation="MIYELMSSGNIVRLPDAMAVPGLPKTKAPIVVVLLPYNRILIGTS
FT                   SYLNGEKWEWGKIGEERRAEVFLYQNQSLTLAVEGFHSIFLNDEVVSELRKSLLSQLEL
FT                   PGDHMSTILILKRLLRNDVADIMSGETLKDEQFVLDLIERDLSVKQAYWGIRFALARND
FT                   YASVARIKTWIKSVGNLFDEVGQAMQMWFSLTDLPGGKEMAELEGLSFTLDDLQRMNSQ
FT                   RSRPVVLFSRTGYLVLSEQSLEKSETIFRIWLFLPLHLWNELREKRKLSIREIVSASWG
FT                   YIDARDAMREMEYYGKKTQTTTSPN"
FT   gene            complement(445621..446274)
FT                   /locus_tag="Amico_0415"
FT   CDS_pept        complement(445621..446274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0415"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="KEGG: reh:H16_A0046 ABC transporter permease;
FT                   TIGRFAM: polar amino acid ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56557"
FT                   /db_xref="GOA:D5EDC5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDC5"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ADE56557.1"
FT                   /translation="MMLDFSSIVPYWHMFVTGAVFTVKASILAVTLGSIMGILIGALRV
FT                   VPVKPIKGLAAAYIYVIRGTPLLIQLFLIYFGLPSLGINLPAFTAGIIGLSINSAGYVG
FT                   EIVRGGIEAVPKGQWEAAKVLGLSYLGTMRHIILPQAIRNMLPALGNEFVTLIKESSLL
FT                   STLAIAELTMVGQQVRSVTYASFETFIMVGLIYLCLTSFTSIALQLIEKRWQVH"
FT   gene            complement(446276..447052)
FT                   /locus_tag="Amico_0416"
FT   CDS_pept        complement(446276..447052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0416"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: dvu:DVU0105 glutamine ABC transporter, ATP-
FT                   binding protein; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56558"
FT                   /db_xref="GOA:D5EDC6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDC6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADE56558.1"
FT                   /translation="MQSAIEVKNLHKSFGNLHVLQGVSMTVGEGEVVSVIGPSGSGKST
FT                   LARCICRLEDINDGEIYLYGQRVDNGKHSNKEVATLVGMIFQQFNLFPHLSVLDNITLC
FT                   PIQAKGMKKKEAEDLAIRLLERVGLGDKVYAKPSQLSGGQQQRVAIARALAMQPKIMLF
FT                   DEPTSALDPELVGEVLEVIAQLAETGMTMVIITHEMLFAKDVSDRIIFMADGNIVEQGS
FT                   PQDIMVKPAHPRTQAFLQRMLVHFGEDLTKEEGGAC"
FT   gene            complement(447257..447388)
FT                   /locus_tag="Amico_0417"
FT   CDS_pept        complement(447257..447388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0417"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56559"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDC7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56559.1"
FT                   /translation="MEMKKAKESSKSIRAKHLNDQSDSFSNEMSDLNQELYRCRYDS"
FT   gene            447530..448417
FT                   /locus_tag="Amico_0418"
FT   CDS_pept        447530..448417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0418"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   gsu:GSU1210 metallo-beta-lactamase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56560"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDC8"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ADE56560.1"
FT                   /translation="MEIKILKGQSCYIPGRVNVGLWKDGKDGCFLIDSGGDETSGRRLF
FT                   RLIQENNLKLRGILNTHSNADHVGGNAYLQKKTACPIWASSIEDTVIQNPFLEPMLLWG
FT                   AAPFRALTGKFLQAAPSLVTQILSPGERVPDTDLTVLALPGHFINMIGFLSADGVCYIA
FT                   DSLFAKEVIEKYRFMVAFDVEATLATLDMLEKLEAAWFVPCHAEPVEDIRPLVNENRKG
FT                   IEALSHAVHDLCSVPRSREEILALLVQKWDLEMNPVQYVLNSSSLSAYLTFLEKKGLIV
FT                   PFVEKGNLLWQKKH"
FT   gene            complement(448452..449837)
FT                   /locus_tag="Amico_0419"
FT   CDS_pept        complement(448452..449837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0419"
FT                   /product="Phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /note="KEGG: afw:Anae109_0166 phosphomannomutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; phosphoglucomutase/phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56561"
FT                   /db_xref="GOA:D5EDC9"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDC9"
FT                   /inference="protein motif:PRIAM:5.4.2.8"
FT                   /protein_id="ADE56561.1"
FT                   /translation="MQVPKHIFREYDIRGIADTELTEKTVTAIGKAYGTFLYREGITSI
FT                   TVGGDVRLSTDRIKKNVIDGVTWAGIHVTDIGVATSPLLYWSQFRFNFDGGIMVTGSHN
FT                   PKDMNGLKLAYGKSTMYGEQIQLILSMIEKDDFEKGPAPGTIKKANIWEEYIAMLLSKI
FT                   KLGPRKLKVAADAGNGTAGLYIQTFLEKLGCEVVPLFCEPDGTFPNHHPDPLKRENLTF
FT                   LIEKVRQEKADLGIAFDGDADRIGVVDEKGTVIWGDTLMGLYWREILPKYPGAVAIIEV
FT                   KCSQALEDEILRLGGKPLYYKAGHSLIKAKMKEVDALFAGELSGHMFFADEFYGFDDSF
FT                   YAAGRLLRILSNDARSLSEMLVDYPVYYSTAEIRVDCPDEKKFQVIEKIKEEALKDHDA
FT                   ITIDGVRILYDRRGWGLVRASNTQPVLVTRCEGKTQEDLDHITRDMKQRMLDVGIPDFE
FT                   WTY"
FT   gene            449949..450878
FT                   /locus_tag="Amico_0420"
FT   CDS_pept        449949..450878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0420"
FT                   /product="Auxin Efflux Carrier"
FT                   /note="PFAM: Auxin Efflux Carrier; KEGG: rlt:Rleg2_4086
FT                   auxin efflux carrier"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56562"
FT                   /db_xref="GOA:D5EDD0"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDD0"
FT                   /inference="protein motif:PFAM:PF03547"
FT                   /protein_id="ADE56562.1"
FT                   /translation="MGSFFIVLPIVIIVGIGWFIRNKGLVREEAFAGMNFILYWVALPA
FT                   LLFRVTYNADVGILSGGNFVKAVYVSLMIAPPMALIFGRFVGLKKERLAVLTMVSIRSN
FT                   NIFMGVPAVSVALGEAGLQALSLYLAVVMAGYQLISIAWGQIVLSGSFRISALKDAFKK
FT                   IFTNPLIMACIAGIIFALAGTGPMPRWIDEALKALGNVGNGLALLALGASLNLTRVGAS
FT                   LKETWETLLFKLVIFPSIVWLFLLLWPVDPILFQTTVLVSSMPIAVNSYIVAKGMGMDP
FT                   AYTAESIAASTLCSIVTIPLWATVLGLS"
FT   gene            complement(450888..452084)
FT                   /locus_tag="Amico_0421"
FT   CDS_pept        complement(450888..452084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0421"
FT                   /product="YibE/F family protein"
FT                   /note="PFAM: YibE/F family protein; KEGG: sse:Ssed_2695
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56563"
FT                   /db_xref="GOA:D5EDD1"
FT                   /db_xref="InterPro:IPR012507"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDD1"
FT                   /inference="protein motif:PFAM:PF07907"
FT                   /protein_id="ADE56563.1"
FT                   /translation="MKKPQSVKNYILASLSVVIIALIAALSFHKMVLKSWNTEDSVIVS
FT                   IDRVGKVRGTETPLPFNNSTAEREKASPETEESPWETEYIDITVTFLNGEKKGESEDIL
FT                   ITQLSTSSLKLTEGRRYLLVCDRFEDGTLQYSISDRYRIPWVIAFLILASGGLIASAGK
FT                   AGFRALAGLLLSLAVLLGWYVPALAKGVAPIPFAILTIGAVSIITVLLVVRRPAFWIVA
FT                   FLGALGGAIAASTVGWIIVKTWQLTGLASDSASLLASTIPNLSMEGLLLAAVMIGAIGA
FT                   VLDVAVSVTSTLAELFSYDSHIESHRLWQAGIGVGREVLGSMINTLILAYLGSSLPFTI
FT                   LISYAGIDAMALLNDPYIAQELLRSVAGTIGLLLTIPITTGVCVWWLDFRLRSKKSAG"
FT   gene            complement(452062..452802)
FT                   /locus_tag="Amico_0422"
FT   CDS_pept        complement(452062..452802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0422"
FT                   /product="GntR domain protein"
FT                   /note="KEGG: gem:GM21_1321 regulatory protein GntR HTH;
FT                   PFAM: GntR domain protein; regulatory protein GntR HTH;
FT                   SMART: regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56564"
FT                   /db_xref="GOA:D5EDD2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDD2"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADE56564.1"
FT                   /translation="MTGKKTTKNRSVKIYEHVAEEIKELITRGEISQGDPLPPERQLIE
FT                   DLNVSRSSLREAFRILELVGLIESIPGKGRFVRKSRFDTQNMRMPLQDEAILELVEARM
FT                   ILEPAIVSEAVKHATPTDLTRIRKILTLTSKDVESLEHRAQCDYDFHLLLAEATHNFVF
FT                   VNIVKMTFNLIMETHERIYSLLDDKEIFLKEHKEIYQCILARDIKKAQRFMTNHVARVY
FT                   KTLLDGIALGEEGRLLHNEETSKR"
FT   gene            452924..454567
FT                   /locus_tag="Amico_0423"
FT   CDS_pept        452924..454567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0423"
FT                   /product="phosphoribulokinase/uridine kinase"
FT                   /note="KEGG: afw:Anae109_3852 cyclic nucleotide-binding
FT                   protein; PFAM: phosphoribulokinase/uridine kinase; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56565"
FT                   /db_xref="GOA:D5EDD3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDD3"
FT                   /inference="protein motif:PFAM:PF00485"
FT                   /protein_id="ADE56565.1"
FT                   /translation="MSFQINIRNYHTCECSSAMSGKDVLSKADIDGGSHIVAWRVNSYL
FT                   RPLGWVVDEDSEVEFVDTSSFEGMEVYRRSLSFSLVLAAQRALGKNVTIKHSISDGYYW
FT                   ELPDRDLTEEEVLRINKALRDLVNRDVPITREVVPLDKARRIFERQGNPESARLFMWAA
FT                   EDPVELYRCEDNYGFYYAPLAPSTGYLRVFELKYFPPGMVLQFPTVSYPDRLPPFRASK
FT                   KLSGVFLDYAKWLEILGLKTMDSFHAKIAQGKGLELVLISEAFHSQRLSRIAEDVALRE
FT                   KTKVIVIAGPSGSGKTTTAKRLKIQLQVCGLNPTVISLDNYFVDREKTPLDEQGNYDFE
FT                   VLEAIDLDLLESQLAKLLKGEEVRVPEFDFIKGKKFPGATLRLNKHDVLIIEGIHGLNE
FT                   KVTAVVPEEMKFGIFVSPLTGINLDEHNRTSTTDNRLLRRMIRDYRTRGHSAERTLDLW
FT                   PSVIKGAREYIFPYQSSAVAMFNSSLPYELAVLRGYAQPLLQTVPESSSMHGEARRLLS
FT                   MLKFVPPLPSENVPSNSILREFIGGGCYEH"
FT   gene            454604..455437
FT                   /locus_tag="Amico_0424"
FT   CDS_pept        454604..455437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0424"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: xcv:XCV4373 LacI family transcription
FT                   regulator; PFAM: regulatory protein LacI; SMART: regulatory
FT                   protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56566"
FT                   /db_xref="GOA:D5EDD4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDD4"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ADE56566.1"
FT                   /translation="MKVKMEDVAKLANVNKATVSRALKGDSRISASTRERVWKAAKALG
FT                   YQPDAVARGLSSNRTGLLGVVFVDLSQPWVGSFLSGLDRVASKQSYSLLVKCSGQGPSQ
FT                   KNVVARDLLSRNVDGIIWIAGAVPDLSFDGPLVAVGSENPRGFSVLIDVERGAQKLQKI
FT                   AKGRVCEVRSGSAPFFRDIASFLKGPSLKTLPPLYVVDSSHDIPISGGGENVVLCGYPN
FT                   VARLLKSYCLDWPAFELGAIAGRLSLNAIQEKGVRPEKVMVVPPLYSPEGDIVSL"
FT   gene            complement(455440..455577)
FT                   /pseudo
FT                   /locus_tag="Amico_0425"
FT   gene            455703..456539
FT                   /locus_tag="Amico_0426"
FT   CDS_pept        455703..456539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0426"
FT                   /product="ATPase-like, ParA/MinD"
FT                   /note="PFAM: ATPase-like, ParA/MinD; KEGG: bov:BOV_0057
FT                   mrp-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56567"
FT                   /db_xref="GOA:D5EDD5"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDD5"
FT                   /inference="protein motif:PFAM:PF10609"
FT                   /protein_id="ADE56567.1"
FT                   /translation="MSEQGCNEMSCGKSSCEGCSGCSKKKKDVGKVIAVGSGKGGVGKS
FT                   SISCLLAVALAKKGFSVGILDADITGPSVPKLMGVTDSPYGSPQGIIPPASSIFDIKVM
FT                   SVNLLLDDPTKPVVWRGPIIASVIKQFWEDVAWDKTDFIIVDLPPGTADAPLTVMQTID
FT                   LDGFLVVTSPQELSVMVVEKALNMTKMMEVPLLGAVENMSYVTCPDCGKAIEVFGPSHV
FT                   KEIEEKFSLPVLGKFPLDLELSHLGDQGRMEEYKNEELLNALADGVLVQLGVGVEV"
FT   gene            complement(456596..457408)
FT                   /locus_tag="Amico_0427"
FT   CDS_pept        complement(456596..457408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0427"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   ppd:Ppro_1945 beta-lactamase domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56568"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041712"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDD6"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ADE56568.1"
FT                   /translation="MNVTVVVDDYCGTSKLLGEHGLSMYIETPRGSLLFDTGRGASLYP
FT                   NASALEVPLGNLNGIVLSHGHFDHTWGLPEILRREGNLPVWASPFFDRQRFARKGEELE
FT                   IAGSLFSKDDLNFRPVNDRTEIIDAIWAITIPLSERNPDFVPVDPDLVIKENGELKADL
FT                   MEDDLSLVVRGINGYSVILGCAHAGTVNILERAALLFNTREFYSVTGGMHFRSQGRGFL
FT                   LRSAKELKDKFSVQHWRPCHCTGFSAAFILGEQLSNVEWAHSGSSFEI"
FT   gene            complement(457435..458937)
FT                   /locus_tag="Amico_0428"
FT   CDS_pept        complement(457435..458937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0428"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: geo:Geob_3717 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56569"
FT                   /db_xref="InterPro:IPR011935"
FT                   /db_xref="InterPro:IPR037291"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDD7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56569.1"
FT                   /translation="MKKLLSLCFATFVIMLTSISLFAAEMVIEHVYVYPRGAQIRLKAN
FT                   VTGEGKILLPNTFDLESISVIPEDGLLLEKVQIVVLNDAQWLPPSLVPLQLRLEDKKRE
FT                   LSSLKSQAVALKQWSALIESSTPADLSVHNLESYLQAAEESRQKKEQERAAVESDIERV
FT                   EQEITDIKGEIEEKKPQTQGKVIAIEYKTLTSGSLFIEGWTPHARWVPEYSLSLSTNEG
FT                   RVEGQLLAKVRQHTGLIWNGIIQLHTAQPVSSVETPDIPPLVATFTEPLYGSGAQQNGR
FT                   MLKTMAVEETAIPSAVEETITDRFFTTKGKISGDNMPVTLLLRDFTMPATVSIECIPLL
FT                   SSQAWIMASSEAIEDPLLPGKADLFIDGMGSGRTRLPALARGEKLTLAFGQTPSVTATR
FT                   EEIIPKEGSNWFGKGKLAQGYTLNITNGLPFEAELMIKDRIPVSAHEKITVEVETLDPQ
FT                   PAEKDEKKGVLTWKKKFKAGEQWQISVVYRLSFPSDKEIWLK"
FT   gene            459050..460141
FT                   /locus_tag="Amico_0429"
FT   CDS_pept        459050..460141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0429"
FT                   /product="GTP-binding protein YchF"
FT                   /note="KEGG: csa:Csal_1521 GTP-dependent nucleic acid-
FT                   binding protein EngD; TIGRFAM: GTP-binding protein YchF;
FT                   PFAM: Protein of unknown function DUF933; GTP- binding
FT                   protein HSR1-related"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56570"
FT                   /db_xref="GOA:D5EDD8"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDD8"
FT                   /inference="protein motif:TFAM:TIGR00092"
FT                   /protein_id="ADE56570.1"
FT                   /translation="MLKCGIVGLPLCGKSTVFNVITRAGAEVKPYASGKTDPNRAMVSV
FT                   PDPRFEHLVTIFEPKKQTPATVEFVDLAGLSRDASKGAGLGNAFLSFVAESDALVHVVR
FT                   TFDNPEVPHPEDNIDPARDWNIVEMELIYRDLGVIDNRLSRLAAKKRLLPEEEEEKKLL
FT                   ERCQAFLMEEKPLRELGLSEDEQRKLSGFAFLTLKPEMIVLNLDETQTEGHVPGLDAIM
FT                   SIAKERGLGLVQVFGRMEMEMADLSEDEQREFMADLGIKEAGRERLIQEAYSLLGLISF
FT                   FTTGKDEVKAWTLKKDATAVEAAGAIHSDLARGFIRAQVVHYPDFVACGDSMPACRDKG
FT                   VLRLEGKEYLVQDGDMIEIRFNV"
FT   gene            460213..460653
FT                   /locus_tag="Amico_0430"
FT   CDS_pept        460213..460653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0430"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: protein serine/threonine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56571"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDD9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56571.1"
FT                   /translation="MPMQISLDELLSALLARVDGMAMNEENLKSRLNIIFRVLYKKGLI
FT                   TDEDVVESIRDEHRLLKELGLTREEPDDEVVNAIAESILLWIKGDAEKLKEQIKEYEQK
FT                   MQEAAMEEARKPKIDVASPQVLQQLDQLSGKERRGGGRKLII"
FT   gene            complement(460715..461431)
FT                   /locus_tag="Amico_0431"
FT   CDS_pept        complement(460715..461431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0431"
FT                   /product="protein of unknown function DUF500"
FT                   /note="PFAM: protein of unknown function DUF500; KEGG:
FT                   gur:Gura_1635 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56572"
FT                   /db_xref="InterPro:IPR007461"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDE0"
FT                   /inference="protein motif:PFAM:PF04366"
FT                   /protein_id="ADE56572.1"
FT                   /translation="MMTRLRRGRCRFFILATLITLISLGWGFTQAAWAKTPEERIAGSV
FT                   KLLREMQEQSDIGTMADLLERAKGVAIFPSVIKAGFVFGGKYGEGLVLKRDSVTGKWYG
FT                   PSFVTIAGASWGLQIGAESIGLVLVITNERGLEGFMGNNVELSGDLGVAAGPLGRRGEL
FT                   GTDIKLKASIYSYSITKGLFAGMSLEGAAINVDDNANTVYWGKPTTASQALKKGATSNK
FT                   IKTLINELQKVIKEAK"
FT   gene            461572..462504
FT                   /locus_tag="Amico_0432"
FT   CDS_pept        461572..462504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0432"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pca:Pcar_1474 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56573"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDE1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56573.1"
FT                   /translation="MSYSEMERIEKLLEQAYQSDDIETISKLARQILEIDPGHPEALIL
FT                   LADTTEYSDEKLDLLKQALEPMRNMVEEADLVNRKELMDEEEGIIYIGLLQRLGFALLS
FT                   EARPEEALEIAEEIISYDEEGVTLGKTLMYRCLIELQRFSEVLERAIRDEEISAARQHA
FT                   MAIAAYMLSGPDKGAYRALWDAFKVGPEIPFYILGYIPEPDFETLDEQQEEDYNFSILF
FT                   EDAWSLSQELANWLASATILFGMLTGRFLEEDEENFAVLMDSLGIRSFCEKAEKAIEEM
FT                   SDSLSSLDAEAFDANILEMLRANIYLPLK"
FT   gene            462525..463082
FT                   /locus_tag="Amico_0433"
FT   CDS_pept        462525..463082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0433"
FT                   /product="histidine kinase"
FT                   /note="KEGG: dat:HRM2_16530 sensory signal transduction
FT                   histidine kinase (ATPase domain protein); PFAM: ATP-binding
FT                   region ATPase domain protein; SMART: ATP-binding region
FT                   ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56574"
FT                   /db_xref="GOA:D5EDE2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDE2"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADE56574.1"
FT                   /translation="MLEDFSQHVLDIAENSINAGATWVDIRITEDCAGGWLYFEVKDNG
FT                   KGMDGDTLLAVTDPFYTSRTTRRVGLGIPFLKQLAELCDGEFEIESAPGKGTRVWASFR
FT                   YDHIDRPPLGNMPASLISLLIAHPDVQLVYCHSFNEKKFIFDSFELNRVLGNIKEVQNP
FT                   AIACWLQDYFEENIETLKHHCE"
FT   gene            463110..463925
FT                   /locus_tag="Amico_0434"
FT   CDS_pept        463110..463925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0434"
FT                   /product="formate/nitrite transporter"
FT                   /note="PFAM: formate/nitrite transporter; KEGG:
FT                   dol:Dole_0884 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56575"
FT                   /db_xref="GOA:D5EDE3"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR024002"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDE3"
FT                   /inference="protein motif:PFAM:PF01226"
FT                   /protein_id="ADE56575.1"
FT                   /translation="MNYKSPLEMAKMACAASQTKTSWNHRQILLLGILGGAYISLGGWL
FT                   MTCVTYDLPGGIAKFMAGAVFSVGLMLVVIGGAELFTGNCMMPLGALVGCTPMKKIFIA
FT                   WTWVYFANFLGGLIVVFLLYNTGLWEGPIGVKTLHIAAAKMSLPFGQAFFRGILCNWLV
FT                   TIAVWLSMASTDVTGKIWAIFFPIMAFVASGFEHCVANMYFLPMGLLLKRVPSLLQAAQ
FT                   LSDAQLQVMNLGGLVKNLIPVTLGNIVGGVLFIAVFYFFIFKEKLLASD"
FT   gene            464000..464176
FT                   /locus_tag="Amico_R0017"
FT   ncRNA           464000..464176
FT                   /locus_tag="Amico_R0017"
FT                   /product="6S RNA"
FT                   /note="6S / SsrS RNA as predicted by Rfam (RF00013), score4
FT                   2.58"
FT                   /ncRNA_class="other"
FT   gene            464246..465223
FT                   /locus_tag="Amico_0435"
FT   CDS_pept        464246..465223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0435"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="KEGG: hch:HCH_03852 phosphatase; TIGRFAM:
FT                   HAD-superfamily hydrolase, subfamily IA, variant 3;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 1; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56576"
FT                   /db_xref="GOA:D5EDE4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDE4"
FT                   /inference="protein motif:TFAM:TIGR01509"
FT                   /protein_id="ADE56576.1"
FT                   /translation="MKTIYTPFWHPIESAGFILDWDGVLADTNLDFSGIRTKYFNGEPA
FT                   PLIEGMTALSEERKKELWQDIYSLEMNGAEQAVPVEKSIEFVKWLNDHNIPWAVVSRNC
FT                   MDSIRRAAERIDFPLPPKVFSRDNGPVKPDPEALWLAAEEIGVPAEQCVMVGDFVYDLI
FT                   GARRAGMRAVLVERPRVEWQHWADAIYPTMNDFLKSLNSPAPLVPWEYSSLEKQKGKGW
FT                   LEKAWKLLVQIPDDVPDICNYCEEVARLGVGTLICTPSVKLSVQQWRIWPGLAPSFLDI
FT                   DQVSVIQKTLKQRYPLVTVKEGSEGIRLSESMDSIERELEEKIK"
FT   gene            465220..466494
FT                   /locus_tag="Amico_0436"
FT   CDS_pept        465220..466494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0436"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="KEGG: gur:Gura_1704 recombination factor protein
FT                   RarA; PFAM: AAA ATPase central domain protein; ATPase
FT                   associated with various cellular activities AAA_5; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56577"
FT                   /db_xref="GOA:D5EDE5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDE5"
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /protein_id="ADE56577.1"
FT                   /translation="MISQTQWERPLADRMRPSSLDDFVGQNHLLAPGTPLRQILQSGKV
FT                   PSCVLYGPPGVGKTTLVRLMAMVTERSLLEINAVSAKVSELRDLVEEAKNLKILSGSAA
FT                   IAFVDEIYHFNKSQQNALLPSVEKGDIILVGTTTENPWFEINKTLLSRLVVFQLKPLAE
FT                   EDLVQILYKALKDEEKGLGALKLAVSEDVITVLAKMAGGDARQALTRLELLASSVAASG
FT                   AAELTMAHVDRLIPSASIRFDPKADDHYAIISALIKSMRGSDPDAALYWLARLIEGGED
FT                   IRFICRRLMIFAAEDVGLADPQALQIAAAASYAADMTGLPEARIILSEAVIYLAASPKS
FT                   NSAYLAIDNATQSIKKGNLQEVPNHLKPGGTGYIYPHDDPRHWVPQKYVTSPQRFYFPG
FT                   NLGRERAFHERLKRFWRRFSREQEN"
FT   gene            complement(466537..467229)
FT                   /locus_tag="Amico_0437"
FT   CDS_pept        complement(466537..467229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0437"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: gme:Gmet_0062 GntR family transcriptional
FT                   regulator; PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; SMART: regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56578"
FT                   /db_xref="GOA:D5EDE6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDE6"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADE56578.1"
FT                   /translation="MDQNTLTPATNQGLRQIVYEKLKDAIVNGVLKPGSKLSEIELAEQ
FT                   LAVSRTPVREAIRQLSQTGLITLTPRRGAFVTLPSLKDASDLYELRQALEIIAIENVCE
FT                   NPPIKDLKLFREIFSAMSGQTSHEEYLTEDRRFHCFLYECSGNKYLHKTLNNIVDLINL
FT                   CRPYSMQSDPTIMGVFLKGHLAIIDAVLHGDCKKAIAEMGSHIEDTKRSLLAFLRQHPG
FT                   DYTSVEEE"
FT   gene            complement(467322..467855)
FT                   /locus_tag="Amico_0438"
FT   CDS_pept        complement(467322..467855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0438"
FT                   /product="ATP/cobalamin adenosyltransferase"
FT                   /note="KEGG: lch:Lcho_0942 ATP--cobalamin
FT                   adenosyltransferase; TIGRFAM: ATP/cobalamin
FT                   adenosyltransferase; PFAM: cobalamin adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56579"
FT                   /db_xref="GOA:D5EDE7"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDE7"
FT                   /inference="protein motif:TFAM:TIGR00636"
FT                   /protein_id="ADE56579.1"
FT                   /translation="MAETWITTKGGDFGETSLGNGDRVPKDHLRVEVFGTIDECQAHVG
FT                   MARALCEYEEICENLCWLEQQLGLLMGYLALFPGLPCPKIEALEAIIDKVGNVTERNFR
FT                   FVRPGDSKAGAALHVARTVARRAERLAVKLFRSKELKEEGYSYINRLSDVIYALSLWYD
FT                   HLARTQEEKSECRQ"
FT   gene            complement(467913..468716)
FT                   /locus_tag="Amico_0439"
FT   CDS_pept        complement(467913..468716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0439"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="KEGG: avi:Avi_7080 transcriptional regulator; PFAM:
FT                   regulatory protein IclR; Transcriptional regulator IclR;
FT                   SMART: regulatory protein IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56580"
FT                   /db_xref="GOA:D5EDE8"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDE8"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ADE56580.1"
FT                   /translation="MRPQKTKGASSIRKCLAVLDSFTWDNPHRTLTEIAEEINAPLPTA
FT                   SRITAVLCEEGFLDKCEGNLYQLGWKCYRMGAIFKASDPTKNVALPHMRKLRDTFNETV
FT                   SLYQRKGIWRICCEQVSSTYPLKRFANPGDRFPLWAGAAGRCFLAYMALEEVDAVFDAA
FT                   PEEVRLKRTILIDRATKVKDDGYATSIAEREPGVSSVSCPIFNFTGLPIACLTISGPSI
FT                   RFTDDVVPRIILALLHESRELSIALGAPEELTVERKPTKFPHLQD"
FT   gene            469036..469923
FT                   /locus_tag="Amico_0440"
FT   CDS_pept        469036..469923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0440"
FT                   /product="2,3-dimethylmalate lyase"
FT                   /note="KEGG: bxe:Bxe_C0659 2,3-dimethylmalate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56581"
FT                   /db_xref="GOA:D5EDE9"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDE9"
FT                   /inference="similar to AA sequence:KEGG:Bxe_C0659"
FT                   /protein_id="ADE56581.1"
FT                   /translation="MKKSTILRQLLEKREALVVPGAHDVLSAKLIEKVGFKALQVSGFG
FT                   LAATLLGLPDMAFLSFEEMRNFTRNIVDAVNIPVMADADTGFGNAINAMYVTEKLIKAG
FT                   CASMNIEDQMFPKRCGHIEGKTIVPCDEMVLKIKACAKVRDELDPDFVINARTDSIAVS
FT                   GIDEAIRRGNAYAEAGADMIFVEAPRTIEEIERAVKEIDALVSINFFDSIEGGKTPLLP
FT                   VNQMKELGVARISVPVGSVFAAAKGVQNYLEAIKDDIAPDRKEVLFSFDEFKNIVGVPG
FT                   FREQEKEYLPKFVD"
FT   gene            469939..470637
FT                   /locus_tag="Amico_0441"
FT   CDS_pept        469939..470637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0441"
FT                   /product="Dimethylmenaquinone methyltransferase"
FT                   /note="PFAM: Dimethylmenaquinone methyltransferase; KEGG:
FT                   kpe:KPK_0254 alkaline protease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56582"
FT                   /db_xref="GOA:D5EDF0"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDF0"
FT                   /inference="protein motif:PFAM:PF03737"
FT                   /protein_id="ADE56582.1"
FT                   /translation="MSIGFRVFTQRDLPPKDLVEKFKHIPAANIADGMNRSAAMASYIR
FT                   LMTAPTECNMVGVALTVRARGGDNLMFHKALNMAEEGDVIVLSNEGDRSYALMGEMMAL
FT                   YARHKKVAGIVIEGPVRDVEALYSLGVPVYATGSTPGGPYKDGPGEVNVGISCGGIFVC
FT                   PGDIIVGDADGVIVVPKGLARQCLEGGRRLLLNEEVKGPRLADGTGDRSWVEKTLDQKG
FT                   CETIDGIWLP"
FT   gene            470653..471549
FT                   /locus_tag="Amico_0442"
FT   CDS_pept        470653..471549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0442"
FT                   /product="Phosphogluconate dehydrogenase, NAD-binding,
FT                   putative-like protein"
FT                   /note="PFAM: Phosphogluconate dehydrogenase, NAD-binding,
FT                   putative-like; 6-phosphogluconate dehydrogenase NAD-
FT                   binding; KEGG: bja:blr2279 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56583"
FT                   /db_xref="GOA:D5EDF1"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015814"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDF1"
FT                   /inference="protein motif:PFAM:PF09130"
FT                   /protein_id="ADE56583.1"
FT                   /translation="MAELSLGFVGFGEVSFCISSGLRDEGLSGICAYDVVLGSGTLYEE
FT                   NLRKRANEANVILCDTPEELFRSCKVIVCAVQAPYAGHAAKSALSHMSAGSLYVDVTTA
FT                   APAEKERWEKEFQARSIYFADSAMMGPLTINRHKVPMIASGCGASLWQEKMVPLGMKID
FT                   VVKGPAGDGTRIKLVRSVFMKGLGALLVETFLLAHRSGLEDVVLKSISATVDQLPFEKT
FT                   ISRMLGADMIHAERRAHEVAESIALMETLRLKPVMAAATKERLELSAAMGLKDELAGLA
FT                   PKTIEEACSVWDRKNYR"
FT   gene            471614..472564
FT                   /locus_tag="Amico_0443"
FT   CDS_pept        471614..472564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0443"
FT                   /product="TRAP transporter solute receptor, TAXI family"
FT                   /note="TIGRFAM: TRAP transporter solute receptor, TAXI
FT                   family; KEGG: wsu:WS0748 immunogenic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56584"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDF2"
FT                   /inference="protein motif:TFAM:TIGR02122"
FT                   /protein_id="ADE56584.1"
FT                   /translation="MFRKSMVSALIAASLVFAVAGVSCAAEFARIGTSSVGGGFYLIGN
FT                   TIAQLGNQEKNGINYTAVTGGSAKNLMALAKKDMEFGLAQSATVDEAWNGTGGFEGRAL
FT                   KQLRFVTAIYPMPAHILISGDGIESIADLKGKKIDYGPIGNGIDTNCRIVLGAYGIKDE
FT                   DITIDRYGRSEVVEALQTGTVNGHIWLTTYPNAQITEMISKNVRLLSIDEEQRQTILKQ
FT                   CPFFASAVIPAGTYKGFDKDLPTIAAVGALITYADMSDEVIYKTVKMMYENSQFLKDRL
FT                   PNYFANFSLENALNGCSMEVHPGALKYYKEAGLVK"
FT   gene            472650..474590
FT                   /locus_tag="Amico_0444"
FT   CDS_pept        472650..474590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0444"
FT                   /product="TRAP transporter, 4TM/12TM fusion protein"
FT                   /note="KEGG: sfu:Sfum_3721 TRAP transporter, 4TM/12TM
FT                   fusion protein; TIGRFAM: TRAP transporter, 4TM/12TM fusion
FT                   protein; PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56585"
FT                   /db_xref="GOA:D5EDF3"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="InterPro:IPR011853"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDF3"
FT                   /inference="protein motif:TFAM:TIGR02123"
FT                   /protein_id="ADE56585.1"
FT                   /translation="MSSPVSSVSSNSSDAAVTAKKVGKRRSLTGFSGKLIMILAVSLAI
FT                   FQLYTAFFGLLPTMKQRSFHVAFVMTMIFLLYPGTKDSPRDRVPFVDWILALAAAGCAL
FT                   YVFFGYEDIAMRAGLIYDYELILGGIFTVLVFEAGRRVLGNALPGFCFLFLLFAYFGRS
FT                   MPGPIQHFGLSIPRIIEELYLTTDGLFGLVTGVSATYIYLFVLFGAFLTSTKASEFFND
FT                   FAMALTGHLKGGPAKIAVVSSALMGTISGSTSANVATTGAFTIPLMKEIGYKPHFAGAV
FT                   EAAASTGGQIMPPVMGAAAFIIADTLGVPYTRVLTAAIIPALLFFWGIWCSLSLEASKL
FT                   GLKGLPKDRLPKVGKVLLTSGYKAIPLFVIVYFLVKGYNPLYSGCWGIFSCVLLSFVKK
FT                   SDRLNVKTLVSTLESGSKGALSVAMACIIVGVVIGMMGATGVALRVGDAILAMTQGHLI
FT                   ITLVVTMIIAMLLGMGMPTTASYVMASAVAAPAMVLLGVRPLDAHLFVFFYAVLSSVTP
FT                   PVCVGAYTAAGIAGADPNKTAFAAVKLALSGFIVPFIFVLAPEILLTNVTSWFVTFQAM
FT                   ISAIVGVFLLASAAENYIMARLRWYERLLAFAGALGLLYPGTVTDLCGLAVLVVLYVVT
FT                   KKRAKDLPDLA"
FT   gene            474654..474920
FT                   /locus_tag="Amico_0445"
FT   CDS_pept        474654..474920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0445"
FT                   /product="citrate lyase subunit gamma"
FT                   /note="KEGG: hiq:CGSHiGG_02605 citrate lyase subunit gamma"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56586"
FT                   /db_xref="GOA:D5EDF4"
FT                   /db_xref="InterPro:IPR023439"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDF4"
FT                   /inference="similar to AA sequence:KEGG:CGSHiGG_02605"
FT                   /protein_id="ADE56586.1"
FT                   /translation="MIVHSAQAGSDGKSDCFVTVKPAETMEWKYQGRNSQLFATRTDSL
FT                   IRETLDRYGSPKVCLIVEDFGALPFVIRARVEVALERALKERA"
FT   gene            474928..475815
FT                   /locus_tag="Amico_0446"
FT   CDS_pept        474928..475815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0446"
FT                   /product="Citrate (pro-3S)-lyase"
FT                   /EC_number="4.1.3.6"
FT                   /note="KEGG: ppd:Ppro_1085 citryl-CoA lyase; PFAM:
FT                   HpcH/HpaI aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56587"
FT                   /db_xref="GOA:D5EDF5"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDF5"
FT                   /inference="protein motif:PRIAM:4.1.3.6"
FT                   /protein_id="ADE56587.1"
FT                   /translation="MKLRRSLLYIPGNNPAMLQSCPSLGADCVILDLEDAVAPAHKDEA
FT                   RRLVAYALRCLFFDCVEKVVRINDVSTPWWELDLEEIVPAGPDVIRLPKAESVENIRMV
FT                   DNRITELEKANGLSEGGIELHILLESAQAVENVANLVRSCKRVKGVGLGGQDLTADMGI
FT                   RKTSSGEELAYANGHMILAAKAAKIDCFDSVYTDINDGEGLLTNTRKAATMGFSGKSAI
FT                   HPSQVRIINQGFYPSEDILSHAQDVIAAAKIARTEGRGAFSVNGKMVDGPVIRQAMNVL
FT                   AQAGIPCNSEEVLP"
FT   gene            475812..477377
FT                   /locus_tag="Amico_0447"
FT   CDS_pept        475812..477377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0447"
FT                   /product="citrate lyase, alpha subunit"
FT                   /EC_number="4.1.3.6"
FT                   /note="TIGRFAM: citrate lyase, alpha subunit; KEGG:
FT                   ppd:Ppro_1084 citrate lyase, alpha subunit; PFAM: Citrate
FT                   lyase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56588"
FT                   /db_xref="GOA:D5EDF6"
FT                   /db_xref="InterPro:IPR006472"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDF6"
FT                   /inference="protein motif:TFAM:TIGR01584"
FT                   /protein_id="ADE56588.1"
FT                   /translation="MTMVRNAAGRLVPDEIPGIGSVRPFEGVTGVAPSPAFNTIMEVER
FT                   DVVPMGTNKIAPDLRTAIERSGLCDGMTIGFHHHLRNGDRVVAQVLEELNCMGFKNLVL
FT                   MSSALLECHNFVVDYIRSGLISQIYAPIRGAVGDYFQTENEKLPPVIIRTHGGRARAVE
FT                   EGSIAVDVAFIGASACDMSGNMTGMSGPSAFGSLGYGMQDARFSRHVIAVTDNLVEYPL
FT                   RPRVSIPQYLVHQVVVLDSIGDPQKLATGSIRITKSPTQLALAYHAYELIAASGAICPG
FT                   FSYQAGGGGISMAVTQYVREYMQRKDITGSFALGGITADMVSLLEEGRFQALFDVQSFD
FT                   PAMGASMLRNPTHYEIDASWYANPLNAGCMTHQLDVAVLGALDVDVDFNVNLLTGHDGY
FT                   LRSGMGGHPDAAGGAKLTVVVLPSFRRGLPSIKKRVQTICTPGASVDAIVTERGICINP
FT                   RREDLLKQALDSGLNVVDIEKLRQDTEALTGVMDPVEFDESRVAAVVEYRDGSILDVVY
FT                   GMKR"
FT   gene            477552..477638
FT                   /locus_tag="Amico_R0018"
FT                   /note="tRNA-Leu1"
FT   tRNA            477552..477638
FT                   /locus_tag="Amico_R0018"
FT                   /product="tRNA-Leu"
FT   gene            477936..479453
FT                   /locus_tag="Amico_0448"
FT   CDS_pept        477936..479453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0448"
FT                   /product="restriction modification system DNA specificity
FT                   domain protein"
FT                   /note="PFAM: restriction modification system DNA
FT                   specificity domain; KEGG: bcs:BCAN_B0855 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56589"
FT                   /db_xref="GOA:D5EDF7"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDF7"
FT                   /inference="protein motif:PFAM:PF01420"
FT                   /protein_id="ADE56589.1"
FT                   /translation="MLRVKMTQKKLKENFDKTANIQRDREVLFQLMKKTTEDHLGFFPT
FT                   DRDDFLEIFEALKDIDLVDFTIEIYKNDRMGTVISPQYLTEYISERIQRLCPQKVLITE
FT                   AEKHLSGLGDLIKRFPNIKITLTTHLKPMHILLQLAFGEYEHVKIRFESIYMPCLENEK
FT                   YDYVYSLPIFSNRPEGTSQTFLTRDSDGIAFENMLNHLDENSTLDIIVPAKITFASLGY
FT                   EKLRSYITENFYVENMYLLPEGTFRPATAIKTYLFSVTSLPKEQVNIGTFELQEEKVNI
FT                   RDKQTISIKDFLSHKDWRIELLLANDNENIRCFRDSDLPKVKLKNVAEVFRGKSILKKD
FT                   LGPGNVAVLNISNIKDGEIDYHDLDTIDEEEHKIKRYELSSGDVVLSCRGTSIKSAVFE
FT                   AQDKTIIASANLVVIRPKEKVKGEFIKIFLESPVGQAMIQSFQRGTILMNINYADIMEM
FT                   EIPFLPIYEQQKMIETYCQEFKTYKEAINLAESRWSNIKMNIYNNLL"
FT   gene            479467..480948
FT                   /locus_tag="Amico_0449"
FT   CDS_pept        479467..480948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0449"
FT                   /product="N-6 DNA methylase"
FT                   /note="PFAM: N-6 DNA methylase; KEGG: afr:AFE_2793 type I
FT                   restriction-modification system, M subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56590"
FT                   /db_xref="GOA:D5EDF8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDF8"
FT                   /inference="protein motif:PFAM:PF02384"
FT                   /protein_id="ADE56590.1"
FT                   /translation="MSVNLEFEDKLWEMADKLRGNIQPSDYKDVVLGLIFLKYISDSFE
FT                   EKYNELVAEEEGFEEDRDAYVAENIFYVPPSARWDFIKKNAKQSTIGQIIDDAMITIER
FT                   ENRNLKGVLPKNYARPELDKAKLGELVDLFSFNLGNKEAKAQDILGRVYEYFLGKFGSS
FT                   EGEFYTPPSIVKLLVGMIEPYKGRVYDPCCGSGGMFVQSSRFVEEHQGRKDDIHIFGQE
FT                   YTATTWRLCKMNLAIRGIDGNLGARDADTFGNDLHKNIRADYILANPPFNVSDYTLIPD
FT                   DARWKYGIPPEKNANYAWIEHIISKLSPTGVAGFVLANGSMSTTTKAEAEIRKNIIEAG
FT                   LVDCIVTMPPNLFYNVTIPVCLWFISKKRENKQDKILFIDARKMGTMVTRKHREFSDGE
FT                   IAKIYDTYHNWRDNKKEYKDIQGFCKSADIEEVREHEYILTPGRYVGIEEVEDDGEPFE
FT                   EKMTRLTGELAEMFAKSHKLEEEIKQRLGAIGYEF"
FT   gene            480938..482107
FT                   /locus_tag="Amico_0450"
FT   CDS_pept        480938..482107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0450"
FT                   /product="restriction modification system DNA specificity
FT                   domain protein"
FT                   /note="PFAM: restriction modification system DNA
FT                   specificity domain; KEGG: cjj:CJJ81176_1536 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56591"
FT                   /db_xref="GOA:D5EDF9"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDF9"
FT                   /inference="protein motif:PFAM:PF01420"
FT                   /protein_id="ADE56591.1"
FT                   /translation="MSSNEWREVKLGEIVDIEMGQSPKSEFYNTEGLGVPFLQGNKTFG
FT                   MIYPKFDVFCTNVKKIAIQNDILMSVRAPVGDLNIAQEKICIGRGICAMRMKNRNNLYL
FT                   FYLLKHNVKNLKKTESGTVFGGVNKKDIMGLSVMWTPNLQEQKTIAATLSCLDDKIELN
FT                   NRINKTLEEMAQAIFKSWFVDFEPFQNGEFIDSELGKIPKGWRVGTLDEIIELFDSKRI
FT                   PLSSRKREKMQKVYPYYGATSLMDYVDDYIFDGVYVLLGEDGTVIDGKGYPILQYVWGK
FT                   FWVNNHAHVLKGKNGFSEESLYILLKNTNVKSIVTGAVQLKINQSNLKSVKVIIPSVDK
FT                   IAEFNYLIARFFAEKRRLSEENQILISVRDALLPKLMSGEVRVPIEEVL"
FT   gene            482108..485302
FT                   /locus_tag="Amico_0451"
FT   CDS_pept        482108..485302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0451"
FT                   /product="type I site-specific deoxyribonuclease, HsdR
FT                   family"
FT                   /note="TIGRFAM: type I site-specific deoxyribonuclease,
FT                   HsdR family; PFAM: protein of unknown function DUF450; type
FT                   III restriction protein res subunit; KEGG: dma:DMR_15220
FT                   type I restriction enzyme R protein; SMART: DEAD-like
FT                   helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56592"
FT                   /db_xref="GOA:D5EDG0"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR021810"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDG0"
FT                   /inference="protein motif:TFAM:TIGR00348"
FT                   /protein_id="ADE56592.1"
FT                   /translation="MAFCECHLEEAALEWFEELGYEVVFAPDIAPEGTYPERTYYSDVV
FT                   LTERLKEALARINPDLPDDALEDGFRQIMFPQSPSLIMNNKTFQKMITDGIDVQVKQED
FT                   GGYRTEKAYIFDLEAPSNNDFLVANQFTVVEHDKEKRPDIVVFVNGIPLVVIELKNASD
FT                   ENVDITDAFNQLQTYKKTIPSLFTYNSFTVISDGVNARAGTLTSNEDRFMAWRTIDGDD
FT                   VAPLCIPQLEVLIKGMFLKDRFLDIIRHFVLFQSDGKEIKKILAGYHQYHAVNKALQST
FT                   QRATMEQGDRRVGVIWHTQGSGKSLSMVFYAGKLVIDEELENPTIVVITDRNDLDDQLF
FT                   STFLKSEELLRNTPVQAQDRVHLRELLNNRTSGGIIFTTIQKFAPFTNETNGEVIDFNR
FT                   WGRVAENSSPYTANTMLTDRRNVVVIADEAHRSQYGFGAEIVMGKTEADVKYGYAKYMR
FT                   DSLPNASYIGFTGTPVELTDKNTRVVFGDYIDIYDMTRAVEDGTTVKIFYESRIAKLDL
FT                   PEEMKPQIDSEYEEITEYQEYSQKERLKSKWARLEAIVGTEQRIKQIAKDIVEHFEKRD
FT                   LAQENEGGKGMIVAMSRRIAIDLYKEIVALRPDWHSDDLMSGKIKVVITGSSSDPSDWQ
FT                   AFIGSKADRETLAKRMKDRNDELKLVIVRDMWLTGFDVPSMHSMYVDKPMSGHNLMQAI
FT                   ARVNRVFKEKQGGLVVDYIGIAENLKNALAQYTESDKKTTGVDTEVASQVLLEKYDLIK
FT                   ELLHGHSYEKFFTGRQSEKMQAITETMDFIIGLREDRKNDYINLVTEMARAYSLCATTD
FT                   TAETLNVEVGFHKAVRACLHKIMSDGSKKKTTSQLDNELNQLISKAISSNEVVDILSSV
FT                   GLSKPNIAILSDEFLEEVKGMRQKNLAVELLNRLLKGSIKNFSRRNLVQSKRFSEMLEA
FT                   SIRKYQNRTIETTQVIMELIELAKEISGAEKRGESTGLTSDELAFYDALADNESARDVM
FT                   GDEILMQIAKDLTLSIRRNISVDWAIRENVQAKMKMDIKRLLKRYNYPPDKTPQAVDTV
FT                   IAQAKLMCQKEVAYGS"
FT   gene            485355..485543
FT                   /locus_tag="Amico_0452"
FT   CDS_pept        485355..485543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0452"
FT                   /product="Uncharacterized conserved protein UCP037246"
FT                   /note="PFAM: Uncharacterised conserved protein UCP037246"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56593"
FT                   /db_xref="GOA:D5EDG1"
FT                   /db_xref="InterPro:IPR003173"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDG1"
FT                   /inference="protein motif:PFAM:PF09901"
FT                   /protein_id="ADE56593.1"
FT                   /translation="MADIKYEIKESYGVLSVSSKGWQKELNLVSWNDREPKYDLRDWDS
FT                   THTKMSKGNNADCEIAR"
FT   gene            485629..485778
FT                   /locus_tag="Amico_0453"
FT   CDS_pept        485629..485778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56594"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDG2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56594.1"
FT                   /translation="MPLLPVEVNEGQFIDDLDIEYESQRGYHSERKGDVSEVCGFSLID
FT                   EDAS"
FT   gene            485997..486788
FT                   /locus_tag="Amico_0454"
FT   CDS_pept        485997..486788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0454"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: cha:CHAB381_1793 hydrolase in agr
FT                   operon (ORF 5)"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56595"
FT                   /db_xref="GOA:D5EDG3"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDG3"
FT                   /inference="protein motif:PFAM:PF00795"
FT                   /protein_id="ADE56595.1"
FT                   /translation="MRISCIQMNMKLANVDYNFAHAQNLIREAVATEQPDVVVLPETWN
FT                   IGFFPKDNLTALCDNNGERTKQELGSLAKELNINIVAGSVGNRRENKIYNTAVVFDREG
FT                   LCIAEYDKIHLFTPLGEHNYFSWGNHISTFKLDGVICGIVICYDIRFPELARTLALQGT
FT                   DVVFAVAQWPSVRITHINVLAEARAIENQMFFAFTNSCGTAGEIKYGGNSALINPWGKV
FT                   LVRAGLQEEIITAELDLSIIADIRSSINVFRDRQPTTYKLD"
FT   gene            487302..487922
FT                   /locus_tag="Amico_0455"
FT   CDS_pept        487302..487922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0455"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: sfr:Sfri_1551 transcriptional regulator, GntR
FT                   family protein; PFAM: GntR domain protein; regulatory
FT                   protein GntR HTH; SMART: regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56596"
FT                   /db_xref="GOA:D5EDG4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDG4"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADE56596.1"
FT                   /translation="MKEKVLKSLREAIIRGYLTGGQQLRQDEIALQLGVSRVPVREALM
FT                   QLEAAGLVTFYPYKGAVVSTLSPDEAKEIFEIRSILETEALRFAFPNLSDKVLDRAEQL
FT                   IEEASLEKDPFNWSDQNWKFHSFLYQYANRPRLLAIINSLHESVDRYKRIYLKTLSFYS
FT                   ESIKTHKQLVSRLREKNIEEATALMKKHLKNAEFHIIQYLTRY"
FT   gene            488044..489045
FT                   /locus_tag="Amico_0456"
FT   CDS_pept        488044..489045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0456"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /note="KEGG: reu:Reut_B5441 uroporphyrinogen decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56597"
FT                   /db_xref="GOA:D5EDG5"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDG5"
FT                   /inference="similar to AA sequence:KEGG:Reut_B5441"
FT                   /protein_id="ADE56597.1"
FT                   /translation="MKPIKRIEALLEGKRLETPAINLWKHFPPYDEDPKMLIKKTIQFQ
FT                   ERFHWDFVKVTYQGLFSIQDWGSKIKWPTRDCEWPNTCAGVGVVTDYSIKNVEDWKKLH
FT                   VLPMDEGSMKDTIDVAKGVIDHYKGEAPVVVTVFNSLTTAQKMSGDKMFIHMRQNPEAF
FT                   REGIETITQTTINYVKELVNAGADGIFFASQLGNYDKMSVAEYETFGRPYDLSILEHAK
FT                   KMWFNIMHMHGNAPMFEMMSQYPVQALNWHDRLVDIDLRKGRELCGDKILIGGVDEFTV
FT                   LPNGSDDELKAQLLDALQQVSDGRIILGPGCCVPSSINEDRFELAKKLLLEL"
FT   gene            489855..490922
FT                   /locus_tag="Amico_0457"
FT   CDS_pept        489855..490922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0457"
FT                   /product="Extracellular solute-binding protein, family 7"
FT                   /note="PFAM: Extracellular solute-binding protein, family
FT                   7, bacteria; KEGG: pmy:Pmen_4515 TRAP dicarboxylate
FT                   transporter- DctP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56598"
FT                   /db_xref="GOA:D5EDG6"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDG6"
FT                   /inference="protein motif:PFAM:PF03480"
FT                   /protein_id="ADE56598.1"
FT                   /translation="MKCRSLIALRVAVAVFVGLIVIGCPSQAIAKPSEVINWKFQSHHT
FT                   PGALSTEYVIPPFIERVREMSGGRLNITLHYAGELVDYQEVFPSLQANMIQMANTSGLF
FT                   WRGSIPVGWLQSGNLPPFVCRSNDEFNELYHRRGIDALIREGLAEQGIHFLGNHNVGNT
FT                   YFWSKKPINSVDDLKGFKVRFFGSMSDTMEHFGAAPVMLPHPETYTAIAMGTLDGSGTA
FT                   WWLYRDLKLHEVCPYFIGPAWQTPQGMELWVSKKAWDALPDDLKAIVETAAVAFTKDYA
FT                   DICWMQEREMFNKSFPEWGTTYIEWGKEDIDRITNEFSLPYLDKIAKEIGPKDPRVVKG
FT                   IEIIKQFMKDYGYID"
FT   gene            490987..491532
FT                   /locus_tag="Amico_0458"
FT   CDS_pept        490987..491532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0458"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter DctQ component"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter DctQ component; KEGG: dat:HRM2_38360 DctQ6"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56599"
FT                   /db_xref="GOA:D5EDG7"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDG7"
FT                   /inference="protein motif:PFAM:PF04290"
FT                   /protein_id="ADE56599.1"
FT                   /translation="MSFLKTFIIFVDNLNDWMGKILGFLIYPTMFILVYEVIMRYAFNK
FT                   PTIWAHDTSCMLYGAHFILGGAYALRWGAFVNVEVFYQRFSLRTKAVVDLVTWMLFYAF
FT                   VGILLWKSVPWAWASVMVQEYSNSPWGPPVWPIKLTIPVAATLVLLQGLTKTIKDFYIA
FT                   VTGRELFAGVATEVTEDN"
FT   gene            491542..492843
FT                   /locus_tag="Amico_0459"
FT   CDS_pept        491542..492843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0459"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="KEGG: rpb:RPB_1293 TRAP dicarboxylate transporter
FT                   DctM subunit; TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56600"
FT                   /db_xref="GOA:D5EDG8"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDG8"
FT                   /inference="protein motif:TFAM:TIGR00786"
FT                   /protein_id="ADE56600.1"
FT                   /translation="MGIGLISILLFGSMLLFLGLGLPVAFVLGGLAAIFWGPESFFIIV
FT                   ARTYSMMSTTTLVACPLFVLMAAVLEQSGVAEDMYEMMYRWMGSLKGGLAVGTVIVCTL
FT                   LAAMSGIASTGVVVMGVMALPAMLKRGYDKSLAVGCILAGGVLGPLIPPSIVLVLYGTI
FT                   AQVSIGGLFAGGMSAGLLCSSLIIVYILIRCYLNPSLGPPIPYEERTNWEAKMTSLKGI
FT                   ILPFLLIVSVLGSIYTGIATPTEAAAVGAFGAMVCSAIHRRLNWQLIRNSAYATIKIQG
FT                   FMMWILFSAQAFASVYMGMGASRLVIGLVEKYEIGWWTMLIAIQIVWFALGFVIDAWSI
FT                   LMITAPIILPLLPIYGFNPLWLGVLYAVNTQTGYLTPPFGTMLFMMKGIAPKSVTMSDI
FT                   YSSVVPFVITQLVTLALCITFPKLITWLPEVLFG"
FT   gene            493095..493685
FT                   /locus_tag="Amico_0460"
FT   CDS_pept        493095..493685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0460"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gme:Gmet_3458 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56601"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDG9"
FT                   /inference="similar to AA sequence:KEGG:Gmet_3458"
FT                   /protein_id="ADE56601.1"
FT                   /translation="MELILILTLAVVIVAVFMGKRQAEAHCDTLSGPVIKAALIAFEQQ
FT                   DVAPVLKWIRPEDEPEIREAFDLSCYVRNLGPDARKLAERAFFETLIRVHRMGEGASYE
FT                   GIKPDSSVPPVVAKADEALESGDVSDLANRISNHVKQTVEKRFQHAWEKKQSAEESPEK
FT                   GRDFVKAYISFVHYVEGIHAMTMKGHAHGEHHH"
FT   gene            493761..494939
FT                   /locus_tag="Amico_0461"
FT   CDS_pept        493761..494939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0461"
FT                   /product="Methionine gamma-lyase"
FT                   /EC_number="4.4.1.11"
FT                   /note="KEGG: cko:CKO_04984 hypothetical protein; PFAM:
FT                   Cys/Met metabolism pyridoxal-phosphate- dependent protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56602"
FT                   /db_xref="GOA:D5EDH0"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDH0"
FT                   /inference="protein motif:PRIAM:4.4.1.11"
FT                   /protein_id="ADE56602.1"
FT                   /translation="MSYRFDTQCVHLGTHPDPITGALSTPIYQTSTFAFHNADEGARRF
FT                   KGEEEGYIYTRLGNPNHTAVEEKIAALEGGEAAAVAASGMGAIASVMWTALSAGDHVIA
FT                   AKSLYGCTHALMNHQFPRFGMEATFMDLKDLAAVKAAMRPNTRMIYCESPANPTMEIAD
FT                   LEGLARIAHEGNAILVVDNTYCTPVIQRPLEFGADVVVHSATKYLNGHGDIIAGVIVGS
FT                   KEFIGRIKLEGLKDLTGATLSPFDSYLLLRGMKTLHIRVPRHCETALKVARFLNGCPEV
FT                   EKVWYPGLDDFPQRELADKQMKYYGAMIAMELKGGYEAGKKFINSTKLWTLAVSLGDAE
FT                   SLVQHPASMTHSALSDEELEKAGISKGLVRLSVGLEDVEDLIDDLKEAFAVM"
FT   gene            495186..497786
FT                   /locus_tag="Amico_0462"
FT   CDS_pept        495186..497786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0462"
FT                   /product="ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC"
FT                   /note="KEGG: sat:SYN_02218 cation transport ATPase;
FT                   TIGRFAM: ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC; PFAM: E1-E2 ATPase-associated domain protein;
FT                   cation transporting ATPase domain protein; Haloacid
FT                   dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56603"
FT                   /db_xref="GOA:D5EDH1"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDH1"
FT                   /inference="protein motif:TFAM:TIGR01494"
FT                   /protein_id="ADE56603.1"
FT                   /translation="MSPSKDIFDAAQVPGLDEEEATRRHIEEGPNELPSTKKNNIFNIA
FT                   IEVAQEPMFLLLVACGSLYLILGELREAAMLLGFVFLVMGITIVQERKTERALEALRDL
FT                   SSPRALVIRGRAQRRIPGREVVRGDIIVVSEGDRIPADARLFAAVNLSVDESMLTGESV
FT                   AVRKRPLEEADVQRRPGGEDSPYIYSGSLVVNGKGIAEVIGIGFQTEMGKIGKALQTLK
FT                   EEETLLKKETERIVKIFSVLGIGLCFLLVLIYGLTRGNWLEGLLAGIALAMAILPEEFP
FT                   VVLTIFLAMGAWRISQKGVLTRRIPAVETLGAATVLCVDKTGTLTLNQMKVGALCSDGI
FT                   SKDLQERRETLPEELHALLEYAILASQKDPFDPMEKAILKAGDDLLKGTEHLHYGWSLV
FT                   REYALTPELLAMSNVWCSPERKDWIIAAKGAPEAIMDLCHLDPSIVEQVESRILLLADN
FT                   GLRVLGIARAKFSSEEDLPIGQHDFKFEFIGLVGLLDPVRPDVPKAIQECYAAGIRTIM
FT                   ITGDYPGTARNIARAIGLNSPDLVITGQELDSLDEITLREKIQTVNVFARVIPEQKLRI
FT                   VEALKANGEITAMTGDGVNDAPALKSAHIGIAMGGRGTDVARESAGLVLVDDAFSSIAK
FT                   AVRMGRRIFDNIRKALAFVVAVHVPIAGMSLLPVFFSDWPMVLLPVHIVFLELIIDPTC
FT                   SVVFEAEEEEEDVMQRLPRDRSKPLFDIRTVLFALFQGFSILCVVALVFTSYIKAGSSP
FT                   DRARALAFSTLVFSNLALILTNRSWTKNAWALLKIPNRAFWSVLVGSILFLAASFAVGP
FT                   LKAVFKFETLSAMEFAKCFGLGLALLLWFELIKTLFEELWNIHSRKKHERLLNR"
FT   gene            complement(497877..499991)
FT                   /locus_tag="Amico_0463"
FT   CDS_pept        complement(497877..499991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0463"
FT                   /product="phosphoesterase PA-phosphatase related protein"
FT                   /note="KEGG: pin:Ping_1883 phosphoesterase, PA-phosphatase
FT                   related; PFAM: phosphoesterase PA-phosphatase related;
FT                   SNARE associated Golgi protein; SMART: phosphoesterase
FT                   PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56604"
FT                   /db_xref="GOA:D5EDH2"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR025902"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDH2"
FT                   /inference="protein motif:PFAM:PF01569"
FT                   /protein_id="ADE56604.1"
FT                   /translation="MDIVHLLLPTLEHFRLLGYWIILALALWESTAFVGMAIPGVLLFP
FT                   TVGFLVAHGYFDPIDAFWFCFLGAMGGYCLSYYLGTAGDRFASRFGRLTSKIDAGKKYL
FT                   SKYGLWAMIPGRFMAIGSLLPFLAGFARLPFRHFVAYSGIANGIGMVTYLLFGYFARHA
FT                   WISLGIWSTRLVFFLATTAGLLGIFYLIRTLVVKGAWPLFIVLASIICSAAEGVGRNPL
FT                   LKTFIDRHPRCASFFWERFNPERFEGFPLTILCLALGYSLVLLGGVVEDLLTADPIVAV
FT                   DKRLATLLLAFRSPILLWIFLKVTLLGSWQIVLGGVILFSLYLLLDNKKYFLAPFWVTL
FT                   GGCTFFTTGGKWLFQRQRPFNMTHLMEFSFPSGHTAYSAFFYGFLAYALARGTTDRGKK
FT                   VDLFFLWVLLVTAVGFSRLYIGVHYLSDVLAGALLGFSWLIIGISLSEWRKSRRTKLEV
FT                   TMPPPATRKKTYWGPALFTAGVFLYLCIVATFVPPYFKESPHPAALTESMDPLAPFELR
FT                   GLSRFTETISGSPQEPLSLMIYVQNGNNLITALEKAGWVKAELVSFRSLVKAFKSALLN
FT                   NSYPQAPVTPSFWNGVPLDIAFEKETELHSVRQRHHIRLWKTGYRLSDGSLQFVGTASF
FT                   DKGVNWLHLSHRIDPVIDTERKTFVDNCLEAKIVSNYEEITFVEPSMGSNFSGDAFFSD
FT                   GKMVILHLFH"
FT   gene            complement(500180..500866)
FT                   /locus_tag="Amico_0464"
FT   CDS_pept        complement(500180..500866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0464"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: eta:ETA_13940 ABC transporter, ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56605"
FT                   /db_xref="GOA:D5EDH3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDH3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADE56605.1"
FT                   /translation="MKNIFAVEGQSLSKTFLRKGGSQIVLFSHLSVSFKKGEVVGLVGP
FT                   SGKGKTTLGDILLGLIVPDRGKVLWKGQDIRTLSKTKKKNLRPYFQKIHQDPGSSFPQN
FT                   RLIRTIFEDFFRWGYHPALSSEKEWWNALGEGMEKASLSERLLHRYPCQLSGGELQRFA
FT                   LLRALLFSPLFLVADEPTSRLDPSVQAKVAHMLVEEAHVKSIAVLFISHDEVLLNALCS
FT                   RIIRLE"
FT   gene            complement(500866..501687)
FT                   /locus_tag="Amico_0465"
FT   CDS_pept        complement(500866..501687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0465"
FT                   /product="Sigma 54 interacting domain protein"
FT                   /note="KEGG: hap:HAPS_1451 ABC transporter ATP-binding
FT                   protein; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56606"
FT                   /db_xref="GOA:D5EDH4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDH4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADE56606.1"
FT                   /translation="MTSFLSVENLSILDEENKPLVRNVSFSIPSESVFFLVGETGSGKT
FT                   PIAQAIAGTLAKRLSVCGKVFLKKQNLLSVKEKELKKLWGRYLFLMPQEPSTALNPLLS
FT                   VFRQVREVFQHLRGMDRHTARTATQNLFSALGITQEASRERPGKLSGGMAQRALLAMAL
FT                   ASPAEFILLDEPTKGLDSSRKEDATALVKGIINAGKTLLCITHDFSLPKQIGGQTGVLF
FT                   SGLLVESGDSQIVLQHPSHPYTQGLLNALPERGLHPISDELLAQLERAWCH"
FT   gene            complement(501684..502481)
FT                   /locus_tag="Amico_0466"
FT   CDS_pept        complement(501684..502481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0466"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: asa:ASA_2644 ABC-type
FT                   dipeptide/oligopeptide/nickel transporter, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56607"
FT                   /db_xref="GOA:D5EDH5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDH5"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADE56607.1"
FT                   /translation="MTTKKKGAIFLLAFLFISLGGFFLHDSDPFSQNLLHTLERPSKNH
FT                   ILGTDHLGRDFAARLAQGALNSIYLSALCVFGSVVIGMLFGSLAACGKEKTEKCLLVLT
FT                   DIVMAFPGIILAIVLSALTSGGPNAVIIALIFTGWPHYFRMVRSLLKGILVSPYVEAAK
FT                   LAGFPLPILLVKYVFPKLIPTLGVMATLAWGKAVLEISSLGFLGIGVAPPEPELGAMIS
FT                   EGIAYMRTDSRVVFLPGGVICLFVFALLLLGNENTDKTGGPQL"
FT   gene            complement(502478..503434)
FT                   /locus_tag="Amico_0467"
FT   CDS_pept        complement(502478..503434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0467"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: eta:ETA_13920 ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56608"
FT                   /db_xref="GOA:D5EDH6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDH6"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADE56608.1"
FT                   /translation="MVRIASFIRTYLLRMVIVALGVSTLCFLAVEFSPGDRAFDVAIAR
FT                   YGLDGATVSATEYVRDSEGLDRHPFVRYQAWLSSLIRGKWGHSMIGGEEIFPMLIRSFQ
FT                   RTAILGGVSLIFSLLLAFPLGIYCGCHPGGIIDISSSILSSLLVSFPSFIKGALLILLL
FT                   AVKLQLFPVAGFTSGWHIALPAIILAIGLAAESCRVIASSVKQVCQSEHYNFAQHKGLF
FT                   GHQLFLPHGLLNALVPITTYVGLQAAELLDGVVVIETLFACPGLGSHLLDALRSGDILA
FT                   IQGAGLLLGWIYVTVNSLTEWLSDSFTPADKKEGLVL"
FT   gene            complement(503422..504960)
FT                   /locus_tag="Amico_0468"
FT   CDS_pept        complement(503422..504960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0468"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: rhi:NGR_b06090 putative ABC-type dipeptide transport
FT                   system, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56609"
FT                   /db_xref="GOA:D5EDH7"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDH7"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ADE56609.1"
FT                   /translation="MKRCIFFAVCLSLFMFCLSLTPAWSASAQPLTIVSAWEASGMDPV
FT                   VSGFVFTRMGCLETLVTSDKKGGIEPRLATNWSVSEDGLTWTFNLRKNVVFHDGTLLTG
FT                   ETAALSLNRTLAKGSIFKGTPVKGFSGDGTKILATTESPFSALPAYLVHYSAAISAPAS
FT                   FDSEGKAITVIGTGFYRMTSFKEGKIIDFEGFDKYWGGKPAINEARYFAVSNPETRVLL
FT                   AESGEGDIVVDIPAEAALRLRENKNLTVISDPLPRVRLLTVNSALPFFSNAKVRSALSY
FT                   LIDRESITTALLKNSNAAATQLFPPVSAWHNKNLAPLAYDPEKGRALLKEEGWVPAGKE
FT                   GILTKDGHPFAFEILTYAGRPDLPLIAEVIQQALKNEGIAVSIRVEKSSMVPERHKNGT
FT                   LETAFIARNFGFVADPIGTLTSDFGPEKERGGWGAMNWSSPLFDDALTTYGQTFASEKQ
FT                   KPLRGTMTSILQEELPVIPVAWYDNHVTINKRVKGVSLDPSEVRPYPEGVEWSE"
FT   gene            complement(504994..505692)
FT                   /locus_tag="Amico_0469"
FT   CDS_pept        complement(504994..505692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0469"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: pmr:PMI2948 probable methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56610"
FT                   /db_xref="GOA:D5EDH8"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDH8"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADE56610.1"
FT                   /translation="MDTGISSNTTAERVASYWSWRSQVYDTTCSKHTQWHDIFLAPFKD
FT                   KKSLRLLDMGAGTGFLSLGFAKKGHRVTGIDLSPEMVNFARKMAREKNISIEFFLGDAQ
FT                   EPPLFSSPFDGITCRNLLWTLPNPLRALTAWKRLLKPQGLVVIADGLWEPRLYLAKEEP
FT                   VTIKFKEAYSEIREQLPYFLGLSAENGFSLLEQAGFSEISRHDHLFHENPYEYNNEFFV
FT                   LSAVNDCRKK"
FT   gene            505938..506216
FT                   /pseudo
FT                   /locus_tag="Amico_0470"
FT   gene            506327..507280
FT                   /locus_tag="Amico_0471"
FT   CDS_pept        506327..507280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0471"
FT                   /product="pyruvate formate lyase activating enzyme"
FT                   /note="KEGG: scl:sce0132 pyruvate formate lyase activating
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56611"
FT                   /db_xref="GOA:D5EDH9"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR040085"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDH9"
FT                   /inference="similar to AA sequence:KEGG:sce0132"
FT                   /protein_id="ADE56611.1"
FT                   /translation="MREGVNRFTLLSKDFEPAYVSLLHSGELKRRAEQALAGLESCTFC
FT                   PRCCGVNRMAGETGVCKTGLLPRVSNHFAHLGEENCLRGRRGSGAIFFAFCNLGCIFCQ
FT                   NYEISHLGEGVEVTPEQLALFMLELQLSGCHNINVVTPSHVVPQIIAAVSIAAENGLHL
FT                   PIVYNTSAYDSMCSLQLLDGIIDIYMPDFKMWNPDQALRYLTASDYPEVACQAIIEMHR
FT                   QVGDLKLDEHGLAKRGLLVRHLVMPGGVAGSEAILHFLAEKVSPHTYVNVMFQYHPAGE
FT                   VSCENFPEINCRPSRAEYLKIVQIACNLGLRLDACR"
FT   gene            complement(507339..507812)
FT                   /locus_tag="Amico_0472"
FT   CDS_pept        complement(507339..507812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0472"
FT                   /product="methionine-R-sulfoxide reductase"
FT                   /EC_number="1.8.4.12"
FT                   /note="TIGRFAM: methionine-R-sulfoxide reductase; KEGG:
FT                   glo:Glov_1981 methionine-R-sulfoxide reductase; PFAM:
FT                   Methionine sulfoxide reductase B"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56612"
FT                   /db_xref="GOA:D5EDI0"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDI0"
FT                   /inference="protein motif:TFAM:TIGR00357"
FT                   /protein_id="ADE56612.1"
FT                   /translation="MKYTLLLLTVGTIIFFVTTSVCATTIERIEKTDEEWKAILTPDQY
FT                   VITRKKGTEPPFSGAYWNLHEKGTYVCVCCGAVIFSSKEKFDSGSGWPSFWATVKDAPI
FT                   ATKLDSSFGMERTEVLCARCDAHLGHLFSDGPPPTGMRYCINSAALNFIAEEE"
FT   gene            508022..508828
FT                   /locus_tag="Amico_0473"
FT   CDS_pept        508022..508828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0473"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   sfu:Sfum_0522 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56613"
FT                   /db_xref="GOA:D5EDI1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDI1"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADE56613.1"
FT                   /translation="MSEYFEDKVAVVTGAASGIGLGITEHLLSRGAMAVFMGDVNEENL
FT                   KSESERLSIAHEGKVFSKLTDVTKLEQVENLIYTAKDFDGHLDFVFNNAGMGMTLPTEK
FT                   ITFDIWKLIIDLNVMGVVHGTYTAIPLMREQGFGHIINTGSITGRIPVPYQAVYAATKS
FT                   AVISMTESLQYELEAYGLQFSVFCPGNVATSIFGELTPPPDSISVDDAVNYIFQEMERN
FT                   SLVIILPQIMREIEALYRENRKEYDEIARKLASERRENYRTKGTYF"
FT   gene            complement(508868..510046)
FT                   /locus_tag="Amico_0474"
FT   CDS_pept        complement(508868..510046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0474"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_1924 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56614"
FT                   /db_xref="GOA:D5EDI2"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDI2"
FT                   /inference="similar to AA sequence:KEGG:Sfum_1924"
FT                   /protein_id="ADE56614.1"
FT                   /translation="MKKYNLLKTADIPFDVILLIIIGMIMLITGGLLLPISAGALPYYE
FT                   NGLYGLLLFIFALQIITLGQTPFGNMRRTKPLLAIGVAIAAIGIVTCFIPDIFNNIPRI
FT                   LLLLCFGLGGFLLFLQMLFSKDKLLSWLKYGGIFHSLVFGCGVVYLLSILIGALILKHN
FT                   LLTTSKTAVVIMVYGVTIIYLAEVLRKIYLLYPEAEKLNDTGIALSTDKAMILLTGIFM
FT                   ILLGVLLIPVNLGLLPFSGSAQLGLLMTIFAIQMLAFGNTPIGPFPRSWPIILFGLLFA
FT                   ALGITSCIIPEILVSPLTVLVGVLNILGGAIMLWRICSPILKKRDRPRDPVPLVLVKLT
FT                   FAQVTLNLVSVLFGTSMLVAHMIPGRVIGVILTINGCVLLYLLHILKLLDKM"
FT   gene            510407..511149
FT                   /pseudo
FT                   /locus_tag="Amico_0475"
FT   gene            511518..512477
FT                   /locus_tag="Amico_0476"
FT   CDS_pept        511518..512477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0476"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: son:SO_2944 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56615"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDI3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56615.1"
FT                   /translation="MKKLFALIVIGGLLVAATAALASTPVEGWWVHPTDKAPQNEVINI
FT                   QDDIDARIMELIDQYGAGADGKSAYEIAVENGFVGSEMDWLDSLIGEQGPQGEQGLSGD
FT                   DGQDGVNGLSAYELAVLNGFEGTEQDWLDSLHGGAPGPQGEPGEDGNSAYEVAVENGFT
FT                   GTLSEWLDSLVGEGVPTGGSAGQALVKASGDDYDTTWADVLTNEDLQEINEKNEEQDGR
FT                   IGSIENWQDSVNSRMDQFEDRLSDLEDPQFILGLNLRLTDTKRTTLEAFGDYSVTRGEV
FT                   DRYGLRLTFKLGKSYEEKLIENLQAEVEELKALLSKKE"
FT   gene            complement(512532..513002)
FT                   /locus_tag="Amico_0477"
FT   CDS_pept        complement(512532..513002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0477"
FT                   /product="methylated-DNA/protein-cysteinemethyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /note="TIGRFAM: methylated-DNA/protein-cysteine
FT                   methyltransferase; KEGG: ppd:Ppro_1338
FT                   methylated-DNA--protein- cysteine methyltransferase; PFAM:
FT                   Methylated-DNA-[protein]-cysteine S- methyltransferase DNA
FT                   binding; methylguanine DNA methyltransferase ribonuclease
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56616"
FT                   /db_xref="GOA:D5EDI4"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDI4"
FT                   /inference="protein motif:TFAM:TIGR00589"
FT                   /protein_id="ADE56616.1"
FT                   /translation="MRHLFFYQTPIGEIAIAEENDVITHLCFQSKDILKDMTIHETKIL
FT                   KEAGKQLKEYMEGKRKEFTLPLAPVGTEFMIRVWKSLCAIPYGETRSYKEIAESIGNKK
FT                   ASRAVGLANNRNPIPIFIPCHRVIGANGKLVGYGGGLHIKSFLLKLEMEYKN"
FT   gene            513184..513978
FT                   /locus_tag="Amico_0478"
FT   CDS_pept        513184..513978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0478"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   pca:Pcar_0812 small-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56617"
FT                   /db_xref="GOA:D5EDI5"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDI5"
FT                   /inference="protein motif:PFAM:PF00924"
FT                   /protein_id="ADE56617.1"
FT                   /translation="MNSFIDLSMPVIKSVALAILAVLIGLKVIHWITKTVEKIIERSSL
FT                   DKTLKPFIVSLVNALLKVLLVISIISILGIDTTSFVAVIAAAGFAVGLAFQGSLSNFAG
FT                   GVLLLALRPFKVGDYIEASGFSGTVQAIQILYTELVTVDNKVIFIPNGSLSNASIVNYS
FT                   VKSTRRVDFKFGVGHEADSHKVIEVLQGVVGNHALILKEPETFVRMSEHGESAIFFTVR
FT                   VWVNAQDYWTVYFDIIETVKRRFDEESISIPYPQMDVHLKQQ"
FT   gene            514179..514391
FT                   /locus_tag="Amico_0479"
FT   CDS_pept        514179..514391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56618"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDI6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56618.1"
FT                   /translation="MSKAQEIIDKIEKTAKDPNVSNAVIDGLLNEMVSLLNKEPEAWDL
FT                   CTDRVRFLLNERFCYTGPSSYGSYR"
FT   gene            complement(514439..515347)
FT                   /locus_tag="Amico_0480"
FT   CDS_pept        complement(514439..515347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0480"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; UAA transporter; KEGG: gbm:Gbem_2300 protein
FT                   of unknown function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56619"
FT                   /db_xref="GOA:D5EDI7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDI7"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADE56619.1"
FT                   /translation="MNNATNTQQSKLPDHYKGAAAALLSAFLFGFIPILAVSAYKKGIT
FT                   VMTFHFMRFIIASIALFCLLYFQKGHQVVMVGKKNFLQLFVLGGILFTLTSFSYFSSFQ
FT                   YIPASMAALIFYSYPALVAIGSLYVNKEPLTTKIILSITLSTVGLIFLSGKIDASVSMK
FT                   GVLLAGFAALSYTSYILYGNSLMKKTPYQVVVAFVCFFSAVSFFIVGKATHNLILPHTT
FT                   STWLLFCIISLVSLSGFLAFFLGVKLTTPSIAAILSMAEPLVTVVLSLLIFKEYLTILQ
FT                   YLGGILVLAGSFLALKACALR"
FT   gene            515559..516251
FT                   /locus_tag="Amico_0481"
FT   CDS_pept        515559..516251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0481"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sun:SUN_2018 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56620"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDI8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56620.1"
FT                   /translation="MKNKFFKGAIFFVLFVTFIFCYAQEGISKVTPPVKSAHIEYELSG
FT                   QTVGKKTVFFDSYGKNYYELRDEETTISFGGTKEVTQNKTLFIRTDSYTYNIDLLTNTG
FT                   TRMKNSDMEKMAAMYSGAMTPEQMKEKGEEMFKEMGGKILGKEKLLGYECVVAEVSGVR
FT                   TWVYEEHITLKSAMSLGTMEQKEEATLFEVNPSIPSSQFTPPGNIEYEDIDLSSMGMPP
FT                   GVSMQPQD"
FT   gene            516322..516825
FT                   /locus_tag="Amico_0482"
FT   CDS_pept        516322..516825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0482"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   dde:Dde_3013 ErfK/YbiS/YcfS/YnhG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56621"
FT                   /db_xref="GOA:D5EDI9"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDI9"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ADE56621.1"
FT                   /translation="MKIKNLILLTFFLCFFAAANNPALSGEKTYAHEPPDRIVVEKRKF
FT                   VLTLYREGKEVLSFPVAVGRNKGNKQRVGDLRTPVGTFMVERIHDSSHWVHDFKDGKGP
FT                   IKGAYGPWFIRLKTGWSGIGIHGTHDPGSIGQRATEGCVRLRNDHLELLVKHVEPGLVV
FT                   VIEE"
FT   gene            516941..517612
FT                   /locus_tag="Amico_0483"
FT   CDS_pept        516941..517612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0483"
FT                   /product="B3/4 domain protein"
FT                   /note="PFAM: B3/4 domain protein; KEGG: dvl:Dvul_1142
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56622"
FT                   /db_xref="GOA:D5EDJ0"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDJ0"
FT                   /inference="protein motif:PFAM:PF03483"
FT                   /protein_id="ADE56622.1"
FT                   /translation="MITTTDAFLKKFPKAHIGILIIKEVSNGSCHDCLNRVRENLEEDL
FT                   RSKFSMMSRAELRNQPVLRVYDQYFKLYGQNYPVLYQIESVAIKGRSIPIVNCLVTAMF
FT                   IAELKNMLLTAGHDFDKVEFPIVADIGDGDRYYTLINDTEKLVCDNDMLICDDKGVISS
FT                   VIYGPDKRTAITAETQNVLFVVYAPENIDKQDTLSHLEDIKNNVLLFSPRAKIDFMAVS
FT                   P"
FT   gene            517631..517747
FT                   /locus_tag="Amico_0484"
FT   CDS_pept        517631..517747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56623"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDJ1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56623.1"
FT                   /translation="MDSLQIKEVHLSHRLFILIEEKFRVHSQLSLLSINFDI"
FT   gene            517833..518162
FT                   /locus_tag="Amico_0485"
FT   CDS_pept        517833..518162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0485"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   gem:GM21_0411 cupin 2 conserved barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56624"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDJ2"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ADE56624.1"
FT                   /translation="MNHGTFEKGEKFEAGKMVEVQEGAIVSRTLIDYPTGTVTLFAFHR
FT                   GQGLSEHTAPYDALVQVLEGKAEISLAGTPQIVEKGEWLIMPANVPHGLRAIEDFKMAL
FT                   VMIRS"
FT   gene            518310..519584
FT                   /locus_tag="Amico_0486"
FT   CDS_pept        518310..519584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0486"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   sat:SYN_02462 type I secretion outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56625"
FT                   /db_xref="GOA:D5EDJ3"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR028351"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDJ3"
FT                   /inference="protein motif:PFAM:PF02321"
FT                   /protein_id="ADE56625.1"
FT                   /translation="MKKYVFLVLTAFLCMCHSTEGLSEEKIIFTTPLSLEQCLAIAEVH
FT                   HPNLKASRAKIDVADSQMGQVASKERPQVDVSSSYSRQESSAARDGDTYSTSAGISQLI
FT                   TDAGKTKAEKSIARLKKESASQNYKTIECQVQYNVKKTYFDALEAQKDLEVAEETLNLY
FT                   TLLLTQAQAFYDVGSVPKYDVTTAEVEQSKARLGVVTAKTAIKKARAELNNAMGVTEAP
FT                   EYVLKDVEERVSFSIPFDEVLKTALRKRADLLASEIGVKAAKESIRLAAKGNAPEVRAS
FT                   GKYAIGGSHPTEDDNWSVGVTLQIPLYDGGLEGEKINQARAELVVAEGEEESLRSDVRK
FT                   EVEQAYMEFIDSDEVLAVAQKTVQQAEENLTIAQNRYKVGVGSPIEVADATEKFKEAKQ
FT                   GYWSALYSHHRSWAALEKVVGGTVE"
FT   gene            519581..520786
FT                   /locus_tag="Amico_0487"
FT   CDS_pept        519581..520786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0487"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="KEGG: sat:SYN_01993 periplasmic component of efflux
FT                   system; TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56626"
FT                   /db_xref="GOA:D5EDJ4"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDJ4"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ADE56626.1"
FT                   /translation="MKKWIVVLLLLLALGGYFIISRKDASKAMVVETTPITRGKIIKTV
FT                   SATGSLQAVNTVNVGTQVSGTVKAIYADFNSITRKGALIAEIDPALLQANLETAKADVL
FT                   SAQADLAKAEATVKNTRKNRDRKKELYSRDLIAESELDAAQTEYDTALAQLKAAKASLA
FT                   QSQANLRHKEVSLGYTRITSPINGVVIDRTVEVGQTVNASQSAPTLFTIAEDLTKMKVE
FT                   ANIDEADIGQIEAGQRVEFTVDAYPELFFIGSIEEIRLAPNAEGNIVTYTVIIMVQNPD
FT                   LKLMPGMTANVSVIAKEKIDVFKVSNAALRFKPSPDFLASNGNGQNFNSARRNASSNQK
FT                   TLWLYDGKEFKPLPVSIGISDGLYTEISGNVNEGMNVVTSILSGKTNSNGGGSPFVPGP
FT                   RR"
FT   gene            520764..521459
FT                   /locus_tag="Amico_0488"
FT   CDS_pept        520764..521459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0488"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: sat:SYN_01994 ABC transporter ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56627"
FT                   /db_xref="GOA:D5EDJ5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDJ5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADE56627.1"
FT                   /translation="MYLVRVDNIYKTYSMGEVDVTALQGVSFSVKKGEFLSIMGASGSG
FT                   KSTLMNIIGCLDTPTEGHYYLDGTDVSTIDENQLADIRKNTIGFVFQGFNLLPRMTALE
FT                   NVELPMLYSGISARKRHERALHALQIVDLEDRANHQPQQLSGGQQQRVAIARALANDAP
FT                   LILADEPTGNLDSKTGIDVMKLFVRLNVESGKTIIQVTHERDMALFGSRIITVKDGTIV
FT                   HDERVNPTC"
FT   gene            521453..522676
FT                   /locus_tag="Amico_0489"
FT   CDS_pept        521453..522676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0489"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   sat:SYN_01995 export ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56628"
FT                   /db_xref="GOA:D5EDJ6"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDJ6"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADE56628.1"
FT                   /translation="MLSLYETSKISFRSLRANKTRSALTMLGIVIGVMAVIIMFAVGSG
FT                   ANKEIAERFSSLGSNMIVVRPETITFGGSRSYIAHNLTIDDAMSIGEECSAVAYVAPYY
FT                   GGTAQAVYGNENYPARVTGTTSDYLFVRDLSLASGRTFTDQDVRSATKVCIVGQTIVDN
FT                   LFVTEDPIGKILRLKGVPMVVIGLLNKIGESAMGRDEDDIVLVPITTVQRRLFSPQRMG
FT                   MASSISVKALSEQHLDLAQEQIEALLAQRHRIKPGESNDFTVRNLTQMVESAKSATRVM
FT                   SLLLTAVAGVSLLVGGIGIMNIMLVSVTERTREIGIRMAIGAKRADIRLQFLVEALTLS
FT                   LLGGITGIILGIAGAEVISKALGWTVDISLLSVVLSFGFSGCVGIFFGFYPAYKASLLN
FT                   PIEALRYE"
FT   gene            complement(522733..523989)
FT                   /locus_tag="Amico_0490"
FT   CDS_pept        complement(522733..523989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56629"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDJ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56629.1"
FT                   /translation="MSYEKFCIMPQTLEDINCFLSDTKNKTLTDLRRVVSKYGTVSEIN
FT                   EKAHEAGKVESLLEKVKHANPSHVKELDWLQAAKDCGDFISLSEYRSRIDPDRPAWSYD
FT                   ETRAVTLEISAMQYFPWLIAEAKQAKEKGEILPGRFIRVRKMKEQEADNGDLPAVRAAI
FT                   KILGASCVETLDTKGTDGSNIHLGGPDTITGYFGGIGQPNSHPLKWIDELLYYYVNYGV
FT                   DEVLNINPGTVFLGYLLYRLGVNIRFKISVFMGNDNPYSVLWTLLAARLFARDDGTTPL
FT                   AGFNLSNSIDGEHIAKSAEIRRELGLEDDVRIEHHITETWKSIVRQPYDRRDELLELAK
FT                   TIPNISAKHEGGNPEDEQQLYHQSDILDYFRDKKEIVGTGDWEALTRNYLLKHKAVNTT
FT                   AEALTKAGLSFIAAGVHRL"
FT   gene            complement(524051..525079)
FT                   /locus_tag="Amico_0491"
FT   CDS_pept        complement(524051..525079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0491"
FT                   /product="Homoserine dehydrogenase"
FT                   /EC_number="1.1.1.3"
FT                   /note="KEGG: rlt:Rleg2_5063 homoserine dehydrogenase; PFAM:
FT                   homoserine dehydrogenase; homoserine dehydrogenase
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56630"
FT                   /db_xref="GOA:D5EDJ8"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR022697"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDJ8"
FT                   /inference="protein motif:PRIAM:1.1.1.3"
FT                   /protein_id="ADE56630.1"
FT                   /translation="MKIWGLCFIGFGNVGQGLARILVREEEKLYHKWGFKFKTLAVVGR
FT                   TKGACKNPEGISLQALLNRLDRGESIGTDLISPLEAVRLSGVDIVIDVTPTNLTTGEPG
FT                   LSITRAALNEGKHVISSNKGPVSLAFHELQKLASDKRCEYRFEGTVMSGTPAINLALES
FT                   MAGCEFYEIQGIVNGTTNYILTRMEEGLEYDVALKEAQDLGYAETNPEGDMDGWDAAVK
FT                   AQIIANVIMRNTIPLSKVTRKGIAGLSRKNIQAAKSKGAKIKLLAHIQRTSNGISASVA
FT                   PVELPLSHPLAGVDGATNAITYTTNNIKNVTIIGPGAGREETGQALLSDMLSIVAHEQV
FT                   LF"
FT   gene            complement(525178..525282)
FT                   /locus_tag="Amico_0492"
FT   CDS_pept        complement(525178..525282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0492"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56631"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDJ9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56631.1"
FT                   /translation="MSSKNHSINEISLINVTTTTTMTTCVDPPGAVGV"
FT   gene            complement(525394..525945)
FT                   /locus_tag="Amico_0493"
FT   CDS_pept        complement(525394..525945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0493"
FT                   /product="ferritin Dps family protein"
FT                   /note="KEGG: gem:GM21_2517 ferritin Dps family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56632"
FT                   /db_xref="GOA:D5EDK0"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR014490"
FT                   /db_xref="InterPro:IPR033921"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDK0"
FT                   /inference="similar to AA sequence:KEGG:GM21_2517"
FT                   /protein_id="ADE56632.1"
FT                   /translation="MAKVAREMVEKAGVDVEKLLKLLVANAAAELTTFYYYTILRCNLI
FT                   GLEGEGIKEIAETARIEDRNHFEALVPRIYELGGKLPDDMKAFHDISACPPASLPKDPT
FT                   DVKAILMVLVNAERCAVRGYTEICHLTAGKDHRTYELALAILNEEIEHESWFSEFLGEG
FT                   PSGHFLRRGETSPFVSKFMR"
FT   gene            526180..526380
FT                   /locus_tag="Amico_0494"
FT   CDS_pept        526180..526380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0494"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="KEGG: pca:Pcar_0201 cold shock protein; PFAM:
FT                   Cold-shock protein DNA-binding; SMART: Cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56633"
FT                   /db_xref="GOA:D5EDK1"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDK1"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ADE56633.1"
FT                   /translation="MTQGTVKWFNGTKGYGFITGEDGKDYFVHFSAIQVDGFKTLDEGQ
FT                   KVSFDIESGQKGPQAANVKPL"
FT   gene            526613..527647
FT                   /locus_tag="Amico_0495"
FT   CDS_pept        526613..527647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0495"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: glo:Glov_2858 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56634"
FT                   /db_xref="GOA:D5EDK2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDK2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56634.1"
FT                   /translation="MALYVTGDKHGTVEMDELLPFYYAVGKNLSEHDFLLIMGDFGLLF
FT                   APEPTQKELEWLQWLSSMPWTTLFIDGNHENFTRLDDLPTEKHFGNPVGVITDKIFHLK
FT                   RGYVYTIENYACFTFGGALSIDRCFRRPGISWWEREIPSEEEMVRGWQSLEQVRWKVDY
FT                   VFTHMAPFSVLLELLRAKYIGITLNPCHVPRDPVALYFDTLVPRLHFRQWYFGHLHVQT
FT                   PPFSVGIEGEGVYQALYRLVIPVEESLMSAEPLAVREHREESLSQILFKTKSLLSLIEH
FT                   HGELLNAWLEFEQVLQGHDIMAFHTLIRRTALEEVEEAIESCKRKGYYHLLLVLKVEFK
FT                   EMSC"
FT   gene            527681..528436
FT                   /locus_tag="Amico_0496"
FT   CDS_pept        527681..528436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0496"
FT                   /product="Allophanate hydrolase subunit 1"
FT                   /note="KEGG: dat:HRM2_46540 putative allophanate hydrolase
FT                   subunit 1; PFAM: Allophanate hydrolase subunit 1; SMART:
FT                   Allophanate hydrolase subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56635"
FT                   /db_xref="GOA:D5EDK3"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDK3"
FT                   /inference="protein motif:PFAM:PF02682"
FT                   /protein_id="ADE56635.1"
FT                   /translation="MVLIEKQWPKIRCAGDSCVVIEYGDAISLDVNGRVQALRRTLESK
FT                   KVSGLRELVPTYCSLAVYFDPLAIDFLRFFPLINRLASEAESDFIGEKGRGVIIPVCYS
FT                   FEFGPDLQNVIHHSGLSEEEVIKRHSSVDYYCYMLGFTPGFSYLGGMDESISTPRLVEP
FT                   REKIPAGSVGIAGRQTGIYPIDSPGGWQLIGRTPLRMFDATREPPTLTDGGLWIRFRPI
FT                   SPNEYALIEEQVSHGEYTLEMFDKGEVPA"
FT   gene            528433..529512
FT                   /locus_tag="Amico_0497"
FT   CDS_pept        528433..529512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0497"
FT                   /product="urea amidolyase related protein"
FT                   /EC_number="6.3.4.6"
FT                   /note="SMART: Allophanate hydrolase subunit 2; TIGRFAM:
FT                   urea amidolyase related protein; KEGG: bbr:BB4478
FT                   hypothetical protein; PFAM: Allophanate hydrolase subunit
FT                   2"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56636"
FT                   /db_xref="GOA:D5EDK4"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDK4"
FT                   /inference="protein motif:TFAM:TIGR00724"
FT                   /protein_id="ADE56636.1"
FT                   /translation="MKIKVAQPGMLTTVQDMGRWGFQGKGMPVAGAMDLFALKSGNVMV
FT                   GNEEGAACLEVTVLGPTLTVIEGEGAVVATGADLGFSINGISYPCNNVLKVGEGDTLSF
FT                   SGMKGNGCRAYLVFSGGVDVPVVMGSRSTYLRAQIGGVDGRALVKGDIFITGEPHILWR
FT                   RFVDFQCPVAVLPERRTGRPLRVVLGPQDDAFSPKGIETFFSEPYKITESADRMGYRLK
FT                   GAVIEHSGGADIISDAIPLGAVQVPGDGQPIVMLADRQTTGGYTKIAVLCSPDIAEIAQ
FT                   YLPGQEIRFQQVSFEEAVSLAKQESDQIIKLRQSVAAWITRIVPPMSECETEILMTSGT
FT                   WELSVDGETHTVSWESLDY"
FT   gene            529536..530309
FT                   /locus_tag="Amico_0498"
FT   CDS_pept        529536..530309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0498"
FT                   /product="LamB/YcsF family protein"
FT                   /note="PFAM: LamB/YcsF family protein; KEGG: bbr:BB4725
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56637"
FT                   /db_xref="GOA:D5EDK5"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDK5"
FT                   /inference="protein motif:PFAM:PF03746"
FT                   /protein_id="ADE56637.1"
FT                   /translation="MFSVDLNSDLGESFGVYVLGHDEDVMKSITSANIACGFHAGDPQV
FT                   MLKTVQEAVVKGVAVGAHPGYPDLMGFGRREMACSPDEVYAYCLYQIGAIQAACKVYGI
FT                   PLQHVKPHGAMYNQLAKNPALAEAVARAVRDGGEGLILLGLAGTCFEKAASEAEIPFAV
FT                   EAFADRAYQSDGTLVPRKQPGAVIHDIELAASRVVRMVKEGVVEAIDGTLVPLRPHSIC
FT                   LHGDTQGAVAMAAAIWEILVQEGISIQNIKEVLGI"
FT   gene            530306..531103
FT                   /locus_tag="Amico_0499"
FT   CDS_pept        530306..531103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0499"
FT                   /product="protein of unknown function DUF1445"
FT                   /note="PFAM: protein of unknown function DUF1445; KEGG:
FT                   par:Psyc_1103 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56638"
FT                   /db_xref="GOA:D5EDK6"
FT                   /db_xref="InterPro:IPR009906"
FT                   /db_xref="InterPro:IPR016938"
FT                   /db_xref="InterPro:IPR038021"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDK6"
FT                   /inference="protein motif:PFAM:PF07286"
FT                   /protein_id="ADE56638.1"
FT                   /translation="MKGADFCSCTPQEVRELIRQGKYNLPTPGMAKGHVQANLVILPKD
FT                   WAYDFLVFAQRNPKPCPVLDVTEPGDPEPKMIAPGADIRTDIPKYKVWIDGLCVDEPTD
FT                   IIKYWRDDLVGFLLGCSFTFESALLGAGIPVRHIEIGSNVPMYVTNIQCKSAGRLSGPM
FT                   VVSMRPIPYTQVPKAVLSTGRFPAVHGAPVHIGNPAAIGIKDIHSPEFGDAVPIYDNEV
FT                   PVFWACGVTPQAALMVSKPPFAITHAPGYMFVADSLDSSYAVF"
FT   gene            531124..531765
FT                   /locus_tag="Amico_0500"
FT   CDS_pept        531124..531765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0500"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: pca:Pcar_3030 L-fuculose-1-phosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56639"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDK7"
FT                   /inference="protein motif:PFAM:PF00596"
FT                   /protein_id="ADE56639.1"
FT                   /translation="MKLQEEREAIVAYCQKMITSRLTTGTGGNISICNRARGEVAMTPT
FT                   GVDYFEMKADDIVIINLDGEIVEGTTKPSSEAGMHLALYHKRDDISAVVHTHSVFATTI
FT                   ACLRWELPPVHYLIGYSGKKVPLAPYATYGTTELAQNVAEAIGSYNAVLLANHGLVTVG
FT                   SSLSRAFSTAEEIELVSEIYYRTKSIGEPVILSKEEMDNVLRKFGSYGKQ"
FT   gene            complement(531809..532099)
FT                   /pseudo
FT                   /locus_tag="Amico_0501"
FT   gene            complement(532171..532890)
FT                   /locus_tag="Amico_0502"
FT   CDS_pept        complement(532171..532890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0502"
FT                   /product="Asp/Glu/hydantoin racemase"
FT                   /note="PFAM: Asp/Glu/hydantoin racemase; KEGG: bbr:BB1531
FT                   putative decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56640"
FT                   /db_xref="InterPro:IPR026286"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDK8"
FT                   /inference="protein motif:PFAM:PF01177"
FT                   /protein_id="ADE56640.1"
FT                   /translation="MFGWRARLGLLVPCINTVLEPEFRHILPIGIDFFTTRMLMKGSSK
FT                   LEKLSSMESSLDLCLESLIDITDIFLYACTSGSFIKGLTWDNELQHRIYMKTKKKAVTA
FT                   MQSLVYALHVFSAKNIVVATPYIPEVNEKQRSFFQECGFNVLKIEGMNIIEHGGSGYIE
FT                   SESIYDFAKQVLTGTSPDVLVLSCTNFRTLNIIEKLETDLNIPVISSNQALLWNALRSL
FT                   NITEMILGHGSLLKGIK"
FT   gene            complement(532901..533782)
FT                   /locus_tag="Amico_0503"
FT   CDS_pept        complement(532901..533782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0503"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56641"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDK9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56641.1"
FT                   /translation="MQKKVYFIPVIDVSWNAFGPLNPRKNYSHESPPLNLCVKELEVML
FT                   DLMVKLYNGNFAVAIHTGTYCRDSFTEEPFLSIWHQVERIGGELLIHTHEEIAAKGTLN
FT                   SNEQHMKKVIYRQFDRLKSANLHPVGYRGGLYGFAPFLTSYLEELGLNVDLTPAPGFQN
FT                   KERNASWSNCPFSAFYLGKGDDLVSPKNEIETSSVLSIPLGASGSGTDNTDYLYIDYDL
FT                   STLKSILSIWNAILDRAQKKNTPQFVHTLFHTNSMSNREMLERYRYFTETALVHGKALT
FT                   PTKLVKRFSKKG"
FT   gene            complement(533853..534506)
FT                   /locus_tag="Amico_0504"
FT   CDS_pept        complement(533853..534506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0504"
FT                   /product="protein of unknown function DUF1121"
FT                   /note="PFAM: protein of unknown function DUF1121; KEGG:
FT                   dal:Dalk_2774 protein of unknown function DUF1121"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56642"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDL0"
FT                   /inference="protein motif:PFAM:PF06555"
FT                   /protein_id="ADE56642.1"
FT                   /translation="MNNKYNDIRFKFLHILGETVVNSLKKRGFLATYVNQKEEALRLIC
FT                   DLIQDGSSVGIPGSVTIREIGAIAALKEKGCTIYEHWNMPLTIEEKNKIFIRENSADYF
FT                   LTSSNAVTRNGILVNVDGVGNRISGMSWGIGELIYVISMNKVADNLEAAFSLIRNRSCV
FT                   LSALRRGVDSPCAQVGYCVNCMTSQKVCKAFLIQEAPPTGRKANVILVGQTLGC"
FT   gene            complement(534560..535285)
FT                   /locus_tag="Amico_0505"
FT   CDS_pept        complement(534560..535285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0505"
FT                   /product="Asp/Glu/hydantoin racemase"
FT                   /note="PFAM: Asp/Glu/hydantoin racemase; KEGG: avi:Avi_7410
FT                   arylmalonate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56643"
FT                   /db_xref="InterPro:IPR026286"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDL1"
FT                   /inference="protein motif:PFAM:PF01177"
FT                   /protein_id="ADE56643.1"
FT                   /translation="MFGWRARLGLMIPTNNTVIEPELALLTPSGVALYTTRMISSRSGY
FT                   ASVSGLQHIVSNVERATEELSITGVNAFLYGCLSTSFVHPDWEASYASHIRKRSKSPAI
FT                   TAMSATISAIRSFNTDDIALLCSYESEMLRLGLNRFAADKINVVSVHSLGISNFSTLSN
FT                   ITNIDIYRSARSMDLKEAKMLCILATDIPSVKIINTLEKDLGIPVISTNQSLLWNVLNE
FT                   LKINVNNKDFGSLFDRKII"
FT   gene            complement(535314..537212)
FT                   /locus_tag="Amico_0506"
FT   CDS_pept        complement(535314..537212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0506"
FT                   /product="TRAP transporter, 4TM/12TM fusion protein"
FT                   /note="KEGG: pmr:PMI1055 TRAP-type C4-dicarboxylate
FT                   transport system permease component; TIGRFAM: TRAP
FT                   transporter, 4TM/12TM fusion protein; PFAM: TRAP
FT                   C4-dicarboxylate transport system permease DctM subunit;
FT                   Citrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56644"
FT                   /db_xref="GOA:D5EDL2"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="InterPro:IPR011853"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDL2"
FT                   /inference="protein motif:TFAM:TIGR02123"
FT                   /protein_id="ADE56644.1"
FT                   /translation="MIKNAGNNLSIIRKHPLELIEKKVIEWSCIAFAAFGILTNSWWML
FT                   SSIEKSGVFLAFTLFIIFLSKPLKFKQKNLHYLDWFLAILGIIVGFYTTFTAKQFAINM
FT                   LAAETRDYIMAGIAFFLVLEAARRTLGIWMVVIPSFFALYALLGHLIPGPLGHYGFTLK
FT                   RFLLRMYLVDEGIYGITTQIASSYIFLFILFGSLLAESGVGEFFTDLANKIAGASAGGP
FT                   AKVATISSGLMGTISGSAAANVATTGAFTIPMMKKIGFNPEFAGAVEAVASTGGMVMPP
FT                   IMGAAAFIMAQYLGTSYNTIMIAALVPAILYYVSVFSWVHFYARKHNIYGLKRSEIPPI
FT                   ENFTRKLTLLLPLGVIIWALFSGYTPIYAAFYGMIATVIAAIIQKKKFTLANLTNGLRD
FT                   GAFSSINAIIACIAAGIIVGVSAMTGIGQVITYNIVGLAGNNLFFALLLTACASLILSM
FT                   GLPATACYIVVGTIVAPALVKMGAIPLAAHMFVFYFSCLSNITPPVAIACYTAAGIANA
FT                   KPFGVAWKSVLIAAPGFLIPFLFTYNPVLLCAKGCISFFFLLSVFTALIGVVFMAIAGT
FT                   GYFIKTISPIPRLLFFAGSILLIFPGLQTDIIGFIVIVVASLPQIRVHTKSRSLKD"
FT   gene            complement(537323..538303)
FT                   /locus_tag="Amico_0507"
FT   CDS_pept        complement(537323..538303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0507"
FT                   /product="TRAP transporter solute receptor, TAXI family"
FT                   /note="TIGRFAM: TRAP transporter solute receptor, TAXI
FT                   family; KEGG: bbr:BB4954 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56645"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDL3"
FT                   /inference="protein motif:TFAM:TIGR02122"
FT                   /protein_id="ADE56645.1"
FT                   /translation="MCKVKTKFTVTLFFLVMLFVFITPLRSNANMRINIATATTGGSYY
FT                   PGGIALAQLWSEKDVANASASTSSGSVENVSLLMGNEANVVACQSNILQYAYEGIETYQ
FT                   GKPHPQLRILSPNFSQPYQFVVKKSSNLESISGWKGKRIVVGRVGSGTFVTHERIFKVF
FT                   GINISDIKANNIGQSEGIDAIRNGLADAAICIGIVPLAPISDALAAPGSDVTIYSLNEK
FT                   EIQSILEQNVWMSPMTIPAGSYKGLDHDVETIGHVGFWIVRDDFPEDVAYNLVKAMHEN
FT                   ADWLKTAYSGYDNPSFLQPATVINRMPVPVHPGALRYYKEVGLLK"
FT   gene            complement(538344..539252)
FT                   /locus_tag="Amico_0508"
FT   CDS_pept        complement(538344..539252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0508"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pol:Bpro_3857 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56646"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDL4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56646.1"
FT                   /translation="MTKEISQEFVNEIFQGAIDCHQHTGPSLFARTCDSIESALEAKEA
FT                   GMRAICFKNHQGITSDRATLVAKATGMECYGGICMNRYSGGINPYSVEAAMRMGGKYIW
FT                   FPTQWAQHHIDTYGRPEYFHMKIQIQYGKENATTKGIYILKEDGTLTDETMEVLTLAKE
FT                   HNAAIASGHLSKNEIVTLFKKAHDMGLDKLVLQHVQLNELWTWSPTEQKELVDLGVLIE
FT                   HVSLYIYEGRYLISPKENLDLINVVGPENVVFGSDCGQLKVPTPTSGLKGYVKALLEAG
FT                   ASVESINIMLKKNPARILGLD"
FT   gene            539693..539803
FT                   /locus_tag="Amico_0509"
FT   CDS_pept        539693..539803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56647"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDL5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56647.1"
FT                   /translation="MAEVKINLNNPLVQSLLTGDLSGLENLVGKVLNAAL"
FT   gene            539957..540954
FT                   /pseudo
FT                   /locus_tag="Amico_0510"
FT   gene            complement(541220..541882)
FT                   /locus_tag="Amico_0511"
FT   CDS_pept        complement(541220..541882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0511"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: cti:RALTA_B1520 putative transcriptional
FT                   regulator, HTH GntR; PFAM: regulatory protein GntR HTH;
FT                   GntR domain protein; SMART: regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56648"
FT                   /db_xref="GOA:D5EDL6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDL6"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADE56648.1"
FT                   /translation="MGIKVFQSLGDQVFETLKEKIVNNEYKPGELMQIDKLASELGVST
FT                   TPVREALLRLESMGLVCIERNKGAVVTQVSKKLAQYTWEFRRLLEAHTSRDAAIHCSDA
FT                   ELEALESTLQTVLAHPSDFELYKKSDLAIHALLSKYTENYLIINSLNNLSINARRIRYF
FT                   AEEGPFPEEVIVPVTYEHLSIVEALKYHNPDLVEQRVKMHLENAEKRTMKSPFFDNE"
FT   gene            541987..543276
FT                   /locus_tag="Amico_0512"
FT   CDS_pept        541987..543276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0512"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein; Transketolase domain protein; KEGG:
FT                   sfu:Sfum_0017 2-oxoglutarate ferredoxin oxidoreductase
FT                   subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56649"
FT                   /db_xref="GOA:D5EDL7"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDL7"
FT                   /inference="protein motif:PFAM:PF01855"
FT                   /protein_id="ADE56649.1"
FT                   /translation="MLKILSAMYVIYLTFSIAHVITYFTLFKKKENIVCQYKLKGALSM
FT                   GTSDENKQSRVLSGVHFMLGNYACVEGALAAGCDFFAGYPITPANEISERMSQRLPAVG
FT                   GHFLQGEDELCSIYAISGASLAGAKAMTATASAGYNYMQEGIGYAVAIEAPIVIVDVQR
FT                   CRGENFATQADVMQMRWGVSGDHEMIVLAPSSVQELFDYTVRAFNLAEQYRTPVVVMSE
FT                   TTIALMRERLSIPEASDIPIVHRKRTTASPEEYMPFKADPFGVPDFAELGEGYHTIYSL
FT                   NPHDEKGSIDWDPDVFERLYKRITGKIWENRHSISTTQTFNMGDADVALIAYGSEVRPC
FT                   LDAMDLAREKGMKVGVLKLDAVWPVPEEAIRDVAKNVGTVISVEMNIGKYAGEIERVCG
FT                   GLCKTARATRNRGLIHSPQEIVTVIEEVWA"
FT   gene            543276..544091
FT                   /locus_tag="Amico_0513"
FT   CDS_pept        543276..544091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0513"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding protein"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; KEGG: ppd:Ppro_2324 2-oxoglutarate ferredoxin
FT                   oxidoreductase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56650"
FT                   /db_xref="GOA:D5EDL8"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDL8"
FT                   /inference="protein motif:PFAM:PF02775"
FT                   /protein_id="ADE56650.1"
FT                   /translation="MLKNPLRKYMREEKLPHMFCPGCGCGQVLNTFLQVVDEMQIDLDS
FT                   TVAIGGVGCTARIPVYIKTDMLHGVHGRTLAWATGIKLHKPQTRVIIFAGDGDAAAIGG
FT                   NHFIQAARRNLDVTMIVVNNFNFAMTGGQVAPMTPAAAVTMTTPYGSGEPPFDLCKVAE
FT                   AAGATYVARSATPFQPQMKSLMKSALSHKGFAVLEILSQCPTHFGRYALNTGQPQKIFE
FT                   WIRSICVMAKKAENMSEEELEGKTVLGEFVNKQRPVFEGSSVYREGVQA"
FT   gene            544088..544654
FT                   /locus_tag="Amico_0514"
FT   CDS_pept        544088..544654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0514"
FT                   /product="Pyruvate/ketoisovalerate oxidoreductase"
FT                   /note="PFAM: Pyruvate/ketoisovalerate oxidoreductase; KEGG:
FT                   afw:Anae109_1896 pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56651"
FT                   /db_xref="GOA:D5EDL9"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDL9"
FT                   /inference="protein motif:PFAM:PF01558"
FT                   /protein_id="ADE56651.1"
FT                   /translation="MKPLSIRLCGYGGQGIILSAIILGETAVTKQGLYAVQTQSYGSEA
FT                   RGGQCQSELIISDTPIRTPIQEKNDILVALFQTAFRSYVPGLKKDGLLIVDSELVPDLS
FT                   GVGSEVSIYKIPATEIAIGLGNKMAANMVVLGYLQAKTNLFTKEHLLDVVRDTVKPRFW
FT                   DLNKRAVEAGVQFALDPEDKADETL"
FT   gene            544641..545774
FT                   /locus_tag="Amico_0515"
FT   CDS_pept        544641..545774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0515"
FT                   /product="Succinate--CoA ligase (ADP-forming)"
FT                   /EC_number="6.2.1.5"
FT                   /note="KEGG: mlo:mlr1324 malate--CoA ligase subunit beta;
FT                   PFAM: ATP-grasp domain protein; ATP-citrate
FT                   lyase/succinyl-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56652"
FT                   /db_xref="GOA:D5EDM0"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDM0"
FT                   /inference="protein motif:PRIAM:6.2.1.5"
FT                   /protein_id="ADE56652.1"
FT                   /translation="MKLYEFQGKELFARCGISVPKRRLVRSFEDLETLDAPLVLKSQVL
FT                   SGGRGKAGGVVVCDDNASLVQEGKRLIGSSLKGERVLALLAEEKVDILQEYYLSFVIDG
FT                   ELKKPLIIASAAGGMEIEKVAEEEPEKILKLSFDPLAGPSDYHFRRIADFLSLRNELKD
FT                   LRKVLRAMYALFNQYDASLIEINPLVKTSAGLIALDSKINLDDDAEFRQKEIFQEFQEQ
FT                   QNVIQQNNAKAKDEGTITYVPLDGNIGMISDGAGTGMLSLDLIRDFGGEAADFCEMGGL
FT                   TSPDVMYQAMETVFNRATKELKSLLVILIGGFNRMDEMAEGIIRYKNDHGLSVPLFVRL
FT                   CGTMETEGKKMMIDSGLPVFDDLEEAVEKAVMAAEGE"
FT   gene            545777..546643
FT                   /locus_tag="Amico_0516"
FT   CDS_pept        545777..546643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0516"
FT                   /product="succinyl-CoA synthetase, alpha subunit"
FT                   /note="KEGG: nis:NIS_0839 succinyl-CoA synthase, alpha
FT                   subunit; TIGRFAM: succinyl-CoA synthetase, alpha subunit;
FT                   PFAM: ATP-citrate lyase/succinyl-CoA ligase; CoA- binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56653"
FT                   /db_xref="GOA:D5EDM1"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDM1"
FT                   /inference="protein motif:TFAM:TIGR01019"
FT                   /protein_id="ADE56653.1"
FT                   /translation="MSILINADTKVLVQGITGRSGALQTQTLIEYGTRIVAGVTPGKGG
FT                   MIVHDIPVFDFVSEAVSRYGADAAISFVPPALAKDAAFEIIDSAIPLLVLTMEGIPQKD
FT                   VLAIISYASAHNTRIIGPGAAGLIAPGKCKLGAHPARMFKEGHVGVVSKSGALSYEMGK
FT                   TLTEAGIGQSTVVALGGGPIWGTTQKEIVELFEKDPETEIILLLGEIGGATEIKAAEYI
FT                   AEHVTKPVVSLIVGRSAPEGKSLGHAGAIIRGNKGTAASKMKALAKSGVYVAQNPREVI
FT                   EIIRKLR"
FT   gene            546649..546849
FT                   /locus_tag="Amico_0517"
FT   CDS_pept        546649..546849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0517"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: dal:Dalk_1630 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56654"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDM2"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ADE56654.1"
FT                   /translation="MTIHIDKDLCKGCGLCVEACPTNVYAITGETNRKGFAVVTAVNAE
FT                   KCVKCRICEKTCPDLALYIEE"
FT   gene            546866..548068
FT                   /locus_tag="Amico_0518"
FT   CDS_pept        546866..548068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0518"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   gur:Gura_2501 aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56655"
FT                   /db_xref="GOA:D5EDM3"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDM3"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADE56655.1"
FT                   /translation="MSRKVLSDLVAGIEPSPTEETSFLANSLKRQGVDVISFAQGEPDF
FT                   DTPDYIKNAAIEAVQEGFTKYTDVPGILELREAVVQKLKRQNNLDYDVLEVLIGNGGKQ
FT                   LLYEVFATLCDPGDEVVIPTPCYVSYVDQIRLTGANAVFMPTQEVNKFRPRLEEVQKIW
FT                   NPKVKVFVLNSPCNPTGAVFEEEEMRKIMDFLVEKETFVVTDEVYEYLLYNGAKHTSPA
FT                   ALDIRYKPWCVLVNSVSKTYAMTGWRVGYAAGPKEIIKGMNALQGHVTGNVNSIAQKAV
FT                   VEALSGPQEDIVLMVGEYAQRKDYIVNRINSINGLSCIDPDGAFYIFANVKKLIGKTFG
FT                   RERIKNDKDVAKFFLNVAHVAVVPGIAFGYEGYVRFVFAKSLDTIKEGLDRIEKAILRL
FT                   E"
FT   gene            complement(548137..549168)
FT                   /locus_tag="Amico_0519"
FT   CDS_pept        complement(548137..549168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0519"
FT                   /product="Homoserine dehydrogenase"
FT                   /EC_number="1.1.1.3"
FT                   /note="KEGG: rhi:NGR_b07030 homoserine dehydrogenase; PFAM:
FT                   homoserine dehydrogenase; homoserine dehydrogenase
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56656"
FT                   /db_xref="GOA:D5EDM4"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR022697"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDM4"
FT                   /inference="protein motif:PRIAM:1.1.1.3"
FT                   /protein_id="ADE56656.1"
FT                   /translation="MRIALIGFGGVGKAFIELLHDKHEILKSMGLTLILKSVMNSKGGI
FT                   YNPMGIDPLRLIEHVHQGGELCEFPDEGIRKETFQNLIMRRDVDLLIETTPTNNKTGEP
FT                   GLTHISKALERGFHVVTANKGPVLLAYKQLCTLAAKSHVQLGIGCTTGGALPTINAGRF
FT                   DLAGAQILSIEGILNGTSNYILSEMEERDCSYEEALKQAQQMGIAETDPSLDVEGWDTA
FT                   TKLLILTNILMEEEHKLREIRVEGITRLSPQHIQEAKKEGKRLKLIGKAEKGNNRTALT
FT                   VGIEALSQDHPLFNVNSTNKAVRYITDTLGDLTVIGGASGTKSAAASILRDIINIYKGY
FT                   PFV"
FT   gene            549292..549804
FT                   /locus_tag="Amico_0520"
FT                   /note="Contains selenocysteine"
FT   CDS_pept        549292..549804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:549685..549687,aa:Sec)
FT                   /locus_tag="Amico_0520"
FT                   /product="protein of unknown function DUF395 YeeE/YedE"
FT                   /note="KEGG: dvm:DvMF_0175 protein of unknown function
FT                   DUF395 YeeE/YedE; Contains selenocysteine"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56657"
FT                   /db_xref="GOA:D5EDM5"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDM5"
FT                   /inference="similar to AA sequence:KEGG:DvMF_0175"
FT                   /protein_id="ADE56657.1"
FT                   /translation="MQRKMRPMNPYVAGSLAGLLSVASTWLSGKYFGASTSFVRSAGFV
FT                   EKTLASEHFSTVGYLVKNAPKIDWQLMFVAGIFLGALVSSLVSGTFRFQWVPDSWEDRF
FT                   GKRIFPRAIIAFFGGIVAMFGARLADGUPSGHGLSGSLQLAVSGFIALVLFFGAGMLVA
FT                   RILYGRE"
FT   gene            549811..550341
FT                   /locus_tag="Amico_0521"
FT   CDS_pept        549811..550341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0521"
FT                   /product="protein of unknown function DUF395 YeeE/YedE"
FT                   /note="PFAM: protein of unknown function DUF395 YeeE/YedE;
FT                   KEGG: dvm:DvMF_0176 protein of unknown function DUF395
FT                   YeeE/YedE"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56658"
FT                   /db_xref="GOA:D5EDM6"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDM6"
FT                   /inference="protein motif:PFAM:PF04143"
FT                   /protein_id="ADE56658.1"
FT                   /translation="MELDLIFGLVTGIIFGILLQRSETIRYDRQLGALRLLDFTILKFM
FT                   LSTIIVAMIGTYFLRDLGVVKLSIKPTILGGVIPGGILFGIGWGLLGYCPGTSLGALGE
FT                   GRFDALWGILGMVAGAALYAEAYPYMEQTLLTWGNLGKITVPEVIGINHWIVITVFLLG
FT                   VLLFFQWSEKKGL"
FT   gene            550449..551363
FT                   /locus_tag="Amico_0522"
FT   CDS_pept        550449..551363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0522"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; Protein of unknown function DUF250; KEGG:
FT                   gbm:Gbem_2300 protein of unknown function DUF6
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56659"
FT                   /db_xref="GOA:D5EDM7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDM7"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADE56659.1"
FT                   /translation="MKRNPEIPSPTSITYYKGSFSVLASASLLGSVAILALFAYKENVN
FT                   VMTMLLLRFSLSTLFLFLFSICKKGYQCVCVERKQFLRLFLLGGVFYAFFCFSYFSSIQ
FT                   YIPASLAVLIFYTYPTLVAIVSSFINKERITRIVVMSIFLSFFGLYFVSGPGLASANIK
FT                   GLLLAVCASVFYAAYVIYGHSVMKVTPFHITVAYVYLCATISYGIGGLLAQNVVLPRTF
FT                   SAWFYVFLVSFISVCGFITFFIGVKLTTPTVASILSMVEPLVTVLLSVIFFQDRLSLMQ
FT                   GIGGGLVLLGALLIILKNRIEKR"
FT   gene            complement(551409..551807)
FT                   /locus_tag="Amico_0523"
FT   CDS_pept        complement(551409..551807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0523"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: putative
FT                   translation initiation inhibitor, yjgF family"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56660"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDM8"
FT                   /inference="protein motif:PFAM:PF01042"
FT                   /protein_id="ADE56660.1"
FT                   /translation="MRPVRLHAPDAPAPKGFYSPAVRIGNLIFTAGQLPLDPKTGECLR
FT                   GSVEEQTDLVIRNIKALLETNGSSLEHVVKSTIFIRSTDQWDAVNKVYSRYFENTTPPA
FT                   RGIYCGLDINYGLDIEMEVVAAIAEPEE"
FT   gene            complement(552194..553129)
FT                   /locus_tag="Amico_0524"
FT   CDS_pept        complement(552194..553129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0524"
FT                   /product="Uncharacterized protein family UPF0324"
FT                   /note="PFAM: Uncharacterised protein family UPF0324; KEGG:
FT                   glo:Glov_0952 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56661"
FT                   /db_xref="GOA:D5EDM9"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDM9"
FT                   /inference="protein motif:PFAM:PF03601"
FT                   /protein_id="ADE56661.1"
FT                   /translation="MVLQSPFFWIATGLILTFTFNSPALALCVGSIIALIWGNPLKNIT
FT                   GKLSKYLLQLAVILLGFGLQLNVILKVGYTSLGITFFSISTTMLLGWLLGKLYKVEHNV
FT                   SLLINSGTAICGGSAIAAMSPAIGASQAQTAVAMAVVFLLNGIALLIFPYAGHFMELSQ
FT                   TDFGIWAALAIHDTSSVVGASAIYGTEALVIGTTVKLTRALWILPLSFLGAKLNKNQSK
FT                   ATIPWFLFGFLLTALIRSLMPEADGCWNMLALGGKKLMVGTLFFVGAGLTKEDLKKIGK
FT                   GALLKAVTLWVLVSLLSLTVIKLGFIHLGL"
FT   gene            553254..554150
FT                   /locus_tag="Amico_0525"
FT   CDS_pept        553254..554150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0525"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: gsu:GSU2817 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56662"
FT                   /db_xref="GOA:D5EDN0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDN0"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADE56662.1"
FT                   /translation="MESVTLRQLEIFVYIAQFENMTAASKKLFLTQSAVSMSLKELEKT
FT                   LGGSVFHRVGRGLILNDRGRALLPKAKNILASVKDLVDMAHNTEKALMGELMIGCSTTI
FT                   GNYFFPTRLKLFCDEHPQVRITLNVGNTREIAKLVREGILDIGLVEGIVEERDLDEKEW
FT                   VKDVLVVIASPEHPFACRSMVPMAEMIEEQWVLRERGSGTLSSFEALLASKNLRFPYVQ
FT                   EIGHTEAIKRVVEAGMGMSCLSRLAVEQELREGSLVEIPTDIEISRWFRIISLPEEHRS
FT                   RLFNYMMKWLFSFASVK"
FT   gene            complement(554204..555382)
FT                   /locus_tag="Amico_0526"
FT   CDS_pept        complement(554204..555382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0526"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /note="KEGG: dps:DP2949 tryptophan synthase subunit beta;
FT                   TIGRFAM: tryptophan synthase, beta subunit; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56663"
FT                   /db_xref="GOA:D5EDN1"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDN1"
FT                   /inference="protein motif:TFAM:TIGR00263"
FT                   /protein_id="ADE56663.1"
FT                   /translation="MIQKNRKGYFGEYGGSFVPEALQVRLDELEEAYEEAKKDPSFSNE
FT                   FITVLKEYVGRPSALTECKNISRHFGGGRLFLKREDLNHTGAHKINNALGQALLARRMG
FT                   KNELIAETGAGMHGTASATVAALMGMKCTVYMGAVDVARQAPNVARMKVLGTEIVAVQD
FT                   GQKTLKEAVDAALKAFAEQPDTFYLLGSAVGPHPYPTMVRDFQSIIGKEARSQFLEREQ
FT                   KLPDYAIACVGGGSNAIGLFSGFLDDSEVKIIGVEPAGKGLATGEHAATLSVGQPNIIH
FT                   GFKSYVLSKENGEPAEVYSISAGLDYPGVGPEHAYLKDIGRVDYKSVTDEEAIDAFKLL
FT                   SNKEGIIPALESSHALAYAFKLLPALAKDQTVLVNLSGRGDKDMDTVLPLLV"
FT   gene            complement(555774..555905)
FT                   /locus_tag="Amico_0527"
FT   CDS_pept        complement(555774..555905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0527"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56664"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDN2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56664.1"
FT                   /translation="MLKEASTEKNIRTRKNVYDPQENEFDLEGLPFAYEDALNNERR"
FT   gene            complement(556067..557182)
FT                   /locus_tag="Amico_0528"
FT   CDS_pept        complement(556067..557182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0528"
FT                   /product="Phenylacetate--CoA ligase"
FT                   /EC_number="6.2.1.30"
FT                   /note="KEGG: gme:Gmet_1825 phenylacetate-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56665"
FT                   /db_xref="GOA:D5EDN3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDN3"
FT                   /inference="protein motif:PRIAM:6.2.1.30"
FT                   /protein_id="ADE56665.1"
FT                   /translation="MGSHEQATLLRLQNMVHRVWNAQGSYRQKMEVAGISPDDIQSIDD
FT                   FKKLPFTTKQDLRDSYPLGMLACPREQVVRLHASSGTTGKPTFVPYTQKDIDIWKECMA
FT                   ECLATAGVAPNDVFQIILGYGLFTGALGFHYGAEKLGAMVIPSGGGFTDRQLMLMEDAH
FT                   TTVFTSTPSYALYLAERVAKESLISRLHLRLAILGGEAWTEDMGSQIEEMLGVTVINSY
FT                   GLSEILGPGVAMECGAKRGMHFNETHFFAETVNAENGKTLLDGEFGELVITTMTKEAFP
FT                   LIRYRTRDLTSLISEPCPCGRHGKRIARVTGRNDDMLIIRGVNIFPSQVEAALADVKGI
FT                   SLHYRLDVDHKQGMPDLTVVCESVSLLSASI"
FT   gene            557423..557664
FT                   /pseudo
FT                   /locus_tag="Amico_0529"
FT   gene            complement(557767..558864)
FT                   /locus_tag="Amico_0530"
FT   CDS_pept        complement(557767..558864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0530"
FT                   /product="(uracil-5)-methyltransferase"
FT                   /note="KEGG: dol:Dole_3073 (uracil-5)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56666"
FT                   /db_xref="GOA:D5EDN4"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDN4"
FT                   /inference="similar to AA sequence:KEGG:Dole_3073"
FT                   /protein_id="ADE56666.1"
FT                   /translation="MKKLPIGCNEKCRACAHRWMTHEESEKQKEAWLKQSLHQWSHLIN
FT                   PILSPAPEQRWGYRNKVSLAAQWNSSDWVFGMKVKDEIISLKECPIHSEGVRLTLSWLE
FT                   QYLPPFPLFPLSIYVQAGRQGTLILKTHETPDLNWLKYKQEALAQTGLEGLWLHMHPSA
FT                   GRRLFGRGAWQLLWGKPRSYNELGLIYGPTAFQQLIPDLYARSLDEAEAFLSPKEKEGV
FT                   IDLYCGSGASLKRWIGKGCHTVGVETSAEAIESAGSNAPGALLLRGTCSQRIPQLAQWI
FT                   ETIEGYERLAYLNPPRTGIESDVRQWLALKARPSRIAYLSCSAGTLGRDLLYMEKEGYK
FT                   IKHITPYDFFPNTYHVETLACLSLK"
FT   gene            complement(558839..559003)
FT                   /locus_tag="Amico_0531"
FT   CDS_pept        complement(558839..559003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56667"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDN5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56667.1"
FT                   /translation="MRKQIARSTIEDTPPPFTLTREVKNDSEIKETGYNYSDSEKERGQ
FT                   TYEKASYRL"
FT   gene            559317..560690
FT                   /locus_tag="Amico_0532"
FT   CDS_pept        559317..560690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0532"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: metal-dependent
FT                   phosphohydrolase HD sub domain; PAS fold-3 domain protein;
FT                   PAS fold domain protein; KEGG: sat:SYN_01234 response
FT                   regulator receiver domain-containing protein; SMART:
FT                   metal-dependent phosphohydrolase HD region; PAC
FT                   repeat-containing protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56668"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDN6"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADE56668.1"
FT                   /translation="MEIKQDLDKVHLQYLFDNALDVAVLVDPSGNVCRVNSYFERLFAL
FT                   KEEEIIGKSIIDIAFPPHSRNRAKQAILELQKGEKIELSEVQCMRKDETTFLCRVVVFP
FT                   ILFNSKVASIYVVFYDLTQKNEREKQLLYASAVVKESPVVFFRLKADEGWPIIYASENV
FT                   SRWGYTSELLVRNENSYLGIIYEEDREKIIRQVRFYEEAGREEYELEYRILTGKGDIIW
FT                   VNEMASVLRDDYGRALYYQCAVKNVTTRKEAEIALSLNYHKMSRAWDQTIEVMAITTEM
FT                   KDPFAMGHQKRVASLSCAIAVKLGLKKEEVHNLEKAALVHDIGRVEIPSELLSKPGPLT
FT                   DAEFELVQTHSEIGFAILSRIDLSWPLAEIVHQHHERIDGSGYPRGLKSDKILLPAKII
FT                   SVADIVEAMTSHRPYRPALGIDAALDEIEKLKGVALDETVVDSCVKLFRENEFSFIDE"
FT   gene            560811..561278
FT                   /locus_tag="Amico_0533"
FT   CDS_pept        560811..561278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0533"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56669"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDN7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56669.1"
FT                   /translation="MSLFKKRFFLLGILFVGSILFMAQPLLAEARDVRVDLGADENKLR
FT                   WYMVKVDEVEGMPVVTLRVYYAVAQEKKKMAQALVSEAEVDEAKAERLYFTEYDYVFHS
FT                   TDNTYAIYAARHYDMGGHEIFSAGVNFHDMQWMEIIEKSIPFKAKAAYNKL"
FT   gene            complement(561285..563897)
FT                   /locus_tag="Amico_0534"
FT   CDS_pept        complement(561285..563897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0534"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="TIGRFAM: PAS sensor protein; metal dependent
FT                   phophohydrolase; PFAM: metal-dependent phosphohydrolase HD
FT                   sub domain; Metal-dependent hydrolase HDOD; PAS fold domain
FT                   protein; KEGG: rfr:Rfer_3391 putative PAS/PAC sensor
FT                   protein; SMART: metal-dependent phosphohydrolase HD region;
FT                   PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56670"
FT                   /db_xref="GOA:D5EDN8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDN8"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADE56670.1"
FT                   /translation="MGTRRRIILKIFLFIIAGLLILRPKDVFSYEPKVPLLILFSYDEN
FT                   NKRTESISQGILSSLQKADVRTEPFIEYLDVQRLPDHTINRSLQELYFMKYFPSHLRVI
FT                   ICEGDHAFRFLVRQGATVFPTVPVVFTGVSDVSILPNSLRKRFTGTVQAAPYKKMVEMM
FT                   TRLHPALQKIVVIGDTSLTGIQNISQLLNIAKERKDYVEIILLTSFPQQEVSSFLELQE
FT                   PRNTVILLTSALSTSDGYYLSLPDTIKSIHRSGDFAIYTNVAEAVELDGIIGGAIYAGE
FT                   RLGNIAAEIALDIIKGTPPEKIPFNENEPVQWVFNYHELKKHGILMERLPAGSRVMEDP
FT                   YKDVRENFRFIITNVAVITVLLALSILLLIKLYRRRQINNALKREQNYLGGLMEGAPEG
FT                   IIALDEMGRILRANNEFCRMFGYSKHEVKGADLNKIICLSKGQCEDGKSLLKKALSYPI
FT                   KDISRYRNKSDGTSLAVSISGFPVMFTGKKKEAFLLFRDITRQKAQQNALAQRFHFEAL
FT                   LSAVSSRLVFSSPFENTLKDVLHEIGTRLGLLGCALYTSQKDNPEFNLKSMWQSTDFES
FT                   IELLKESLSFSTELLQQDLLVNLEPLTIEKGNNADEKIKVTFLPFSAGFNKPGVLLLAQ
FT                   RKSSTPQQLINDASLKILAETIGRAFERKQQQEDLLRTIQQLEQTFHSTISTIGRVIEM
FT                   KDHSTYGHQNRVAQLCLAIAKKMKLSDSAREAVYNTALVHDLGKLYIPSEILIKPQSLS
FT                   AIEYNIVKQHSRFGYEVLRNVHFPWPVAEIVLQHHERIDGTGYPKGLKSREILQEAKIL
FT                   AVADVVEAMVSPRPYRPAYSIEEALEEIKKGAGTAFDPSIVTCCVHLFEKNEFTFRID"
FT   gene            complement(563914..566070)
FT                   /locus_tag="Amico_0535"
FT   CDS_pept        complement(563914..566070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0535"
FT                   /product="Tex-like protein protein-like protein"
FT                   /note="KEGG: sfu:Sfum_1838 RNA-binding S1 domain-
FT                   containing protein; PFAM: Tex-like protein-like; RNA
FT                   binding S1 domain protein; SMART: Resolvase RNase H domain
FT                   protein fold"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56671"
FT                   /db_xref="GOA:D5EDN9"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDN9"
FT                   /inference="protein motif:PFAM:PF09371"
FT                   /protein_id="ADE56671.1"
FT                   /translation="MVQQKLNLVLAISTEMKISSAQIEAVFSLLDEGCTIPFIARYRKE
FT                   ATGSLDEVSIARIRDRREELLELEKRRLAILKSLEDREILTDELAQAINGAANLTTLED
FT                   TYLPYRPKRKTRASMALEKGLALLAENIMAQDGCNPRHEAKAFIDVEKGVESIEEALKG
FT                   ALDIIAERVSENSEARNVCRRIFARHSYITSALVSEKENEAAKYKDYFSWKERAIEAPS
FT                   HRILALFRGENEGMLSLKIQPDEMLCLSALKKLFIKTKGEEADLFEEAITDGYKRLLSP
FT                   SMETELRNALKKRADEEAISVFAQNIREILMTPPLGYKNILAVDPGFRTGCKVVCLNRQ
FT                   GSLIFTDTIYPHPPINRQEESAKKIRETVNKFSIEAIAIGNGTAGRETETFIKTLNLPQ
FT                   NIITTMVNESGASVYSASEIARKEFPDHDVTVRGAVSIGRRLMDPLAELIKIDPRSLGV
FT                   GQYQHDVDQKALKRALDDAVMSCVNAVGVDINTASRELLTFVSGVGPQLAANIVKYREE
FT                   NGLFNTRNDLKKVPRLGPKSFQQCAGFLRIQGGVNPLDSSAVHPENYALVKNMASDLNT
FT                   TVKELMGKAEIRQRIDITRYVKGEIGLPTLKDIMEELEKPGRDPRCIFEEFSFVDGITD
FT                   ISHLKKGMVLPGIITNVTAFGAFVDIGVHQDGLVHISALSDKYISSPHAVVSPGQQVKV
FT                   IVMDIDMDRKRISLSMKTSDLEEK"
FT   gene            566186..566800
FT                   /locus_tag="Amico_0536"
FT   CDS_pept        566186..566800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0536"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reh:H16_B1604 phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56672"
FT                   /db_xref="GOA:D5EDP0"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDP0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56672.1"
FT                   /translation="MESWKELIYKTLDMLYIPDSLIEMRGRAVLHISDTPSSFYPCLKK
FT                   LINLLEPLAVIHTGDLVDEIKLAIQPNRLQHYIKRLRPLAQILEGGRKRDVIVIIGNHD
FT                   NEDAARQVFHKSLIVNKSGSFNVCGVSLNVSHHFEGLPISPGALNLFGHNQFMPEQGGG
FT                   EVYLNGLLSMHLIDPDNGTIHPLSYPRFVDQNRLLKRKFGL"
FT   gene            566973..567233
FT                   /locus_tag="Amico_0537"
FT   CDS_pept        566973..567233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0537"
FT                   /product="Stage V sporulation protein S"
FT                   /note="PFAM: Stage V sporulation protein S; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56673"
FT                   /db_xref="GOA:D5EDP1"
FT                   /db_xref="InterPro:IPR007347"
FT                   /db_xref="InterPro:IPR036882"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDP1"
FT                   /inference="protein motif:PFAM:PF04232"
FT                   /protein_id="ADE56673.1"
FT                   /translation="MEVLKVSAKSQPKSVAGAIAAVLREKGAVEVQAVGAGAVNQSVKS
FT                   IAIARGYVAPNGIDLVCIPAFAKIEIDDEERTAIKFQLESR"
FT   gene            567453..568715
FT                   /locus_tag="Amico_0538"
FT   CDS_pept        567453..568715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0538"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="TIGRFAM: histidyl-tRNA synthetase; KEGG: gsu:GSU1659
FT                   histidyl-tRNA synthetase; PFAM: tRNA synthetase class II (G
FT                   H P and S); Anticodon-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56674"
FT                   /db_xref="GOA:D5EDP2"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDP2"
FT                   /inference="protein motif:TFAM:TIGR00442"
FT                   /protein_id="ADE56674.1"
FT                   /translation="MADIKAPRGVRDILPEESWKWSYVLKIAAEVAKNFGYSEVHLPVF
FT                   EHTELFSRGIGETTDVVEKEMYTFEDRGGRSLTLRPEATASMVRCYLENKLNSHAQPVK
FT                   LWCAGPMFRYERPQKGRYRQFWQLDFESLGTKNPMVDVEVIALSLELYRRLGLQNLEVV
FT                   INSVGCPECRPAYKEKLKEYFKPRYEELCKTCQSRFERNPLRILDCKNPECKEITDGAP
FT                   DIYTSLCDDCRCHFDKVQEGLSRIGAHYHIDKRLVRGLDYYTKTAYEVLSGALGAQNAV
FT                   CGGGRYDNLAETIGGPFTPSVGFATGLERIVLVMEEQNCSFGPSPDLDVYAIGLDEASR
FT                   EELQKLVAELRQANISTDMDYMERGMKAQFKSADASGAVFACILGGNELANGVVNVKNL
FT                   KTGEQVEVERTAVLNYIKSNL"
FT   gene            568755..570563
FT                   /locus_tag="Amico_0539"
FT   CDS_pept        568755..570563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0539"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /note="KEGG: sfu:Sfum_3302 aspartyl-tRNA synthetase;
FT                   TIGRFAM: aspartyl-tRNA synthetase; PFAM: tRNA synthetase
FT                   class II (D K and N); tRNA synthetase class II (G H P and
FT                   S); GAD domain protein; nucleic acid binding OB-fold
FT                   tRNA/helicase-type"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56675"
FT                   /db_xref="GOA:D5EDP3"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDP3"
FT                   /inference="protein motif:TFAM:TIGR00459"
FT                   /protein_id="ADE56675.1"
FT                   /translation="MSRSEHFDVSWKRTVRCGELSLDQEDNKVVLNGWVRRRRDLGGLI
FT                   FIELWDYTGVTQVVINPELVPEVHERAKSLRSEFVISVHGKVRKRPEGTVNLSMKTGEI
FT                   EVVAEDFMLLSPAAPLPFEVSDATNKVDENLRLRYRYLDLRRDKMQRNLRIRNQIIRFT
FT                   RDFLARYDFVDIETPMLTKSTPEGARDYLVPSRVNPGTFYALPQSPQIFKQILMVSGFD
FT                   RYYQIVKCFRDEDLRADRQPEFTQIDMEMSFITEEDIYALVEEFMAGLFREIAQVDIPT
FT                   PFRKMDYWEAMDRFGSDKPDLRIPFEIHDVAYIFKESDFAPFKDLLAKGGYVRGLPLPG
FT                   GASLSRKEVSLVEEKAKKLGASGLACFQFKEGCLKGPLVKFLSEEQRQRLVEKAALHEG
FT                   DAFFVLGDLNRSVASQILGQLRLDLAKEHNLMDRDKWEFLWVVHFPLFERDEEENRWVA
FT                   VHHPFTSPVIEDLPFLDSEPQKVRSRAYDCVLNGNEIGGGSIRIHDPEIQEKVFQCLAF
FT                   SREEARKRFGFLLDALSSGTPPHGGIAFGVDRLVMLLCGASSIRDVMAFPKTQKAQCLM
FT                   SGAPSFVSQEQLDELHIDSLAEEDQE"
FT   gene            570621..571313
FT                   /locus_tag="Amico_0540"
FT   CDS_pept        570621..571313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0540"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   ank:AnaeK_1127 beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56676"
FT                   /db_xref="GOA:D5EDP4"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR022877"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDP4"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ADE56676.1"
FT                   /translation="MVRIHYVGHAAFLIKTEEFQLLIDPFITGNPLAVDTIDAFTNVDY
FT                   IFVTHGHGDHLGDTVEIHKRTKATVITNFEISQYLGNKGVACHAMHIGGSFAFPFGQVK
FT                   MTPALHGSGITDENGNVIPGGSPCGFLIEIQGCKIYHAGDTGLSVEMQLLKDEHIHVAL
FT                   LPIGGNFVMNVKDAAKAANIIQPSLVVPMHYNTFDLIKANPEELAPLITGDTEVRILQP
FT                   GDELLIKP"
FT   gene            complement(571325..572191)
FT                   /locus_tag="Amico_0541"
FT   CDS_pept        complement(571325..572191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0541"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: sugar isomerase (SIS); helix-turn-helix
FT                   protein RpiR; KEGG: bpd:BURPS668_A1857 RpiR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56677"
FT                   /db_xref="GOA:D5EDP5"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDP5"
FT                   /inference="protein motif:PFAM:PF01380"
FT                   /protein_id="ADE56677.1"
FT                   /translation="MSDQEFLDLLRHKMEGMPNKARRVVEYILANSREAAFLSIGEVAE
FT                   KLDVSKAQLVRVARMLGFDGYAALKDTLKKTVLQQVNPSAMLSKIMKDHKNLPEEIYRL
FT                   EHANIDDTWNQIQADNAAVFCAMLQKAKTIFCIGWGISALVAESLYTRLLELGLKGVLL
FT                   KRGSLALIEQARAIEKGDLVIVCELPSYVIEVTNSIKLAAERGANIITITDSPAAPICK
FT                   FADLSFFVSDMSPTFGSSLIGPLFLIHILSSILAVNMGEEAKKALEKQAQGLHDEKVYH
FT                   PTYDLRY"
FT   gene            complement(572286..573233)
FT                   /locus_tag="Amico_0542"
FT   CDS_pept        complement(572286..573233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0542"
FT                   /product="Radical SAM domain protein"
FT                   /note="KEGG: gsu:GSU2227 radical SAM domain-containing
FT                   protein; PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56678"
FT                   /db_xref="GOA:D5EDP6"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR034687"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDP6"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADE56678.1"
FT                   /translation="MKRRAVFLPMRNCPHRCIYCDQRAITGEYQPPSPHEVVTMLSTLL
FT                   EPVELCYFGGSFTCQPERLQEEYLAAIVAAPSGSSVRFSTHPLCISRDTVERLKKFPIS
FT                   MVELGISSLDDHVLSLCNRGYSEKDGLKALKLLLDQGFSVAAQMMVGLPTQNLKSSLED
FT                   LFKLAELKGPRSITLRFYPCLVLRNTMLENLLLSGQYTPLSVSEAAHWVGTLLYYAKNL
FT                   GFSVQRVGLQQTESLERSVSAGPHHPSFGELAKSVAFVLRLTGISSKGPWIIFQKDVSL
FT                   LTGHNCWGLSFLSEMTGQSPEKLKAQIVIWENTN"
FT   gene            complement(573247..573618)
FT                   /locus_tag="Amico_0543"
FT   CDS_pept        complement(573247..573618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0543"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: geo:Geob_0718
FT                   transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56679"
FT                   /db_xref="GOA:D5EDP7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDP7"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADE56679.1"
FT                   /translation="MSLGIRIKTLRKAARLTQQALADKTDVSRIYIQALESNRRLPSMK
FT                   LLSKLAQALDVEITDLVKGTPSDESGRIHLEELLENHGGGGIWYKSHCFSKNELCFLLQ
FT                   LIETTVSFWQNENKENLDK"
FT   gene            573813..574712
FT                   /locus_tag="Amico_0544"
FT   CDS_pept        573813..574712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0544"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: dar:Daro_1985 regulatory protein, LysR:LysR,
FT                   substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56680"
FT                   /db_xref="GOA:D5EDP8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDP8"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADE56680.1"
FT                   /translation="MDFRQLESLVEVLEKGSISGAAASLGISQPAVSKHIARLEEEMGI
FT                   KIFVRGQKCSKLTVEGEILYDFAKKVVSSLNDIKREVTNVSSEVAGTVTISASSIPGDF
FT                   VLPSILVDFRRQYPYVNVEVYISDSREALERLVTKDTDIAVTGFSRNTSGLESYPLCED
FT                   ELVLIVSPDHPLANRRAVTMKDVEDLDLIGRVPGSATRRIWEDAYKEHFGVEKEVGLSF
FT                   GHVSAVVNAVESGGEGGIVSRLAVGKNTHLVTIPFSPALKRFFYITYGTVSTRAMKVLI
FT                   DFLRERVLQIIGGVTRVD"
FT   gene            574702..575190
FT                   /locus_tag="Amico_0545"
FT   CDS_pept        574702..575190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0545"
FT                   /product="YbaK/prolyl-tRNA synthetase associated region"
FT                   /note="PFAM: YbaK/prolyl-tRNA synthetase associated region;
FT                   KEGG: pap:PSPA7_2120 YbaK/prolyl-tRNA synthetase associated
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56681"
FT                   /db_xref="GOA:D5EDP9"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDP9"
FT                   /inference="protein motif:PFAM:PF04073"
FT                   /protein_id="ADE56681.1"
FT                   /translation="MSTELVFDPVANVTAFLRENGYDVNITISCQTIFTVDDAALAVGA
FT                   PAEHILKTLLLLVDEKPVLALMSGPNRVDLKKVKQVFGAKKTKMASPDFVYGYSGYKIG
FT                   GVPPVGYPEKIPAVLDEDLFRYETVWAAAGTDHAFFPISPERLQILTEGRKADIKKER"
FT   gene            complement(575192..575617)
FT                   /locus_tag="Amico_0546"
FT   CDS_pept        complement(575192..575617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0546"
FT                   /product="protein of unknown function DUF296"
FT                   /note="PFAM: protein of unknown function DUF296; KEGG:
FT                   mms:mma_1955 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56682"
FT                   /db_xref="InterPro:IPR005175"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDQ0"
FT                   /inference="protein motif:PFAM:PF03479"
FT                   /protein_id="ADE56682.1"
FT                   /translation="MKYAATDEMIVLRLTHGEDIHNSISFVCKERDVDSAVVVSAAGMV
FT                   TNVTFGWFNGKEYEKATYNNVMELLALNGNVSYKHEGIYPHLHAVFSRPDHTCLGGHIL
FT                   QALVHHNVEICIIPLKTIYLNREFDEWFEALAPETRL"
FT   gene            575806..576033
FT                   /locus_tag="Amico_0547"
FT   CDS_pept        575806..576033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56683"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDQ1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56683.1"
FT                   /translation="MLMLPFWVFLGMSLANAGRDRVLNPREAIHFASAVKMTYDVLQYD
FT                   IKSIKKSWAVLLEELPSSSSLLRVEKFLKL"
FT   gene            complement(576001..576990)
FT                   /locus_tag="Amico_0548"
FT   CDS_pept        complement(576001..576990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0548"
FT                   /product="Asparaginase/glutaminase"
FT                   /note="PFAM: Asparaginase/glutaminase; KEGG: dps:DP0994
FT                   L-asparaginase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56684"
FT                   /db_xref="GOA:D5EDQ2"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDQ2"
FT                   /inference="protein motif:PFAM:PF00710"
FT                   /protein_id="ADE56684.1"
FT                   /translation="MPKRGKIALVIAGGQIGLKTEEDSGHQPFLSGETMLSWLPEDMSQ
FT                   DVFLVDWSHQPSSHYSIRMTTDLIQILNKLIIEGVDGIVVSSGTDTLEEMAYLTDLFWA
FT                   YPQPVIFTAATLPFDVPGTDAIINLTQAMYAASSQKCWGLGVLVCLQDQLFAASEITEE
FT                   TNHRRSAFVSPDRGPLGEIIGQDIQILRIHKRSKVLEGDHVPARNVELIYANLGGGELL
FT                   IKLLSEAKDRDLDGLVIAGFGDGTISPSWIPFLRKIIRDGIPVVISSRCFMGRTRRFFN
FT                   FEGSLNKLLELGVYDGGNLRPLQARLKLSAGLGAGLKGSELQKFLYSQ"
FT   gene            complement(577057..577719)
FT                   /locus_tag="Amico_0549"
FT   CDS_pept        complement(577057..577719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0549"
FT                   /product="protein of unknown function DUF1121"
FT                   /note="PFAM: protein of unknown function DUF1121; KEGG:
FT                   dal:Dalk_2774 protein of unknown function DUF1121"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56685"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR009501"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDQ3"
FT                   /inference="protein motif:PFAM:PF06555"
FT                   /protein_id="ADE56685.1"
FT                   /translation="MTNKKDPFAAAQTASNRQLGVNVVKNLTSKGFEAIYVDTGEQALE
FT                   EVLKLIPQNATVGIPGSVTIRQIGAIEKLQERGCTIAQHWDPTLSPEQKKEVLKKEFLS
FT                   DYFLTSSNALTEEGMLVNIDGTGNRVSAMAWGTNILIFVVGINKIARDVDSALARIRDK
FT                   ATPPNAIRLNIDTPCSHVGHCVDCNSATRVCRAILILERPTTGRETHVIVVGENLGY"
FT   gene            577881..578174
FT                   /locus_tag="Amico_0550"
FT   CDS_pept        577881..578174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0550"
FT                   /product="putative helix-turn-helix protein YlxM/p13 family
FT                   protein"
FT                   /note="PFAM: putative helix-turn-helix protein YlxM/p13
FT                   family protein; Sigma-70 region 4 type 2; KEGG: Protein
FT                   kinase domain containing protein; K04514 Rho-associated,
FT                   coiled-coil containing protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56686"
FT                   /db_xref="InterPro:IPR007394"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDQ4"
FT                   /inference="protein motif:PFAM:PF04297"
FT                   /protein_id="ADE56686.1"
FT                   /translation="MREEDLLEDRIYLNQLYDLYGALLTEKQRNAYEHHEFSDLSITET
FT                   AERLDTTRQAAFDLISRAKSRLEELEALLKLHERIKNLEKRIEDLEERCQDK"
FT   gene            578203..579552
FT                   /locus_tag="Amico_0551"
FT   CDS_pept        578203..579552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0551"
FT                   /product="signal recognition particle protein"
FT                   /note="TIGRFAM: signal recognition particle protein; PFAM:
FT                   GTP-binding signal recognition particle SRP54 G- domain;
FT                   Signal peptide binding (SRP54) M- domain protein;
FT                   GTP-binding signal recognition particle SRP54 helical
FT                   bundle; KEGG: sfu:Sfum_3038 signal recognition particle
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56687"
FT                   /db_xref="GOA:D5EDQ5"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDQ5"
FT                   /inference="protein motif:TFAM:TIGR00959"
FT                   /protein_id="ADE56687.1"
FT                   /translation="MFEALKERLESVFNTLKGKGKLSEEDVNAALREVRRALLEADVDY
FT                   KVVKSLVDSIRGRCIGQEVLDSITPGQQVVAIVYEELVSLMGEDVVPFIISSKPPTLCM
FT                   MVGLQGSGKTTSAVKIAKRIQNAHNPLVVACDLRRPAAIEQLKVLAQQSKVAFYGPSGG
FT                   TQDVIKVAKEALAYAEDHLNDVIIFDTAGRLHVDEDLMEELSRLKDLVNPHEILLVVDA
FT                   MTGQEAVKVATSFHEKLSLTGVVLSKLDGDARGGAALAIRATTQVPIKFAGVGEGIDAI
FT                   ELFDAKRMAQRIIGMGDVMGLAEKVQQVTSQEDVAKITKSLKKDKLTMEDLLLQFEQIE
FT                   KLGPLDKVIDMLPGMGKMKELKNAELDPKRLKQSKAIIQSMTLEERRNPQIIKGSRRRR
FT                   IAEGSGTTVQMVNQLLKQYDQMKQLWKYMGKGKKGFRLPKGLFGGGGFPF"
FT   gene            579618..579893
FT                   /locus_tag="Amico_0552"
FT   CDS_pept        579618..579893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0552"
FT                   /product="ribosomal protein S16"
FT                   /note="KEGG: gme:Gmet_2871 30S ribosomal protein S16;
FT                   TIGRFAM: ribosomal protein S16; PFAM: ribosomal protein
FT                   S16"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56688"
FT                   /db_xref="GOA:D5EDQ6"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR020592"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDQ6"
FT                   /inference="protein motif:TFAM:TIGR00002"
FT                   /protein_id="ADE56688.1"
FT                   /translation="MAVRIRLARFGRKKTPFYRLVVADSRSPRDGRFIELLGTYNPMVD
FT                   PADIKIDEEKALYWLKNGASPSDTARGILKMAGVWEKFAAEKNSAE"
FT   gene            579893..580141
FT                   /locus_tag="Amico_0553"
FT   CDS_pept        579893..580141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0553"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_0021 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56689"
FT                   /db_xref="GOA:D5EDQ7"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020627"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDQ7"
FT                   /inference="similar to AA sequence:KEGG:Sfum_0021"
FT                   /protein_id="ADE56689.1"
FT                   /translation="MMANYQELVKYIVDHLVTIPDQVEITTEVNDRGIVMVLIKVASED
FT                   VGRVIGKRGATINAIRLVAKAAAVKENERVEVDIEAD"
FT   gene            580155..580685
FT                   /locus_tag="Amico_0554"
FT   CDS_pept        580155..580685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0554"
FT                   /product="16S rRNA processing protein RimM"
FT                   /note="KEGG: dal:Dalk_4647 16S rRNA processing protein
FT                   RimM; TIGRFAM: 16S rRNA processing protein RimM; PFAM: RimM
FT                   protein; PRC-barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56690"
FT                   /db_xref="GOA:D5EDQ8"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDQ8"
FT                   /inference="protein motif:TFAM:TIGR02273"
FT                   /protein_id="ADE56690.1"
FT                   /translation="MENRNLVTIGRIVGVHGLRGGIKIFPLTDFPQRFFTMKNLAVYGE
FT                   DEKPLAVLTVQDMKFLDGKGIIVAETRELQTPKSAESLKDCLIKITSEERYSLEEGEYW
FT                   IDDLIGMKVFEKGSGRYLGMVHNVFFAGENDIYTVISDDGKEHFIPAVSEFIKKVDIDN
FT                   RVMEVEMIEGLWE"
FT   gene            580685..581944
FT                   /locus_tag="Amico_0555"
FT   CDS_pept        580685..581944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0555"
FT                   /product="tRNA (guanine-N1)-methyltransferase"
FT                   /note="TIGRFAM: tRNA (guanine-N1)-methyltransferase; KEGG:
FT                   dde:Dde_1096 tRNA (guanine37-N1) methyltransferase; PFAM:
FT                   tRNA (guanine-N1-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56691"
FT                   /db_xref="GOA:D5EDQ9"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR019230"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDQ9"
FT                   /inference="protein motif:TFAM:TIGR00088"
FT                   /protein_id="ADE56691.1"
FT                   /translation="MRVTIITAFPEFFRDFLSTSIIGRAVETGLINVNLINLREYGFGN
FT                   YRQIDDYSFGGDGMVLMAEPLSKALEKAREGHQGVDTVVYPSPQGAMLTQEMVESLASR
FT                   EHVIIICGHYEGIDERFAGKCVDLEVSIGDYVLTGGEIPAMAIIDAMARLVPNVVGRGG
FT                   AVEEDSFFRGMLDFPHYTRPALWEGDQVPPVLISGNEKEIDKWRKQQSVQRTLRRRPDL
FT                   LSRANIASYLEKGVYLALVHHPVMDHYGQKTTAALTGLDLSDISRSCRTYGLRKFLVVT
FT                   PLKSQRELAKTMAAHWVKGYGASFNPSRAEAFKTMKTVPTLDKAIEWIKSKEHEEPLVV
FT                   GTTARACSGAIHWLEMKRTLLESQKPVLFVFGTASGLHKEVTERCSVLLQPLSGGKEDY
FT                   NHLSVRTAVGVILDRFFGWR"
FT   gene            581978..582325
FT                   /locus_tag="Amico_0556"
FT   CDS_pept        581978..582325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0556"
FT                   /product="ribosomal protein L19"
FT                   /note="KEGG: hypothetical protein; TIGRFAM: ribosomal
FT                   protein L19; PFAM: ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56692"
FT                   /db_xref="GOA:D5EDR0"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDR0"
FT                   /inference="protein motif:TFAM:TIGR01024"
FT                   /protein_id="ADE56692.1"
FT                   /translation="MDAIKLVEKKYMKNEVPEFRSGDTVRVHVKVTEGARERIQVFEGV
FT                   VIARKHGGVNETFTVRKISNGVGVERVFPIHCPSIDKIEVKRLGKVRRAKLYYLRKLSG
FT                   KAARIKERREF"
FT   gene            582387..582473
FT                   /locus_tag="Amico_R0019"
FT                   /note="tRNA-Leu2"
FT   tRNA            582387..582473
FT                   /locus_tag="Amico_R0019"
FT                   /product="tRNA-Leu"
FT   gene            complement(582572..583366)
FT                   /locus_tag="Amico_0557"
FT   CDS_pept        complement(582572..583366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56693"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDR1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56693.1"
FT                   /translation="MEERLKAILLRKPELIADFPPWMLPRDDIKRIRATEDVVIIEVAG
FT                   RDSFAALFKYMENHSVKGVVPTIAYTATEYGDWISLYDNLDYMKDHLRSLSVHIYSPVF
FT                   MGSPALWKRVCGSITAISLAKFGFYTPCIGCHLYLHGIRIPLALQLGIKTVIAGERESH
FT                   DSAIKINQISVSLDGYIALFKLFGLSLEMPLRHISKGSEIESLLGISWEGGRRQLDCVL
FT                   SGNYVGENGCVAYSEESIQKYLNDFAVPLMEEYIRKAIASPF"
FT   gene            complement(583372..584673)
FT                   /locus_tag="Amico_0558"
FT   CDS_pept        complement(583372..584673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0558"
FT                   /product="phosphonopyruvate decarboxylase-related protein"
FT                   /EC_number="5.4.2.-"
FT                   /note="TIGRFAM: phosphonopyruvate decarboxylase-related
FT                   protein; KEGG: sat:SYN_00621 phosphoglycerate mutase; PFAM:
FT                   2,3-bisphosphoglycerate-independent phosphoglycerate
FT                   mutase; metalloenzyme domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56694"
FT                   /db_xref="GOA:D5EDR2"
FT                   /db_xref="InterPro:IPR004456"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR042253"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDR2"
FT                   /inference="protein motif:TFAM:TIGR00306"
FT                   /protein_id="ADE56694.1"
FT                   /translation="MRCILVVLDGLGDKGIAPLEGKTPLQAARTVNLDRIAASGTCGLY
FT                   HSCLQGQALPSEMAHFIMFGYDLAFFPGRGYIEARAEGVPVRDGDVSLLSRTFSVDKKE
FT                   NLFILKIEKMNPDPSVLKPLHDAIRFYRKDNIEIEFIPTTGIAGLSIMRGPGLSSEVTD
FT                   SNPIYEERPIMQVLPREDTKNFKKAHYTAEILNDYMRWSYEILSSHPINSKRERDNEPP
FT                   INFIGLQRAGQYRPLIPFHQKWGLRALCIASGAIYHGLCSILGMDILRVSDTDAPEKDL
FT                   EERLRTAYEATDYDFIYVHTKATDEAAHKRSYQKKIDVIEALDKAFKFAYEVIVPDDEV
FT                   LFIVTSDHSTASVGNMIHSGETVPIIMSGRYTRKDSVQVFDEISCAAGGLGLLRGHELM
FT                   YMTLNLLDRGKLAGLMDSPVDQPYYPGPYIPLRG"
FT   gene            584745..585533
FT                   /locus_tag="Amico_0559"
FT   CDS_pept        584745..585533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0559"
FT                   /product="protein of unknown function DUF82"
FT                   /note="PFAM: protein of unknown function DUF82; KEGG:
FT                   acp:A2cp1_3352 protein of unknown function DUF82"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56695"
FT                   /db_xref="InterPro:IPR002782"
FT                   /db_xref="InterPro:IPR027798"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDR3"
FT                   /inference="protein motif:PFAM:PF01927"
FT                   /protein_id="ADE56695.1"
FT                   /translation="MKAQIAFSPSFSYFFYPSKEEMTPLNFPLQRLTSVKDGVEALGVP
FT                   HTEVGEILVNGISVDFNYLLKDRDKACILPFSPPVDVTKATLLRPVPLERPSFVVDINV
FT                   ARLGSLLRLMGLDTVYNHAWRDKDIAAISKDEGRIVITRDRSLLKRKIITYGRLIREER
FT                   PWAQLFEVIKFYNLKSWLFPFSRCSFCNETLRPVQKEDVLDRLEPLTRLFYNEFTECPK
FT                   CGKVYWSGSHKQRIKERILVMLEKSQQLKAEDDYTSDNIF"
FT   gene            585577..587631
FT                   /locus_tag="Amico_0560"
FT   CDS_pept        585577..587631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0560"
FT                   /product="CoA-binding domain protein"
FT                   /note="KEGG: bpy:Bphyt_4084 CoA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56696"
FT                   /db_xref="GOA:D5EDR4"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDR4"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_4084"
FT                   /protein_id="ADE56696.1"
FT                   /translation="MSEAKFDRLFNPRSIALIGEGLAWSGAAARAEKTLQESSFNGPVI
FT                   EIKNEEATFQQVDLAILDVATCRLPYWLGRCGEENIPYAMLLASEQSGVWSQKDKETVS
FT                   RILSKSALRIIGPDSMGFINLKDKIVISPFQGCFSKDQYEKVALISQSGDLGFAVASAA
FT                   RLAGTGFRYVITTGGTSDIDLAEVGTWILNDPCVKLMLFCLEGLRDGVAFLRMAREANL
FT                   RGVRLGVLKAGQNVSSRQAISSHVSAGAGNAAIWSAAFKQFGILPLRDTDEIIDLACVY
FT                   NSFLPPAGRKTIIVSPSRGAGIAFSDNCFEEGLKVPSVPEDLQRELKKSLPSDVYVNNP
FT                   IDLASLGMEGAEYVTYLLRRLMNSPNLDIIAAVLTESRGEEVRNIMAALLDVVRDRKHP
FT                   VVCCSMGGIEEEEVREMLKEEGIPFFTSPRRCARALAGLSVGIPSLEASMPVSCEECAV
FT                   AEEKEGLPDLPQSMTEYDAKRLLAFHNIDITKEYLCHSLEEAIETAETIGYPVALKVMS
FT                   PNIVHKSEARIIALNLRGEEELRNAYGRTLEKARLANPAADIRGVLVQEMLEDGIECTV
FT                   AIKRDTVFGAVLSVGLGGIYASAVRDFVMRVAPVDEESAMAMIRELKGYSLLRGVWGRP
FT                   GYDVAAFAKMVASLSRLACTETRLVQLEINPVFVKKKGAVVVDAFVLRR"
FT   gene            587634..588236
FT                   /locus_tag="Amico_0561"
FT   CDS_pept        587634..588236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0561"
FT                   /product="protein of unknown function DUF205"
FT                   /note="PFAM: protein of unknown function DUF205; KEGG:
FT                   pca:Pcar_0651 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56697"
FT                   /db_xref="GOA:D5EDR5"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDR5"
FT                   /inference="protein motif:PFAM:PF02660"
FT                   /protein_id="ADE56697.1"
FT                   /translation="MTNWMWILIAYLAGSFPTGYVFVKLFCGEDIRTFGSGNIGATNVG
FT                   RRMGKKWAIIVTIIDMIKGGMVLVLARSMKVEGSSLLALMAFASVCGHNFPIWLKGKGG
FT                   KGVATTFGVVFFMIPPYSSYAALAAGIIWYGTLKISRYVSVASIASLFSLPLIFITLKM
FT                   DSSHVLAVLSMAFLALVRHKENIKRIRSGEENQVGKK"
FT   gene            588329..588811
FT                   /locus_tag="Amico_0562"
FT   CDS_pept        588329..588811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0562"
FT                   /product="transcriptional repressor, CtsR"
FT                   /note="PFAM: Firmicute transcriptional repressor of class
FT                   III stress genes"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56698"
FT                   /db_xref="GOA:D5EDR6"
FT                   /db_xref="InterPro:IPR008463"
FT                   /db_xref="InterPro:IPR040465"
FT                   /db_xref="InterPro:IPR041473"
FT                   /db_xref="InterPro:IPR041902"
FT                   /db_xref="InterPro:IPR041908"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDR6"
FT                   /inference="protein motif:PFAM:PF05848"
FT                   /protein_id="ADE56698.1"
FT                   /translation="MSSLTEVIEDYINKLFQEEMEEEAISLRRKDLAEFFGCVPSQINY
FT                   VLRSRFTPERGYIVESQRGGHGYIRIVRICYDVPEEKISHIEDIVGNAVSEQDAKRLLA
FT                   ALQDRELLSARERLVIEVAMRFLDEVASSDFDVSPYKRNALQAEILKRMLRGLALA"
FT   gene            588839..591331
FT                   /locus_tag="Amico_0563"
FT   CDS_pept        588839..591331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0563"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="KEGG: CLPC; CLPC (HEAT SHOCK PROTEIN 93-V); ATP
FT                   binding / ATPase; PFAM: ATPase AAA-2 domain protein; Clp
FT                   ATPase-like; AAA ATPase central domain protein; UvrB/UvrC
FT                   protein; ATPase associated with various cellular activities
FT                   AAA_5; Clp domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56699"
FT                   /db_xref="GOA:D5EDR7"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDR7"
FT                   /inference="protein motif:PFAM:PF07724"
FT                   /protein_id="ADE56699.1"
FT                   /translation="MWQFFTERGKKVVQLAHREALRMGHDVIGTEHILLGLLVEGEGVA
FT                   AQVLNSLGVNFQEVRRQTEELVGKGQPILKPIDLPLSPRAKRVLDLAIKEARNMGVNYV
FT                   GTEHVLLGLLAEGEGVAAQILLSSGVDTVIVQREISRFIANNEADRGVQPDLSGEGQRS
FT                   LHSKTPTLDQLGIDLSEKSRKDELDPVIGRDKEIQRVIQILARRTKNNPVLLGDPGVGK
FT                   TAIVEGLAQKIQDGNIAEILRGKKIVQLNIGNLVAGTKYRGEFEERMRKLLKELRETGD
FT                   VIIFIDEIHSIIGAGGAEGAVDAANILKPSLSRGEFQVIGATTLDEYRKYIEKDAALER
FT                   RFQPVMVEEPSVDDTISILEGLRDRYESHHRVKISDDALVAAARLSSRYITERFLPDKA
FT                   IDLIDEAAARARLKTMEIPANLKDIEHDLEEVRKEKEAAVTSQEFEKAARLRDTERKIS
FT                   EELEEKKKDWQSRRYQEKPLVSFDDIATIVSEWTNIPVTQLTEEETQRLLRMEEEIHCR
FT                   LIGQEEAVSAVARAIRRARSGMKDPRRPVGSFLFLGPTGVGKTELARRLADFLFGSEDA
FT                   MIRLDMSEFMERHEVGKLIGAPPGYVGYDEGGKLTEAIRRRPYSVVLFDEIEKAHEDVF
FT                   NILLQILEDGRLTDGQGHTVDFRNAVIIMTSNIGAKDWVKGTSLGFSISGEADGYFDWD
FT                   KTKSDILDAVQKTFRPEFINRVDEMVVFRPLSKKEMLVIVDIMLSDVRERLRYQDIDIK
FT                   VSEEAKAFILEKGYNPRYGARPLRRKIQQLIEDRMADMLLEGKIKKGSLVSIDEDKGEM
FT                   TFECTKPQKRKKEKKAAV"
FT   gene            591447..592268
FT                   /locus_tag="Amico_0564"
FT   CDS_pept        591447..592268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0564"
FT                   /product="protein of unknown function DUF114"
FT                   /note="PFAM: protein of unknown function DUF114; KEGG:
FT                   afw:Anae109_3319 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56700"
FT                   /db_xref="GOA:D5EDR8"
FT                   /db_xref="InterPro:IPR002825"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDR8"
FT                   /inference="protein motif:PFAM:PF01972"
FT                   /protein_id="ADE56700.1"
FT                   /translation="MGSSNSWFLLFIFFFIYPQLRQQILHWRRITALRACEKRRKTRII
FT                   TLIHRQESVGFFGMFSRNFINIEDSEEVLRAIRLTSEGTPIDLIIHTPGGLLLAAEQIA
FT                   YALKKHPAKVTVVVPHYAMSGGTLIALAADEILMDKHAVLGPVDPQIGQYPAASILRAV
FT                   EEKPVSEVEDTTLILADVSRKAVKQTRSFVFNLLKDRMGDEKATELALVLTEGRWTHDY
FT                   PITAEEAQALGLPVNTDLSSQVCNIMKLYPQSGIGRPSVQYVPIPYPSAPD"
FT   gene            592295..592813
FT                   /locus_tag="Amico_0565"
FT   CDS_pept        592295..592813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56701"
FT                   /db_xref="GOA:D5EDR9"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDR9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56701.1"
FT                   /translation="MVKMFDKAPQCLSKTSCFNNEPPLEETSILTSGFAFPKWMRGITF
FT                   VVGFLILAIGMAKLFSMKIKGLMLMFPYVLVGIVCLSMGGINNSMSISSEGVIYARTVW
FT                   GKKRQEVLPWETVQSVAILRKKNLFYARFFKEDGKGWQIPFRSDQWEIFQCIVNKYRPD
FT                   LTIEDKTKV"
FT   gene            592836..593699
FT                   /locus_tag="Amico_0566"
FT   CDS_pept        592836..593699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0566"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   noc:Noc_0602 MscS mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56702"
FT                   /db_xref="GOA:D5EDS0"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDS0"
FT                   /inference="protein motif:PFAM:PF00924"
FT                   /protein_id="ADE56702.1"
FT                   /translation="MDKLKMAFPFAHQIAIAIGIVIVWIIVNKVVSLTTSRGFDLLHKR
FT                   LVKNGKNGSRPAALQRIETLKGITLNVVKWLIAVIFVLSLIGSFGVNITPILTGVGLAG
FT                   LGISMAAQNIIRDFLNGIFVVLEDHYGVGDWINTSMGGGTVEKLTLRTTHLRDIDGNLI
FT                   IIPNGSINGVTNYTKNWSRAAIKIRVPFDSDVRKAMKIMEETAHTLQRENSSLFIGSPT
FT                   VQGILDFLDSSMVLRTLFDTTPGDQWALSREYRLRVKEAFDEANIPMAIPQTEVRLHSL
FT                   EPKKIP"
FT   gene            complement(593669..595417)
FT                   /locus_tag="Amico_0567"
FT   CDS_pept        complement(593669..595417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0567"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG:
FT                   xca:xccb100_4252 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56703"
FT                   /db_xref="GOA:D5EDS1"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDS1"
FT                   /inference="protein motif:PFAM:PF05036"
FT                   /protein_id="ADE56703.1"
FT                   /translation="MARKKTTTALWCISSIIFLLIFQAIPAEAISRGIMAEAIIESLAI
FT                   PRWTGEEHFSDVPENHPAFPAVETARAYGIIFPGERFHPDLEATRMEALLFAFKAMGWS
FT                   HEARLINFLVPKNNPQIPEYMIPYLTLGKACTPCAPEVFLSDPLENLNPQDLQELKDWL
FT                   IQCRRSISWDQTFHGEYASLRVCREKIGTPPSSWAIFIKEFQDKENALSLQKNLSEQGL
FT                   SAFMANTECAYAVYVGPYTNYVKAWEVLARIPADLAGQVVPYSEQGGNALFWAAIQIKD
FT                   EQSPFIVTAHSLGKYILPLSQMNKELKAEGAINGGFFTKGKPIGTLLINGIPLFPSYER
FT                   RSAVGWTAKGKALFGSGEFRAVLRKNDRIAPIGSLNTFPSQNGLALFSPEAGALPRPLQ
FT                   SDAEAFLLQQGAVKKLNRGDKARRIVPEGHVLLAARGYGIQIVNSLLEHGNPLSIEVQW
FT                   RDSAMREAIFALQGGPMLLLDGQLQTKNEGFSKGFRERRHPRTLVGTDGKALWWIVVDG
FT                   RDPWHSNGVTLMEASQLAHNLGLSTVLNLDGGGSSQLLWKGEIVNAIPGGKERPLPYGI
FT                   FFGSRE"
FT   gene            595579..595654
FT                   /locus_tag="Amico_R0020"
FT                   /note="tRNA-Ala1"
FT   tRNA            595579..595654
FT                   /locus_tag="Amico_R0020"
FT                   /product="tRNA-Ala"
FT   gene            595822..596232
FT                   /locus_tag="Amico_0568"
FT   CDS_pept        595822..596232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0568"
FT                   /product="S-adenosylmethionine decarboxylase proenzyme"
FT                   /note="KEGG: nis:NIS_1526 S-adenosylmethionine
FT                   decarboxylase proenzyme; TIGRFAM: S-adenosylmethionine
FT                   decarboxylase proenzyme; PFAM: S-adenosylmethionine
FT                   decarboxylase related"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56704"
FT                   /db_xref="GOA:D5EDS2"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="InterPro:IPR017716"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDS2"
FT                   /inference="protein motif:TFAM:TIGR03330"
FT                   /protein_id="ADE56704.1"
FT                   /translation="MSPKGYHFIVEASGCGGVIGQVERLQEILVEAAKRANTQVWSVSF
FT                   HRFPPYGVSGVVVISESHLSVHTWPEAQYMALDIYTCGEHSMPEVAVKYVLEQVGAAHT
FT                   HITEITRGIDDGDEIYYHSFITWEERLKEEVE"
FT   gene            complement(596316..596391)
FT                   /locus_tag="Amico_R0021"
FT                   /note="tRNA-Glu2"
FT   tRNA            complement(596316..596391)
FT                   /locus_tag="Amico_R0021"
FT                   /product="tRNA-Glu"
FT   gene            complement(596400..596473)
FT                   /locus_tag="Amico_R0022"
FT                   /note="tRNA-Gln2"
FT   tRNA            complement(596400..596473)
FT                   /locus_tag="Amico_R0022"
FT                   /product="tRNA-Gln"
FT   gene            596717..596812
FT                   /locus_tag="Amico_0569"
FT   CDS_pept        596717..596812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56705"
FT                   /db_xref="GOA:D5EDS3"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDS3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56705.1"
FT                   /translation="MNVNLNILINIIIILLVIISCGSSSGVPTGV"
FT   gene            596990..598330
FT                   /locus_tag="Amico_0570"
FT   CDS_pept        596990..598330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0570"
FT                   /product="sodium:neurotransmitter symporter"
FT                   /note="PFAM: sodium:neurotransmitter symporter; KEGG:
FT                   cvi:CV_1670 sodium/chloride ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56706"
FT                   /db_xref="GOA:D5EDS4"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDS4"
FT                   /inference="protein motif:PFAM:PF00209"
FT                   /protein_id="ADE56706.1"
FT                   /translation="MKQEKMEREQWGSRIGFLLASAGSAIGLGNIWRFPYITGKNGGAA
FT                   FLVIYIALAFTIGASVMLAEFAIGRAAKKNAVGAFRELKGGVWPLVGWMGLAVAFIILS
FT                   YYAVIGGWTFAYIFKSFTGLMSLHDTSAAQDSFLGFIANPTQVLLAFFVFMLMVVLVVY
FT                   KGVGQGIERASKILMPGLFIVLLVLVTRALTLPGASKGIAFYLKPDFSKVTGSTIIDAL
FT                   GQAFYSLSLGMGILITFGSYIGKNENIPKSVVTVTFLDTLVAFLAGLIIFPTVFAFGID
FT                   AGAGPGLTFITLPAVFSKMWGGMVWSALFFVLLFIAALTSSVSLFEVVVSYCKDELGWS
FT                   RGKSSLLMGTAIFLFGVPSALSQGAYPINLFGKSFLDAMDWMCNNILLTTGGLLICLFV
FT                   GWVVTDRIKDDISNKGRLNFALMSPWLLILRFLAPIAIVMIMWSGLR"
FT   gene            598489..599745
FT                   /locus_tag="Amico_0571"
FT   CDS_pept        598489..599745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0571"
FT                   /product="ketose-bisphosphate aldolase class-II"
FT                   /note="PFAM: ketose-bisphosphate aldolase class-II; KEGG:
FT                   dol:Dole_2284 fructose/tagatose bisphosphate aldolase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56707"
FT                   /db_xref="GOA:D5EDS5"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDS5"
FT                   /inference="protein motif:PFAM:PF01116"
FT                   /protein_id="ADE56707.1"
FT                   /translation="MRKNSASYKEMLKKRPLNVQALWENEEVGLVSGRDIVRAFREANA
FT                   IILAVNARNPLTIKGVFKAAQKLNAAVFIEIAKSESTYCAGNFDNLPEYAVKTSAELGH
FT                   GIVFGLHVDHYAIKSEKDLFKAVGHLPSVIQKGWTSVAIDASHMPDWENLCFTRDIAMH
FT                   IPPYLGLEVEVGEIKGPGELTTVEEAQFFIGGLNSWGIFPDLLAISNGSLHGTYDTGQQ
FT                   EGIDLQRTQDIAHVIRPFGVSIAQHGISGTPIEKVAKFANFGINKGNVATLFQNIVFGI
FT                   KMDSDTGNAIAENGSYVKEPHRGVSEKTWQKIVEWCDSQSYSRKDGNYKKANLPLGNVI
FT                   LEESPEIIGRIIDETEEWASRFIKAFNAVDSADRVLEVIAKRSDHNGAPEQAILGKRSD
FT                   YTEDRAPGHSLKDGGDYSD"
FT   gene            600076..601125
FT                   /locus_tag="Amico_0572"
FT   CDS_pept        600076..601125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0572"
FT                   /product="threonine synthase"
FT                   /note="KEGG: abo:ABO_0807 threonine synthase; TIGRFAM:
FT                   threonine synthase; PFAM: Pyridoxal-5'-phosphate-dependent
FT                   protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56708"
FT                   /db_xref="GOA:D5EDS6"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR026260"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDS6"
FT                   /inference="protein motif:TFAM:TIGR00260"
FT                   /protein_id="ADE56708.1"
FT                   /translation="MARQGILHRYEKDLPLTRATPRITLMEGDTPLIHLKNLSRELKVE
FT                   LWAKFDGLNPTGSFKDRGMVMAVAKALEEKTTAVICASTGNTSASAAAYAASAGLACFV
FT                   LLPAGKVALGKLTQALIYGAKVVAVKGNFDEALQLAREAALSKKITLVNSINPYRLWGQ
FT                   RSAAWEICDELQKAPDWIVLPVGNAGNISAYAAGLEYYKEIGKIDSMPRLMGVQAEGAA
FT                   PLVLGRIVEKPETVATAIRIGNPVNAEKAVRAIEMSNGKFDAVTDTEILEAQRELASQD
FT                   GVFAEPASCAPLAFLLKQKRAGKLSEGLRIVLILTGNGLKDPDSPLQGLPGPISAEGTL
FT                   EALKGVLGL"
FT   gene            601122..602030
FT                   /locus_tag="Amico_0573"
FT   CDS_pept        601122..602030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0573"
FT                   /product="homoserine kinase"
FT                   /note="KEGG: homoserine kinase (predicted); K00872
FT                   homoserine kinase; TIGRFAM: homoserine kinase; PFAM: GHMP
FT                   kinase; GHMP kinase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56709"
FT                   /db_xref="GOA:D5EDS7"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDS7"
FT                   /inference="protein motif:TFAM:TIGR00191"
FT                   /protein_id="ADE56709.1"
FT                   /translation="MRLFRVKVPASSANLGSGFDTLGLGLSLYNFFDVRAFLKKGSYVL
FT                   EIIGEGSGELGRENNALIQSYEFACNKWGIDPPGLDLCSLNAIPMARGLGSSSTAIVAG
FT                   VAIANTLRENSLQKDELLSLMVELEGHPDNVVPCCMGGMVVSGVDGGIIRFVKMPPLPE
FT                   DMVAVVAVPEVRVSTQSAREALPTKVFLKDAVYNISRAALLAASWSTGNWSNLPWAMGD
FT                   RLHQPFRARLFPGGEEILRELSNAPNCSGVAISGSGPSMIAFARGLAGDIAKLMCSIFS
FT                   RHGIRSRFFVLREDREGLSIF"
FT   gene            602063..602575
FT                   /pseudo
FT                   /locus_tag="Amico_0574"
FT   gene            602637..603395
FT                   /locus_tag="Amico_0575"
FT   CDS_pept        602637..603395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0575"
FT                   /product="OstA family protein"
FT                   /note="PFAM: OstA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56710"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDS8"
FT                   /inference="protein motif:PFAM:PF03968"
FT                   /protein_id="ADE56710.1"
FT                   /translation="MKKGLRHVRACAVIAFLFIYAGALWGIEAHVTADTMVYHSRTGDF
FT                   TAEGNVRIQRMELEITAPMGEGNSQTGHVILSGGVHIFGKWENEPVDLTSVFLEGHLSN
FT                   GGRYSLRENVSGYLGARIIDAQELEVSESSFIAKKVKKFEDTKQKMFLSASTVKGNISN
FT                   GETTDIQASGDVVIVITETDGQKTRITGSNAVYSKAQDNIKVWGNALAVQPERTLRAEE
FT                   ILYSPQSGKILASGKPQITIQIQDKEGKKQ"
FT   gene            603395..604123
FT                   /locus_tag="Amico_0576"
FT   CDS_pept        603395..604123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0576"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: sat:SYN_00946 ABC transporter ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56711"
FT                   /db_xref="GOA:D5EDS9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDS9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADE56711.1"
FT                   /translation="MGAKTLKARKVCKAFKGRTVVSSVDLDVHMGEIVGLLGPNGAGKT
FT                   TTFYMIVGLIKPDSGRVMIDSKDITPFPMFRRARIGVGYLPQEASIFRNLTVKENIEIV
FT                   LQELGKPQKEIETMVSHILEELGLTSLASIPGYALSGGERRRVEIARCLSIMPDFLLLD
FT                   EPFSGIDPIAVYDIQQIILSLRAKGYGILLTDHNVRDTLAITDRTYLIHQGEIVIEGSP
FT                   DEVAQSEVARKFYLGDRFSW"
FT   gene            complement(604096..604572)
FT                   /locus_tag="Amico_0577"
FT   CDS_pept        complement(604096..604572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0577"
FT                   /product="hydrogenase maturation protease"
FT                   /note="KEGG: dze:Dd1591_2717 hydrogenase maturation
FT                   protease HycI; TIGRFAM: hydrogenase maturation protease;
FT                   PFAM: peptidase M52 hydrogen uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56712"
FT                   /db_xref="GOA:D5EDT0"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR004420"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDT0"
FT                   /inference="protein motif:TFAM:TIGR00072"
FT                   /protein_id="ADE56712.1"
FT                   /translation="MGTITLWGIGNPLFGDDGVGPFIAKELHKKRALHPITAIDCETIP
FT                   ENYIAPLKRNLPNLLLIVDAADMNLPPGSVRRIPLHMVENVSFSTHGLPLGMLLEDIAQ
FT                   KITIIYIGIQPFSQNLGESLSQKVKDAAEKLILILEKQHFEKIPLLYQENLSPK"
FT   gene            604615..606171
FT                   /locus_tag="Amico_0578"
FT   CDS_pept        604615..606171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0578"
FT                   /product="integral membrane protein MviN"
FT                   /note="KEGG: sat:SYN_00104 virulence factor protein;
FT                   TIGRFAM: integral membrane protein MviN; PFAM: virulence
FT                   factor MVIN family protein; multi antimicrobial extrusion
FT                   protein MatE"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56713"
FT                   /db_xref="GOA:D5EDT1"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDT1"
FT                   /inference="protein motif:TFAM:TIGR01695"
FT                   /protein_id="ADE56713.1"
FT                   /translation="MSSRVSRMVRHALVMMVGTFASRILGLAREIVTAALFGASSQLDA
FT                   FYVAYTLANLSRQMLAEGALSAAFVPVFSQSLVQRGKEKASHLARQALWILLVAGTAVV
FT                   FAGVILSPFLVKIMAPGFDSVKASLAISMTQWMFPFLILVSLAALAMGVLNSLDSFFVP
FT                   AIAPALSNVVYLLILFFAASRLGIWTLIIAVLAGGVCQMVLQWVWSAWNGVLLLPEKPN
FT                   SRDPELRKMMKLFFPYAAGLSLNQINPVISRVLGSFLQDGAISVLNYANRVIQLPLGLF
FT                   VIAISQAVLPELSRCAVGDEKEFRETMRDAVRFALFVILPVTIGLVLVSDEVVNLLFYR
FT                   GAFNAWAWHATGIALAMYAWGLPGMACTTVFLRGLYAQSNPRSALLVTLSSVVSNVVFC
FT                   LLLVKPMGFAGLALATSLGFTFSSFAGGYLLARSINHPLDILGVKWTLRISIVLGAMAF
FT                   TVWKFKSLCPYPVDAGLLLRCGWLFIVMLLGALIYMGGTLAFHFHEWQWLRGALKRRDK
FT                   E"
FT   gene            606191..606733
FT                   /locus_tag="Amico_0579"
FT   CDS_pept        606191..606733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56714"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDT2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56714.1"
FT                   /translation="MTRNKMKLVLLVSILLMGLTGTLGWASNSLQGKIDERTTVIWIEG
FT                   TALGDMVIGSRAQAAFVYVDGTLSHAVASDPNAPEWLKWHSNHYSDKKLKNRALFIMRY
FT                   KAIKRWSFSPEMIRIGEYKVTDDDILTSKDFMAVGELPPDSTGTLAFSVPAKYVPKGRN
FT                   ILISLGDFSGELNVPKR"
FT   gene            606740..607753
FT                   /locus_tag="Amico_0580"
FT   CDS_pept        606740..607753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0580"
FT                   /product="metalloendopeptidase, glycoprotease family"
FT                   /EC_number="3.4.24.57"
FT                   /note="TIGRFAM: metalloendopeptidase, glycoprotease family;
FT                   KEGG: glo:Glov_2314 metalloendopeptidase, glycoprotease
FT                   family; PFAM: peptidase M22 glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56715"
FT                   /db_xref="GOA:D5EDT3"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDT3"
FT                   /inference="protein motif:TFAM:TIGR00329"
FT                   /protein_id="ADE56715.1"
FT                   /translation="MERRFLTLGIESSCDDTAVSILDGQRDVKADLISSQIKDHAPFGG
FT                   VVPEFASRKHLEAILPLVDRALENAGVSDPAQELSLIGVTAGPGLMGSLLVGVMTAKAL
FT                   AQTWHLPILGVNHLEGHLFANVVASPDLEPPFICLIVSGGHTEIILAEDFGNYSLLGAT
FT                   RDDAAGEAYDKVAKLLGLGYPGGPIIDSLAHKGNSEAFSFPVPLRSSDEIAFSFSGLKT
FT                   AVLWAVKDLKEKSVDLPIADLCASFQKAAVEALMTKVERAVEVTGIRKVAISGGVAANR
FT                   GLRNALQRKKDWNVFIPPAIRCTDNGVMIAAAAYNGYKRGLISDLFLTPNPSWPLV"
FT   gene            607957..608247
FT                   /locus_tag="Amico_0581"
FT   CDS_pept        607957..608247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0581"
FT                   /product="chaperonin Cpn10"
FT                   /note="PFAM: chaperonin Cpn10; KEGG: sat:SYN_00062
FT                   co-chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56716"
FT                   /db_xref="GOA:D5EDT4"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDT4"
FT                   /inference="protein motif:PFAM:PF00166"
FT                   /protein_id="ADE56716.1"
FT                   /translation="MNLKPLGDRLVVKVINQEEKTRGGIVLPDTAKEKPQEGEVVAVGT
FT                   GKVLENGQKLPLEVKVGDRIIFSKYAGTEVKLDGDEYIIFSERDVLAIVEK"
FT   gene            608285..609922
FT                   /locus_tag="Amico_0582"
FT   CDS_pept        608285..609922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0582"
FT                   /product="chaperonin GroEL"
FT                   /note="KEGG: gur:Gura_4307 chaperonin GroEL; TIGRFAM:
FT                   chaperonin GroEL; PFAM: chaperonin Cpn60/TCP-1"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56717"
FT                   /db_xref="GOA:D5EDT5"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDT5"
FT                   /inference="protein motif:TFAM:TIGR02348"
FT                   /protein_id="ADE56717.1"
FT                   /translation="MPKILTFSEEARHAMLRGIDKVADTVGVTLGPKGRNVVLEKKFGS
FT                   PTITNDGVTIAKEIDLEDSFENTGAQLVKEVASKTNDVAGDGTTTATVLARAIIREGMK
FT                   NVAAGANGMLMRQGIEKAIDFVVDELKKMAIPVKNRDKIAQVAAISANDSGIGQLIAEA
FT                   MEKVGQDGVITVEDSQTVGTTLEMVEGLQFDKGYISPYMVTDPERMEVALDDAYILIHD
FT                   GKISNIKDLLPVLEKVVQTGKPLLIIAEDVEGEALATLVVNKLRGVMQVAAVKAPGFGE
FT                   RRKAMLSDIAIVTGGQVVSEDVGIKLDSADISMLGKAKKIRVTKEETTIVEGSGNPDEI
FT                   RKRAAQIKRELEDSTSDYDREKLQERLAKLVGGVAVIQVGSATETEQKELKHRIEDALN
FT                   ATRAAVEEGIVAGGGVAIINCIASLEKFLENFNGDVKTGGTIVLSSLSSPLHLIAQNAG
FT                   FQGDVIVEKVRGLRAGNGLDASTGEYVDMIEAGIIDPVKVTRSALQNAGSIAAMVLTTE
FT                   AIVADKPEPKGASPMPGGPGMGGMEGMY"
FT   gene            610051..611583
FT                   /locus_tag="Amico_0583"
FT   CDS_pept        610051..611583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0583"
FT                   /product="GMP synthase, large subunit"
FT                   /note="KEGG: glo:Glov_1901 GMP synthase; TIGRFAM: GMP
FT                   synthase, large subunit; GMP synthase, small subunit; PFAM:
FT                   GMP synthase domain protein; glutamine amidotransferase
FT                   class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56718"
FT                   /db_xref="GOA:D5EDT6"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDT6"
FT                   /inference="protein motif:TFAM:TIGR00884"
FT                   /protein_id="ADE56718.1"
FT                   /translation="MDNIIILDCGSQFTQLIARRIRELKVHSEIIPWDVCIDDIRQRKP
FT                   RGIIISGGPQSVMDEDSPTVPMELFEFGVPILGVCYGMQLIAKLFGGQIESGSSREYGR
FT                   TAISLKDLNSLLFKSAPGTFEVWMSHGDHIAKLPDGALLLAETDGGVPAAFAIEEKGIW
FT                   GLQFHPEVAHTQNGITILSNFLFNICGCTGDWDLGSWIDMMVKDVQQKTENARVICGLS
FT                   GGVDSTVAAVLTSKAIGDRLECIFVNNGLLRHREAERVLEKYKQLDLNVHYVDASNRFL
FT                   DALKGVIDPEQKRKIIGETFIRVFEAEAAKIHNAEWLLQGTLYPDVIESGHKGKGASVI
FT                   KSHHNVGGLPEDMKLKVLEPLRDLFKDEVRTIGALLGVPEEIVNRQPFPGPGLAVRCLG
FT                   EISRDRLDTLRAADEIFREEFSKSETYFTVWQSFCVLLPIKTVGVMGDSRTYAEVVALR
FT                   AVESSDGMTADWVRVPYDVLDRTARRICNSIKGINRVVLDVTSKPPSTIEWE"
FT   gene            611596..612804
FT                   /locus_tag="Amico_0584"
FT   CDS_pept        611596..612804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0584"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   gme:Gmet_1154 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56719"
FT                   /db_xref="GOA:D5EDT7"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDT7"
FT                   /inference="protein motif:PFAM:PF01594"
FT                   /protein_id="ADE56719.1"
FT                   /translation="MHGKAQPYDCVFSVKKLKWVRLLAYESRRPYKRIRSFFLPFTVVF
FT                   LALGALAYLVSFNLLRPLAWSAILSFFVYPFYTLIYEKILKKKYANIAASLTTAVIIVL
FT                   IVVPSIFVGVTLAREGIRIYGHLATVLSRVNVEQGKTIMSVFFPDVLAERIRPFLAEYP
FT                   FLVNVIEQVGSWIASTLATLSRSFLGDTIRILYQLIVIVVASFFMIRDGHIILDYVNDI
FT                   VPLPLKEKEAFFNRAKQILQAVIYGITLTAGVQGFLGALGWWYVGLPSPAVFGAVMALL
FT                   AMIPFIGTPLVWGPGAIYLFYSGQIKEALILAIWGLIVVSMVDNFIRPIFISGGGKAHV
FT                   LIIFIGVVGGLASWGFLGLFLGPLVISLFIFLLDSYRNIWKNYIREYGIRPSSAVSLKK
FT                   KEE"
FT   gene            612814..613461
FT                   /locus_tag="Amico_0585"
FT   CDS_pept        612814..613461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0585"
FT                   /product="Molybdopterin-guanine dinucleotide biosynthesis
FT                   protein-like protein"
FT                   /note="KEGG: sfu:Sfum_3074 molybdopterin-guanine
FT                   dinucleotide biosynthesis MobB region"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56720"
FT                   /db_xref="GOA:D5EDT8"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDT8"
FT                   /inference="protein motif:COG:COG1763"
FT                   /protein_id="ADE56720.1"
FT                   /translation="MAYIFAVSGMKNSGKTKLCLLLLKYLKEAGIHVGYIKHSHEKVLS
FT                   PMDTDTGKVLSQGIPALYWGVDGCRYEKPGEISIYDIQNRIGSNFDILLLEGGKSFPCH
FT                   KIWLGEADTCPGNIPGIVAYYEAIPAKKGGRDDTKRFFSFGEESSIADFIIALYERSSE
FT                   RLSLIIEGEKIPLRPFVSDFIEGGIKGMLSSLKKIDKLNGDIAISIKKEKDK"
FT   gene            613585..615540
FT                   /locus_tag="Amico_0586"
FT   CDS_pept        613585..615540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0586"
FT                   /product="V-type H(+)-translocating pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="TIGRFAM: V-type H(+)-translocating pyrophosphatase;
FT                   KEGG: pca:Pcar_2001 membrane-bound proton- translocating
FT                   pyrophosphatase; PFAM: Inorganic H pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56721"
FT                   /db_xref="GOA:D5EDT9"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDT9"
FT                   /inference="protein motif:TFAM:TIGR01104"
FT                   /protein_id="ADE56721.1"
FT                   /translation="MDAFWIVVGSGVLALAYAFFAYGKVKRFKVENERVNELSEIIHGG
FT                   AMAFLSREYRWLFPFALLVGALLWFTIGMGTSISFLVGALFSAVAGYIGMTVATRSNGK
FT                   TSFAATLGMNEALGIAFRGGSVMGMSVVGLGVLGIMICYALFKDPNIVTGFGFGASSIA
FT                   LFARVGGGIYTKAADVGADLVGKVEAGIPEDDPRNPAVIADNVGDNVGDIAGMGADLFE
FT                   SYVNSIIAAMAIGLTIFGDRGVFYPLLLSALGIASAIIGTMFVRVKEGGNAQVALRVGT
FT                   FVTGGVMIFGSYFITKSVFGDLTLFWSVLSGVAVGVLIGYVTEIYTSGDYDAVKQIAKS
FT                   SETGAATVILSGIAVGMKSTVIPVILICVATLVGFKFGGLFGIACAAVGMLSITGMTLS
FT                   VDAYGPIADNAGGIAEMSHLPHEVREITDKLDAVGNTTAAMGKGLAIGSAALTALALFA
FT                   AYAHAVNLDAIDLKDPYVMVGLFVGGMLPFLFSALTIQAVGRAAQSMIDEVRRQFREIP
FT                   GIMEGTGRPEYERCVDISTGSALKEMVFPGLLAVITPILVGYILGPAALGGLLGGAIVT
FT                   GVMMAIFMSNSGGAWDNAKKFIEEGNFGGKGTSNHAAAVVGDTVGDPFKDTAGPSLNIL
FT                   IKLMTVVALVLAPLFI"
FT   gene            615632..617377
FT                   /locus_tag="Amico_0587"
FT   CDS_pept        615632..617377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0587"
FT                   /product="DNA primase"
FT                   /note="TIGRFAM: DNA primase; PFAM: zinc finger CHC2-family
FT                   protein; DNA primase catalytic core domain; TOPRIM domain
FT                   protein; KEGG: dol:Dole_2153 DNA primase; SMART: zinc
FT                   finger CHC2-family protein; Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56722"
FT                   /db_xref="GOA:D5EDU0"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDU0"
FT                   /inference="protein motif:TFAM:TIGR01391"
FT                   /protein_id="ADE56722.1"
FT                   /translation="MGDDVVRQIKDRLDIADVVGDYVRLHKTGKNLKGLCPFHQEKTPS
FT                   FIVSPDRQTFHCFGCGEGGDVFSFIMKIEGLNFREALELLAQRAGVEVETSPSHFSTKG
FT                   KRSLYDIMETSLFFYRSSLKNQGGRLAQQYLNSRGMNIESASLFEIGWAPPTWDSLWRL
FT                   LFKEKVSLKEALDCGLVIEGTKGIYDRFRGRVIFPIRDVSGRLLAFGGRIIDGDSAKYI
FT                   NSPEGVLYSKRKNLYLLHMAKQEIREKNRVILVEGYMDAIRLHMTGYKEAVASLGTSLT
FT                   EDQARLLKRFTNNCFICYDSDTAGQEAAVRGMYVLQQCGLDVRVVELLSGKDPDDLLSN
FT                   EEGRELFRKAMERALPLVLFHLSLRQRQLENPDTRRAAAEDLLQGLSQLSPIDIAPFLS
FT                   SVSAALGILPYELQEQLESIRSAKKSQKTISSEQSYKTMNNNENSSRNSVVDPLEAALV
FT                   YCLWNDIARRRVARPEEVFCLVENEDVKNMLAAIFSGHSPESLEEHWRTLNETTPFAIL
FT                   AGGGAFCDSFSEDQDCWDAISLALERRREEEVFKKIHERMLRGEASKEDLEEYSKIAKK
FT                   LKSRS"
FT   gene            617424..617699
FT                   /locus_tag="Amico_0588"
FT   CDS_pept        617424..617699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0588"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="KEGG: nam:NAMH_1067 S4 domain protein; PFAM:
FT                   RNA-binding S4 domain protein; SMART: RNA-binding S4 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56723"
FT                   /db_xref="GOA:D5EDU1"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDU1"
FT                   /inference="protein motif:PFAM:PF01479"
FT                   /protein_id="ADE56723.1"
FT                   /translation="MRLDKFLKESRLVKRRVVAQEMIGIGAVRLNGRQCRSSAQVCVGD
FT                   TVEIAYMTRVLKVTVLVDDEKELRKKQSIPYVLQEERRVNSDEKPW"
FT   gene            617736..619022
FT                   /locus_tag="Amico_0589"
FT   CDS_pept        617736..619022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0589"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="TIGRFAM: enolase; KEGG: ppd:Ppro_1654
FT                   phosphopyruvate hydratase; PFAM: enolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56724"
FT                   /db_xref="GOA:D5EDU2"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDU2"
FT                   /inference="protein motif:TFAM:TIGR01060"
FT                   /protein_id="ADE56724.1"
FT                   /translation="MGVIAGVYGREILDSRGNPTVEVEVWLDNGIIGTAAVPSGASTGT
FT                   HEALELRDGGDRYMGKGVLTAVGNVNDKIGPELIGSDPSEQVFIDMAMVQLDGTQNKSN
FT                   LGANAMLGVSMAVARAAAEDHGLPLWAYLGGIGPNLLPTPMMNVINGGAHADNNLDIQE
FT                   FMIVPHGAGSFTEALRMAVETYHALKKTLINRGYSTGIGDEGGFAPNLQSNRQALDLIL
FT                   EAVESAGYTPGDQISLALDVAASELYKDGCYNFEGEGKILTREEIVSYYGDLCKAYPIV
FT                   SIEDGMAEDDWDGWSVLTKNLGKSMQLVGDDLFVTNPERLERGICQGVANSILIKLNQI
FT                   GTVTETMKVIDMAIRQGYSTVISHRSGETDDTFISDLAVAIGAGQIKSGAPARTDRVAK
FT                   YNQLLRIEEEISSGLGTEYAGLTRFNICR"
FT   gene            619068..619697
FT                   /locus_tag="Amico_0590"
FT   CDS_pept        619068..619697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0590"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; Rex DNA-binding
FT                   domain protein; KEGG: sfu:Sfum_1603 redox-sensing
FT                   transcriptional repressor REX"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56725"
FT                   /db_xref="GOA:D5EDU3"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDU3"
FT                   /inference="protein motif:PFAM:PF02629"
FT                   /protein_id="ADE56725.1"
FT                   /translation="MKIAEPTVERLVQYHRLLEQLYNEGQKVVSSQEIGEMLAFKASQV
FT                   RKDLSYFGEIGKRGVGYHVEKLYRHIDGILASPRKWPIALIGVGRLGEALLGHKAFKSP
FT                   KFDIKALFDVNPEKVGRKIAGISCYHVDDISDVMRKNGIEVVILTVPSSVAQECVDKIV
FT                   QAGTVKGILNFSPLSIVAPDSVLIYSVDISVELEKLLFYLKHREER"
FT   gene            619782..620186
FT                   /locus_tag="Amico_0591"
FT   CDS_pept        619782..620186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0591"
FT                   /product="preprotein translocase, YajC subunit"
FT                   /note="KEGG: bba:Bd2235 preprotein translocase YajC
FT                   subunit; TIGRFAM: preprotein translocase, YajC subunit;
FT                   PFAM: YajC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56726"
FT                   /db_xref="GOA:D5EDU4"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDU4"
FT                   /inference="protein motif:TFAM:TIGR00739"
FT                   /protein_id="ADE56726.1"
FT                   /translation="MNQQCGQTTGAGGAQGGLLGMLFPLVIFVLIFYFFIIRPQKKRQK
FT                   QHDDLLAALTRGDQVITAGGFFGIIREVKDDSIILEIADGVKVRILKSSIVNKRSSVAE
FT                   QGKEKVTEEPKEVSEEHKIEEKTTEENEKK"
FT   gene            620304..621698
FT                   /locus_tag="Amico_0592"
FT   CDS_pept        620304..621698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0592"
FT                   /product="protein-export membrane protein SecD"
FT                   /note="KEGG: dde:Dde_1818 preprotein translocase subunit
FT                   SecD; TIGRFAM: protein-export membrane protein SecD;
FT                   protein-export membrane protein, SecD/SecF family; PFAM:
FT                   SecD/SecF/SecDF export membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56727"
FT                   /db_xref="GOA:D5EDU5"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDU5"
FT                   /inference="protein motif:TFAM:TIGR01129"
FT                   /protein_id="ADE56727.1"
FT                   /translation="MLKKDRWRLAIVIVVVVAALLSVFPLDGKINLGLDLKGGAHIVLQ
FT                   AKPTSGSALTDDSIERLLAVLRNRIDQYGVAEPVIQREGRDRVIVDLPGVEDPEAALEL
FT                   IGKTALLEFRKVLGATPAMPPGPERQNYASDDEFQAAQKRWNDAKVEIETYKSELEKQV
FT                   GIAGGDIVAKDEEGRYFLLGPSLVSGKHLVDAKTQFDNLGRAVVTLEFNSEGAKLFEQA
FT                   TAENVGKQISIVLDGNVVSAPVVQERISGGNAQISGRFSTAEAQRLAIMLRAGALPVPV
FT                   DVLENRSVGPSLGADSINAGLKAGLIGTLLVLGFMLLYYRTLGIAADVALTVCLLLVFA
FT                   GLISLKATLTLPGIAGIILTIGMAVDGNILIYERIIEEAKLGKTPTAAIDAGFKKALTT
FT                   ILDANITTLIAAGVLYYFGSGPIRGFAVTLSIGILASVFSAIVVTRVLLQVLMGGSKSP
FT                   FLVNRS"
FT   gene            621717..622595
FT                   /locus_tag="Amico_0593"
FT   CDS_pept        621717..622595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0593"
FT                   /product="protein-export membrane protein SecF"
FT                   /note="KEGG: tgr:Tgr7_2065 preprotein translocase subunit
FT                   SecF; TIGRFAM: protein-export membrane protein SecF;
FT                   protein-export membrane protein, SecD/SecF family; PFAM:
FT                   SecD/SecF/SecDF export membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56728"
FT                   /db_xref="GOA:D5EDU6"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDU6"
FT                   /inference="protein motif:TFAM:TIGR00966"
FT                   /protein_id="ADE56728.1"
FT                   /translation="MFRRDFSFKFMKHRRQAILLSLGLIVVSLVLLFTKGLNLGIDFTG
FT                   GNLIQVEFASQVPVGDVRDVLAEIGQKQAVIQGYSDNGVIIRVNVDTEESRKEVIQTLK
FT                   DKYPGMEVLRFEKVGPVVGEKLRREAFLAVSLALLGILAYITVRFKFRFAVVSVIALMH
FT                   DTIITLGIFSLLGREISLPFIAAILTIVGYSLNDTIVVFDRVRENWKYLRQEGLLEVLD
FT                   MSINQTLSRTINTSLTTFFPVLALFIWGGAVIANFSFALLLGILVGTYSSVCIASSLLA
FT                   EWYLRYPESKK"
FT   gene            622780..624231
FT                   /locus_tag="Amico_0594"
FT   CDS_pept        622780..624231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0594"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG: gsu:GSU0244
FT                   radical SAM domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56729"
FT                   /db_xref="GOA:D5EDU7"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDU7"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADE56729.1"
FT                   /translation="MAITMIDRAKGILSQKAIEKAASMLKKGDEKNLTTLFRGIAGIAP
FT                   ARYHRETFKQLADMVEKNDPFVGFVKRIALELNPHCLSKFIHNLVVNFMVLGRGIRDQK
FT                   EKEYNVHLPNFMVISPTMKCNLHCKGCYAAEYDTSRELTFYELDNLLKDAKDLGMYFFT
FT                   FSGGEAFFRNDLLDLWEKHNDCYFQVYTNGTLLDDKMVDRLVKLGNVMPMISVEGSREQ
FT                   TDFRRGAGVYDKVIAAYQRLNEAGVMFGFSATYTRSAADYMASDEFIQTMIQRGCKVGW
FT                   FFQYVPVGENPDLSYMATPHQRARLHEKVEEWRHRDDCPIFIGDFWNDGPYVDGCMAAG
FT                   ERYWHIISDGSVEPCVFVPFAVDNIRQKSLVDIARSPFFTYIRNQLPYDGEDNLLRPCM
FT                   ILDHPDVLREVVTKFGARPCHGGLGNLLSGEIPRALDEYAQEIKQIYDPLWEKREKGKY
FT                   LKSLEKEDKKEWLERMTLPTGSEEK"
FT   gene            624260..624688
FT                   /locus_tag="Amico_0595"
FT   CDS_pept        624260..624688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0595"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56730"
FT                   /db_xref="GOA:D5EDU8"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDU8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADE56730.1"
FT                   /translation="MRSYALAVGLAMLISAVFAFQNTGEITVNFLIWTRQVPQGIWEVA
FT                   VFAGGCVLMWLVSMSAALESRGKYKKQIRELDGKMKKLEEERTSLLNALNATSNVTSHN
FT                   ATSCVEEGKENCIVLPSEPLETVKEEFETTPREENEQQ"
FT   gene            624685..626349
FT                   /locus_tag="Amico_0596"
FT   CDS_pept        624685..626349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0596"
FT                   /product="phosphoesterase RecJ domain protein"
FT                   /note="PFAM: phosphoesterase RecJ domain protein;
FT                   phosphoesterase DHHA1; KEGG: dal:Dalk_5177
FT                   single-stranded-DNA-specific exonuclease RecJ"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56731"
FT                   /db_xref="GOA:D5EDU9"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDU9"
FT                   /inference="protein motif:PFAM:PF01368"
FT                   /protein_id="ADE56731.1"
FT                   /translation="MTSFCLRSKLNVTTLEDSCHRIARELSCPPFVAAILEMQGRVSLH
FT                   DIDKARAWLSPSLDFFAASCFLGEGARAVAERWQRLSSLGNVVVYGDYDVDGVSSTTLA
FT                   MELCKERAAGVRYYIPHRHMEGYGLHRQVVQQLLVAGCDTLIIVDCGTKDGDILKEAQQ
FT                   TGMNVFVFDHHLPEKGELPASFIVNPQIDGDKEGKLLCATAVLWLWAYQFKIMPMEWLA
FT                   EHLDLVALATIADCMTLGSLNRALVKEGLERIRYTARPGLELLIKRLGLFHRFVNEEQL
FT                   AMKVIPCLNAAGRLAFADLAVKVLTGEEPVENHVEELISLNRKRQNLSTRITKEAVKVV
FT                   EERSKHVLFEESWPVGVLSGVASRLCSEKNAPVVLAAPVQDWIRGTLRMPEGGNAVQVL
FT                   DHLSDQLEAWGGHKQAAGFSVSKDNWEKLRGDLEHILASVEYEDPEISALALHPSQITL
FT                   QDWKSALDLGPFGMGNPCPLLYCESYGNEQFLPLGKTGLHLKIQLGSEYLVAFNSVEIL
FT                   KTLSSSHITGWVYHPRVDFWRGQPRLQFMLDYIVLDS"
FT   gene            626480..628684
FT                   /locus_tag="Amico_0597"
FT   CDS_pept        626480..628684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0597"
FT                   /product="(p)ppGpp synthetase I, SpoT/RelA"
FT                   /EC_number="2.7.6.5"
FT                   /note="SMART: metal-dependent phosphohydrolase HD region;
FT                   TIGRFAM: RelA/SpoT family protein; KEGG: gbm:Gbem_3211
FT                   (p)ppGpp synthetase I, SpoT/RelA; PFAM: RelA/SpoT domain
FT                   protein; TGS domain protein; amino acid-binding ACT domain
FT                   protein; metal-dependent phosphohydrolase HD sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Amico_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ADE56732"
FT                   /db_xref="GOA:D5EDV0"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:D5EDV0"
FT                   /inference="protein motif:TFAM:TIGR00691"
FT                   /protein_id="ADE56732.1"
FT                   /translation="MRDSYIGRIPETERTISVKFAWHELWSKVTYYLTKEELKKLGEAF
FT                   VMAADAHGEQKRSSGDPYVVHSINVASILADMQLDLVTLIAALLHDVLEDTALSAEKVK
FT                   SAFGDDVITLVDGVTKLGKLPFKSFEDYQAENLRKMFVVMAKDIRVVLIKLADRLHNMR
FT                   TLGALRRDKQLRIAKETLEIYAPLAHRLGIYQVKRGLEDLAFKYSDPDMYYEIRRRVRK
FT                   KLPEREAIIKKAIEILQDRLKQESIHFKVKGRAKHFYSIYEKMNRKKLPVEQLYDLLAL
FT                   RVVVDDVAACYTVLGIVHTIWKPIPGQFDDYIANPKTNMYQSLHTTVVGPTGEPLEVQI
FT                   RSAEMNRLAEYGIAAHWRYKEGGNVLDDLDARLTWIRQALEGDHEGGPTEFLERLKEDV
FT                   LTSDVFVFTPQGKVVSLPKGSTPIDFAYAIHTQVGNRCVGAMVNNRIVSLTYEVKNGDI
FT                   VKIITSPQGTPSRDWLKMARSSKAKGKIRSFFRQQEKAERQEKIERGHELLEREIKRRD
FT                   IEDLSAEYEDLIPLLNRIARDIGHANGEDILVAIGNNTLSPSTLIQKLIGRTQVPALPE
FT                   IPEEIPPAGIKKTDSDIIVEGAEGVQVVIANCCLPVPGDEIVGYSTRSRGITVHRSGCP
FT                   NVEEAGETRLIQISWGPGTRGNRYTTRLKLEAMDRSGLFTDVAQAIMASDGNIVGIKAN
FT                   VVGGTLARMKIEIRVRDIEHLYAIVAKLNAVKNVIEVTRG"
FT   gene            628691..629140
FT                   /locus_tag="Amico_0598"
FT   CDS_pept        628691..629140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amico_0598"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /note="KEGG: gur:Gura_0610 D-tyrosyl-tRNA(Tyr) deacylase;
FT                   TIGRFAM: D-tyrosyl-tRNA(Tyr) deacyl