(data stored in SCRATCH3701 zone)

EMBL: CP001999

ID   CP001999; SV 1; circular; genomic DNA; STD; PRO; 3192235 BP.
XX
AC   CP001999;
XX
PR   Project:PRJNA32593;
XX
DT   19-MAY-2010 (Rel. 104, Created)
DT   11-SEP-2019 (Rel. 142, Last updated, Version 8)
XX
DE   Arcobacter nitrofigilis DSM 7299 chromosome, complete genome.
XX
KW   .
XX
OS   Arcobacter nitrofigilis DSM 7299
OC   Bacteria; Proteobacteria; Epsilonproteobacteria; Campylobacterales;
OC   Campylobacteraceae; Arcobacter group; Arcobacter.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-3192235
RX   PUBMED; 21304714.
RA   Pati A., Gronow S., Lapidus A., Copeland A., Glavina Del Rio T., Nolan M.,
RA   Lucas S., Tice H., Cheng J.F., Han C., Chertkov O., Bruce D., Tapia R.,
RA   Goodwin L., Pitluck S., Liolios K., Ivanova N., Mavromatis K., Chen A.,
RA   Palaniappan K., Land M., Hauser L., Chang Y.J., Jeffries C.D., Detter J.C.,
RA   Rohde M., Goker M., Bristow J., Eisen J.A., Markowitz V., Hugenholtz P.,
RA   Klenk H.P., Kyrpides N.C.;
RT   "Complete genome sequence of Arcobacter nitrofigilis type strain (CI)";
RL   Stand Genomic Sci 2(3):300-308(2010).
XX
RN   [2]
RP   1-3192235
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Mikhailova N., Chertkov O., Brettin T., Detter J.C., Han C., Tapia R.,
RA   Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T.,
RA   Wu D., Gronow S., Wellnitz S., Schneider S., Klenk H.-P., Eisen J.A.;
RT   "The complete genome of Arcobacter nitrofigilis DSM 7299";
RL   Unpublished.
XX
RN   [3]
RP   1-3192235
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Mikhailova N., Chertkov O., Brettin T., Detter J.C., Han C., Tapia R.,
RA   Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T.,
RA   Wu D., Gronow S., Wellnitz S., Schneider S., Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (30-MAR-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; f1939c2d73ea305e7d4d55e3b8dafc4f.
DR   BioSample; SAMN02598489.
DR   CABRI; DSM 7299.
DR   EnsemblGenomes-Gn; Arnit_R0001.
DR   EnsemblGenomes-Gn; Arnit_R0002.
DR   EnsemblGenomes-Gn; Arnit_R0003.
DR   EnsemblGenomes-Gn; Arnit_R0004.
DR   EnsemblGenomes-Gn; Arnit_R0005.
DR   EnsemblGenomes-Gn; Arnit_R0006.
DR   EnsemblGenomes-Gn; Arnit_R0007.
DR   EnsemblGenomes-Gn; Arnit_R0008.
DR   EnsemblGenomes-Gn; Arnit_R0009.
DR   EnsemblGenomes-Gn; Arnit_R0010.
DR   EnsemblGenomes-Gn; Arnit_R0011.
DR   EnsemblGenomes-Gn; Arnit_R0012.
DR   EnsemblGenomes-Gn; Arnit_R0013.
DR   EnsemblGenomes-Gn; Arnit_R0014.
DR   EnsemblGenomes-Gn; Arnit_R0015.
DR   EnsemblGenomes-Gn; Arnit_R0016.
DR   EnsemblGenomes-Gn; Arnit_R0017.
DR   EnsemblGenomes-Gn; Arnit_R0018.
DR   EnsemblGenomes-Gn; Arnit_R0019.
DR   EnsemblGenomes-Gn; Arnit_R0020.
DR   EnsemblGenomes-Gn; Arnit_R0021.
DR   EnsemblGenomes-Gn; Arnit_R0022.
DR   EnsemblGenomes-Gn; Arnit_R0023.
DR   EnsemblGenomes-Gn; Arnit_R0024.
DR   EnsemblGenomes-Gn; Arnit_R0025.
DR   EnsemblGenomes-Gn; Arnit_R0026.
DR   EnsemblGenomes-Gn; Arnit_R0027.
DR   EnsemblGenomes-Gn; Arnit_R0028.
DR   EnsemblGenomes-Gn; Arnit_R0029.
DR   EnsemblGenomes-Gn; Arnit_R0030.
DR   EnsemblGenomes-Gn; Arnit_R0031.
DR   EnsemblGenomes-Gn; Arnit_R0032.
DR   EnsemblGenomes-Gn; Arnit_R0033.
DR   EnsemblGenomes-Gn; Arnit_R0034.
DR   EnsemblGenomes-Gn; Arnit_R0035.
DR   EnsemblGenomes-Gn; Arnit_R0036.
DR   EnsemblGenomes-Gn; Arnit_R0037.
DR   EnsemblGenomes-Gn; Arnit_R0038.
DR   EnsemblGenomes-Gn; Arnit_R0039.
DR   EnsemblGenomes-Gn; Arnit_R0040.
DR   EnsemblGenomes-Gn; Arnit_R0041.
DR   EnsemblGenomes-Gn; Arnit_R0042.
DR   EnsemblGenomes-Gn; Arnit_R0043.
DR   EnsemblGenomes-Gn; Arnit_R0045.
DR   EnsemblGenomes-Gn; Arnit_R0046.
DR   EnsemblGenomes-Gn; Arnit_R0047.
DR   EnsemblGenomes-Gn; Arnit_R0048.
DR   EnsemblGenomes-Gn; Arnit_R0049.
DR   EnsemblGenomes-Gn; Arnit_R0050.
DR   EnsemblGenomes-Gn; Arnit_R0051.
DR   EnsemblGenomes-Gn; Arnit_R0052.
DR   EnsemblGenomes-Gn; Arnit_R0053.
DR   EnsemblGenomes-Gn; Arnit_R0054.
DR   EnsemblGenomes-Gn; Arnit_R0055.
DR   EnsemblGenomes-Gn; Arnit_R0056.
DR   EnsemblGenomes-Gn; Arnit_R0057.
DR   EnsemblGenomes-Gn; Arnit_R0058.
DR   EnsemblGenomes-Gn; Arnit_R0059.
DR   EnsemblGenomes-Gn; Arnit_R0060.
DR   EnsemblGenomes-Gn; Arnit_R0061.
DR   EnsemblGenomes-Gn; Arnit_R0062.
DR   EnsemblGenomes-Gn; Arnit_R0063.
DR   EnsemblGenomes-Gn; Arnit_R0064.
DR   EnsemblGenomes-Gn; Arnit_R0065.
DR   EnsemblGenomes-Gn; Arnit_R0066.
DR   EnsemblGenomes-Gn; Arnit_R0067.
DR   EnsemblGenomes-Gn; Arnit_R0068.
DR   EnsemblGenomes-Gn; Arnit_R0069.
DR   EnsemblGenomes-Gn; Arnit_R0070.
DR   EnsemblGenomes-Gn; Arnit_R0071.
DR   EnsemblGenomes-Gn; EBG00001110654.
DR   EnsemblGenomes-Gn; EBG00001110655.
DR   EnsemblGenomes-Gn; EBG00001110656.
DR   EnsemblGenomes-Gn; EBG00001110657.
DR   EnsemblGenomes-Gn; EBG00001110658.
DR   EnsemblGenomes-Gn; EBG00001110659.
DR   EnsemblGenomes-Gn; EBG00001110660.
DR   EnsemblGenomes-Gn; EBG00001110661.
DR   EnsemblGenomes-Gn; EBG00001110662.
DR   EnsemblGenomes-Gn; EBG00001110663.
DR   EnsemblGenomes-Gn; EBG00001110664.
DR   EnsemblGenomes-Gn; EBG00001110665.
DR   EnsemblGenomes-Gn; EBG00001110666.
DR   EnsemblGenomes-Gn; EBG00001110667.
DR   EnsemblGenomes-Gn; EBG00001110668.
DR   EnsemblGenomes-Gn; EBG00001110669.
DR   EnsemblGenomes-Gn; EBG00001110670.
DR   EnsemblGenomes-Gn; EBG00001110671.
DR   EnsemblGenomes-Gn; EBG00001110672.
DR   EnsemblGenomes-Gn; EBG00001110673.
DR   EnsemblGenomes-Gn; EBG00001110674.
DR   EnsemblGenomes-Gn; EBG00001110675.
DR   EnsemblGenomes-Gn; EBG00001110676.
DR   EnsemblGenomes-Gn; EBG00001110677.
DR   EnsemblGenomes-Gn; EBG00001110678.
DR   EnsemblGenomes-Gn; EBG00001110679.
DR   EnsemblGenomes-Gn; EBG00001110680.
DR   EnsemblGenomes-Gn; EBG00001110681.
DR   EnsemblGenomes-Gn; EBG00001110682.
DR   EnsemblGenomes-Gn; EBG00001110683.
DR   EnsemblGenomes-Gn; EBG00001110684.
DR   EnsemblGenomes-Gn; EBG00001110685.
DR   EnsemblGenomes-Gn; EBG00001110686.
DR   EnsemblGenomes-Gn; EBG00001110687.
DR   EnsemblGenomes-Gn; EBG00001110688.
DR   EnsemblGenomes-Gn; EBG00001110689.
DR   EnsemblGenomes-Gn; EBG00001110690.
DR   EnsemblGenomes-Gn; EBG00001110691.
DR   EnsemblGenomes-Gn; EBG00001110692.
DR   EnsemblGenomes-Gn; EBG00001110693.
DR   EnsemblGenomes-Gn; EBG00001110694.
DR   EnsemblGenomes-Gn; EBG00001110695.
DR   EnsemblGenomes-Gn; EBG00001110696.
DR   EnsemblGenomes-Gn; EBG00001110697.
DR   EnsemblGenomes-Gn; EBG00001110698.
DR   EnsemblGenomes-Gn; EBG00001110699.
DR   EnsemblGenomes-Gn; EBG00001110700.
DR   EnsemblGenomes-Gn; EBG00001110701.
DR   EnsemblGenomes-Gn; EBG00001110702.
DR   EnsemblGenomes-Gn; EBG00001110703.
DR   EnsemblGenomes-Gn; EBG00001110704.
DR   EnsemblGenomes-Gn; EBG00001110705.
DR   EnsemblGenomes-Gn; EBG00001110706.
DR   EnsemblGenomes-Gn; EBG00001110707.
DR   EnsemblGenomes-Gn; EBG00001110708.
DR   EnsemblGenomes-Gn; EBG00001110709.
DR   EnsemblGenomes-Gn; EBG00001110710.
DR   EnsemblGenomes-Gn; EBG00001110711.
DR   EnsemblGenomes-Gn; EBG00001110712.
DR   EnsemblGenomes-Gn; EBG00001110713.
DR   EnsemblGenomes-Gn; EBG00001110714.
DR   EnsemblGenomes-Gn; EBG00001110715.
DR   EnsemblGenomes-Gn; EBG00001110716.
DR   EnsemblGenomes-Gn; EBG00001110717.
DR   EnsemblGenomes-Gn; EBG00001110718.
DR   EnsemblGenomes-Gn; EBG00001110719.
DR   EnsemblGenomes-Gn; EBG00001110720.
DR   EnsemblGenomes-Gn; EBG00001110721.
DR   EnsemblGenomes-Gn; EBG00001110722.
DR   EnsemblGenomes-Gn; EBG00001110723.
DR   EnsemblGenomes-Gn; EBG00001110724.
DR   EnsemblGenomes-Gn; EBG00001110725.
DR   EnsemblGenomes-Gn; EBG00001110726.
DR   EnsemblGenomes-Tr; Arnit_R0001-1.
DR   EnsemblGenomes-Tr; Arnit_R0002-1.
DR   EnsemblGenomes-Tr; Arnit_R0003-1.
DR   EnsemblGenomes-Tr; Arnit_R0004-1.
DR   EnsemblGenomes-Tr; Arnit_R0005-1.
DR   EnsemblGenomes-Tr; Arnit_R0006-1.
DR   EnsemblGenomes-Tr; Arnit_R0007-1.
DR   EnsemblGenomes-Tr; Arnit_R0008-1.
DR   EnsemblGenomes-Tr; Arnit_R0009-1.
DR   EnsemblGenomes-Tr; Arnit_R0010-1.
DR   EnsemblGenomes-Tr; Arnit_R0011-1.
DR   EnsemblGenomes-Tr; Arnit_R0012-1.
DR   EnsemblGenomes-Tr; Arnit_R0013-1.
DR   EnsemblGenomes-Tr; Arnit_R0014-1.
DR   EnsemblGenomes-Tr; Arnit_R0015-1.
DR   EnsemblGenomes-Tr; Arnit_R0016-1.
DR   EnsemblGenomes-Tr; Arnit_R0017-1.
DR   EnsemblGenomes-Tr; Arnit_R0018-1.
DR   EnsemblGenomes-Tr; Arnit_R0019-1.
DR   EnsemblGenomes-Tr; Arnit_R0020-1.
DR   EnsemblGenomes-Tr; Arnit_R0021-1.
DR   EnsemblGenomes-Tr; Arnit_R0022-1.
DR   EnsemblGenomes-Tr; Arnit_R0023-1.
DR   EnsemblGenomes-Tr; Arnit_R0024-1.
DR   EnsemblGenomes-Tr; Arnit_R0025-1.
DR   EnsemblGenomes-Tr; Arnit_R0026-1.
DR   EnsemblGenomes-Tr; Arnit_R0027-1.
DR   EnsemblGenomes-Tr; Arnit_R0028-1.
DR   EnsemblGenomes-Tr; Arnit_R0029-1.
DR   EnsemblGenomes-Tr; Arnit_R0030-1.
DR   EnsemblGenomes-Tr; Arnit_R0031-1.
DR   EnsemblGenomes-Tr; Arnit_R0032-1.
DR   EnsemblGenomes-Tr; Arnit_R0033-1.
DR   EnsemblGenomes-Tr; Arnit_R0034-1.
DR   EnsemblGenomes-Tr; Arnit_R0035-1.
DR   EnsemblGenomes-Tr; Arnit_R0036-1.
DR   EnsemblGenomes-Tr; Arnit_R0037-1.
DR   EnsemblGenomes-Tr; Arnit_R0038-1.
DR   EnsemblGenomes-Tr; Arnit_R0039-1.
DR   EnsemblGenomes-Tr; Arnit_R0040-1.
DR   EnsemblGenomes-Tr; Arnit_R0041-1.
DR   EnsemblGenomes-Tr; Arnit_R0042-1.
DR   EnsemblGenomes-Tr; Arnit_R0043-1.
DR   EnsemblGenomes-Tr; Arnit_R0045-1.
DR   EnsemblGenomes-Tr; Arnit_R0046-1.
DR   EnsemblGenomes-Tr; Arnit_R0047-1.
DR   EnsemblGenomes-Tr; Arnit_R0048-1.
DR   EnsemblGenomes-Tr; Arnit_R0049-1.
DR   EnsemblGenomes-Tr; Arnit_R0050-1.
DR   EnsemblGenomes-Tr; Arnit_R0051-1.
DR   EnsemblGenomes-Tr; Arnit_R0052-1.
DR   EnsemblGenomes-Tr; Arnit_R0053-1.
DR   EnsemblGenomes-Tr; Arnit_R0054-1.
DR   EnsemblGenomes-Tr; Arnit_R0055-1.
DR   EnsemblGenomes-Tr; Arnit_R0056-1.
DR   EnsemblGenomes-Tr; Arnit_R0057-1.
DR   EnsemblGenomes-Tr; Arnit_R0058-1.
DR   EnsemblGenomes-Tr; Arnit_R0059-1.
DR   EnsemblGenomes-Tr; Arnit_R0060-1.
DR   EnsemblGenomes-Tr; Arnit_R0061-1.
DR   EnsemblGenomes-Tr; Arnit_R0062-1.
DR   EnsemblGenomes-Tr; Arnit_R0063-1.
DR   EnsemblGenomes-Tr; Arnit_R0064-1.
DR   EnsemblGenomes-Tr; Arnit_R0065-1.
DR   EnsemblGenomes-Tr; Arnit_R0066-1.
DR   EnsemblGenomes-Tr; Arnit_R0067-1.
DR   EnsemblGenomes-Tr; Arnit_R0068-1.
DR   EnsemblGenomes-Tr; Arnit_R0069-1.
DR   EnsemblGenomes-Tr; Arnit_R0070-1.
DR   EnsemblGenomes-Tr; Arnit_R0071-1.
DR   EnsemblGenomes-Tr; EBT00001701749.
DR   EnsemblGenomes-Tr; EBT00001701750.
DR   EnsemblGenomes-Tr; EBT00001701751.
DR   EnsemblGenomes-Tr; EBT00001701752.
DR   EnsemblGenomes-Tr; EBT00001701753.
DR   EnsemblGenomes-Tr; EBT00001701754.
DR   EnsemblGenomes-Tr; EBT00001701755.
DR   EnsemblGenomes-Tr; EBT00001701756.
DR   EnsemblGenomes-Tr; EBT00001701757.
DR   EnsemblGenomes-Tr; EBT00001701758.
DR   EnsemblGenomes-Tr; EBT00001701759.
DR   EnsemblGenomes-Tr; EBT00001701760.
DR   EnsemblGenomes-Tr; EBT00001701761.
DR   EnsemblGenomes-Tr; EBT00001701762.
DR   EnsemblGenomes-Tr; EBT00001701763.
DR   EnsemblGenomes-Tr; EBT00001701764.
DR   EnsemblGenomes-Tr; EBT00001701765.
DR   EnsemblGenomes-Tr; EBT00001701766.
DR   EnsemblGenomes-Tr; EBT00001701767.
DR   EnsemblGenomes-Tr; EBT00001701768.
DR   EnsemblGenomes-Tr; EBT00001701769.
DR   EnsemblGenomes-Tr; EBT00001701770.
DR   EnsemblGenomes-Tr; EBT00001701771.
DR   EnsemblGenomes-Tr; EBT00001701772.
DR   EnsemblGenomes-Tr; EBT00001701773.
DR   EnsemblGenomes-Tr; EBT00001701774.
DR   EnsemblGenomes-Tr; EBT00001701775.
DR   EnsemblGenomes-Tr; EBT00001701776.
DR   EnsemblGenomes-Tr; EBT00001701777.
DR   EnsemblGenomes-Tr; EBT00001701778.
DR   EnsemblGenomes-Tr; EBT00001701779.
DR   EnsemblGenomes-Tr; EBT00001701780.
DR   EnsemblGenomes-Tr; EBT00001701781.
DR   EnsemblGenomes-Tr; EBT00001701782.
DR   EnsemblGenomes-Tr; EBT00001701783.
DR   EnsemblGenomes-Tr; EBT00001701784.
DR   EnsemblGenomes-Tr; EBT00001701785.
DR   EnsemblGenomes-Tr; EBT00001701786.
DR   EnsemblGenomes-Tr; EBT00001701787.
DR   EnsemblGenomes-Tr; EBT00001701788.
DR   EnsemblGenomes-Tr; EBT00001701789.
DR   EnsemblGenomes-Tr; EBT00001701790.
DR   EnsemblGenomes-Tr; EBT00001701791.
DR   EnsemblGenomes-Tr; EBT00001701792.
DR   EnsemblGenomes-Tr; EBT00001701793.
DR   EnsemblGenomes-Tr; EBT00001701794.
DR   EnsemblGenomes-Tr; EBT00001701795.
DR   EnsemblGenomes-Tr; EBT00001701796.
DR   EnsemblGenomes-Tr; EBT00001701797.
DR   EnsemblGenomes-Tr; EBT00001701798.
DR   EnsemblGenomes-Tr; EBT00001701799.
DR   EnsemblGenomes-Tr; EBT00001701800.
DR   EnsemblGenomes-Tr; EBT00001701801.
DR   EnsemblGenomes-Tr; EBT00001701802.
DR   EnsemblGenomes-Tr; EBT00001701803.
DR   EnsemblGenomes-Tr; EBT00001701804.
DR   EnsemblGenomes-Tr; EBT00001701805.
DR   EnsemblGenomes-Tr; EBT00001701806.
DR   EnsemblGenomes-Tr; EBT00001701807.
DR   EnsemblGenomes-Tr; EBT00001701808.
DR   EnsemblGenomes-Tr; EBT00001701809.
DR   EnsemblGenomes-Tr; EBT00001701810.
DR   EnsemblGenomes-Tr; EBT00001701811.
DR   EnsemblGenomes-Tr; EBT00001701812.
DR   EnsemblGenomes-Tr; EBT00001701813.
DR   EnsemblGenomes-Tr; EBT00001701814.
DR   EnsemblGenomes-Tr; EBT00001701815.
DR   EnsemblGenomes-Tr; EBT00001701816.
DR   EnsemblGenomes-Tr; EBT00001701817.
DR   EnsemblGenomes-Tr; EBT00001701818.
DR   EnsemblGenomes-Tr; EBT00001701819.
DR   EnsemblGenomes-Tr; EBT00001701820.
DR   EnsemblGenomes-Tr; EBT00001701821.
DR   EuropePMC; PMC6256499; 30533764.
DR   EuropePMC; PMC6256585; 30533749.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01069; purD.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001999.
DR   SILVA-SSU; CP001999.
DR   StrainInfo; 128227; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4085824
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Arcobacter nitrofigilis DSM 7299
CC   Culture Collection ID :: DSM 7299, ATCC 33309, CCUG 15893, LMG
CC                            7604, NCTC 12251
CC   GOLD Stamp ID         :: Gi02306
CC   Greengenes ID         :: 260782
CC   Isolation Site        :: roots of the marshplant Spartina
CC                            alterniflora in Nova Scotia, Canada
CC   Isolation Country     :: Canada
CC   Host Name             :: Spartina alterniflora
CC   Oxygen Requirement    :: Microaerophilic
CC   Cell Shape            :: Rod-shaped
CC   Motility              :: Motile
CC   Sporulation           :: Nonsporulating
CC   Temperature Range     :: Mesophile
CC   Temperature Optimum   :: 25C
CC   Gram Staining         :: gram-
CC   Biotic Relationship   :: Symbiotic
CC   Diseases              :: None
CC   Habitat               :: Host
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3192235
FT                   /organism="Arcobacter nitrofigilis DSM 7299"
FT                   /host="Sporobolus alterniflorus"
FT                   /strain="DSM 7299"
FT                   /mol_type="genomic DNA"
FT                   /country="Canada:Nova Scotia"
FT                   /isolation_source="roots"
FT                   /note="type strain of Arcobacter nitrofigilis"
FT                   /db_xref="taxon:572480"
FT                   /type_material="type strain of Arcobacter nitrofigilis"
FT   gene            71..1384
FT                   /locus_tag="Arnit_0001"
FT   CDS_pept        71..1384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="COGs: COG0593 ATPase involved in DNA replication
FT                   initiation;
FT                   InterProIPR020591:IPR010921:IPR003593:IPR013159:IPR
FT                   013317:IPR001957; KEGG: abu:Abu_0001 chromosomal
FT                   replication initiator protein DnaA; PFAM: Chromosomal
FT                   replication initiator DnaA; Chromosomal replication
FT                   initiator DnaA domain; SMART: Chromosomal replication
FT                   initiator DnaA domain; AAA ATPase; SPTR: A8EQT0 Chromosomal
FT                   replication initiator protein dnaA; TIGRFAM: chromosomal
FT                   replication initiator protein DnaA; PFAM: domain; Bacterial
FT                   dnaA protein; TIGRFAM: chromosomal replication initiator
FT                   protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91671"
FT                   /db_xref="GOA:D5V3G0"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3G0"
FT                   /protein_id="ADG91671.1"
FT                   /translation="MTTKEILSVLKNETSKSDYDRYLKQLIYKKISSDDNIAIFEVPNK
FT                   YIANWIKSKYSKIIQHCIETIDGTKPTVEIKLTGEKKTKKEILKEQVGKTDVESTILNP
FT                   SYTFDSFVVGSSNQMAFNASLAVSKKPGIQYNPLFIYGGTGLGKTHLLQAIGNDAIEHG
FT                   RTIIYVTIEQFMNDFTFAIKNKNMEHFRSKYRKCDVLLIDDIQFLSGKEQTQEEFFHTF
FT                   NELHNAEKQIVMTSDRLPSQIAGLVDRLKSRFEWGLTADVQIPGLETKIAIIEKKSELN
FT                   GIHLEREIVNYIATNLDNSIREIEGVLIRINASAALLNQEINLPMVQNLLKEQIKETKE
FT                   NIKLPDIITIVAIELNIKPSDIKSKKRTAIVANARRIVIYLARELTHNSMPDIAKFLGM
FT                   KDHSSISHNIKKANELIEKDENFKLIIENLKNKIINRG"
FT   gene            1545..2615
FT                   /locus_tag="Arnit_0002"
FT   CDS_pept        1545..2615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="COGs: COG0592 DNA polymerase sliding clamp subunit
FT                   (PCNA homolog); InterPro IPR001001; KEGG: abu:Abu_0002 DNA
FT                   polymerase III subunit beta; PFAM: DNA polymerase III beta
FT                   chain; PRIAM: DNA-directed DNA polymerase; SMART: DNA
FT                   polymerase III beta chain; SPTR: A8EQT1 DNA polymerase III,
FT                   beta subunit; TIGRFAM: DNA polymerase III, beta subunit;
FT                   PFAM: DNA polymerase III beta subunit, C-terminal domain;
FT                   DNA polymerase III beta subunit, N-terminal domain; DNA
FT                   polymerase III beta subunit, central domain; TIGRFAM: DNA
FT                   polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91672"
FT                   /db_xref="GOA:D5V3G1"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3G1"
FT                   /protein_id="ADG91672.1"
FT                   /translation="MRFIIAKNIFENIISSMQPFLEKKDSSSITSHIYLEVINSKLILK
FT                   ATDYEIGLESYVNDIEESTDGKGTVNGSNLLGIIKRLKNDKIIVETIDNNLVIKQSRST
FT                   FKLPMYDANEYPNLIMNTELNILNISTISLVNSIRKITPAIDNNNPKFELNGALIDIKN
FT                   SKINFVATDTRRLAISHLQNISNNESQFIIPKKAIIEIQKLFLDDAKIAYDDTNLVIET
FT                   DNSKFFTKLINGKFPDYERIIPNSLKYNLTLPKAMLIDSIKLVTSLFSNIKITFSPNSM
FT                   VFESLDEDTESKTQIDIDLNISENFYLAVNAKYLLDFLSMSNNENVVVGFNESNLPFYL
FT                   EDDKFFTIVMPIVLDK"
FT   gene            2629..4947
FT                   /locus_tag="Arnit_0003"
FT   CDS_pept        2629..4947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0003"
FT                   /product="DNA gyrase, B subunit"
FT                   /note="COGs: COG0187 Type IIA topoisomerase (DNA
FT                   gyrase/topo II topoisomerase IV) B subunit;
FT                   InterProIPR001241:IPR000565:IPR013760:IPR003594:IPR
FT                   020568:IPR018522:IPR013759:IPR013506:IPR006171:IPR002288:I
FT                   PR011557; KEGG: abu:Abu_0003 DNA gyrase subunit B; PFAM:
FT                   DNA topoisomerase type IIA subunit B region 2 domain
FT                   protein; ATP-binding region ATPase domain protein; TOPRIM
FT                   domain protein; DNA gyrase subunit B domain protein; SMART:
FT                   DNA topoisomerase II; ATP-binding region ATPase domain
FT                   protein; SPTR: A8EQT2 DNA gyrase subunit B; TIGRFAM: DNA
FT                   gyrase, B subunit; PFAM: Histidine kinase-, DNA gyrase B-,
FT                   and HSP90-like ATPase; DNA gyrase B; DNA gyrase B subunit,
FT                   carboxyl terminus; TIGRFAM: DNA gyrase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91673"
FT                   /db_xref="GOA:D5V3G2"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3G2"
FT                   /protein_id="ADG91673.1"
FT                   /translation="MSQEYGASNIKVLKGLEAVRKRPGMYIGDTNTNGLHHMVYEVVDN
FT                   SIDEAMAGYCKNIKITMTKDHWIRVEDDGRGIPTAIHEGEGISAATVVLTVLHAGGKFD
FT                   KDTYKVSGGLHGVGVSVVNALSKEVKMTIYREGKIHYQEFSKGIPKAPLEVIGDSPRKT
FT                   GTTIEFLADDSIFEVNTYDFAVLAKRFREVAYLNSFISITLINEITKKTEVYHFEGGIK
FT                   QFVEDINTATAVSDAVAFNDNVDGVEVDIAVMYNDTYVEKTLSFVNNIRTIDGGTHEAG
FT                   FKAGLTRSIVKYLNENAAAREKDTKITGDDVREGLIAIISVKVPEPQFEGQTKGKLGSS
FT                   YVKPICQRLTSEQLDKYFEENPAQAKAIMDKALMAARGREAAKKARDMTRKKDAMTVGT
FT                   LPGKLAECQSKDPAIRELYLVEGDSAGGSAKQGRDRVYQAILPLKGKILNVEKSRLDKI
FT                   LKSDEIRNMITALGCGIGEDFDEEKIRYHKIIFMTDADVDGSHIQTLLLTFFFRFLRPV
FT                   IEKGYLYIAQPPLYRYKKGKNETYLKDDNALSAFLIENGLESFEFQGLGYNDLVDLFKT
FT                   VSRYRGMLQQLEKRYSLAEVLKHLIENSNLVNLDYQALYEEVKGFLEAKGYNILSKRLT
FT                   DESIQLFVQTKEGLEELLIDDELFASPYFSEATYIYNKLVERDLTVFEGRDLVEILDEI
FT                   ETLAKKGAYIQRYKGLGEMNPEQLWETTMTPEARRLLRVTIDDATVASDTFTLFMGDEV
FT                   EPRRNYIEEHAKDVEHLDV"
FT   gene            5120..5452
FT                   /locus_tag="Arnit_0004"
FT   CDS_pept        5120..5452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0004"
FT                   /product="protein of unknown function DUF891"
FT                   /note="COGs: COG4679 Phage-related protein; InterPro
FT                   IPR009241; KEGG: amr:AM1_6214 putative phage protein GP49;
FT                   PFAM: protein of unknown function DUF891; SPTR: B0C629
FT                   Phage derived protein Gp49-like protein (DUF891); PFAM:
FT                   Phage derived protein Gp49-like (DUF891)"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91674"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3G3"
FT                   /protein_id="ADG91674.1"
FT                   /translation="MNWNIEYFNESVENQILDLPVGLLARYLKLTDMMLIHGSNLGLPH
FT                   TKSLSSGLFELRLKSKEGIGRVFYCTKVGKNIIMLHSFVKKSQKIPKNEMDIALQRLKE
FT                   VKENDS"
FT   gene            5442..5741
FT                   /locus_tag="Arnit_0005"
FT   CDS_pept        5442..5741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0005"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="InterPro IPR010982:IPR001387; KEGG: amr:AM1_6215
FT                   helix-turn-helix domain-containing protein; PFAM:
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein; SPTR: B0C630 Helix-turn-helix domain
FT                   protein; PFAM: Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91675"
FT                   /db_xref="GOA:D5V3G4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3G4"
FT                   /protein_id="ADG91675.1"
FT                   /translation="MTHEELKQKALQNKNVKKEYDDLELEFQLLNEMLHARKEAGLNQL
FT                   QVAELMGTKQTAITRLESALSAGGHSPSLTTLKKYANAVGCHLDIKFVNNRESI"
FT   gene            5806..6309
FT                   /locus_tag="Arnit_0006"
FT   CDS_pept        5806..6309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0006"
FT                   /product="protein of unknown function DUF45"
FT                   /note="COGs: COG1451 metal-dependent hydrolase; InterPro
FT                   IPR002725; KEGG: abu:Abu_0267 metal-dependent hydrolase;
FT                   PFAM: protein of unknown function DUF45; SPTR: A8ERG8
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function DUF45"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91676"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3G5"
FT                   /protein_id="ADG91676.1"
FT                   /translation="MKNLKYLNHYPKDIISQIQKLIDDKKLDKYLLNKYKTSHEYKNDK
FT                   ALYSYAMDFKNSYLKKSLPLSKVIYDGKINVINDALGLHTIISRVQGGKLKSKNEIRIG
FT                   TLFKNVPEEFLRMIVVHELAHLKEKEHDKAFYSLCCFMEPNYHQFEFDLRVYLTYMDLY
FT                   GKLY"
FT   gene            6548..6943
FT                   /locus_tag="Arnit_0007"
FT   CDS_pept        6548..6943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0007"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pfo:Pfl01_5227 hypothetical protein; SPTR:
FT                   Q3K5J0 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF3010)"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91677"
FT                   /db_xref="InterPro:IPR021378"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3G6"
FT                   /protein_id="ADG91677.1"
FT                   /translation="MNICGIELKANQTILAVQIDGEYKDLKTKKITLEDDEKQESIRSY
FT                   CNDLLVFLTQNDIEQVYIKKRAKKGNFAGGAVTFKMESLIQLNPKCTVDLVSAQAMGSF
FT                   ERKNSIEYPEALNKYQEQAYLTILTSK"
FT   gene            7254..8267
FT                   /locus_tag="Arnit_0008"
FT   CDS_pept        7254..8267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0008"
FT                   /product="Extracellular solute-binding protein, family 7"
FT                   /note="COGs: COG4663 TRAP-type mannitol/chloroaromatic
FT                   compound transport system periplasmic component; InterPro
FT                   IPR018389; KEGG: vsp:VS_II0405 TRAP dicarboxylate family
FT                   transporter, DctP subunit; PFAM: Extracellular
FT                   solute-binding protein, family 7; SPTR: C9NTT3 Predicted
FT                   gluconate TRAP family transporter DctP subunit; PFAM:
FT                   Bacterial extracellular solute-binding protein, family 7"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91678"
FT                   /db_xref="GOA:D5V3G7"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3G7"
FT                   /protein_id="ADG91678.1"
FT                   /translation="MFKKLLKLSLAIGMFATFLQGASTFTLKLQSADPSGSINFKLQEK
FT                   WAKTVATMTNSDIKIEILPVNSIVKYTETLDAIGAGVLDGEISSIAYFSGKDPAFALMG
FT                   NTVGAWSDPNDLILFMEYGGGNEFMNKLMNPYGVTFVSAMTNGLESLVAKKPIRSVAEL
FT                   KGLKMRAPEGLVQAVFKAAGAAPVNLPYSEVFTSLDKGVIEAADASTLAVNAQAGLNKI
FT                   AKYPIFPGFHSIPLMDLSINTKLWNKMPKNYQEIIKVSFRDYVRQIISTIKLSDKAEAA
FT                   RATATKDYTIITWPESEKIKFRRIAQGEWKKMSTESPNAKEAYDLITKFLKDNGMI"
FT   sig_peptide     7254..7346
FT                   /locus_tag="Arnit_0008"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            8267..8779
FT                   /locus_tag="Arnit_0009"
FT   CDS_pept        8267..8779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0009"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter DctQ component"
FT                   /note="InterPro IPR007387; KEGG: pin:Ping_2934 tripartite
FT                   ATP-independent periplasmic transporter DctQ; PFAM:
FT                   Tripartite ATP-independent periplasmic transporter DctQ
FT                   component; SPTR: C9PCZ1 Predicted gluconate TRAP family
FT                   transporter DctQ subunit; PFAM: Tripartite ATP-independent
FT                   periplasmic transporters, DctQ component"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91679"
FT                   /db_xref="GOA:D5V3G8"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3G8"
FT                   /protein_id="ADG91679.1"
FT                   /translation="MENSELKYNKLDRLIISIGRKICIFYIVCFIIICYEVFSRYVLNS
FT                   PTSWVQETTTLIAGILFIWGGLHSLTTDRHIKITILYDMLTKKYKYYVDILISTLLIIC
FT                   LVFMNYSAFLLFKSSWFKPWGAFYMETSGSAWNPPFPAISKLVLFVVLILMLIQVLVKF
FT                   ISILRRK"
FT   gene            8779..10104
FT                   /locus_tag="Arnit_0010"
FT   CDS_pept        8779..10104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0010"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="COGs: COG4664 TRAP-type mannitol/chloroaromatic
FT                   compound transport system large permease component;
FT                   InterPro IPR010656:IPR004681; KEGG: rsk:RSKD131_4254 TRAP
FT                   dicarboxylate transporter, DctM subunit; PFAM: TRAP
FT                   C4-dicarboxylate transport system permease DctM subunit;
FT                   SPTR: Q0G5L5 TRAP dicarboxylate transporter, DctM subunit;
FT                   TIGRFAM: TRAP dicarboxylate transporter, DctM subunit;
FT                   PFAM: DctM-like transporters; TIGRFAM: TRAP transporter,
FT                   DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91680"
FT                   /db_xref="GOA:D5V3G9"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3G9"
FT                   /protein_id="ADG91680.1"
FT                   /translation="MFELLNISSMGIEAGSLLMLGMIIGLLILGLPLAFITALVAGFFL
FT                   LFWIGPQASSLISTRVYAFVTSYAFVSVPMFVLMAAILDGSNISKDLFAAMKSFSGNIR
FT                   GSVAIQTIVLAVFLAAMSGIIGGETILLGMIALPQMLKMGYDKKLAIGVVVSGGALGTM
FT                   VPPSIVLIIFGLTANVSISDLFTAAFIPALMLAGFYVAYVLIRGYLNPSMVPESVQEYV
FT                   PWSEKFKALKKVILPLFVAASVLGSIYMGIASVTESSAIGVLGITISVYLRKELTWKLM
FT                   VDSAYKTLETCGTIIWIGIGATLLVGVFNLMGGIEFVKGVILAHGSGSPVYIIFLMMVI
FT                   LFFLGMFLDWVGIVLLTIPIFMPIVIALGYDPVWFGVLFALNMQIAFLSPPFGTGVFIL
FT                   KTVAPSDVSLGDIFKAVIPFIMLQALAIVVLIIFPEIALWWK"
FT   gene            10156..11607
FT                   /locus_tag="Arnit_0011"
FT   CDS_pept        10156..11607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0011"
FT                   /product="Glycolaldehyde dehydrogenase"
FT                   /EC_number="1.2.1.22"
FT                   /EC_number="1.2.1.21"
FT                   /note="COGs: COG1012 NAD-dependent aldehyde dehydrogenase;
FT                   InterPro IPR016161:IPR016160:IPR016162:IPR015590; KEGG:
FT                   cff:CFF8240_0070 aldehyde dehydrogenase A; PFAM: Aldehyde
FT                   Dehydrogenase; PRIAM: Glycolaldehyde dehydrogenase; SPTR:
FT                   A0RM47 Aldehyde dehydrogenase A; PFAM: Aldehyde
FT                   dehydrogenase family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91681"
FT                   /db_xref="GOA:D5V3H0"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR015657"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3H0"
FT                   /protein_id="ADG91681.1"
FT                   /translation="MSEKRVYEMYINGEFVSNKGETTPVINPSTKEIISYIPKGNAEDA
FT                   KVAIDAAHNAQDAWAKLPAVERGNYLRKIAQKIRENSDMLAKTITQEQGKVLGLAEVEV
FT                   NFTADYLDYMAEWARRYEGEIIQSDRPNENIFLFKLPIGVATGVLPWNFPFFLIARKLA
FT                   PALLTGNTIVIKPSGETPNNAFEFAKLVDQIDLPKGVFNLVSGSGSTVGNELAANEKVG
FT                   IVSFTGSVPTGVKIMEAASKNVTKVSLELGGKAPAIVMADANLDIAVEAIKNSRVTNNG
FT                   QVCNCAERVYVHKSIAKEFTDRITKSMAALTCGNPLTEKIDMGPLINEDAITHVQKLVD
FT                   SAVAAGASITTGGKRCDRDDGYFYEPTVVIDVKQDMDIIKEEIFGPVLPIVTFDTLDEA
FT                   IALANDSEFGLTSSIYTQNLDIAMRACKEIKCGETYINRENFEAMQGFHAGWKKSGIGG
FT                   ADGKHGLEEFLQTKVVYLQYDLNKQ"
FT   gene            complement(11768..12952)
FT                   /locus_tag="Arnit_0012"
FT   CDS_pept        complement(11768..12952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0012"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="COGs: COG4948 L-alanine-DL-glutamate epimerase;
FT                   InterPro IPR013341:IPR013342; KEGG: bcm:Bcenmc03_6234
FT                   mandelate racemase/muconate lactonizing protein; PFAM:
FT                   Mandelate racemase/muconate lactonizing protein; SPTR:
FT                   A5ZUR5 Putative uncharacterized protein; PFAM: Mandelate
FT                   racemase / muconate lactonizing enzyme, C-terminal domain;
FT                   Mandelate racemase / muconate lactonizing enzyme,
FT                   N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91682"
FT                   /db_xref="GOA:D5V3H1"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR023444"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3H1"
FT                   /protein_id="ADG91682.1"
FT                   /translation="MEMSKRTIKSIRAYVVSGGGADYHDQGEEHWIVKQISTPMSLFPE
FT                   YKQTRTSFGINALKTIVVEVEDNTGNVGFGISTGGYPAAWLVMNHIDRFIVGQNPSDIE
FT                   KMWEQMYRGTLYYGRKGIVMNAISAVDLALWDLLGKIRNEPVYSMIGGKVRDELEFYAT
FT                   GPRPDLAKEMGFIGGKMPLVYGPADGEEGLKKNIEYARIMREAVGDDFMLMWDCWMSLD
FT                   LPYAKKLMHESEKLGMKWIEECFNPDDYWAYRDLKKAAGNTMMVTGGEHEATKYGFKML
FT                   IEMCDLDILQPDVGWCGGMTELIKIGNLAEAAGKLVIPHGSGVYSHHYVITKLSSPFTE
FT                   CLMMAPKADKVLPQYYPLLLDEPVPVNGKLKVSDKPGFGVTLNRDNLIEVKKEA"
FT   gene            complement(12967..13863)
FT                   /locus_tag="Arnit_0013"
FT   CDS_pept        complement(12967..13863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0013"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="COGs: COG0329 Dihydrodipicolinate
FT                   synthase/N-acetylneuraminate lyase; InterPro
FT                   IPR002220:IPR020625:IPR013785; KEGG: gka:GK1961
FT                   dihydrodipicolinate synthase; PFAM: dihydrodipicolinate
FT                   synthetase; SPTR: A5ZUR8 Putative uncharacterized protein;
FT                   PFAM: Dihydrodipicolinate synthetase family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91683"
FT                   /db_xref="GOA:D5V3H2"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3H2"
FT                   /protein_id="ADG91683.1"
FT                   /translation="MGKIQGVFPPLITVFNEDSTIDIDSIKKHIDFLIEKGVDGVAILG
FT                   TTGEFFSLSFEEKKFLVENILAHTKNRIKVIVGVGETNSTEAFKFINYLEDKDVEALLV
FT                   INPYFVVYDEETIIKYYGEICNRTSKNVLIYNFPTLSGFDFTYDIVRKIALKNDNLIGI
FT                   KETVEDIKHIEKMLKIKDEKKDFSVFCAFESQAIDALNLGVDGFINATVNFAPEFTVNT
FT                   YKYFNEGNEELTKEYFDKMNSAMKVYTYSQPLLQACKQAVYFRVLKENKYEKLPAYSLS
FT                   EEKKQELKSDLQKLNIL"
FT   gene            14054..14827
FT                   /locus_tag="Arnit_0014"
FT   CDS_pept        14054..14827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0014"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="COGs: COG1414 Transcriptional regulator; InterPro
FT                   IPR005471:IPR014757; KEGG: amt:Amet_0500 transcriptional
FT                   regulator IclR-like protein; PFAM: Transcriptional
FT                   regulator IclR; regulatory protein IclR; SPTR: A6TKK9
FT                   Transcriptional regulator IclR-like protein; PFAM: IclR
FT                   helix-turn-helix domain; Bacterial transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91684"
FT                   /db_xref="GOA:D5V3H3"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3H3"
FT                   /protein_id="ADG91684.1"
FT                   /translation="MKALHSTTSRIINILELISNNKEGYTLTEVSKLLEIPKTSLSPIL
FT                   KTLAYYNYLAYNEITLKYSIYIGILSVSSSVNKNNAIVKFIKEEMNKIVGSCNEICQLG
FT                   VLDKDEVLYVEKVNASNPIQLATSVGVQFPANCSALGKALLYKHSFKELKNVFPGELER
FT                   RTENTITSIKDLYEDIIKIDQNGYATEKEEGMKEVECIAVPIIKDNLVLAAISVSIPLF
FT                   RSSQKKKDKVIDLLTESRKKVEKYISNMNVKSIFD"
FT   gene            complement(14840..15472)
FT                   /locus_tag="Arnit_0015"
FT   CDS_pept        complement(14840..15472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0015"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="COGs: COG1280 Putative threonine efflux protein;
FT                   InterPro IPR001123; KEGG: spl:Spea_0493 lysine exporter
FT                   protein LysE/YggA; PFAM: Lysine exporter protein
FT                   (LYSE/YGGA); SPTR: C6MPJ6 Lysine exporter protein
FT                   (LYSE/YGGA); PFAM: LysE type translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91685"
FT                   /db_xref="GOA:D5V3H4"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3H4"
FT                   /protein_id="ADG91685.1"
FT                   /translation="MNIDIFIQGFIPLALAHFIALLSPGADFFILVSSSSKNGKVAGIL
FT                   TAFGIAFANGLYILFALFGILLIQNNQILFISIKLVGALYLLYLSYHLIFSKQRELFTN
FT                   DKNIKKTKELLKNFLKGFLSAILNPKNSIFYFTMFSISSTHKIPLDFQIIYAFWMFFVV
FT                   LFWDIFIVYLINSKNNRVLIQKYSNKIEKISGVILFVLGFAILISLF"
FT   gene            complement(15513..16322)
FT                   /locus_tag="Arnit_0016"
FT   CDS_pept        complement(15513..16322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0016"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="COGs: COG2207 AraC-type DNA-binding
FT                   domain-containing protein;
FT                   InterProIPR009057:IPR003313:IPR018062:IPR012287:IPR
FT                   018060:IPR000005; KEGG: vsa:VSAL_I1212 transcriptional
FT                   regulator, AraC-family; PFAM: helix-turn-helix- domain
FT                   containing protein AraC type; AraC protein
FT                   arabinose-binding/dimerisation; SMART: Helix-turn-helix,
FT                   AraC domain; SPTR: A6DBM1 Transcriptional regulator, AraC
FT                   family protein; PFAM: Bacterial regulatory helix-turn-helix
FT                   proteins, AraC family; AraC-like ligand binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91686"
FT                   /db_xref="GOA:D5V3H5"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3H5"
FT                   /protein_id="ADG91686.1"
FT                   /translation="MNKTQFFIDEKIPYIELRYSKTKLNYKEHLHDDLSIGALVSGKRE
FT                   YANKNNKYIIEKDSLAIVNPNIIHSCNNITSEETSYYMLYIKKQWLFKIQKELNPALNS
FT                   FVPFSKEFLENKKEYEDFIKLCEVIFSSELYLEKEVLLLEFISNLYLNHCDFKIDSKES
FT                   YKTKVKDIMEYLNKNISENISLDELSKKFNLSTFYIIKLFKKELGISVYSYFINLKIEY
FT                   AKVLLKKGISIVETALECGFYDQSHLHRNFLKIVALTPKEYQDNFVQ"
FT   gene            complement(16329..17276)
FT                   /locus_tag="Arnit_0017"
FT   CDS_pept        complement(16329..17276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0017"
FT                   /product="TRAP transporter solute receptor, TAXI family"
FT                   /note="COGs: COG2358 TRAP-type uncharacterized transport
FT                   system periplasmic component; InterPro IPR011852; KEGG:
FT                   wsu:WS0748 immunogenic protein; SPTR: C1ZY21 TRAP
FT                   transporter solute receptor, TAXI family; TIGRFAM: TRAP
FT                   transporter solute receptor, TAXI family; PFAM: NMT1/THI5
FT                   like; TIGRFAM: TRAP transporter solute receptor, TAXI
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91687"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3H6"
FT                   /protein_id="ADG91687.1"
FT                   /translation="MKKFILLVFLGSIPTFLFATQFITIGTGGVTGTYYPTGGKICKFV
FT                   NKAKEKTNIRCSIESTGGSVFNVKAIKSGELDFAIVQSDIVYQASKGIGKFKGEEFPKL
FT                   RSVLAIYPESFTLVTRKDANINGITDIKGKRINIGNLGSGTEATALALFKTLNIETSDL
FT                   SYVGNLKSSAMPDALRDNKLDGYFYMVGHPTANIKDASNSTDTIIVPITGAKVDKFVKE
FT                   HPYFTKTDIPGGIYRGNPNDIPTFGVKAVLVASADMSDKAVYTLVKQIMENFNEFKKAH
FT                   LALSPITKKSFLVGLSAPLHSGAKKYFKEIGLIK"
FT   sig_peptide     complement(17220..17276)
FT                   /locus_tag="Arnit_0017"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(17344..18192)
FT                   /locus_tag="Arnit_0018"
FT   CDS_pept        complement(17344..18192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0018"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="InterPro IPR000620; KEGG: abu:Abu_0604 hypothetical
FT                   protein; PFAM: protein of unknown function DUF6
FT                   transmembrane; SPTR: A8ESE5 Membrane protein, putative
FT                   (DUF6 domain protein); PFAM: EamA-like transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91688"
FT                   /db_xref="GOA:D5V3H7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3H7"
FT                   /protein_id="ADG91688.1"
FT                   /translation="MMNIKLVLLVSLTLFFFATSSVLARAALINNSIDPYSFTFFRLFF
FT                   GALTLVVILFLKEKKLNLTLNKNWHTSFLLFLYAICFSYAYINLDAGLGALILFAMVQL
FT                   TIIITALIKKESINLKKALGITLAFIGLIYLLYPSEGFEVSLYHSILMMISGVAWGLYT
FT                   IFGKKSSNATLNTTDNFTKSLLFAIIFFALFVHNVKLSSYGITLAFISGGITSSIGYLL
FT                   WYYLLPNMKIITSGILQLLIPPLAIFLGVLFLNEKITSTLIISTILILLGILISIYKKD
FT                   K"
FT   sig_peptide     complement(18121..18192)
FT                   /locus_tag="Arnit_0018"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(18194..19222)
FT                   /locus_tag="Arnit_0019"
FT   CDS_pept        complement(18194..19222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0019"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="COGs: COG0492 Thioredoxin reductase; InterPro
FT                   IPR013027:IPR000103:IPR001327; KEGG: nis:NIS_1734
FT                   thioredoxin reductase; PFAM: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; SPTR: A6Q5T1
FT                   Thioredoxin reductase; PFAM: Pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91689"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3H8"
FT                   /protein_id="ADG91689.1"
FT                   /translation="MKTDNYDIAIIGGGPGGIATALEAAVHGIQNIILIDKADNHSSTI
FT                   RKFYKENKRVDKDWKGKSVQIEGNIPFMDGTKESTLDFFDKLLDLDKIDTLFNTEVESI
FT                   IKDENEDEFLISTGNQNFKSKAVVVAIGKMGKPNKPEYKIPPSIKAKVNFNLDGCSEGE
FT                   KILVVGGGNSAAEYAYELADENNNVTLVYRKAQFTRLNPENEEILRTYNGQEKLRLRLN
FT                   TNITSLENEKGKIKVNFDDGYFTLFDRIIYAIGGTSPIDFLKNCGIKLDSENKPIYNEH
FT                   YMTNILFLYVAGDIAFNTGGSIAASLNHGYHIVNSYMRRTGKIYAHTDKVEEFLKNNPE
FT                   FK"
FT   gene            19361..19738
FT                   /locus_tag="Arnit_0020"
FT   CDS_pept        19361..19738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0020"
FT                   /product="7-cyano-7-deazaguanine reductase"
FT                   /EC_number="1.7.1.13"
FT                   /note="COGs: COG0780 Enzyme related to GTP cyclohydrolase
FT                   I; InterPro IPR016856:IPR020602; KEGG: abu:Abu_0005
FT                   7-cyano-7-deazaguanine reductase; PFAM: GTP cyclohydrolase
FT                   I/Nitrile oxidoreductase; PRIAM: PreQ(1) synthase; SPTR:
FT                   A8EQT4 7-cyano-7-deazaguanine reductase; TIGRFAM:
FT                   7-cyano-7-deazaguanine reductase; PFAM: GTP cyclohydrolase
FT                   I; TIGRFAM: 7-cyano-7-deazaguanine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91690"
FT                   /db_xref="GOA:D5V3H9"
FT                   /db_xref="InterPro:IPR016856"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3H9"
FT                   /protein_id="ADG91690.1"
FT                   /translation="MKYGEKEIVEFDINKEENFWPNKNDKNYVINIELPEFMAKCPRSG
FT                   YPDFATIFIHYTPNKKVIELKALKLYINSFMLREVSHENGANEIFDTLMEKLEPKWLKV
FT                   IADFKPRGNVHTVIEIDSAKL"
FT   gene            19742..20350
FT                   /locus_tag="Arnit_0021"
FT   CDS_pept        19742..20350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0021"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: abu:Abu_0006 hypothetical protein; SPTR:
FT                   A8EQT5 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91691"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3I0"
FT                   /protein_id="ADG91691.1"
FT                   /translation="MTLERLVTTAQAAEILGISLQGVHYRIKNNQLKSIKQSGKTYVYL
FT                   WDDNSKKEGYSTSLEEVAQRKEEENIYIEKVIESKDEQILLLRKSVKWLRRQYQEEIER
FT                   LEKNQDKIISVFDSEIKLLQSAFNEMRAIYKPELKPLSPKKKFISLVDFTSLMKTYKKT
FT                   DKEIKILILKAIKNADKRFIYNKHTKKVLILDEDFSDFK"
FT   gene            complement(20362..20471)
FT                   /locus_tag="Arnit_R0001"
FT   ncRNA           complement(20362..20471)
FT                   /locus_tag="Arnit_R0001"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            20558..21523
FT                   /locus_tag="Arnit_0022"
FT   CDS_pept        20558..21523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0022"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="COGs: COG0697 Permease of the drug/metabolite
FT                   transporter (DMT) superfamily; InterPro
FT                   IPR002114:IPR000620; KEGG: dvl:Dvul_0297 hypothetical
FT                   protein; PFAM: protein of unknown function DUF6
FT                   transmembrane; SPTR: C2A221 Predicted permease, DMT
FT                   superfamily; PFAM: EamA-like transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91692"
FT                   /db_xref="GOA:D5V3I1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3I1"
FT                   /protein_id="ADG91692.1"
FT                   /translation="MTFNYRRVQFYPYFKKSDNLTKNFNLIGIFSLIFAMFIWGSSFVA
FT                   LKIAMQDLGEFTVLFFRMFIASLCFVYFIKRFSKYSFEKSDIKYMLMLCIFEPSLYFIF
FT                   EIKALTYTSVSQAGMITSLMPIITAMGAGYFLKELVSRQLLFGSVIAMIGAIWLSVQGS
FT                   VTFGAPNPMLGNFLELCAMVCGAAYTILARHLIEKYPALFITAIQAFAGAIFFFPFFIY
FT                   EYMTRDINFTQNSVLSLIYLGVVVTLAGYGLYNYALTKIEASKAAMYINLIPIFTMILA
FT                   FFILKEELSVEELIASATILSGVIISQVSVKRFRRKRKIA"
FT   sig_peptide     20558..20689
FT                   /locus_tag="Arnit_0022"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            21520..21936
FT                   /locus_tag="Arnit_0023"
FT   CDS_pept        21520..21936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0023"
FT                   /product="SNARE associated Golgi protein-related protein"
FT                   /note="COGs: COG1238 membrane protein; InterPro
FT                   IPR020143:IPR015414; KEGG: abu:Abu_0007 putative integral
FT                   membrane protein; PFAM: SNARE associated Golgi protein;
FT                   SPTR: A8EQT6 Putative uncharacterized protein; PFAM: SNARE
FT                   associated Golgi protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91693"
FT                   /db_xref="GOA:D5V3I2"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3I2"
FT                   /protein_id="ADG91693.1"
FT                   /translation="MIYLTLFFSSFVSATFFPMVSEAVLVYDILQGYNLALLLFVATLG
FT                   NSLGSCVNYFLGLKGEEYLENKKYIPKKSIDRAKSFFDKYGGWSLLLSWMPIIGDPITL
FT                   IAGVLKYKFRYFFALVVIAKFVRYAVLAYLTLLY"
FT   sig_peptide     21520..21588
FT                   /locus_tag="Arnit_0023"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(21933..22703)
FT                   /locus_tag="Arnit_0024"
FT   CDS_pept        complement(21933..22703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0024"
FT                   /product="putative transcriptional regulator, ModE family"
FT                   /note="COGs: COG2005 N-terminal domain of
FT                   molybdenum-binding protein;
FT                   InterProIPR008995:IPR011991:IPR016462:IPR000847:IPR 005116;
FT                   KEGG: hya:HY04AAS1_0940 transcriptional regulator, ModE
FT                   family; PFAM: TOBE domain protein; regulatory protein LysR;
FT                   SPTR: B6BI33 Molybdenum-pterin-binding protein; PFAM: TOBE
FT                   domain; Bacterial regulatory helix-turn-helix protein, lysR
FT                   family; TIGRFAM: ModE molybdate transport repressor domain;
FT                   molybdenum-pterin binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91694"
FT                   /db_xref="GOA:D5V3I3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR016462"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3I3"
FT                   /protein_id="ADG91694.1"
FT                   /translation="MENKFNIDGNFWVNKDTKGFIGKGRVELLKNIQIYGSISKAAKQM
FT                   KMSYKAAWDSVDIMNKLSKEPLVTKITGGVGGGGTVITTYAKEIINAYDELRNLHETYL
FT                   KNMSSLFDGLVINLKNEKPVFSKLEGKITNILSKNETCEIEITLASEQKLITIVSTEFL
FT                   EKRELTLQKYVKLLIETSSIVITKSVNSNSARNSLKGIIEKINDDGINTFLSIRCGEKN
FT                   LIDAKITNSSYKNLEIKINDTIFAQFKAYNINII"
FT   gene            22861..25557
FT                   /locus_tag="Arnit_0025"
FT   CDS_pept        22861..25557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0025"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="COGs: COG4191 Signal transduction histidine kinase
FT                   regulating C4-dicarboxylate transport system;
FT                   InterProIPR004358:IPR003594:IPR009082:IPR001638:IPR
FT                   000014:IPR005467:IPR013767; KEGG: pin:Ping_0979 sensor
FT                   histidine kinase; PFAM: extracellular solute-binding
FT                   protein family 3; PAS fold domain protein; ATP-binding
FT                   region ATPase domain protein; SMART: ATP-binding region
FT                   ATPase domain protein; extracellular solute-binding protein
FT                   family 3; PAS domain containing protein; SPTR: A1STK4
FT                   Sensor protein; TIGRFAM: PAS sensor protein; PFAM:
FT                   Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase;
FT                   Bacterial extracellular solute-binding proteins, family 3;
FT                   PAS fold; TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91695"
FT                   /db_xref="GOA:D5V3I4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3I4"
FT                   /protein_id="ADG91695.1"
FT                   /translation="MFKIFISIYLIIFFTTNIFASSTYSNISLTFKEKEWIKNNPKVSI
FT                   ALSRDFPPFSYKENGKLKGLTIDVINKIGKLTGLTFKTESSTWTTSLNNFKSGRVEIIS
FT                   DISYTKKREAFTLFTKPYYEIPNFIFGLKEDKSYKDKNSLIGKTLAVTRGIFYIDEINK
FT                   AGINTLEVDSVVDKPKVVIEGKADYFVSAYTKGIKIIKQNSLTNFKVIDEFDRIKKEDL
FT                   RFGVNPNNPLLYSIIKKALDKISSEELNSIVNKWITISQDSSNYKNINFTEEEKAYLRT
FT                   KPILKYSEINWKPLSIIENNEMQGILGDFLKIVSIRSGLKFQFVPSKSWKDVLDKFKEG
FT                   KIDLIPAVTSYKDKNVKGLLSKMYSKFPMVIITGSKYSYVNNLNDLKNKVIAVPKYYTS
FT                   YNFIKKNYPNIKILETSNIQEALILVEKGKADAFVGHIATSIFYISLLHLNDLKISGST
FT                   LFDFEHHYLVQKNNPILLSIINKTIDSITQKEKKEIYSNWIQTTVKEKAIDYKILIIIL
FT                   LITLLIIIGFLYRQYFLKKYNSKLENSYRNIQSIINSTLEAIILTEDRVCIDANDSALK
FT                   LFNLSKKEIIGLDYLEFVPDEEKQKVKESFLNNTSEPFEVNILTSDKKVIPTLGRGTNL
FT                   KLDNKIIRISSIIDLSEVKDKEKLLIEQSKMAALGEMIGHIAHQWRQPLSIITTISSSW
FT                   SIYEQIGKFNKEKVLEDSKQIVLNANYLSQTIDDFRSFIKGGEETKEFNIKELIENLSR
FT                   LISSSLQSAQVKYLFDNTLDKNVKGNQNEVLQVLINIINNAIDALTENKKDGDRFLFIK
FT                   VTQDKDTICVSIKDNANGIPENIMNKIYEPYFTTKHESNGTGLGLYMAYSIVKKMGGEI
FT                   SVSNVEYEHESKKYKGANFLVSLKCVG"
FT   sig_peptide     22861..22920
FT                   /locus_tag="Arnit_0025"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(25587..25970)
FT                   /locus_tag="Arnit_0026"
FT   CDS_pept        complement(25587..25970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0026"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="InterPro IPR017900:IPR017896:IPR001450; KEGG:
FT                   wsu:WS0032 hypothetical protein; PFAM: 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; SPTR: Q7MSX0 Putative
FT                   uncharacterized protein FDXA"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91696"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3I5"
FT                   /protein_id="ADG91696.1"
FT                   /translation="MAVKITEECISCEACAPECPVAAILEDGHDKNPTDVFYVKPESCV
FT                   ECVDHADKPRCAEACPTEGAIVWDMPYTSEFSDYYAMGNDEGTYKIREHKTKGLMLPSV
FT                   KEQKFIADIPMEDREAYANVGQF"
FT   gene            complement(26029..26493)
FT                   /locus_tag="Arnit_0027"
FT   CDS_pept        complement(26029..26493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0027"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="InterPro IPR016181:IPR000182; KEGG: tgr:Tgr7_1703
FT                   GCN5-related N-acetyltransferase; PFAM: GCN5-related
FT                   N-acetyltransferase; SPTR: B8GS82 GCN5-related
FT                   N-acetyltransferase; PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91697"
FT                   /db_xref="GOA:D5V3I6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3I6"
FT                   /protein_id="ADG91697.1"
FT                   /translation="MILKNNLQICKATNDDLPDLINLLQSLFTIEQDFTFNEKKHEEGI
FT                   ILLINNKSSEVILVKFENEVIGMITIQKIISTVMGTKVGLIEDFIIKDDYRDLGVGTYL
FT                   LEYIKDYAKKHSLTRLQLVCDEDNTTAKEFYTNKKFKRSNLNAWYYTLDK"
FT   gene            complement(26477..27724)
FT                   /locus_tag="Arnit_0028"
FT   CDS_pept        complement(26477..27724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0028"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   ClpX"
FT                   /note="COGs: COG1219 ATP-dependent protease Clp ATPase
FT                   subunit;
FT                   InterProIPR003593:IPR010603:IPR013093:IPR019489:IPR 004487;
FT                   KEGG: wsu:WS1403 ATP-dependent protease ATP-binding subunit
FT                   ClpX; PFAM: ATPase AAA-2 domain protein; zinc finger C4
FT                   domain protein; Clp ATPase-like; SMART: AAA ATPase; SPTR:
FT                   Q7M8U5 ATP-dependent Clp protease ATP-binding subunit clpX
FT                   2; TIGRFAM: ATP-dependent Clp protease, ATP-binding subunit
FT                   ClpX; PFAM: AAA domain (Cdc48 subfamily); C-terminal,
FT                   D2-small domain, of ClpB protein; ClpX C4-type zinc finger;
FT                   TIGRFAM: endopeptidase Clp ATP-binding regulatory subunit
FT                   (clpX)"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91698"
FT                   /db_xref="GOA:D5V3I7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3I7"
FT                   /protein_id="ADG91698.1"
FT                   /translation="MPSTKKSCDFCGKEIKEVKKIFSSENANICDECISMCSNVMEKET
FT                   IKEAKKEFQKGLSVPIKIKEHLDEYVIGQDDAKKVLAVALYNHYKRIDKPIVKNVELEK
FT                   SNIMLIGPTGSGKTLLAKSLAKIMDVPFAVADATALTEAGYVGEDVESILSRLLAAADF
FT                   DLEKAKRGIVYIDEIDKIANKSESATSGRDVSGEGVQQGLLKILEGAEVYVPVKGSRKN
FT                   SSAETIIFDTTHVLFICGGAFVGLRKDENKEKSTVMGFLNKDNKQKDKKDIEAKELISF
FT                   GLIPEFIGRIPVIAELNKLSKDDLIRVLKEPKNAITKQYEILFELDGVDLKFDDKALDE
FT                   IANIAYEKDVGARGLRGIIEKLMLPLQYTIPSEENLGSCVITQEYICNEKDVDLIYVKG
FT                   TEKKVSKEINYNDIKK"
FT   gene            complement(27717..28541)
FT                   /locus_tag="Arnit_0029"
FT   CDS_pept        complement(27717..28541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0029"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ttu:TERTU_1536 hypothetical protein; SPTR:
FT                   C5BTA9 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91699"
FT                   /db_xref="InterPro:IPR039444"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3I8"
FT                   /protein_id="ADG91699.1"
FT                   /translation="MDNLIEKLKSGTLVPFLGMGIFEDSIAKDGTRLPFDSDSMILALN
FT                   NGRAMSPRLMYEYSRAAMSLEQRKGREFIVQMTNHIYSSKEYDLPKVYTWLKAIKPKYV
FT                   IDTNMDDSLQKIYSDVEHFLITGVSRITADYDRFIIYKFNLSKNTYEKIEKEALTLDLP
FT                   ILFKPMGSTKPEMNFIISDADFVDWLTEAMGGFAMPPILKDFRKDKEYLFMGVDFSKDT
FT                   FRMVANEITIDLKGGFTIFNKPELTKKEDKFIKTHNLENLNLSLNEFINSHA"
FT   sig_peptide     complement(28461..28541)
FT                   /locus_tag="Arnit_0029"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(29117..29629)
FT                   /locus_tag="Arnit_0030"
FT   CDS_pept        complement(29117..29629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0030"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR012335; KEGG: cha:CHAB381_1783 thiol
FT                   peroxidase (scavengase P20); SPTR: B0NMN1 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91700"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3I9"
FT                   /protein_id="ADG91700.1"
FT                   /translation="MKYKNEEFELIDELIDVGYMAEDIEAIDLQDKELTLKKASPNRMI
FT                   QIFLSFPNFEEFKEEIIAFDEFMNDAKVEIFTYIIFDKKIDFDYKFKKILPVFDINEDY
FT                   GNMYGTKIISGNLKNCLTKALFLVGKDGAIYHIDMPEDLSKPLDMERIRIELNKVYQSY
FT                   TGVGCHG"
FT   gene            complement(29613..31175)
FT                   /locus_tag="Arnit_0031"
FT   CDS_pept        complement(29613..31175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0031"
FT                   /product="transcriptional regulator, NifA subfamily, Fis
FT                   Family"
FT                   /note="COGs: COG3604 Transcriptional regulator containing
FT                   GAF AAA-type ATPase and DNA binding domains;
FT                   InterProIPR020441:IPR009057:IPR002078:IPR003018:IPR
FT                   003593:IPR002197; KEGG: wsu:WS1404 NifA family
FT                   transcriptional regulator; PFAM: sigma-54 factor
FT                   interaction domain-containing protein; GAF domain protein;
FT                   helix-turn-helix Fis-type; SMART: GAF domain protein; AAA
FT                   ATPase; SPTR: Q7M8U4 TRANSCRIPTIONAL REGULATOR (NIFA
FT                   FAMILY); PFAM: GAF domain; Bacterial regulatory protein,
FT                   Fis family; Sigma-54 interaction domain; TIGRFAM:
FT                   Nif-specific regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91701"
FT                   /db_xref="GOA:D5V3J0"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3J0"
FT                   /protein_id="ADG91701.1"
FT                   /translation="MSLFDNTACNSCLTLRELTTLYEISAVISNHYDLETSLEKSIKIL
FT                   KNSLNLTNCTVHILEDDLLTVFASVELSTIQKKLSVYKVGEGATGVAALSKEPVVVENI
FT                   HNDSLFLNKSGKRDFSNLSYVAVPLVVENETVGVLGAALTKSTEIGFEDCVRILTIIGS
FT                   IFAQTIYSYQLNIKEKERLEDLKSYYKMEWDSKVHNFGDIIGDSPKMKQVFQVIQRIAQ
FT                   SEVTILVRGETGTGKELVAAAIHKRSKRANEPFIKLNCAAITDTLLESELFGHEKGAFT
FT                   DARETRKGRFELADKGTLFLDEIGDISSSAQVKLLRVLQEREFERVGGSKTIKVNVRLV
FT                   AATNRNLEQMVKEGKFREDLYYRLNVIPIDLPPLRERGDDIKQLVNFFLERAIKNHKKN
FT                   VKILDEAMELLASYPWPGNVRELENTMERIVLMGNENGIDSFDMSLLLPALEKGKLEDK
FT                   PIASSKQASHKKSLEDMEKEAIKEALIANNFNQSSAAKELGITLRQMGYKINKYGITNE
FT                   IQE"
FT   gene            complement(31257..31466)
FT                   /locus_tag="Arnit_0032"
FT   CDS_pept        complement(31257..31466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0032"
FT                   /product="nitrogen fixation protein FixT"
FT                   /note="InterPro IPR009727; KEGG: wsu:WS1400 hypothetical
FT                   protein; PFAM: NifT/FixU family protein; SPTR: Q7MRF3
FT                   Putative uncharacterized protein; TIGRFAM: nitrogen
FT                   fixation protein FixT; PFAM: NifT/FixU protein; TIGRFAM:
FT                   probable nitrogen fixation protein FixT"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91702"
FT                   /db_xref="GOA:D5V3J1"
FT                   /db_xref="InterPro:IPR009727"
FT                   /db_xref="InterPro:IPR024044"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3J1"
FT                   /protein_id="ADG91702.1"
FT                   /translation="MAKVMLRENEGKIYFYFAKKDMEEIIETVEFDSEENWGGECELSN
FT                   GETWWIQPGPKNLPKEEVCKKLNN"
FT   gene            complement(31486..33135)
FT                   /locus_tag="Arnit_0033"
FT   CDS_pept        complement(31486..33135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0033"
FT                   /product="L-aspartate oxidase"
FT                   /EC_number="1.4.3.16"
FT                   /note="COGs: COG1053 Succinate dehydrogenase/fumarate
FT                   reductase flavoprotein subunit; InterPro
FT                   IPR015939:IPR003953:IPR004112; KEGG: wsu:WS1399 fumarate
FT                   reductase flavoprotein subunit; PFAM: fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; PRIAM: L-aspartate oxidase; SPTR: Q7M8U6 FUMARATE
FT                   REDUCTASE FLAVOPROTEIN SUBUNIT; PFAM: domain; FAD binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91703"
FT                   /db_xref="GOA:D5V3J2"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3J2"
FT                   /protein_id="ADG91703.1"
FT                   /translation="MIYDVVVVGGGVAGLMAAIEAKKVDNTVALITKGNIFKSNSAMAS
FT                   GGINAVLNPKDSYAINSHIDDTFKSSKSLADINAITFMCKNASSIISKLEEYGVNFDKD
FT                   EKGNILQRPFGGGSANRTCYVGDKTGFAITQALIKKAKEVGITFLINTYVLNLATHENS
FT                   ISGVVCLRRSDTSVLVYPAKAVVLAGGGYAGIFRGNSTNAQDYTGDLLAVCLRARLVLK
FT                   DMEFMQFHPTGIAKTNYLVTEAARGEGGYLVNSDGERFINELETRDKIAKAILEQQQNG
FT                   KEVFIDLRHLGYEKIQEKLPSLFNAAYNQVGIDISKELLKVKPVAHYSMGGVDTNMGDT
FT                   SIKGLFVCGEMASNGVHGANRLGGNSLLEGTIFGELVGQKAYKYTHYKEYLPIDYNTVI
FT                   KDIQNIDKIFEGDTTKNFNAIRISLGKVLFEKVGIIRSEKSLIQAFDYVKYLRRESYSL
FT                   HCINKEKTNNVELISILELRNALEISEAIILSAQKRKESRGAHFREDYPNEDENLKNHI
FT                   LIKEIQKGYFRLRYEDNSLLTKIRNLFINRLD"
FT   gene            complement(33138..34247)
FT                   /locus_tag="Arnit_0034"
FT   CDS_pept        complement(33138..34247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0034"
FT                   /product="aldo/keto reductase"
FT                   /note="COGs: COG0667 oxidoreductase (related to
FT                   aryl-alcohol dehydrogenase); InterPro IPR001395; KEGG:
FT                   wsu:WS1398 hypothetical protein; PFAM: aldo/keto reductase;
FT                   SPTR: Q7MRF4 Putative uncharacterized protein; PFAM:
FT                   Aldo/keto reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91704"
FT                   /db_xref="GOA:D5V3J3"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3J3"
FT                   /protein_id="ADG91704.1"
FT                   /translation="MTEATLEATHNFAKKFSTYKEFYIKHNDLIFSKLGLGTFNKEPYK
FT                   EENYVFHYIEGVKEAVKNGINLIDSASNYRYGQSEKEIGIALKELFEEKIVTREELIIC
FT                   SKGGFIQLEYPFPKNPYTWIEDNIIKTKLATKEDIELDQHCLSADFIEWSCKKSLENMG
FT                   IDKFDIYYLHNPEIQIQKNGYKKFLKKVESIFKRFEKMVKMGFIKYYGVAVWNGFSDKS
FT                   TGEHINLEDLVEIALKVGGENHHFKYIQTPFNIAKTNIYTMPTQMVKGEECTLLQAAHR
FT                   LKIGVISSSSLLQMHLFKKSFKAETGYLLDNKMVLENDIQLALQFVRSTPGIITSLFAS
FT                   KVPVHIKSNLKITQIKTTPRAHYDLMYRV"
FT   gene            34441..36864
FT                   /locus_tag="Arnit_0035"
FT   CDS_pept        34441..36864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0035"
FT                   /product="hydrogenase (NiFe) small subunit HydA"
FT                   /note="COGs: COG1740 Ni Fe-hydrogenase I small subunit;
FT                   InterPro IPR001821:IPR013027:IPR007419:IPR006137; KEGG:
FT                   sun:SUN_1652 Ni-Fe hydrogenase, small subunit; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; BFD domain protein [2Fe-2S]-binding domain
FT                   protein; NADH ubiquinone oxidoreductase 20 kDa subunit;
FT                   SPTR: B6BMJ6 Quinone-reactive Ni/Fe-hydrogenase small
FT                   chain; TIGRFAM: hydrogenase (NiFe) small subunit HydA;
FT                   PFAM: Pyridine nucleotide-disulphide oxidoreductase; NADH
FT                   ubiquinone oxidoreductase, 20 Kd subunit; BFD-like [2Fe-2S]
FT                   binding domain; TIGRFAM: hydrogenase (NiFe) small subunit
FT                   (hydA)"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91705"
FT                   /db_xref="GOA:D5V3J4"
FT                   /db_xref="InterPro:IPR001821"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR027394"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037024"
FT                   /db_xref="InterPro:IPR037148"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3J4"
FT                   /protein_id="ADG91705.1"
FT                   /translation="MKIVIIGGGIAAVYLANNILNVDSSCSVTMLSDEEYIPYDRIHLC
FT                   RLIDTKNDVESIKLELNSAVNLQLNQTISNINKDKKEVLSNDKTYDYDKLIIATGSTPI
FT                   TLLDTTLENVSVFRNVNDCKKIEQYCKTNEVVLVGSGPIALELLDALNEMSDVKSITLL
FT                   IRSRHLYDKYISNESMQIMQTSFLKNKKVKISYEDEIVDTKIKNNKIEVLKTKKLNIKN
FT                   PFIVFGIGIKANAKPFEKFIDVNRGILVNEFMQSSDENIYAVGECAEVVKDNFVAGHVK
FT                   ECTTQANVAISHIFEKESKPFELDVAVDMLKIGDFTLVEICSSDFNNDFEKVVIESKDK
FT                   KRVDEYFLKDKKLIRFIGINSNIDTAYLEKVIKENSVIDLNYLYENRELSPRGKLVCAC
FT                   KHIYYDDLKSLIVSCKIDSFSSMKEFSEAGRVCGRCKKEVDDIIIASQDLIDNKTPKKT
FT                   LEEIKLEEELKRSQRSVDKFKKLHPKNDMDEKNLESALKMLDIGKGEINSWISMVTASM
FT                   KLNPAFEDVVSEGIKNLNKIPIIWLELSDCSGNSEAFIKSSNPVLEDLIFDYISLDYHE
FT                   LLMSASGDESETILENIIKNDKGKYVLIVEGAVPLALDGKYLRIGKKGETGVELLKKCA
FT                   KDAALVLAVGSCAFDGGVVSAYPNPTGAVGVAQALNRDDVINITGCPTNPINIVGTLLS
FT                   YMMFEELPALDKFNRPLWAYEQRVHDNCERRGHYELGEFVKEWGDDGAKNGWCLFEMGC
FT                   KGPYANVNCPSMKFNQGTSWPVQVGHGCMGCTELGFFDKFANERVYKKTKEDEK"
FT   gene            36864..38528
FT                   /locus_tag="Arnit_0036"
FT   CDS_pept        36864..38528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0036"
FT                   /product="nickel-dependent hydrogenase large subunit"
FT                   /note="COGs: COG0374 Ni Fe-hydrogenase I large subunit;
FT                   InterPro IPR018194:IPR001501; KEGG: sun:SUN_1653 Ni-Fe
FT                   hydrogenase, large subunit; PFAM: nickel-dependent
FT                   hydrogenase large subunit; SPTR: B6BMJ3 Quinone-reactive
FT                   Ni/Fe-hydrogenase large chain; PFAM: Nickel-dependent
FT                   hydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91706"
FT                   /db_xref="GOA:D5V3J5"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3J5"
FT                   /protein_id="ADG91706.1"
FT                   /translation="MKKIVIDPITRIEGHLRAEVEVDENGIVKEAYVSGQLFRGIEIIL
FT                   QNRDPRDAGLLAGRVCGVCTNSHFRGAINAVENAYSLSIPENAKIIRDLMSMALFIQDH
FT                   VVHFYQLHLLDFVDVLSVLKANPKETTKEAHKYCQKPFRNSNTHYEAVLEKLQNFIDAG
FT                   RLGPFNSGYWGHSDYKLSSEQNLILLSHYFEALQFQTKISKAIAIFGGKTPHPQSLVVG
FT                   GITSVADMLNPQRLNDFIFVIKEASDFINRAYLPDMKLLAIAYKDEIKSKSGKTAGNFL
FT                   SVGGYPINKEMKLFSGGVIFEQDFSNIQEFDADKIKEEVQRAWYSDDEKQEPFYTDLND
FT                   DGTLKTKNKDDKYSWIKAPRYDGKTMETGPVARLFISYLNNNTAINSFVDEFLKETSLK
FT                   LEDFNSTVGRNCARAIESQYICEYIFKLVSNLIQNIKYYDTNTWDKYNFSELEKDASGY
FT                   IFLEVPRGVLLHSINIENSKIKNYQIIAPTTWNATPKNSDGIRGAYEEALVGIKIADTS
FT                   KPLEVLKVLHSFDPCLACAVHIIDAKGKSLGEYKVLN"
FT   gene            complement(38525..39373)
FT                   /locus_tag="Arnit_0037"
FT   CDS_pept        complement(38525..39373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0037"
FT                   /product="Quinolinate phosphoribosyl transferase"
FT                   /note="COGs: COG0157 Nicotinate-nucleotide
FT                   pyrophosphorylase; InterPro IPR002638:IPR013785; KEGG:
FT                   abu:Abu_0906 molybdenum transport system protein ModD,
FT                   putative; PFAM: Quinolinate phosphoribosyl transferase;
FT                   SPTR: A8ET92 Molybdenum transport system protein ModD,
FT                   putative; PFAM: Quinolinate phosphoribosyl transferase,
FT                   C-terminal domain; Quinolinate phosphoribosyl transferase,
FT                   N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91707"
FT                   /db_xref="GOA:D5V3J6"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3J6"
FT                   /protein_id="ADG91707.1"
FT                   /translation="MYNLTDYELQQYINDDIPFLDLTTYLQDKNDKNVSLSIFTRENII
FT                   VACSEEAKRIAELLNCKVKSFVPSQTSIKENDVILEFNGKYEDVHKAWRACQILLEYSC
FT                   KMATYTHKMKEEIRSVNKKCELLSTRKTFPFAKKLCIKSIIIGGAMPHRLGLSESILIF
FT                   PQHRIAYKNESELLKDIQNFKRKAPEKKIVIETEELDDAKKLMQNGADVLQVDKIEIAI
FT                   LEKIINYRNKNFPNVNILVAGGVNVSNVKEYASLDIQGIVSSAMYSTGMANLGSKMSIL
FT                   N"
FT   gene            complement(39429..39842)
FT                   /locus_tag="Arnit_0038"
FT   CDS_pept        complement(39429..39842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0038"
FT                   /product="TOBE domain protein"
FT                   /note="InterPro IPR008995:IPR005116:IPR004606; KEGG:
FT                   tdn:Suden_1548 molybdenum-pterin binding protein; PFAM:
FT                   TOBE domain protein; SPTR: Q30QA6 Molybdenum-pterin binding
FT                   protein; PFAM: TOBE domain; TIGRFAM: molybdenum-pterin
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91708"
FT                   /db_xref="GOA:D5V3J7"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3J7"
FT                   /protein_id="ADG91708.1"
FT                   /translation="MKTSARNQLSGKVVEITTGTVMSEIKIEVSPSIHICATVTNDGKE
FT                   SLGIDVDSKVGTLIKASTIILSKETIKTTARNNIKGVVKEVIKGAVNSEIKVSIGENQL
FT                   CAVVTNEAVEDLSIKKDDTVYAIFKASSVILVA"
FT   gene            complement(39896..40573)
FT                   /locus_tag="Arnit_0039"
FT   CDS_pept        complement(39896..40573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0039"
FT                   /product="molybdate ABC transporter, inner membrane
FT                   subunit"
FT                   /note="COGs: COG4149 ABC-type molybdate transport system
FT                   permease component; InterPro IPR000515:IPR011867; KEGG:
FT                   cts:Ctha_1428 molybdate ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: C6RH80 Molybdate ABC
FT                   transporter, permease protein; TIGRFAM: molybdate ABC
FT                   transporter, inner membrane subunit; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component; TIGRFAM: molybdate ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91709"
FT                   /db_xref="GOA:D5V3J8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3J8"
FT                   /protein_id="ADG91709.1"
FT                   /translation="MYLELAQISKPFILSIKTIGVSAILFMTIGVPISFILSKKNLRFK
FT                   WILDTIVTMPLIFPPIAVGFFLLLILGRDGVLGALLNHFNITLIFSFSGIVIAAFIAGL
FT                   PLMVKPLQASIEQFPKNIKEAAYISGKSEINTFLFIVLPNIKNSLYISLLIATARALGE
FT                   VGITLMLGGNIIGKTDTVSLAIYNAVFDGEYDLAMALSGILVVISIVFFICLNILQKKE
FT                   KIY"
FT   gene            complement(40573..41280)
FT                   /locus_tag="Arnit_0040"
FT   CDS_pept        complement(40573..41280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0040"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="COGs: COG0725 ABC-type molybdate transport system
FT                   periplasmic component; InterPro IPR005950; KEGG:
FT                   tau:Tola_1211 molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein; SPTR: C4LE08 Molybdenum ABC
FT                   transporter, periplasmic molybdate-binding protein;
FT                   TIGRFAM: molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein; TIGRFAM: molybdenum ABC
FT                   transporter, periplasmic molybdate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91710"
FT                   /db_xref="GOA:D5V3J9"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3J9"
FT                   /protein_id="ADG91710.1"
FT                   /translation="MLKKILFCIIAVSVTLVASDLKVAAGAGYKKPLMEVIKEYEKSGK
FT                   KVDAFFGNMRQVTTQAKQTDMSLIIGDKRFLSKKSNLKFNDYIKLGEGKVVLAYAKDKK
FT                   INSINDLAKKDITRISMPQPKKAIYGIAGKEFLINSNLEDKVKDKLYIVATVPQSMTYI
FT                   ITGEVDVGIVNLTAALANKDKIGGYIEVPQKYYTNIKIVAGKLNACNTKECRDFVDFLQ
FT                   NNTSKKIFEKYGL"
FT   sig_peptide     complement(41227..41280)
FT                   /locus_tag="Arnit_0040"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(41331..42185)
FT                   /locus_tag="Arnit_0041"
FT   CDS_pept        complement(41331..42185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0041"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1118 ABC-type sulfate/molybdate transport
FT                   systems ATPase component; InterPro
FT                   IPR017871:IPR003593:IPR003439; KEGG: abu:Abu_0009
FT                   molybdenum ABC transporter, ATP-binding protein; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase; SPTR: B6BI30
FT                   Molybdenum transport ATP-binding protein; PFAM: ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91711"
FT                   /db_xref="GOA:D5V3K0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3K0"
FT                   /protein_id="ADG91711.1"
FT                   /translation="MIKIDIFKKLHGSNGQMNLDVNLEIKEGDFIALAGLSGSGKTTLL
FT                   RILAGLEEAKGEIKIGETYWQNNSTFLAPQKREIGFVFQDYALFPNMSVIDNLLFVKKD
FT                   KDLAIKLLKITEMEELENRLPNTLSGGQKQRVSLCRALMNKPKLLLMDEPLSALDPKMR
FT                   AKLQQEILTLHKEFNTTTIMVSHDPSEMYRLSNRVIVLNQGLVINDGKAKDILLRTSGS
FT                   QKFSFEGELLDIIKVDVIQVAIVSIGQQLVEVVVSNDEAKNLNIGQKVLVSTKAFAPLI
FT                   KNT"
FT   gene            complement(42189..42881)
FT                   /locus_tag="Arnit_0042"
FT   CDS_pept        complement(42189..42881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0042"
FT                   /product="molybdate ABC transporter, inner membrane
FT                   subunit"
FT                   /note="COGs: COG4149 ABC-type molybdate transport system
FT                   permease component; InterPro IPR000515:IPR011867; KEGG:
FT                   sun:SUN_2103 molybdenum ABC transporter, permease; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: A6QC35 Molybdenum ABC transporter,
FT                   permease; TIGRFAM: molybdate ABC transporter, inner
FT                   membrane subunit; PFAM: Binding-protein-dependent transport
FT                   system inner membrane component; TIGRFAM: molybdate ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91712"
FT                   /db_xref="GOA:D5V3K1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3K1"
FT                   /protein_id="ADG91712.1"
FT                   /translation="MFETLKAIEFGPFILSFKLAFITTSILFVISLPLSWYLSQTKSRM
FT                   KPFLEAITALPIVLPPSVLGFYILWVLSYNSPIGAFFENTLGIKLVFNFYGLVIASCFY
FT                   SLPFMVQPLQSGFESISKNMIEASYICGKGKIKTLLKVALPNIKPALLTAIIVTFAHTV
FT                   GEFGVVLMVGGSIPGETKVASVAIYEMVEIMDYKTAHIYSAIMVIISFLVLLSVYIFNG
FT                   RSNKKFGI"
FT   gene            complement(42874..43275)
FT                   /locus_tag="Arnit_0043"
FT   CDS_pept        complement(42874..43275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0043"
FT                   /product="TOBE domain protein"
FT                   /note="InterPro IPR008995:IPR005116; KEGG: abu:Abu_0011
FT                   hypothetical protein; PFAM: TOBE domain protein; SPTR:
FT                   A8EQU0 Putative uncharacterized protein; PFAM: TOBE domain;
FT                   TIGRFAM: molybdenum-pterin binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91713"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3K2"
FT                   /protein_id="ADG91713.1"
FT                   /translation="MNKIEAIISQIDNIDNLNIVQFDFLGIKLKMMSLDLNENIKIGQN
FT                   VILVAKATNIILARDFKGMISFSNQINGKIDNIENGKLLCSVTIKAEDSYFQSIITQAS
FT                   AKKMNLKKDDEINIFIKASDLSIEEIINV"
FT   gene            complement(43272..44018)
FT                   /locus_tag="Arnit_0044"
FT   CDS_pept        complement(43272..44018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0044"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="COGs: COG0725 ABC-type molybdate transport system
FT                   periplasmic component; InterPro IPR006059:IPR005950; KEGG:
FT                   abu:Abu_0012 molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein; PFAM: extracellular
FT                   solute-binding protein family 1; SPTR: A8EQU1 Molybdenum
FT                   ABC transporter, periplasmic molybdate-binding protein;
FT                   TIGRFAM: molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein; PFAM: Bacterial extracellular
FT                   solute-binding protein; TIGRFAM: molybdenum ABC
FT                   transporter, periplasmic molybdate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91714"
FT                   /db_xref="GOA:D5V3K3"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3K3"
FT                   /protein_id="ADG91714.1"
FT                   /translation="MKKIVIGILVISLSLFAGQINVAVAANVSYAIGDLIKEFNKTNPD
FT                   TKVEVTLGSSGKLTAQIKNGAPYNIFMAANMKYPKALYSDKIAITKPVIYAQGSLAILS
FT                   VKKLDMSKGINLAKDSSVSKIAIANPKTAPYGKAAVEAMKNAKIYNDVVKKYVYAESIS
FT                   QTVTYATTATDIGFIAKSSLYSPKMSMYKEGVNWIDVNPKLYTPINQGIVIINNAKDNK
FT                   EAKAFYDFILSADAKKIFNKFGYLVP"
FT   sig_peptide     complement(43944..44018)
FT                   /locus_tag="Arnit_0044"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(44028..44447)
FT                   /locus_tag="Arnit_0045"
FT   CDS_pept        complement(44028..44447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0045"
FT                   /product="TOBE domain protein"
FT                   /note="InterPro IPR008995:IPR005116:IPR004606; KEGG:
FT                   abu:Abu_0013 molybdenum-binding protein; PFAM: TOBE domain
FT                   protein; SPTR: A8EQU2 Molybdenum-binding protein; PFAM:
FT                   TOBE domain; TIGRFAM: molybdenum-pterin binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91715"
FT                   /db_xref="GOA:D5V3K4"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3K4"
FT                   /protein_id="ADG91715.1"
FT                   /translation="MKLSARNQLTGVIELVEQGQVNSEIYVKLNSGYTIVSVITNNAVK
FT                   NLDLKIDDIVTVIFKSSCVLITTDVSLNISARNKLQGSVENIYLGSVTAEVEIDIGNKE
FT                   RVIAVITASSIKNLHIKIGNSVSAIIKATDVMIGK"
FT   gene            complement(44533..46074)
FT                   /locus_tag="Arnit_0046"
FT   CDS_pept        complement(44533..46074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0046"
FT                   /product="nitrogenase molybdenum-iron protein beta chain"
FT                   /EC_number="1.18.6.1"
FT                   /note="COGs: COG2710 Nitrogenase molybdenum-iron protein
FT                   alpha and beta chains; InterPro
FT                   IPR000318:IPR000510:IPR005976; KEGG: wsu:WS1391 nitrogenase
FT                   beta subunit; PFAM: oxidoreductase/nitrogenase component 1;
FT                   PRIAM: Nitrogenase; SPTR: Q7M8U9 NITROGENASE BETA SUBUNIT;
FT                   TIGRFAM: nitrogenase molybdenum-iron protein beta chain;
FT                   PFAM: Domain of unknown function (DUF3364); Nitrogenase
FT                   component 1 type Oxidoreductase; TIGRFAM: nitrogenase
FT                   molybdenum-iron protein beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91716"
FT                   /db_xref="GOA:D5V3K5"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005976"
FT                   /db_xref="InterPro:IPR024564"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3K5"
FT                   /protein_id="ADG91716.1"
FT                   /translation="MQDLDNIVNGQKLFLKPEYQEVLKNKKEFEGSMGAINPAKVEEIQ
FT                   KWTESWDYREKNLAREAITVNPAKACQPLGAVMVALGFENTMPYVHGSHGCVAYFRTYF
FT                   TRHFKEPTPCVSDSMSESAAVFGGLANMKDGLRNCNALYKPEMIAVSTTCMAEVIGDDL
FT                   GAFIIGAKDEAEGELDNVLIPNAHTPSFVGSHITGYDNMMKSILEQVSTEKTTVDEERI
FT                   NIIPGFEPYLGSLKEIKKISKMFGDKIVMIGDHEEQWDTGAGEYKLYAGGTKIEDLKGS
FT                   INAKATISLQKYSSIATAKTIKNKWKQTYETCNPIGLSGTDAFVMKLAELTGKEIPEEL
FT                   KQQRARLVDAMQDSYPYMHGKKIAIWGDPDFLLGMVSFLVEMGAIPTHVVCHNAPRKNW
FT                   EAEMRAILDKSNRSDECNIWPGKDLWALRSLLFTEPVDFMIGNVYGKELYRDTKTPLIR
FT                   IGFPIFDRHHLHRYSMSGYEGGINLLTWITNGILDQLDEETKDIAETDYFFDSVR"
FT   gene            complement(46076..47542)
FT                   /locus_tag="Arnit_0047"
FT   CDS_pept        complement(46076..47542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0047"
FT                   /product="nitrogenase molybdenum-iron protein alpha chain"
FT                   /EC_number="1.18.6.1"
FT                   /note="COGs: COG2710 Nitrogenase molybdenum-iron protein
FT                   alpha and beta chains; InterPro
FT                   IPR000318:IPR000510:IPR005972:IPR010143; KEGG: wsu:WS1392
FT                   hypothetical protein; PFAM: oxidoreductase/nitrogenase
FT                   component 1; PRIAM: Nitrogenase; SPTR: Q7MRF8 Nitrogenase
FT                   protein alpha chain; TIGRFAM: nitrogenase molybdenum-iron
FT                   protein alpha chain; nitrogenase component I, alpha chain;
FT                   PFAM: Nitrogenase component 1 type Oxidoreductase; TIGRFAM:
FT                   nitrogenase component I, alpha chain; nitrogenase
FT                   molybdenum-iron protein alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91717"
FT                   /db_xref="GOA:D5V3K6"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005972"
FT                   /db_xref="InterPro:IPR010143"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3K6"
FT                   /protein_id="ADG91717.1"
FT                   /translation="MGPETLESLQKQAIAEVLEAYPEKAKKNRAKHLGTDNPEGVKGSC
FT                   DTTRSNKQTVPGVMSQRGCAYAGSKGVVWGPIKDMIHISHGPIGCGQYSRGGRRNYYIG
FT                   TTGIDTFVTMNFSTDFNEKDIVFGGDKKLKKALEEIDELFPLNNGISIQSECPIGLIGD
FT                   DIQAVAKVHKKETGHQTVAVSCEGFRGVSQSLGHHIANDMIRDHVMPDTSHRKDFESTP
FT                   YDVAIIGDYNIGGDAWSTRLILEEMGLRVIAQWSGDATYKELAIAPKAKLNLLHCYRSM
FT                   NYISRHMEQEFGIPWMEYNFFGPTKTTESLRKIASFFDEKIQEQTEKVIAKYTAMTDAV
FT                   IAKFRPMLEGKKVMLYVGGLRPRHVIGAYEDLGMEVIGTGYEFGHGDDYKRTKEDLGRS
FT                   TLIYDDANEYELEEFVKKLRPDLVAAGVKEKYVFQKMGLPFRQMHSWDYSGPYHGYDAF
FT                   AIFAKDMDLAMNSPVWNHTKAPWDKEVEGA"
FT   gene            complement(47571..47930)
FT                   /locus_tag="Arnit_0048"
FT   CDS_pept        complement(47571..47930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0048"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: wsu:WS1393 hypothetical protein; SPTR: Q7MRF7
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91718"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3K7"
FT                   /protein_id="ADG91718.1"
FT                   /translation="MFVCGYHFPADMGNDVSFDKVIEKVQDGVDATGKSVTVSSETREG
FT                   VKLEEISIPEGSFLHTALVDYYTNTECKEKDGYKMVYYTNKYQISEISKSVDGDATKAI
FT                   CKKLDDMNLYRVKVA"
FT   gene            complement(48063..48977)
FT                   /locus_tag="Arnit_0049"
FT   CDS_pept        complement(48063..48977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0049"
FT                   /product="nitrogenase iron protein"
FT                   /EC_number="1.18.6.1"
FT                   /note="COGs: COG1348 Nitrogenase subunit NifH (ATPase);
FT                   InterPro IPR000392:IPR005977; KEGG: wsu:WS1394
FT                   dinitrogenase reductase subunit; PFAM: NifH/frxC-family
FT                   protein; PRIAM: Nitrogenase; SPTR: Q7M8U8 Nitrogenase iron
FT                   protein; TIGRFAM: nitrogenase iron protein; PFAM: 4Fe-4S
FT                   iron sulfur cluster binding proteins, NifH/frxC family;
FT                   TIGRFAM: nitrogenase iron protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91719"
FT                   /db_xref="GOA:D5V3K8"
FT                   /db_xref="InterPro:IPR000392"
FT                   /db_xref="InterPro:IPR005977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030655"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3K8"
FT                   /protein_id="ADG91719.1"
FT                   /translation="MSDLRQIAFYGKGGIGKSTTSQNTLAAMCHYYGKKILIVGCDPKA
FT                   DSTRLILHEKAQCTIMQLASEAGTVEDLELEDVCKPGAGEFHPENNDITEGYINCTESG
FT                   GPEPGVGCAGRGVITAINFLEEEGAYTDELDFVSYDVLGDVVCGGFAMPIREGKAQEIY
FT                   IVMSGEMMAMYAANNISKGILKYANTGGVRLAGLICNARMTDKEYDLSKHLAMQIGTQM
FT                   IHFVPRSNHVQRAELRRMTVVEFAPSSDQAMEYKELARKIIANDLKVIPEPLEMDDLEA
FT                   LLMEFGLEEEVDEENLGKKAEEA"
FT   gene            complement(49258..49905)
FT                   /locus_tag="Arnit_0050"
FT   CDS_pept        complement(49258..49905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0050"
FT                   /product="TrkA-N domain protein"
FT                   /note="COGs: COG0569 K+ transport systems NAD-binding
FT                   component; InterPro IPR016040:IPR003148:IPR006037; KEGG:
FT                   abu:Abu_1288 trk system potassium uptake protein TrkA,
FT                   putative; PFAM: TrkA-N domain protein; TrkA-C domain
FT                   protein; SPTR: A8EUC1 TRK system potassium uptake protein
FT                   TrkA, putative; PFAM: TrkA-N domain; TrkA-C domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91720"
FT                   /db_xref="GOA:D5V3K9"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3K9"
FT                   /protein_id="ADG91720.1"
FT                   /translation="MKTIAVIGLGKFGSYIVKSLSRLDVKVIAVDNDEKRIQEISEYID
FT                   NAFVLDSTNKQALEDVGIYNLDTVIVSIGENIEASILTVMALKDLNNQNIIAKAITSTH
FT                   GEILSKIGAFKIIYPEKIAGRMLVNKLIDNMTMEEIDVSNNIKIIKLVANENFINRRIY
FT                   EIKEEYKKLKIVSYKSDGTWVLNIDSSYKVKENDVLVFIGEAKYSKEFCKQF"
FT   gene            complement(49902..51230)
FT                   /locus_tag="Arnit_0051"
FT   CDS_pept        complement(49902..51230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0051"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /EC_number="7.1.2.2"
FT                   /note="COGs: COG0168 Trk-type K+ transport systems membrane
FT                   components; InterPro IPR003445:IPR004772; KEGG:
FT                   abu:Abu_1289 trk system potassium uptake protein TrkB,
FT                   putative; PFAM: cation transporter; PRIAM:
FT                   H(+)-transporting two-sector ATPase; SPTR: A8EUC2 TRK
FT                   system potassium uptake protein TrkB, putative; TIGRFAM:
FT                   potassium uptake protein, TrkH family; PFAM: Cation
FT                   transport protein; TIGRFAM: potassium uptake protein, TrkH
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91721"
FT                   /db_xref="GOA:D5V3L0"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3L0"
FT                   /protein_id="ADG91721.1"
FT                   /translation="MEHKYVRSIFVGYVLVIFFGALVLALPICHKGHLAFIDAIFTATS
FT                   ATCVTGLIVTSTSENFTLLGEVIILLLIQIGGIGYMSLVIIFFLSFRQRLDIDEKRAMR
FT                   QSLDLPSLHVRKFLRKIFAVVLVIEILGAIILTTQFLKKYDLLHSLWYGIFHSVSAFNN
FT                   AGFSLFTNSLEGYQSDTISLVTICILVVLGGMGYFVLIEIYENRRFAKRFTIHTRIMIY
FT                   GTVILIVAGMILFLSIEWNNPKTFGGLSVYDKLLNAFFLSINFRTSGFNSIDLGGLKES
FT                   SLFFSTLFMMTGAGQGSTGGGMKITTVAILIITVIYILKESNQQPSIFKRTIEQKIINK
FT                   ALAIILSSSFFVLLATLILVETQDLPFLRILFEVVSAFGTVGVSTGNGGGVLSFSQEFD
FT                   ILGKSIIIVMMLAGRLGVFAFGLILVGKAKTKHFKYPTGRIII"
FT   gene            complement(51243..51932)
FT                   /locus_tag="Arnit_0052"
FT   CDS_pept        complement(51243..51932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0052"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="COGs: COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain; InterPro IPR011006:IPR016032:IPR001789:IPR001867;
FT                   KEGG: abu:Abu_1290 two component system transcriptional
FT                   regulatory protein; PFAM: response regulator receiver;
FT                   transcriptional regulator domain protein; SMART: response
FT                   regulator receiver; SPTR: A8EUC3 Two component system
FT                   transcriptional regulatory protein; PFAM: Response
FT                   regulator receiver domain; Transcriptional regulatory
FT                   protein, C terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91722"
FT                   /db_xref="GOA:D5V3L1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3L1"
FT                   /protein_id="ADG91722.1"
FT                   /translation="MKELIHIIEDDSSVKRLLEITFKEYAFNFISSESKKNAIMMFLSH
FT                   NPSLLIVDLGLPDGDGKDLIKQIREISKVPILVLTARHDEKEIVAALDVGADDYITKPF
FT                   SVNELLARIRANLRRNIAKEEIDNNFICNDLELDISSRTIKFKKEVLKLTPIEYELLKY
FT                   FMINANKTLTHKQILNEVWGVGYQTEMQYLRTYVNTLRKKIEENSTRPKYIKTESGIGY
FT                   RFSYTQD"
FT   gene            complement(51929..52960)
FT                   /locus_tag="Arnit_0053"
FT   CDS_pept        complement(51929..52960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0053"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="COGs: COG2205 Osmosensitive K+ channel histidine
FT                   kinase; InterProIPR004358:IPR003594:IPR009082:IPR003661:IPR
FT                   005467; KEGG: abu:Abu_1291 two-component regulatory protein
FT                   sensor kinase KdpD; PFAM: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; SPTR: A8EUC4 Sensor protein; PFAM:
FT                   Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase;
FT                   His Kinase A (phosphoacceptor) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91723"
FT                   /db_xref="GOA:D5V3L2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3L2"
FT                   /protein_id="ADG91723.1"
FT                   /translation="MKNLLFPYRQYNYILKALVILLIITIISHMFRNSLDIINITLIHI
FT                   IPVIVVAIHGKGKTTFFMTILCVVLLNFLYIPPIYSFSVHNELYIWSFLIFGIVGWIIT
FT                   YQAKSLNTQMKQNELRESLLHIISHDLRTPLSTIHGSINLILSNNELNETNKNSLLEDI
FT                   NYASIRMERLITNILDSTRLSSGNINLKLQWCDFEDIVGVALDEFSQKQSDEKVIVNIE
FT                   ETGLFWGDNTLLTQLVVNLLDNAFKYSTTNAKIDFEVLDYNNYIKIQVFNETEFIDEEK
FT                   LKNIFDKFYRVEDTNDISGSGIGLAICKSIVKLHNGEIKAISQNNGILIEINLPVLKRA
FT                   KLI"
FT   gene            complement(53203..54654)
FT                   /locus_tag="Arnit_0054"
FT   CDS_pept        complement(53203..54654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0054"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Pas/Pac sensor"
FT                   /note="COGs: COG0840 Methyl-accepting chemotaxis protein;
FT                   InterProIPR004090:IPR001610:IPR004089:IPR000014:IPR
FT                   000700:IPR013655; KEGG: abu:Abu_0788 methyl-accepting
FT                   chemotaxis protein; PFAM: chemotaxis sensory transducer;
FT                   PAS fold-3 domain protein; SMART: chemotaxis sensory
FT                   transducer; PAC repeat-containing protein; SPTR: A8ESX9
FT                   Methyl-accepting chemotaxis protein; TIGRFAM: PAS sensor
FT                   protein; PFAM: Methyl-accepting chemotaxis protein (MCP)
FT                   signaling domain; PAS fold; TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91724"
FT                   /db_xref="GOA:D5V3L3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3L3"
FT                   /protein_id="ADG91724.1"
FT                   /translation="MFNFGKTEEETARLTAMEENYAIISFKPDGTIIHANHNFLNVLGY
FT                   KLEETVGKHHRMFCDKKYVTTKEYSEFWESLNKGISQINEFERIRKDGTSVWIQASYTP
FT                   VKNSSGKVTRVVKFAQDITDAKNVIKAANKAIDIAKTGIMKQTIKETTQNEGIENLKNG
FT                   INDLFEIVSTKVDGDLNKISAALLSFQKLNFTHRIEGNNLGEVAEGLNSLANVVNDMLV
FT                   ENKANGLTLDKGSDLLLANVDKLNQSSNEAAASLEETAAALEEITANIRNNTQNIAKMA
FT                   SNSTNVTSSVSNGEKLANQTTVAMDEINEQVKSINEAISVIDQIAFQTNILSLNAAVEA
FT                   ATAGEAGKGFAVVAQEVRNLASRSAEAAKEIKSLVENATSKANEGKNIAGNMIKGYKEL
FT                   NQNIQETINLISDIEMSSKEQQTGIEQINSAVNQLDQQTQQNAMVASQTHDIATTTDTI
FT                   AKLIVSEANEKEFIGKNDVKAKEMN"
FT   gene            complement(54794..56041)
FT                   /locus_tag="Arnit_0055"
FT   CDS_pept        complement(54794..56041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0055"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN"
FT                   /note="COGs: COG1508 DNA-directed RNA polymerase
FT                   specialized sigma subunit sigma54 homolog; InterPro
FT                   IPR000394:IPR007046:IPR007634; KEGG: wsu:WS2100 RNA
FT                   polymerase factor sigma-54; PFAM: sigma-54 DNA-binding
FT                   domain protein; sigma-54 factor; sigma-54 factor
FT                   core-binding region; SPTR: Q7M7T2 RNA POLYMERASE SIGMA-54
FT                   FACTOR; TIGRFAM: RNA polymerase sigma-54 factor, RpoN;
FT                   PFAM: Sigma-54 factor, Activator interacting domain (AID);
FT                   Sigma-54, DNA binding domain; Sigma-54 factor, core binding
FT                   domain; TIGRFAM: RNA polymerase sigma-54 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91725"
FT                   /db_xref="GOA:D5V3L4"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3L4"
FT                   /protein_id="ADG91725.1"
FT                   /translation="MAQTLSTSASQKQNLNLSLKLWLPMLQSSLQDLEKHLKNVSYENP
FT                   FLEIKKPKEFYANFMPQGTSGEFIESLAIYNESLNDVISEQICAPNFSTPNSQKVAMEI
FT                   LCDINEEGYFEGDIEKIAITCNVYKEYVESIRQRFSLLEPSGIGSLNLSESFLFQLDAC
FT                   DKKIDDELYNFIKKIIKDISHLDKYAGHHRFDDAKEIIKYFNNPPAINYMNDNVQIIPD
FT                   FFVDIGEDINIKINHAYYPDLEVKDAFNSKNEGIKEKLKEARDLVNLLGLRKSTLYKIV
FT                   LLIVEKQISFFVGGELRPYSMQELANEIGFAESTISRAVANKYIECSLGTFPLKHFFSN
FT                   AVNNKDLSSSEIKNYIKSLVEYEDKETPLTDQDILDAIQEKFNLEMVRRTITKYRKMLD
FT                   MPSSKERKKLYKVENL"
FT   gene            complement(56095..56391)
FT                   /locus_tag="Arnit_0056"
FT   CDS_pept        complement(56095..56391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0056"
FT                   /product="ferredoxin"
FT                   /note="InterPro IPR001041:IPR006058:IPR012675; KEGG:
FT                   wsu:WS1382 hypothetical protein; PFAM: ferredoxin; SPTR:
FT                   Q7MRG5 Putative uncharacterized protein; PFAM: 2Fe-2S
FT                   iron-sulfur cluster binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91726"
FT                   /db_xref="GOA:D5V3L5"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3L5"
FT                   /protein_id="ADG91726.1"
FT                   /translation="MTTRVEIINDFLAINVKPGSTIQDVVEASGSALPFGCRDGECGTC
FT                   VVEIEQGMEFISEINEKEIKVIKENCVGTATEKTRLSCQMKIVKPNGVVRIKY"
FT   gene            complement(56589..56930)
FT                   /locus_tag="Arnit_0057"
FT   CDS_pept        complement(56589..56930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0057"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpt:Rpal_2139 ferredoxin; SPTR: C5ESK5
FT                   D-serine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91727"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3L6"
FT                   /protein_id="ADG91727.1"
FT                   /translation="MAKVIFMHFDTVTDGIYNAKIGEPISRLAKEKGVPLISDSKDYAK
FT                   SLIYVENLADEEPTSYMEDEELDVLVKLGAISSEEALQCQQFTISPKIRIAPMMLIKGD
FT                   ILVKPYILK"
FT   gene            complement(57023..57433)
FT                   /locus_tag="Arnit_0058"
FT   CDS_pept        complement(57023..57433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0058"
FT                   /product="NifZ family protein"
FT                   /note="InterPro IPR007415; KEGG: wsu:WS1383 putative
FT                   nitrogen fixation protein; PFAM: NifZ family protein; SPTR:
FT                   Q7M8V0 PUTATIVE NITROGEN FIXATION PROTEIN; PFAM: NifZ
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91728"
FT                   /db_xref="GOA:D5V3L7"
FT                   /db_xref="InterPro:IPR007415"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3L7"
FT                   /protein_id="ADG91728.1"
FT                   /translation="MGAKDGFTHKDIVDANTPLHDSVTAGRSGKDEDKPKFGIGQKVKL
FT                   LKEIVNDGTYPHAPIGTQLMPAGAIGYIKSMGEFLQVIRVYEVHFLGLLDVPVEIVGCR
FT                   EHELEAMEDYRDEVEEELEFMRKHREKYYSKD"
FT   gene            complement(57423..57758)
FT                   /locus_tag="Arnit_0059"
FT   CDS_pept        complement(57423..57758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0059"
FT                   /product="nitrogen fixation protein NifW"
FT                   /note="InterPro IPR004893; KEGG: wsu:WS1384 hypothetical
FT                   protein; PFAM: nitrogen fixation protein NifW; SPTR: Q7MRG4
FT                   Putative uncharacterized protein hydA; PFAM: Nitrogen
FT                   fixation protein NifW"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91729"
FT                   /db_xref="GOA:D5V3L8"
FT                   /db_xref="InterPro:IPR004893"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3L8"
FT                   /protein_id="ADG91729.1"
FT                   /translation="MKTVEEFYKLRDTEDFFKFFDIDFDQKLINVKRFHMMKEYGTLIK
FT                   KGLAEISDESKLLEFLKFSLLRVYGDYKNGHAPSAADVWNMYETGKLEGCSSCSPSPTG
FT                   TGGSCGC"
FT   gene            complement(57784..58299)
FT                   /locus_tag="Arnit_0060"
FT   CDS_pept        complement(57784..58299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0060"
FT                   /product="flavodoxin/nitric oxide synthase"
FT                   /note="COGs: COG0716 Flavodoxins; InterPro IPR008254; KEGG:
FT                   avn:Avin_45950 flavodoxin I; PFAM: flavodoxin/nitric oxide
FT                   synthase; SPTR: B4WRT9 Flavodoxin; PFAM: Flavodoxin;
FT                   TIGRFAM: flavodoxin, long chain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91730"
FT                   /db_xref="GOA:D5V3L9"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010086"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3L9"
FT                   /protein_id="ADG91730.1"
FT                   /translation="MANIGIFCGTAGGTSMIVAQALAEAFEVEEVINMEEDFDDIDQML
FT                   EHDVLFIGSSTWGQGDVYFEWVDPLLEIESDGIDFSGKTIALFGAGDSVKHGEHFCSAL
FT                   GKLYKTFTAAGAKVVGFVDASDYKYESSLAEMDGKLCGLAIDEHNEKDKTEIRVSKWID
FT                   SLKEEIPA"
FT   sig_peptide     complement(58231..58299)
FT                   /locus_tag="Arnit_0060"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(58319..58750)
FT                   /locus_tag="Arnit_0061"
FT   CDS_pept        complement(58319..58750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0061"
FT                   /product="nitrogen fixation protein"
FT                   /note="InterPro IPR004952; KEGG: msl:Msil_3626 nitrogen
FT                   fixation protein; PFAM: protein of unknown function DUF269;
FT                   SPTR: B8EJ19 Nitrogen fixation protein; TIGRFAM: nitrogen
FT                   fixation protein; PFAM: Protein of unknown function,
FT                   DUF269; TIGRFAM: probable nitrogen fixation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91731"
FT                   /db_xref="InterPro:IPR004952"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3M0"
FT                   /protein_id="ADG91731.1"
FT                   /translation="MDKKELFKITLIGQVRALDQFGTWVNKSDEDLLVEKYVRTKEDLK
FT                   NIPIIADIDEMQIKDIRLVFQAVALAFEKMTGVMCSVVMEMSHEGFGRVVVFAGKIVLC
FT                   EKFFKDAHRFSFRTYDDLLIEGEKYLLKAEETYNKYKNV"
FT   gene            complement(58750..59145)
FT                   /locus_tag="Arnit_0062"
FT   CDS_pept        complement(58750..59145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0062"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /note="InterPro IPR003731; KEGG: wsu:WS1387 hypothetical
FT                   protein; PFAM: Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein; SPTR: Q7MRG1 NIFX; PFAM:
FT                   Dinitrogenase iron-molybdenum cofactor; TIGRFAM: nitrogen
FT                   fixation protein NifX"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91732"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3M1"
FT                   /protein_id="ADG91732.1"
FT                   /translation="MSSIKITTNDSQEGSLKVAFATTDLENIDAHFGAAKQFAVYEISK
FT                   TGTSLCEIKKVLEKDTDKAVALLEGIDIVYFTNVGAIAAAKLINSGIFTIKYKEIVSIE
FT                   EEVKKLKEMLNSNPPPFIKKIIEKKAS"
FT   gene            complement(59203..59505)
FT                   /locus_tag="Arnit_0063"
FT   CDS_pept        complement(59203..59505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0063"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xau:Xaut_2910 hypothetical protein; SPTR:
FT                   A7IJF4 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91733"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3M2"
FT                   /protein_id="ADG91733.1"
FT                   /translation="MSKETYVELYKKYDLYRSDIYMLCEERPAEILFLFEEVCDELIKP
FT                   LGINTQLPKEFIQSAKSFSAQNTFTNIYFAELSNRAFFLSDLIDFLALIKSKKTT"
FT   gene            complement(59502..60749)
FT                   /locus_tag="Arnit_0064"
FT   CDS_pept        complement(59502..60749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0064"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR000415; KEGG: cyc:PCC7424_2100
FT                   hypothetical protein; SPTR: B7KG56 Putative uncharacterized
FT                   protein; PFAM: Nitroreductase family; TIGRFAM: SagB-type
FT                   dehydrogenase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91734"
FT                   /db_xref="GOA:D5V3M3"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR020051"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3M3"
FT                   /protein_id="ADG91734.1"
FT                   /translation="MQEFHNQTDITKKNAFTQTQFINWQTQAKAYKTYPKFYRRYNLDD
FT                   YEELRFIKNFGKVTYSKKYGNDEVKLRVNPSAGGLYPCEIYIQIRGIKKFLNGIYHYEP
FT                   LEDSLTLIHELSNDGLESYMNIKQQKFIFLLSNVYFRTSWKYEKRAIRYLLLDTGHQLG
FT                   SIYASLVLEDMEHLFNFKFKKKQLNKAFSFDKYEHFVASIYSSEYKDIETNKLRDNIPF
FT                   VPPCDYYIKEPFIEEFYSHSYHKSFDNLKINFLKELSKENLQSAINNRRSVRAFKQEAI
FT                   TKEEFETVLKDVFIIARKYNIEIFFINNLIIGLKKGIYKEFQLQEEGNFNDISTTLAFN
FT                   QKIGGTSSATIFFTSKIRTNYSLALILSGFLAHIISLRATNLQISSTGIGAYFDDITQD
FT                   TLITSNNILYLMAVGK"
FT   gene            complement(60733..61185)
FT                   /locus_tag="Arnit_0065"
FT   CDS_pept        complement(60733..61185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0065"
FT                   /product="Ankyrin"
FT                   /note="InterPro IPR020683:IPR002110; KEGG: ava:Ava_3944
FT                   ankyrin; PFAM: Ankyrin; SMART: Ankyrin; SPTR: A0YVD4
FT                   Putative uncharacterized protein; PFAM: Ankyrin repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91735"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3M4"
FT                   /protein_id="ADG91735.1"
FT                   /translation="MKNLSSELKLWLKENNYNENDLNQAGKYGNSAVMKAAREGKNKLV
FT                   SELLELDVDLNMKNVDGNSALWNACFASSYECFELLVNAGIEIDSKNVNDVTALMYCAS
FT                   AGKEDFVQLLLEKGANSSFENLDGFKAIDLAVTPKIVKMLRNARVS"
FT   gene            complement(61182..61703)
FT                   /locus_tag="Arnit_0066"
FT   CDS_pept        complement(61182..61703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0066"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR012336:IPR012335; KEGG:
FT                   hya:HY04AAS1_0035 redoxin domain protein; SPTR: B4U657
FT                   Redoxin domain protein; PFAM: AhpC/TSA family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91736"
FT                   /db_xref="GOA:D5V3M5"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3M5"
FT                   /protein_id="ADG91736.1"
FT                   /translation="MEVKYKKEFYILKQKERKIDSEAPAVRVEMLDGESKVIGMMAPKI
FT                   QVMLSSPNIKDYNNGLHDILKKFESKILVYMITNSTISDIKKVASVFGLEESTLSNDFN
FT                   KFSLKFGINLNESLIAKSVFIIDKEGVIKYKEIPSNAEHKLDLDEFETALEEVINFKVK
FT                   GHTHENWMGV"
FT   gene            complement(61704..62081)
FT                   /locus_tag="Arnit_0067"
FT   CDS_pept        complement(61704..62081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0067"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_00717 hypothetical protein; SPTR:
FT                   C1QB54 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91737"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3M6"
FT                   /protein_id="ADG91737.1"
FT                   /translation="MGINLQRPIVKALGLEMINGSTRLLGIPKDKIQVVISLPDIKNFN
FT                   EQLDDAISFFKNRAETFVITMSSIDECEEIIKEFELKDSLISREYKEFSKTFSIKDEKN
FT                   QLKKSLMIIDTNCQITHKEIL"
FT   gene            complement(62071..63366)
FT                   /locus_tag="Arnit_0068"
FT   CDS_pept        complement(62071..63366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0068"
FT                   /product="nitrogenase molybdenum-iron cofactor biosynthesis
FT                   protein NifN"
FT                   /EC_number="1.18.6.1"
FT                   /note="COGs: COG2710 Nitrogenase molybdenum-iron protein
FT                   alpha and beta chains; InterPro
FT                   IPR000318:IPR000510:IPR005975; KEGG: pca:Pcar_0314
FT                   nitrogenase molybdenum-iron cofactor biosynthesis protein
FT                   NifN; PFAM: oxidoreductase/nitrogenase component 1; PRIAM:
FT                   Nitrogenase; SPTR: Q3A7S0 Nitrogenase molybdenum-iron
FT                   cofactor biosynthesis protein NifN; TIGRFAM: nitrogenase
FT                   molybdenum-iron cofactor biosynthesis protein NifN; PFAM:
FT                   Nitrogenase component 1 type Oxidoreductase; TIGRFAM:
FT                   nitrogenase molybdenum-iron cofactor biosynthesis protein
FT                   NifN"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91738"
FT                   /db_xref="GOA:D5V3M7"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005975"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3M7"
FT                   /protein_id="ADG91738.1"
FT                   /translation="MESISAKPLQLNPIKLSQPMGAMLCFLGIKNCMPLMHGAQGCASF
FT                   TKVFFTRHFNDPIAVQTTAVNDITAVIDGGDYAISESIKNITKKVQPDLVGLFTTGLTE
FT                   TKGDDIKGACLLVQDQQKMVYVNTPDFEGSIESGFAKSIEAIIDQLVASASEVDVNKAV
FT                   IIPNVNLKPIEIEKIKDTIALFGYEVLSLPDLSDSLDGHLGLKQGALSSGGITVEDIEK
FT                   LGTCSLAISIGSSVKKAGDKLKAKNENMKLLHFDSLGGLEDSDKFFKALCQIKNISTPH
FT                   PSIVRWRKRLQDAMLDSHFAIGSASVVLALEPDQCISVANTIIEAGANIKAIITTHKND
FT                   LLDNIECENILIGDFEDVEKYLKDSDVLISNFHGERYTMRHKKALMLRGFPDFEGVGNQ
FT                   LKNDVLYEGSTYLLFELANLINHHNQGAFHGH"
FT   gene            63525..63947
FT                   /locus_tag="Arnit_0069"
FT   CDS_pept        63525..63947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0069"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: abu:Abu_1394 hypothetical protein; SPTR:
FT                   A8EUM5 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91739"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3M8"
FT                   /protein_id="ADG91739.1"
FT                   /translation="MSGINDVVDSFNVGFFQTTNTNKNPIDLNIPENTQFGDFSEKLKV
FT                   ISSEATYRPPETVYLDGFDGSDPKNPIPIKIPLTGYFQHPFLDKDGNWDEEAEYKSYAE
FT                   KELEYKKGVVSNWMEERGYDLQKNAELMKALLEKEG"
FT   gene            63996..64241
FT                   /locus_tag="Arnit_0070"
FT   CDS_pept        63996..64241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0070"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpe:MYPE7800 hypothetical protein; SPTR:
FT                   Q8EUY8 Putative uncharacterized protein MYPE7800"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91740"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3M9"
FT                   /protein_id="ADG91740.1"
FT                   /translation="MATIGEITGGFSSGIFKTDTNGEFNIPKDSEFDDLMKGEFTDVGS
FT                   SNIEPVPYEQAPLEYDNNTELTNNATLMKAVLGNQG"
FT   gene            complement(64248..65270)
FT                   /locus_tag="Arnit_0071"
FT   CDS_pept        complement(64248..65270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0071"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="COGs: COG0628 permease; InterPro IPR002549; KEGG:
FT                   abu:Abu_1751 hypothetical protein; PFAM: protein of unknown
FT                   function UPF0118; SPTR: A8EVM4 Conserved hypothetical
FT                   transmembrane protein; PFAM: Domain of unknown function
FT                   DUF20"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91741"
FT                   /db_xref="GOA:D5V3N0"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3N0"
FT                   /protein_id="ADG91741.1"
FT                   /translation="MDEEKIRNYFFYLACIVVIIAGVKIASEIVIVLFLAIFISSIIST
FT                   LIKILDKRHIPKLISYLLVLGFFTLISLLLAYIVNISLKDFITNLPTYEEKLQQTIVNI
FT                   ISLAENYGYSIDKKTILDALNLNSFFGITTNLIGSIGTFLSKFLLIIIGIGFILAESKS
FT                   FEKKLKILFRKESDKIEHFNLFSNNIQKYFLVKTATSFLTGFLVAITLIFFDISYPILW
FT                   GVIAMLFNFIPVVGSIIAAVPAILLSFLTSDLNTTLILIVLYLAINIFISNIIEPKFMG
FT                   KELGLSPLVIFFSLILWGWVLGIVGMFLAVPITMTLKIAFDSNKTTKWISLLMSSVKEG
FT                   "
FT   gene            complement(65320..66825)
FT                   /locus_tag="Arnit_0072"
FT   CDS_pept        complement(65320..66825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0072"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: conserved hypothetical protein; SPTR: Q8IEN8
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91742"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3N1"
FT                   /protein_id="ADG91742.1"
FT                   /translation="MINMTNINNFNAFANISNTLNTNPKSSTLEIEKDEVNVQITAFTK
FT                   KVEGDYSTYSAAELSELSYNEIKKNYEEIKKELESRMKESQDILNSESFKNYQKRLLVS
FT                   NPSEIRGGSKDHEVYLNEVTSNFANEDKITNNMLDKQYGEVTRVNKETQNLLNFNDKFK
FT                   IVNYFDNDEINRAIYSNYEDNAQVFYDYSDPADLDGSDGFFAGSSYSIQGTDLKQIVQS
FT                   IEDATEFMDAHGFIQSNKQFDSQYGYNHGFMISGKEITISNKTFSLYEVKKSVNNDYSK
FT                   NENNQIKENTEVDSKTEEIENEDIKPDYNTYSAAQLRQITFDEAKKNYEDLKRILDDSL
FT                   KNISTLNKKDTDNILAFKAQLEKVAYLKDDTLNETIYNKLQNIEDPKVAVWSNLVINEN
FT                   IENLQNGNLDSIIIDGLLVYPSDIQKNEDNKDNDENQKEDKNPPNTQQVDAKALNLDSI
FT                   IDIVEKSAKNAGQTPPKTYNKNIIEAYSNFISQYNEIKNNLFS"
FT   gene            complement(66910..68250)
FT                   /locus_tag="Arnit_0073"
FT   CDS_pept        complement(66910..68250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0073"
FT                   /product="oxidoreductase/nitrogenase component 1"
FT                   /note="COGs: COG2710 Nitrogenase molybdenum-iron protein
FT                   alpha and beta chains; InterPro IPR020558:IPR000510; KEGG:
FT                   pca:Pcar_0313 nitrogenase MoFe cofactor biosynthesis
FT                   protein NifE; PFAM: oxidoreductase/nitrogenase component 1;
FT                   SPTR: Q3A7S1 Nitrogenase MoFe cofactor biosynthesis protein
FT                   NifE; PFAM: Nitrogenase component 1 type Oxidoreductase;
FT                   TIGRFAM: nitrogenase molybdenum-iron cofactor biosynthesis
FT                   protein NifE"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91743"
FT                   /db_xref="GOA:D5V3N2"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR042459"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3N2"
FT                   /protein_id="ADG91743.1"
FT                   /translation="MVNKKLIQELLSESACSHNKEKKSSCDKPKPGATSGGCAFEGAQI
FT                   ALFPFADVVHLVHSPATCIGASWETRQTLTSHHGENNTITGYTTDVNTNDVIFGGDKKL
FT                   EDAINYIVANKNPKGIFVYETCVTAMIGDDMDNTCNRMEEKHGIPIVVIHSPGFVGGKN
FT                   LGSRLGGESVLHQLIGTKEPEEIHPFGINLIGEYNVTGDMWQYTPILEKIGIKVVSTLA
FT                   GDGRIENIQMAHRAKLNVIVCAKSLISLTRKMQERYNIPYISISFYGKRDTTNAIMSIV
FT                   NAFGDEKLIKRAKEVIEEEETKLEKALTPYRKILEGKKAILNTGGNKTWSIASALQDIG
FT                   IDVVATSVKKATLEDKEICATYVKILMNDPGTEQAKLIDEHNIDILLAGGRSLYTAIKK
FT                   KVAFVDVNQEKKVSYGAYSGLINLAKDVSNAVNNKVFKVVGSPEPWN"
FT   gene            68404..68790
FT                   /locus_tag="Arnit_0074"
FT   CDS_pept        68404..68790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0074"
FT                   /product="dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /note="InterPro IPR003731; KEGG: sul:SYO3AOP1_1078
FT                   dinitrogenase iron-molybdenum cofactor biosynthesis
FT                   protein; SPTR: C2A0P3 Uncharacterized conserved protein;
FT                   PFAM: Dinitrogenase iron-molybdenum cofactor"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91744"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3N3"
FT                   /protein_id="ADG91744.1"
FT                   /translation="MIAIPLSKEDSTVISDLYGNAPYFALLDLSSGYFNVKENIGCGNG
FT                   LETAKCVEELGAKSTIFYHMGEGVFNHLNENKVKVYSAAKTYLTIEDIYRNILNKSCKV
FT                   VTKENCESLLDSGTTSCSCECDKN"
FT   gene            68802..69773
FT                   /locus_tag="Arnit_0075"
FT   CDS_pept        68802..69773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0075"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="COGs: COG0790 FOG: TPR repeat SEL1 subfamily;
FT                   InterPro IPR011990:IPR006597:IPR001075; KEGG: aas:Aasi_0854
FT                   hypothetical protein; PFAM: Sel1 domain protein
FT                   repeat-containing protein; nitrogen-fixing NifU domain
FT                   protein; SMART: Sel1 domain protein repeat-containing
FT                   protein; SPTR: B3ESM2 Putative uncharacterized protein;
FT                   PFAM: Sel1 repeat; NifU-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91745"
FT                   /db_xref="GOA:D5V3N4"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3N4"
FT                   /protein_id="ADG91745.1"
FT                   /translation="MEKDLEYYLSLDYPFETYSGENEVGDAFLVEFFDFDIKASSEDFD
FT                   EAVELAHTYLEEHLKRELKAKREIPKPNEGRRFMEHRTALAAYKNKDFEKAYSIWEEEA
FT                   KLKNDQAMANLGLMYLKGEGVEKDYSIAKDWFEKASSYDNDSANFNLALMYQTKIGVEE
FT                   DIEKAKEYFRKAVRKNHTQAAFRLALVLLQDRQNLDGVREGFDCMLKAAKNGHAMASIQ
FT                   LTGIDKDLATNVELNEHFRAQSMEKQLEIINDTLDRFIRPILLKDGGNILLIDYVNEPE
FT                   IELRLAYQGACVGCSIASTGTYEMIKGTLEKVIDPRVRLYIL"
FT   gene            69770..70126
FT                   /locus_tag="Arnit_0076"
FT   CDS_pept        69770..70126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0076"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /note="InterPro IPR003731; KEGG: cyc:PCC7424_2114 nitrogen
FT                   fixation protein NifX; PFAM: Dinitrogenase iron-molybdenum
FT                   cofactor biosynthesis protein; SPTR: B7KG70 Nitrogen
FT                   fixation protein NifX; PFAM: Dinitrogenase iron-molybdenum
FT                   cofactor; TIGRFAM: nitrogen fixation protein NifX"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91746"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR034169"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3N5"
FT                   /protein_id="ADG91746.1"
FT                   /translation="MRIAFASKDNIHVNQHFGWAKEFYIYEIKDDNYTFVKSVDSSIEI
FT                   EDEIEKLNYKIECCEGCDILYVQQIGPKASLMVKASKIFPMQASAENEKIEEILQKLIK
FT                   MKENPPLWMRRLIG"
FT   gene            70131..71369
FT                   /locus_tag="Arnit_0077"
FT   CDS_pept        70131..71369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0077"
FT                   /product="flavodoxin/nitric oxide synthase"
FT                   /note="COGs: COG0426 flavoprotein; InterPro
FT                   IPR016440:IPR008254; KEGG: dar:Daro_1451
FT                   beta-lactamase-like:flavodoxin/nitric oxide synthase; PFAM:
FT                   flavodoxin/nitric oxide synthase; SPTR: Q47G31
FT                   Beta-lactamase-like:Flavodoxin/nitric oxide synthase; PFAM:
FT                   Metallo-beta-lactamase superfamily; Flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91747"
FT                   /db_xref="GOA:D5V3N6"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR016440"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3N6"
FT                   /protein_id="ADG91747.1"
FT                   /translation="MYSNKPIEIAPNIYFIGSFDPDIRTFDIIMKTANGSSYNAYLIKT
FT                   DEGVIILDTVKLEFQDEFFKKIEALCSYEEIKYVISHHLEPDHAGAIPELINRAPRAKV
FT                   LISPQATPMLKAITRNENIDFETVWTNKSLTLGNKTIKFLTTPYLHWPETMSSYVVEDK
FT                   LLFSGDVFGSHYHDRRLFDDLVGDFFYAFKYYYDHIMRPFKSYALNAIKLYDKLEIDMI
FT                   ATLHGPILRNNPKQYIDYYRKWSQDNYKDSAHGKKILSIFYLTSYKNTKDMAEAIFEGA
FT                   ESVDGIITNVYDLASIEESNMINILEESDGVLIGTPTINADAPKPVWDLLSCMMLLEKK
FT                   GKTGGAFGSYGWSGEAIDMILHRLKSLNFRVPPMDSLKIKLIPTTEELAQCYDYGVEFA
FT                   EIINGKMLEMTMN"
FT   gene            complement(71433..71618)
FT                   /locus_tag="Arnit_0078"
FT   CDS_pept        complement(71433..71618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0078"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hwa:HQ2074A hypothetical protein; SPTR: Q18IH1
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91748"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3N7"
FT                   /protein_id="ADG91748.1"
FT                   /translation="MSIQDSIKEQLLQEVFSNIDNIYYFMETRFDMDKHCDEDIIKKLN
FT                   ELKDVVYKVSTLSDLS"
FT   gene            complement(71615..71974)
FT                   /locus_tag="Arnit_0079"
FT   CDS_pept        complement(71615..71974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0079"
FT                   /product="arsenate reductase and related protein"
FT                   /note="InterPro IPR012336:IPR012335:IPR006660; KEGG:
FT                   cyh:Cyan8802_1800 nitrogenase-associated protein; PFAM:
FT                   arsenate reductase and related; SPTR: B7JWW9
FT                   Nitrogenase-associated protein; PFAM: ArsC family; TIGRFAM:
FT                   nitrogenase-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91749"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3N8"
FT                   /protein_id="ADG91749.1"
FT                   /translation="MIPVIFYEKVGCVNNTKQKKRLKDFGFNVISTDLLKTNFSKNQLL
FT                   NFFENKSIKECINPNAPLVKNKEIDLDNTSDEELLNLMISNPILIKRPLITIGTNKFCG
FT                   FDLNKILDFKLRELR"
FT   gene            72076..73524
FT                   /locus_tag="Arnit_0080"
FT   CDS_pept        72076..73524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0080"
FT                   /product="nitrogenase cofactor biosynthesis protein NifB"
FT                   /note="COGs: COG0535 Fe-S oxidoreductase; InterPro
FT                   IPR003731:IPR000385:IPR007197:IPR005980; KEGG:
FT                   lch:Lcho_1404 nitrogenase cofactor biosynthesis protein
FT                   NifB; PFAM: Radical SAM domain protein; Dinitrogenase
FT                   iron-molybdenum cofactor biosynthesis protein; SPTR: B1Y745
FT                   Nitrogenase cofactor biosynthesis protein NifB; TIGRFAM:
FT                   nitrogenase cofactor biosynthesis protein NifB; PFAM:
FT                   Radical SAM superfamily; Dinitrogenase iron-molybdenum
FT                   cofactor; TIGRFAM: nitrogenase cofactor biosynthesis
FT                   protein NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91750"
FT                   /db_xref="GOA:D5V3N9"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR005980"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3N9"
FT                   /protein_id="ADG91750.1"
FT                   /translation="MSCSCTSSSTQEELQQEVMDKINNHPCYSEGAHQHYARIHVAVAP
FT                   ACNIQCNYCNRKFDCSNESRPGVTSAKLSPEDAVKKVLYVGGDIQQLSVVGIAGPGDAL
FT                   ANPKKTFDTFRMLHEKAPDQKLCLSTNGLRLPDYVDEMVKYNVDHVTVTINSVDPTGEI
FT                   GAKIYPWVHWNHEKVFGAEGAKILLEQQLKGIKMLTERGILVKANSVLIPGVNDKELVN
FT                   VAKKLKELNVFLHNIMPLLSKEEYGTYYGLNGQASATDQEVMAAQEACGMDMKLMSHCR
FT                   QCRADAVGLIGEDRGEEFTPDVFQNMSWEELQTQYNMEARAKKHEVIENWRAALDAAND
FT                   RIKIEQASKEELSSTGETKLVAVTTAGEGTVNLHFGNATEFLIYEVGDKAIKFVMHRKV
FT                   ENAYCKGPEDCDGSYPIEEIKNTLKDVDILLTEKIGGCPQDELAQINLISDDSYALQPI
FT                   EKSVFAAAQKYFFAVDTKSEKELG"
FT   gene            73540..73821
FT                   /locus_tag="Arnit_0081"
FT   CDS_pept        73540..73821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0081"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: Q4YCC1 Putative
FT                   uncharacterized protein (Fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91751"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3P0"
FT                   /protein_id="ADG91751.1"
FT                   /translation="MKNNPKIILLKGNGPISINNELLELYPVTTCHGAIGFPLKSLRAD
FT                   NVYIVNSLDEFWQIEKTIKEKPCCFVYAYENLEKEDLSKIHALDMISV"
FT   gene            73875..74990
FT                   /locus_tag="Arnit_0082"
FT   CDS_pept        73875..74990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0082"
FT                   /product="homocitrate synthase"
FT                   /note="COGs: COG0119
FT                   Isopropylmalate/homocitrate/citramalate synthase; InterPro
FT                   IPR002034:IPR013785:IPR000891:IPR013477; KEGG: wsu:WS1396
FT                   homocitrate sythase 1; PFAM: pyruvate carboxyltransferase;
FT                   SPTR: Q7M8U7 HOMOCITRATE SYTHASE 1; TIGRFAM: homocitrate
FT                   synthase; PFAM: HMGL-like; TIGRFAM: homocitrate synthase
FT                   NifV"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91752"
FT                   /db_xref="GOA:D5V3P1"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR013477"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3P1"
FT                   /protein_id="ADG91752.1"
FT                   /translation="MFLINDTTLRDGEQAPYVAFNTKEKLDIAQKLYEAGADELEVGIP
FT                   AMGKKEQEDLKEILALNLPIPIMSWNRATMSDLEASLECGLKSVDLSIPVSDILIDVKF
FT                   GGDKEKVLSQLEKVILHAKKEGLFVCIGGEDSSRADLNFLKEILALGKSLGANRFRYCD
FT                   TVGILTPTKTYQNISELTKLDLLDIEMHTHNDFGMATANAISGYEAGAKSANTTVIGLG
FT                   ERAGNASFEQVLMTLARLLGKDTQIKSDKLKALIQTVGLASNRRIDTNLPIVGEYIFSH
FT                   ESGIHVNGMMKSKSAYEPFTPMEVGLERYFPIGKHSGTSTLLFHLQTLGITPTKESLQK
FT                   LLPLVREMVTNRKKVLDIKELEELYLCSLDI"
FT   gene            74972..75778
FT                   /locus_tag="Arnit_0083"
FT   CDS_pept        74972..75778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0083"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ech:ECH_0024 glycyl-tRNA synthetase, beta
FT                   subunit; SPTR: Q2GI76 Glycyl-tRNA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91753"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3P2"
FT                   /protein_id="ADG91753.1"
FT                   /translation="MFVGYLRNDFEEELSSILESDTLFDLELLKQTYEIFPQYCFAAYE
FT                   DGKIVGVVSAYAFSKHVFINVIKALDTHKDVLTRLIKLLVQNVSSMNIYVLIEDKLASY
FT                   FTAFNFQEHSKFLRYLHSGEAVAFNFSNSTAKQVSGENYDDISRKIDREVFLDDREEYI
FT                   KKDCVFTNSLKLSTTSGFMHSYVVNKRYIKISPWLMQNESYLDAEKLLRGVLYYRGLKK
FT                   IFAFIPKDIKEISELYESYKFKKDGNFSLLYLGEKPELKLENLYAL"
FT   gene            75802..76011
FT                   /locus_tag="Arnit_0084"
FT   CDS_pept        75802..76011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0084"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cpc:Cpar_1595 hypothetical protein; SPTR:
FT                   B3QPZ0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91754"
FT                   /db_xref="InterPro:IPR007774"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3P3"
FT                   /protein_id="ADG91754.1"
FT                   /translation="MADLTEEQKEKKKELAKYKRKVIEKAGVVHDIVEDTIWTEYDKLP
FT                   KLSEEIGLAMKDVESFLEEHPYLK"
FT   gene            76018..76260
FT                   /locus_tag="Arnit_0085"
FT   CDS_pept        76018..76260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0085"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: wsu:WS1395 hypothetical protein; SPTR: Q7MRF6
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91755"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3P4"
FT                   /protein_id="ADG91755.1"
FT                   /translation="MEDLKNKLICECGQKSILDAVKIFENTDLPYKKAKKLVTGCNKTC
FT                   CRKPLMALFNMVDFGFVDYEEISFLIDAMNDRLKG"
FT   gene            76262..77254
FT                   /locus_tag="Arnit_0086"
FT   CDS_pept        76262..77254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0086"
FT                   /product="leucine-rich repeat protein"
FT                   /note="COGs: COG4886 Leucine-rich repeat (LRR) protein;
FT                   InterPro IPR003591:IPR001611; KEGG: ter:Tery_3798 small
FT                   GTP-binding protein; PFAM: leucine-rich repeat protein;
FT                   SMART: leucine-rich repeat-containing protein typical
FT                   subtype; SPTR: Q10Y31 Small GTP-binding protein; PFAM:
FT                   Leucine Rich Repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91756"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3P5"
FT                   /protein_id="ADG91756.1"
FT                   /translation="MRSEIEDFIKWVNVNGLNSYISTHIDDINGMTHLDLSKKKIRELP
FT                   ESFGVLQNLTVLKLSNNRLKKLPNCIGEFKYLKNLQCENNLLSEIPSSIGKLSKLLILN
FT                   LNGNRLEELPKELYDLKSLTRLTLAANKIKRLDVELGKLSKLLYFSLDTNELDELPDSF
FT                   SKMKSLYYLDVSFNNLTKLPKSISQIDELQTLLLEGNQIDDLPSLESHDMLIKLDLSDN
FT                   SLKSLDFNVSKLEDLKILILDNNFLVKLPDEVCDLTNLTNLSVSSNSLIELPKNIGKLQ
FT                   NLEELDIEDNSVEKLPDSFFELKKLKNLYLADNEGLKRPEGMDFEYCDI"
FT   gene            77310..77591
FT                   /pseudo
FT                   /locus_tag="Arnit_0087"
FT   gene            complement(77612..78514)
FT                   /locus_tag="Arnit_0088"
FT   CDS_pept        complement(77612..78514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0088"
FT                   /product="pseudouridine synthase"
FT                   /note="COGs: COG0564 Pseudouridylate synthase 23S
FT                   RNA-specific; InterPro IPR020103:IPR006224:IPR006145; KEGG:
FT                   abu:Abu_0018 ribosomal large subunit pseudouridine
FT                   synthase; PFAM: pseudouridine synthase; SPTR: A8EQU7
FT                   Pseudouridine synthase; PFAM: RNA pseudouridylate synthase;
FT                   TIGRFAM: pseudouridine synthase, RluA family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91757"
FT                   /db_xref="GOA:D5V3P6"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3P6"
FT                   /protein_id="ADG91757.1"
FT                   /translation="MPFILKEYPALSGEKIQVHLVKNLKIKTSTAQKSISKGRVFDEAF
FT                   NTLKYGDIIDSDLIYMAQFEGHTRGLKPLFQTNYFAIFEKPSGIVVHPISKNTEYCLLD
FT                   EVRYHFGPDANLVHRIDAETSGLIMCAKDRDIESKLKLMFEEKKYQKSYLAIVRGHIKE
FT                   SVIIDTSIQKEGKNIGVRMAAGAEGKKSKTIINPIKYNEKKDLTLIEAIPVTGRQHQIR
FT                   VHLYSIGHPIFGDPIYGVDDDFADAYLDRLLDDKRREEVSGSHRLWLHANYLEFNYENV
FT                   LYKIYSQNKDLYEQFLEDN"
FT   gene            78648..79976
FT                   /locus_tag="Arnit_0089"
FT   CDS_pept        78648..79976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0089"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /note="COGs: COG0015 Adenylosuccinate lyase;
FT                   InterProIPR000362:IPR003031:IPR008948:IPR020557:IPR
FT                   019468:IPR004769; KEGG: abu:Abu_0019 adenylosuccinate
FT                   lyase; PFAM: fumarate lyase; Adenylosuccinate lyase-like;
FT                   SPTR: A8EQU8 Adenylosuccinate lyase; TIGRFAM:
FT                   adenylosuccinate lyase; PFAM: Lyase; Adenylosuccinate lyase
FT                   C-terminus; TIGRFAM: adenylosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91758"
FT                   /db_xref="GOA:D5V3P7"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3P7"
FT                   /protein_id="ADG91758.1"
FT                   /translation="MVERYAREEMSSKWTQQARYAAWLEVEKAAVKAWNKIGLIPDEDC
FT                   EKIVKNATFSVERIEEIEAVTKHDLIAFNTSVSESLGSESRWFHYGMTSSDAVDTGVAI
FT                   QMRDSLKIIIEDVKMLMESIKKRAQEHKFTLMVGRSHGIHGEPITFGLTLAVWYDEVSR
FT                   HLKNLEETMEVISVGQISGAMGNFAHAPLELEEYAMEELGLKPEPCSNQVIHRDRYARL
FT                   ATALALLASSVEKFAVQVRHLQRTEVYEAEEYFAKGQKGSSAMPHKRNPILTENITGLA
FT                   RMIRSYAAPAMENVALWHERDISHSSTERFWLPDAFITSDFMLHRMNSVIANLSVMPEN
FT                   MMKNLNLTGGLVFSQRVLLELPKAGVSREDAYRIVQRNAMKVWEEIQQGKPSTNEKGES
FT                   LYLQYLLGDEELRNSLSEEQIRECFNFDYYTKNVDAIFKRVFK"
FT   gene            80006..82390
FT                   /locus_tag="Arnit_0090"
FT   CDS_pept        80006..82390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0090"
FT                   /product="ribonucleoside-diphosphate reductase, alpha
FT                   subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="InterProIPR000788:IPR008926:IPR005144:IPR013509:IPR
FT                   013346; KEGG: abu:Abu_0020 ribonucleotide-diphosphate
FT                   reductase subunit alpha; PFAM: ribonucleotide reductase
FT                   large subunit; Ribonucleotide reductase large subunit
FT                   domain protein; ATP-cone domain protein; PRIAM:
FT                   Ribonucleoside-diphosphate reductase; SPTR: A8EQU9
FT                   Ribonucleoside-diphosphate reductase; TIGRFAM:
FT                   ribonucleoside-diphosphate reductase, alpha subunit; PFAM:
FT                   Ribonucleotide reductase, all-alpha domain; ATP cone
FT                   domain; Ribonucleotide reductase, barrel domain; TIGRFAM:
FT                   ribonucleoside-diphosphate reductase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91759"
FT                   /db_xref="GOA:D5V3P8"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3P8"
FT                   /protein_id="ADG91759.1"
FT                   /translation="MALMIQKRNGRKEVLDITKIQKMSIAATEGLEGVSQSELELDAQI
FT                   KFIDGMSSSDIQDALIKTAIEKIDIDVPNWTFVAARLFIFNLYHRVGRTTNSVKGEAYS
FT                   HMSDYIKTAQDAGRMIPGLERGYDLEDLNNYLKPERDLQFNYLGIKTLYDRYLIKDKNS
FT                   DPIELPQHMFMGIAMFLAQDEDDKQARAKEFYDVVSKFEVMLATPTLSNARTNRHQLSS
FT                   CYIGSSPDNIEGIFDGYKEMALLSKYGGGIGWDWNQIRALGGAIDGHKSAAGGTVPFLK
FT                   ITNDIAIAVDQLGTRKGAIAVYLEPWHMDISDFLDLKKNSGEERRRAHDLFPSLWICDL
FT                   FMQRIMEDSHWTLFDPNDVKDLSELHGDAFEKRYIEYENDNSIVKDRIKAKDLWKKILT
FT                   SYFESGSPFLCFKDNANRANPNAHVGHIRSSNLCTEIFQNTNPNKYKIKLEFDDGSIEL
FT                   YDEDDTIKVDSGIIKKANKVTALDSVGGKKIFIVEKEKTDGDTAVCNLASVNLSKIHTK
FT                   EDIERVVPTAIRMLDNVIDLNFYPLRKVKATNLKSRSIGLGVMGEAQMLAEEKLVWGSV
FT                   DHLKKIDKVMEAISYNAIKSSAELAVEKGKYPTFDGSNWSKGIMPHDHAPQAVNALVEK
FT                   DLFDTGYDWDALRAQVKKDGMRNGYLMAVAPTSSISILVGTTQAIEPVYKRKWYEENLS
FT                   GLIPVVVPKLSPETWSYYTPAYEVDQLDIIKAAAVRQKWIDQGQSTNIFLSLDKASGKY
FT                   MHQIYTLAWQLGLKSTYYLRSQSPEASNDVEDRSMECAGCQ"
FT   gene            82439..83458
FT                   /locus_tag="Arnit_0091"
FT   CDS_pept        82439..83458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0091"
FT                   /product="Ribonucleoside-diphosphate reductase"
FT                   /EC_number="1.17.4.1"
FT                   /note="COGs: COG0208 Ribonucleotide reductase beta subunit;
FT                   InterPro IPR009078:IPR012348:IPR000358; KEGG: abu:Abu_0021
FT                   ribonucleotide-diphosphate reductase subunit beta; PFAM:
FT                   ribonucleotide reductase; PRIAM: Ribonucleoside-diphosphate
FT                   reductase; SPTR: A8EQR9 Ribonucleoside-diphosphate
FT                   reductase, beta chain; PFAM: Ribonucleotide reductase,
FT                   small chain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91760"
FT                   /db_xref="GOA:D5V3P9"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3P9"
FT                   /protein_id="ADG91760.1"
FT                   /translation="MARKTIYNPDSKESLSDRRIFGGNPDGMINFTKMKYQWALNLWDT
FT                   MEANTWFPREVQMTGDAKDYKYLTPAEKRMYDLVLSQLIFMDSLQTNNLMDNINPYITV
FT                   PEINACLSRQSYEEANHSKSYAVMVESISDNTDEIYDMWKNDTQLREKNNYIAAVYDNL
FT                   SDNITDEKMVLAMFANQILEGLYFYAGFAAIYALGKSGKMLGSSQMIKFIQRDEVTHLL
FT                   LFQNMINSTRKERPDLFTPELEVKVRAMFRKAVELEAAWGAYITQGQILGFTDGIITQY
FT                   IQYLADKRLDAVGYKPEYNVKHPIPWVDGYSSFNDQRTNFFEGNVVNYSKGSIDFDDF"
FT   gene            83635..84354
FT                   /locus_tag="Arnit_0092"
FT   CDS_pept        83635..84354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0092"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rce:RC1_2412 hypothetical protein; SPTR:
FT                   A8T108 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91761"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3Q0"
FT                   /protein_id="ADG91761.1"
FT                   /translation="MNEDELINNFKEDPASTVLKFTQSVLEEIRENVRFNQSGLTVIND
FT                   INKDKFYDKIIDYYSALYSMFTHSDLFTEIHFKEPEGNIEQDIDSIFDVFYAISEEYRA
FT                   LCARRKFKSVSDKYTGLFNNEFMYHFSDKEVDKIQELINLLREEISKSTLFEEEHQQRL
FT                   LKRLEKLQAEIHKKMSDLDRFWGLVGDAGVAIGKFGKDAKPIVDRIRELTDVVWGAQRR
FT                   AEKLPDNSSNPLIDNES"
FT   gene            complement(84646..86388)
FT                   /locus_tag="Arnit_0093"
FT   CDS_pept        complement(84646..86388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0093"
FT                   /product="7TM domain sensor diguanylate cyclase"
FT                   /note="COGs: COG3706 Response regulator containing a
FT                   CheY-like receiver domain and a GGDEF domain; InterPro
FT                   IPR000160:IPR011623; KEGG: tdn:Suden_1328 diguanylate
FT                   cyclase; PFAM: GGDEF domain containing protein; Diverse 7TM
FT                   receptor transmembrane region; PRIAM: Diguanylate kinase;
FT                   SMART: GGDEF domain containing protein; SPTR: B6BNQ1
FT                   Diguanylate cyclase; TIGRFAM: diguanylate cyclase; PFAM:
FT                   7TM diverse intracellular signalling; GGDEF domain;
FT                   7TMR-DISM extracellular 2; TIGRFAM: diguanylate cyclase
FT                   (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91762"
FT                   /db_xref="GOA:D5V3Q1"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011622"
FT                   /db_xref="InterPro:IPR011623"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3Q1"
FT                   /protein_id="ADG91762.1"
FT                   /translation="MIKYLLLLIFFFTTLFAEHTLIIDNNSTIEKFKISTYEDKTSSLT
FT                   IKDIRSIKKFKEVNNNISNGFTNSTFWYKLTIKNTSPQTIQRYLKLTESIMDKIDFYIY
FT                   SNNKMIKYKKDGVGYFKEGQKNYLERPFIEFDLKKDETKTIYIKISSLYPMFNSFQIYD
FT                   KNALNTFEREYTTIYAFLIGSLLSLALYNLMIFFYTRDISYIFYVLYSLSFISWQTSMS
FT                   GIYPFDTFLNTQSYYFVGASIPLLVAFLTLFTNHILDIRTMSKKYYYVLNFIGSFYIFL
FT                   AICSIFAFKPSILVMNATTTFVLPFLLYMGYKSYKNGNIIAIFYLLAQVGFLSMSTLFS
FT                   LSSYGFLEYNFYSRHGIMVGSFIEMILFSLALAYRIKILEKEKFIIMQKAKDNLEINVK
FT                   KRTKELEESKKKLEILANKDFLSDLLNRRPLFEISNRLISLAKRENTTISVLLFDIDKF
FT                   KAINDTYGHKEGDEVIKAFSKILKKDRRNSDIVARIGGEEFVILLPSTTHKDAFIIAEE
FT                   IRKEVETFQVKTKDSTICFTVSCGVSSLRKEDNNMDELIARADKRLYMAKNNGRNVVVD
FT                   GDIV"
FT   sig_peptide     complement(86338..86388)
FT                   /locus_tag="Arnit_0093"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            86594..87043
FT                   /locus_tag="Arnit_0094"
FT   CDS_pept        86594..87043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0094"
FT                   /product="thioesterase superfamily protein"
FT                   /note="COGs: COG0824 thioesterase; InterPro IPR006683;
FT                   KEGG: abu:Abu_0023 hypothetical protein; PFAM: thioesterase
FT                   superfamily protein; SPTR: A8EQS1 Putative uncharacterized
FT                   protein; PFAM: Thioesterase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91763"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3Q2"
FT                   /protein_id="ADG91763.1"
FT                   /translation="MFTEIIKPRFLETDALGHINNNTYGVWFEAARDEIFRIFMPKANV
FT                   KEWNLIMAHTSFDFLKEVFWGKEVIVKTGVAKLGNSSIELCHAVYQDGKLCTIGKCILI
FT                   HYDFETKQAVSIPEKIRAELEAHLFTSPWMGTLEEVEEFENSNKS"
FT   gene            complement(87054..87668)
FT                   /locus_tag="Arnit_0095"
FT   CDS_pept        complement(87054..87668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0095"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="COGs: COG1280 Putative threonine efflux protein;
FT                   InterPro IPR001123; KEGG: son:SO_1716 amino acid
FT                   transporter LysE; PFAM: Lysine exporter protein
FT                   (LYSE/YGGA); SPTR: Q8EG90 Transporter, LysE family; PFAM:
FT                   LysE type translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91764"
FT                   /db_xref="GOA:D5V3Q3"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3Q3"
FT                   /protein_id="ADG91764.1"
FT                   /translation="MEELYTVSLLISIATFALTATITPGPNNVLLLSSGLTFGYKRTLP
FT                   HVFGVFLGFGLMVLLVGLGIGIVFERFPIVLKILKVIGILYLFWMAYKIGSSKGHMKIK
FT                   EKHKPFTFIQAALFQWVNPKGWIMSMTAMSIFVTSKENSIAQVVIIAFLFLLAGAISCN
FT                   VWAMGGVALKRFIKEESHVRKFNLIMAILLVVSILPVIIES"
FT   sig_peptide     complement(87612..87668)
FT                   /locus_tag="Arnit_0095"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(87669..88550)
FT                   /locus_tag="Arnit_0096"
FT   CDS_pept        complement(87669..88550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0096"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="InterPro IPR000620; KEGG: yen:YE3697 hypothetical
FT                   protein; PFAM: protein of unknown function DUF6
FT                   transmembrane; SPTR: B9C9T6 Probable amino-acid metabolite
FT                   efflux pump; PFAM: EamA-like transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91765"
FT                   /db_xref="GOA:D5V3Q4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3Q4"
FT                   /protein_id="ADG91765.1"
FT                   /translation="MKINDLLLAVLVAFIWGVNFSVIKLGLLSLDPFILSGMRFLLCAL
FT                   PLVFFVKKPKVHIKWLISYGLLFGVGLWGMVSLGIYFGMSAGMASLVLQMSAFLTVILG
FT                   AILLDETIDITKKIAFAISLFGLLLIISVTDGSVTILGSVLVLIAAVSLSFTNIIIKKA
FT                   GTKNLFSFMVWASLFSPIPLFVLAFLTNGGIVFTNFFENLSNMAIFSIMFQVYPTTLLG
FT                   YWIWNTLLHKYPVSSVAPLSLLIPIFGIAGSYFIFDEKIGLIKIVAAGLIILALVINTF
FT                   GKRISLKKYKGV"
FT   gene            88689..89573
FT                   /locus_tag="Arnit_0097"
FT   CDS_pept        88689..89573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0097"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="COGs: COG2207 AraC-type DNA-binding
FT                   domain-containing protein;
FT                   InterProIPR020449:IPR011256:IPR009057:IPR012287:IPR
FT                   018060:IPR000005:IPR010499; KEGG: abu:Abu_0178 AraC family
FT                   transcriptional regulator; PFAM: transcription activator
FT                   effector binding; helix-turn-helix- domain containing
FT                   protein AraC type; SMART: Helix-turn-helix, AraC domain;
FT                   SPTR: A8ER81 Transcriptional regulator, AraC family; PFAM:
FT                   Bacterial transcription activator, effector binding domain;
FT                   Bacterial regulatory helix-turn-helix proteins, AraC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91766"
FT                   /db_xref="GOA:D5V3Q5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3Q5"
FT                   /protein_id="ADG91766.1"
FT                   /translation="MQKRSTYNKNVQIANDAMYYIYEYIDTDINIDDLALNFGISKFHL
FT                   HKLFKEVMGINIYETIKSIRLQKAASLLLTNRYSTITQIASMCGYSSQTSFIRAFKERF
FT                   HQTPKVWRNGGSEEYSTSILKNSSMLLYEEKGFENIEPKIIKSKALKTYYIRQRGYLKE
FT                   DVVKIWQKLQAWVYTNNITQYDEIGIYHDNPTITPHNECFYVAGIIPKGEVDLSNTSLP
FT                   IFYTPEALYATFEIKGKMGDILRFIQWAYQEWLPKSGFETTTNPPYVIFKKNHFLNEDR
FT                   FFEATYYLPIQYV"
FT   gene            89592..89972
FT                   /locus_tag="Arnit_0098"
FT   CDS_pept        89592..89972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0098"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="InterPro IPR004360; KEGG: abu:Abu_2072 hypothetical
FT                   protein; PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; SPTR: A8EWG6 Putative uncharacterized
FT                   protein; PFAM: Glyoxalase/Bleomycin resistance
FT                   protein/Dioxygenase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91767"
FT                   /db_xref="GOA:D5V3Q6"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3Q6"
FT                   /protein_id="ADG91767.1"
FT                   /translation="MIKINHLDHLVLTVKNIDATVEFYTQILGMEKEVFKGSRIALKYG
FT                   NQKINLHELGKEFEPKAFNVKEGSADLCFIVDTPVKEVKEFLESKNIEIIEGIVPRTGA
FT                   RGPIESVYIRDPDMNLIELSNY"
FT   gene            complement(89969..90451)
FT                   /locus_tag="Arnit_0099"
FT   CDS_pept        complement(89969..90451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0099"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR009056; KEGG: sun:SUN_0504 hypothetical
FT                   protein; SPTR: A6Q7K5 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91768"
FT                   /db_xref="GOA:D5V3Q7"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3Q7"
FT                   /protein_id="ADG91768.1"
FT                   /translation="MRILTLLLIILNFIYALPDEFDKQRYLQGEEIFEQKCNNCHVKSM
FT                   DIQLLMKNFFEENNKLLNLKAPTGNEISYRLKHQIGSMEDIGFHLEETADFLKDYLYYP
FT                   DKSKTICLEGVIKHFDTMPSQKGKISLEEIEDVNFFLYFLEGFNDVNEFYHDETKF"
FT   gene            90635..91450
FT                   /locus_tag="Arnit_0100"
FT   CDS_pept        90635..91450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0100"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="COGs: COG2885 Outer membrane protein and related
FT                   peptidoglycan-associated (lipo)protein; InterPro IPR006665;
FT                   KEGG: abu:Abu_0025 hypothetical protein; PFAM: OmpA/MotB
FT                   domain protein; SPTR: A8EQS3 Putative uncharacterized
FT                   protein; PFAM: OmpA family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91769"
FT                   /db_xref="GOA:D5V3Q8"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3Q8"
FT                   /protein_id="ADG91769.1"
FT                   /translation="MSILKQIIFLSFLLVAIMVACVYLYINQDKFGTTTFYTPSISQKI
FT                   IIPEKTVPIQEEIVEGPSEKVVPPIIEDQKDDAVIDENTDEDQKKIDDIEKPDIENADI
FT                   IVDDKKEVDNTKKVVIPEDKKIEELSHKIQPKNIQDDTIESKMDKNKKTQDEINAVISK
FT                   DHIFFKRLGTDITDESYKVVEQIAKILKNNPSVKIEIGGHTDAKGEADVNQWISLQRAK
FT                   SVKKELEKLGIAEDRITAVGYGESQPLVPNDKNGYSSENRRVEFKIIEE"
FT   sig_peptide     90635..90706
FT                   /locus_tag="Arnit_0100"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            91453..91842
FT                   /locus_tag="Arnit_0101"
FT   CDS_pept        91453..91842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0101"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG3743 conserved hypothetical protein; KEGG:
FT                   abu:Abu_0026 hypothetical protein; SPTR: A8EQS4 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91770"
FT                   /db_xref="GOA:D5V3Q9"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3Q9"
FT                   /protein_id="ADG91770.1"
FT                   /translation="MLIIASKIVFWLIAVAIIAMYIGFLIGKLRYKKRQVSYEINPILR
FT                   KPGNIYNKPFILGNPRPTGKDDLKAIEGIDHQMENKLNALGIFHIEQIAKWSEKNIDWI
FT                   EEYFSIDNRVSEEQWVEKAKVIIKR"
FT   gene            complement(91846..92289)
FT                   /locus_tag="Arnit_0102"
FT   CDS_pept        complement(91846..92289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0102"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="COGs: COG0394 Protein-tyrosine-phosphatase; InterPro
FT                   IPR000106:IPR017867; KEGG: abu:Abu_0594 protein tyrosine
FT                   phosphatase; PFAM: Protein-tyrosine phosphatase, low
FT                   molecular weight; SMART: Protein-tyrosine phosphatase, low
FT                   molecular weight; SPTR: A8ESD7 Protein tyrosine
FT                   phosphatase; PFAM: Low molecular weight phosphotyrosine
FT                   protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91771"
FT                   /db_xref="GOA:D5V3R0"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3R0"
FT                   /protein_id="ADG91771.1"
FT                   /translation="MKILFVCLGNICRSPLAEAIAKDFAKQNNYKIEVDSCGTGSWHIG
FT                   EAPCLDSQKIAKIKGLDISNYKARQVQKEDFKKFDLIVGLDSKNIASLKNLGCQNPLLI
FT                   GDFGYEGQDVPDPYFFDGFEGFDKVFEMIETCVKNLLKEKIEK"
FT   gene            complement(92291..93007)
FT                   /locus_tag="Arnit_0103"
FT   CDS_pept        complement(92291..93007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0103"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="COGs: COG0388 amidohydrolase; InterPro IPR003010;
FT                   KEGG: abu:Abu_1765 putative nitrilase/cyanide hydratase;
FT                   PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; SPTR: A8EVN8 Putative uncharacterized
FT                   protein; PFAM: Carbon-nitrogen hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91772"
FT                   /db_xref="GOA:D5V3R1"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3R1"
FT                   /protein_id="ADG91772.1"
FT                   /translation="MNLVTLQIKPSTNFQDNLNHLEELILQTPKDSFILAPELCLTGYA
FT                   YGRIIEAGKFARTAIDKLTQLSKDRTISLTMTNKECEEYFNTFYIFHKGKILHKQSKIK
FT                   LFAINDENKYFESGREEDIKLFDFEGLKVGVLICFELRFLDYWKKLQGADIILIPAMWG
FT                   AKRKENYETLTRALAITNQCFVIASDSSDESCAKSSAIINPFGDITIDDNKELISKLID
FT                   LKDIQLMRKYLDVGIK"
FT   gene            complement(92982..94382)
FT                   /locus_tag="Arnit_0104"
FT   CDS_pept        complement(92982..94382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0104"
FT                   /product="Phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /note="COGs: COG1109 Phosphomannomutase;
FT                   InterProIPR005841:IPR016055:IPR016066:IPR001579:IPR
FT                   005844:IPR005845:IPR005846:IPR005843; KEGG: sun:SUN_1934
FT                   phosphomannomutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; phosphoglucomutase/phosphomannomutase; PRIAM:
FT                   Phosphomannomutase; SPTR: C1ZZL7 Phosphomannomutase; PFAM:
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain III; Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain II;
FT                   Phosphoglucomutase/phosphomannomutase, C-terminal domain;
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain I"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91773"
FT                   /db_xref="GOA:D5V3R2"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3R2"
FT                   /protein_id="ADG91773.1"
FT                   /translation="MINKSIFREYDIRGIVGNELNEQSSKLIGYYLGLEAIKRTNVQEP
FT                   VVVIGYDARIHSPELFNYLTSGFNKAGCKVLGMGMVATGVNYFASFQEFDGEKPNASVM
FT                   ITGSHNPSPYNGFKITINNAPFFGDDIYAMGEEIINNQNMNIKDNETYKEIDVKSLYKN
FT                   YMITEFAHLKGMKQKLIIDCGNGVADTVLTDILDALELNYDALYCEPDGTFPNHHPDPS
FT                   EEKNLKDVIEKLKGDYEYGFAYDGDADRIAFLTKNHNVKGDIMALLFAKTMKNPVIIGE
FT                   VKCTQIMYDRINENGTAVMYKTGHSNLKVKLKELNADMAAEVSGHIFFNDRYYGFDDAI
FT                   YATFRLLELIFNGMDIDKEIDSLPKVYSTEEIKVETTEEEKFLLMHQIKKNLITVGDDF
FT                   PKILDIIEVDGVRIVFEQGWGLVRASNTTPVLVTRFESTDLEVAKLYENKINELILRSK
FT                   NELSNTTN"
FT   gene            94492..95121
FT                   /locus_tag="Arnit_0105"
FT   CDS_pept        94492..95121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0105"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="COGs: COG1280 Putative threonine efflux protein;
FT                   InterPro IPR001123; KEGG: ppd:Ppro_1992 lysine exporter
FT                   protein LysE/YggA; PFAM: Lysine exporter protein
FT                   (LYSE/YGGA); SPTR: A1AQI0 Lysine exporter protein
FT                   (LYSE/YGGA); PFAM: LysE type translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91774"
FT                   /db_xref="GOA:D5V3R3"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:D5V3R3"
FT                   /protein_id="ADG91774.1"
FT                   /translation="MLELSNLYMFILASFLLCLAPGPDNIYVLTQGMTKSKKAALVTTL
FT                   GLCTGLIIHTSAAAFGISVIFKTSEIAFNIVKFAGAAYLLYIAFQSFKYRNTPLDLSVQ
FT                   NSSNELKKLYIKGFFMNVLNPKVSIFFLAFLPQFVSPQNGSVPIQMIILGLVFMALTII
FT                   VFSSIGIAGNLLSAKLIQKPSIVKYMNIMTSFVLGGLAVKLALSQR"
FT   sig_peptide     94492..94569
FT                   /locus_tag="Arnit_0105"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(95124..96026)
FT                   /pseudo
FT                   /locus_tag="Arnit_0106"
FT   gene            complement(96037..96615)
FT                   /pseudo
FT                   /locus_tag="Arnit_0107"
FT   gene            complement(96694..97359)
FT                   /locus_tag="Arnit_0108"
FT   CDS_pept        complement(96694..97359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0108"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="COGs: COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain; InterPro IPR011006:IPR001789:IPR001867; KEGG:
FT                   tdn:Suden_0616 two component transcriptional regulator;
FT                   PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; SPTR: B6BL93 Two component transcriptional
FT                   regulator, winged helix family, putative; PFAM: Response
FT                   regulator receiver domain; Transcriptional regulatory
FT                   protein, C terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91775"
FT                   /db_xref="GOA:D5V442"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D5V442"
FT                   /protein_id="ADG91775.1"
FT                   /translation="MNIIILEDEAIMMMFLKDSLEKRGHTVKATFNSYLGFFEFIEKEN
FT                   IDLVFMDILLKGALDGTQIAKRLREINKTIKIVFITSYKDSQILQMAKLSKPNGYLIKP
FT                   VSKEDLEAILMVCETNTEIEENNDYITIATYKYHIINKTVEENNELIKLTKNELKCFEL
FT                   LLQNKNTYISPEILINHLWNVEASIKFNSLRELVYRIRKKLPNLHIDNSINIGYILKD"
FT   gene            97473..99323
FT                   /locus_tag="Arnit_0109"
FT   CDS_pept        97473..99323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0109"
FT                   /product="signal transduction histidine kinase"
FT                   /note="COGs: COG3920 Signal transduction histidine kinase;
FT                   InterPro IPR003594:IPR005467:IPR011623:IPR011495; KEGG:
FT                   tcx:Tcr_1062 diguanylate cyclase; PFAM: Diverse 7TM
FT                   receptor transmembrane region; histidine kinase
FT                   dimerisation/phosphoacceptor; ATP-binding region ATPase
FT                   domain protein; SPTR: Q31GR6 Diguanylate cyclase (GGDEF
FT                   domain); PFAM: Histidine kinase; 7TM diverse intracellular
FT                   signalling; 7TMR-DISM extracellular 2"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91776"
FT                   /db_xref="GOA:D5V443"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR011622"
FT                   /db_xref="InterPro:IPR011623"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5V443"
FT                   /protein_id="ADG91776.1"
FT                   /translation="MRLYYLIILLVSFSSVFATEIDLSNKNLTYEGKKMSYFEDKDSSY
FT                   TINKIKELNNKSFTKQEKEVFLRFFTDSTYWFKFDALNKTNNNLKRYFVFDTPWIDSIN
FT                   IYIYDNQNRLTTYKLGTLLPFKERSMKINLLNQAHNFSKGKSTVYLQIKTRDPFIVPFS
FT                   ILSEKNFYKKIMNMDLIVISTYSIVFAIFIFNILIFIIARYKPYFYYSLYLLSYLLMSL
FT                   SYDSHTFKYIFYDYPNIQNWMQSLTILFYLVFSLLFAKSFLELKDNFPKINTYTNYILI
FT                   GHIGICILASILGYKYTIFYASCITPLFSIYMLFLGVYSYLKGNKKAVFFTLATIFGCT
FT                   GAFLTASIAASMIDYNWYLFKGVDIGVSIDSILFSIALAYRYTSLNLILENTKKEVTLL
FT                   NKNLEKKVEERTKELDIQVKNKTVLLKELSHRIKNNLQIISALLSMDKDKLENEKDKDI
FT                   LDENIKRIKSISILYENFLEIKNPNKIELKKYIEKIISEIKNSYSSLDIQYDLDIHKIL
FT                   LNQNSLIPIGLVMNELILNSVKYAFKQTPNPKISIYFSKDDKNINFMYKDNGIGANIDE
FT                   VESGFGFSLMKTLISFQLNGKLDCKNNDGLEYKIILPADS"
FT   sig_peptide     97473..97526
FT                   /locus_tag="Arnit_0109"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(99343..100575)
FT                   /locus_tag="Arnit_0110"
FT   CDS_pept        complement(99343..100575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0110"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /EC_number="1.2.1.41"
FT                   /note="COGs: COG0014 Gamma-glutamyl phosphate reductase;
FT                   InterProIPR016161:IPR020593:IPR016162:IPR016163:IPR
FT                   012134:IPR000965; KEGG: abu:Abu_1757 gamma-glutamyl
FT                   phosphate reductase; PRIAM: Glutamate-5-semialdehyde
FT                   dehydrogenase; SPTR: A8EVN0 Gamma-glutamyl phosphate
FT                   reductase; TIGRFAM: gamma-glutamyl phosphate reductase;
FT                   PFAM: Aldehyde dehydrogenase family; TIGRFAM:
FT                   gamma-glutamyl phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91777"
FT                   /db_xref="GOA:D5V444"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/TrEMBL:D5V444"
FT                   /protein_id="ADG91777.1"
FT                   /translation="MQQFLIEAKKTSRHISTLSGEVKNKVLNQMAEAIIEHCDYIINHN
FT                   EKDMENARVNNLDAALMDRLLLTGDRVMDMAKAIKEIAALKEPVGRTLDGWVTEDGLNI
FT                   QKVSIPIGVIGIIYESRPNVTSDTAALCFKSGNVCVLKGGKEAENSNKAIATILRKVLD
FT                   DNGLPQNAISLLPDSSREGVAFLIKQDKYVDLIVPRGGEALIKYVSENATVPVVKHDKG
FT                   VCHTYIDKDANHEKAIAISINAKCSRPSACNALETLLIHKDVAAYILPPLHEAFMKNGT
FT                   ELRGCSITRNYIDIHSASENDYDTEYLANILSIKVVKNIDDAIAHIAKHGSGHSEAIIS
FT                   ENYSSINKFLDEVDSACVYANASTRFTDGGAFGLGAEVGISTNKLHSRGPMGINDLTTF
FT                   KFKVYGNGQIR"
FT   gene            complement(100632..102569)
FT                   /locus_tag="Arnit_0111"
FT   CDS_pept        complement(100632..102569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0111"
FT                   /product="adenylate/guanylate cyclase with integral
FT                   membrane sensor"
FT                   /note="COGs: COG2114 Adenylate cyclase family 3 (some
FT                   protein contain HAMP domain); InterPro IPR001054:IPR003660;
FT                   KEGG: mgm:Mmc1_1821 adenylate/guanylate cyclase; PFAM:
FT                   adenylyl cyclase class-3/4/guanylyl cyclase; histidine
FT                   kinase HAMP region domain protein; SMART: adenylyl cyclase
FT                   class-3/4/guanylyl cyclase; histidine kinase HAMP region
FT                   domain protein; SPTR: A0L8N6 Adenylate/guanylate cyclase;
FT                   PFAM: Adenylate and Guanylate cyclase catalytic domain;
FT                   HAMP domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91778"
FT                   /db_xref="GOA:D5V445"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D5V445"
FT                   /protein_id="ADG91778.1"
FT                   /translation="MNIRKKVIFSFVILILFIISISSLSLITTYHMKENASFAKEVSKL
FT                   INIQEDMNELINLATLESSLKNLDKIKENFNSFEKKFELLKHEILKKNKKDFIDNIIHN
FT                   IRQNDEVKSHLDKLFENEHTIELIFDEVYNFQKKHVFHQNMFKKVYPKEDEARNKLQKL
FT                   IKETKSLTLVQEFGDLKYYSKETLYQHKDKERYEKWISSIDKIILELLKKDEKELFDLF
FT                   TNYKKTVQKVGKIVLDINNIEKQEKVLVNVLISILKENKQVSVSIERKIEEITDQFLSN
FT                   LSTLEFTLVASIVFITFVLTLYITSRLTIILKKLKNGVQKLKNGDYDANISIQEDKEFN
FT                   EIAKTFNNMSQNIKENQNTLEQRIKSRTNELQTALINIQEQKDTLENLSNKLSKYLSPQ
FT                   IFESIFSGKQDVQLESKRKYLTVFFSDIQGFTDLTDSVETETLTQLLNEYLDIMSSIVI
FT                   KHGGTIDKYIGDSIMVFFGDPLSNGKTKDAISCINMAIEMREAMGELRIKWQKDGISKP
FT                   VHIRMGINSGYCTVGNFGSKNRLDYTIIGGVVNLASRLESNANPDEILISSETYMFIKD
FT                   SIKCTKREELNVKGISHPIQTYEVLSSSSNSTIIEEQNGFNLILDLNEINKSSVISTLK
FT                   NTILSIEKNS"
FT   sig_peptide     complement(102495..102569)
FT                   /locus_tag="Arnit_0111"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(102610..103584)
FT                   /locus_tag="Arnit_0112"
FT   CDS_pept        complement(102610..103584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0112"
FT                   /product="quinone oxidoreductase, YhdH/YhfP family"
FT                   /note="COGs: COG0604 NADPH:quinone reductase and related
FT                   Zn-dependent oxidoreductase;
FT                   InterProIPR011032:IPR016040:IPR013154:IPR013149:IPR 014188;
FT                   KEGG: pcr:Pcryo_1784 zinc-binding alcohol dehydrogenase;
FT                   PFAM: Alcohol dehydrogenase zinc-binding domain protein;
FT                   Alcohol dehydrogenase GroES domain protein; SPTR: Q1Q9U2
FT                   Alcohol dehydrogenase, zinc-binding; TIGRFAM: quinone
FT                   oxidoreductase, YhdH/YhfP family; PFAM: Alcohol
FT                   dehydrogenase GroES-like domain; Zinc-binding
FT                   dehydrogenase; TIGRFAM: putative quinone oxidoreductase,
FT                   YhdH/YhfP family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91779"
FT                   /db_xref="GOA:D5V446"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR014188"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5V446"
FT                   /protein_id="ADG91779.1"
FT                   /translation="MKAYIVEKLEDKKFQSGLKDIDIPTIGENEVLIKATYSSLNYKDA
FT                   LSSVGNPGVTRNFPHVTGIDVAGVVEKSNSDKFSVGEKVLVTGYDLGMNTDGGHQEFVK
FT                   VPDSWVVKIPDTITDREIMTYGTAGLTAALSVNELLNNGITEGNILVTGATGGVGSIAI
FT                   SILHKLGFNTTAISGKEDKIPFLKDLGASEVILRSEFDVENKRPMGSEKFDGVIDTVGG
FT                   NILAEALKIVRYDGVVTCCGLTSSFELNTNVFPFILRGVRLIGIDSVECKIEKKIAAWE
FT                   KIASEFKIENLEQLTNEISLDNIKDAYDALLKGKASGRFLVKI"
FT   gene            complement(103674..104954)
FT                   /locus_tag="Arnit_0113"
FT   CDS_pept        complement(103674..104954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0113"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_3895 hypothetical protein; SPTR:
FT                   Q07W94 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91780"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D5V447"
FT                   /protein_id="ADG91780.1"
FT                   /translation="MGHVKILKDNCIKWGSMILVTFVLMTNAKAGDLPTFLDKKDILNA
FT                   NFKCLGTTTKYSKEEQKYVDILWDETLKYLNAYAIALTNSKENNCRNSDEAMYDTSAGI
FT                   KKMCIMDRRDMKLMVKNIYQVINNPDKAKACFSAREDVNWIYSPGGELEEKSPVAKWLK
FT                   RTTYEEFFNKKVKNKEVKKLGLEFTKNFYKMVTGDEVKMPSVFPYDVSANSLPNLWAAV
FT                   GWFPMYAEESKRNEKNFLNIRGGYAYGEVFGPWGLLRIEKINGQEVGAEVGMTVQSVNT
FT                   FYPYHNHAISEIYYNMRVPACVKEFKSFAIREDSPLLKTVEVTDKMRKVQFDSGQAHEH
FT                   DMWLDSSYKKDPLMYFHQNTIHAFEVDGNCEAKPEERAIVSVWARSNANDRRNDYGTTL
FT                   LCESAKNPNTPAKRGEMIQCELTHTKW"
FT   sig_peptide     complement(104865..104954)
FT                   /locus_tag="Arnit_0113"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            105064..105408
FT                   /locus_tag="Arnit_0114"
FT   CDS_pept        105064..105408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0114"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="COGs: COG1733 transcriptional regulator protein;
FT                   InterPro IPR002577; KEGG: abu:Abu_0028 hypothetical
FT                   protein; PFAM: helix-turn-helix HxlR type; SPTR: A8EQS6
FT                   Putative uncharacterized protein; PFAM: HxlR-like
FT                   helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91781"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5V448"
FT                   /protein_id="ADG91781.1"
FT                   /translation="MTKRIDKDFQEIIEKCPVETALDALAGKWKILILWYLRTETKRFS
FT                   ELQKLLPRTTQKMLIQKLRELEEDGVVHREVYPVVPPKVEYSLTDYGKTLKPILKQLYL
FT                   WGEIHKNKDL"
FT   gene            complement(105410..106102)
FT                   /locus_tag="Arnit_0115"
FT   CDS_pept        complement(105410..106102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0115"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG0390 ABC-type uncharacterized transport
FT                   system permease component; InterPro IPR005226; KEGG:
FT                   kko:Kkor_0960 hypothetical protein; PFAM: conserved
FT                   hypothetical protein; SPTR: B6BLG4 ABC-type transport
FT                   system, permease component; PFAM: Uncharacterised protein
FT                   family (UPF0014); TIGRFAM: conserved hypothetical protein
FT                   TIGR00245"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91782"
FT                   /db_xref="GOA:D5V449"
FT                   /db_xref="InterPro:IPR005226"
FT                   /db_xref="UniProtKB/TrEMBL:D5V449"
FT                   /protein_id="ADG91782.1"
FT                   /translation="MQIIPFTHLVYSILPLLIVWYFYKKWTNEKYEIITSTIRMVIQLL
FT                   IIGYFLIYLFKEKNDFVGLLIITFMITVSTWIALRNTQDRSFNHYSKIFLSIGISGIIH
FT                   LILIIAFVLDLHTLYEPRYVIPIAGMIFANTMNALSLAIERYEKEISRDVSFEKAREVA
FT                   FKACLIPQINSLLAVGLVSLPGMMTGQILSGIDPLIAVRYQIMIMTMVLSSAGISAIIY
FT                   FTLKRKDI"
FT   gene            complement(106104..106994)
FT                   /locus_tag="Arnit_0116"
FT   CDS_pept        complement(106104..106994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0116"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD(P)(+))"
FT                   /EC_number="1.1.1.94"
FT                   /note="COGs: COG0240 Glycerol-3-phosphate dehydrogenase;
FT                   InterProIPR008927:IPR016040:IPR006168:IPR013328:IPR
FT                   011128:IPR006109; KEGG: abu:Abu_0029 NAD(P)H-dependent
FT                   glycerol-3-phosphate dehydrogenase; PFAM: NAD-dependent
FT                   glycerol-3-phosphate dehydrogenase domain protein; PRIAM:
FT                   Glycerol-3-phosphate dehydrogenase (NAD(P)(+)); SPTR:
FT                   A8EQS7 Glycerol-3-phosphate dehydrogenase; PFAM:
FT                   NAD-dependent glycerol-3-phosphate dehydrogenase
FT                   C-terminus; NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase N-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91783"
FT                   /db_xref="GOA:D5V450"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5V450"
FT                   /protein_id="ADG91783.1"
FT                   /translation="MGKIAVIGAGKWGQALHFALSLKQEVYISSRTKKDIKNFVDLETA
FT                   MECEYLIIAIPAQEIKKWLKENFTYKGQKILVASKGIEASSGKFLNEIYEKFVPNKNIG
FT                   FISGPSFAAEVIKALPAAIVINSKSKKLYDEFSKFFPEYLKTYHSKDVIGAEIAGAYKN
FT                   VLAIASGICDGLKLGNNARASLISRGLVEMARFGKEFGAKKSTFLGLSGAGDLFLTASS
FT                   TMSRNYRVGLGLALNKKLEDILEELGEVAEGVKTAEAIYGLSKEHNIYTPIANEVKKIL
FT                   NGKEPIDSLKDLLKS"
FT   gene            107146..107580
FT                   /locus_tag="Arnit_0117"
FT   CDS_pept        107146..107580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0117"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="InterPro IPR000835:IPR011991; KEGG: lwe:lwe2757 MarR
FT                   family transcriptional regulator; PFAM: regulatory protein
FT                   MarR; SMART: regulatory protein MarR; SPTR: A0AME3 Complete
FT                   genome; PFAM: MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91784"
FT                   /db_xref="GOA:D5V451"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5V451"
FT                   /protein_id="ADG91784.1"
FT                   /translation="MNDIKKVSLPHKVAQTAYKINQSLSKVLIDFDIAPEQRVILEVID
FT                   KNKKVSQNELSQYLKKDKTTVSRTLDVIERKGYIVRKYTNEDKRIKFITLTSFGKEALD
FT                   KTEKTVNLFREKTLNNFSKEEIDTFYHFLEKLTLNIESEE"
FT   gene            complement(107621..109039)
FT                   /locus_tag="Arnit_0118"
FT   CDS_pept        complement(107621..109039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0118"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /note="COGs: COG0064 Asp-tRNAAsn/Glu-tRNAGln
FT                   amidotransferase B subunit (PET112 homolog);
FT                   InterProIPR003789:IPR017958:IPR006075:IPR006107:IPR
FT                   018027:IPR004413; KEGG: abu:Abu_0030 aspartyl/glutamyl-tRNA
FT                   amidotransferase subunit B; PFAM: GatB region; GatB central
FT                   domain protein; Asn/Gln amidotransferase; SPTR: A8EQS8
FT                   Glutamyl-tRNA(Gln) amidotransferase, subunit B; TIGRFAM:
FT                   glutamyl-tRNA(Gln) amidotransferase, B subunit; PFAM:
FT                   GatB/GatE catalytic domain; GatB domain; TIGRFAM:
FT                   glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn)
FT                   amidotransferase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91785"
FT                   /db_xref="GOA:D5V452"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:D5V452"
FT                   /protein_id="ADG91785.1"
FT                   /translation="MFEVIIGLEVHVQLNTNSKLFCSCATSFGEDPNTNVCPTCLGLPG
FT                   ALPVLNKEAVHKAIMLGTALKSKINQKSIFNRKNYFYPDLPSGYQISQFEVPVVGLGEL
FT                   VIDFPDGSQKTIGVTRAHLENDAGKNIHAGAVSHVDLNRAGTPLLEIVSEPDMRTAEEA
FT                   ILYLKKLHSIVRYLGISDANMQEGSFRCDVNVSIRPKGDTNLYTRCEIKNMNSFKFIEK
FT                   AIAYEVNRHIEAWEDGIHSTEIVQETRLFDPEKGETRSMRGKEDAADYRYFPDPDLRPV
FT                   IITDEMLEKYSQIPELPDEKKARFVKDYGIKDYDASVITSQLEMANFFEEMLAEGISGK
FT                   NAVTWLTVELQGRLTDSLATSPVDAKKLATIVKKIEDNTISGKAAKEVLDYLMENDASV
FT                   DSVIEKLGLKQVSDDGALLTMIDEILANNQDKVEEYKAGKEKMFAFFVGQTMKASKGTA
FT                   NPQKVSELLKQRLA"
FT   gene            complement(109049..109900)
FT                   /locus_tag="Arnit_0119"
FT   CDS_pept        complement(109049..109900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0119"
FT                   /product="SurA domain protein"
FT                   /note="InterPro IPR000215:IPR015391; KEGG: abu:Abu_0031
FT                   hypothetical protein; PFAM: SurA domain; SPTR: A8EQS9
FT                   Putative uncharacterized protein; PFAM: SurA N-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91786"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:D5V453"
FT                   /protein_id="ADG91786.1"
FT                   /translation="MKDKQIKLFAKRVLFTLMATFTFSNAQMIDALALTVNDEPITTSD
FT                   INQKMAETHLKKADAVSELIDQILYKQELEKQNITVDIFEVNDYLEKLAASNGMDLYTF
FT                   KSILRQKNKNFDEFEAQTKKELMKKKLAAKLIRGNIPVATEEDLKIYYDNNKSMFTTAS
FT                   KINVTQYASKNKRSLIIMSQNPMALLNDVVKKDFTLEQDKLNPQLKFLLNDTKDGSFTP
FT                   IFTADRTFVMFFVKSKSGVTTLKFDEVKEKIFNALMGEREQKFLKEYFEKLKLTADIKV
FT                   IR"
FT   sig_peptide     complement(109823..109900)
FT                   /locus_tag="Arnit_0119"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(109976..112807)
FT                   /locus_tag="Arnit_0120"
FT   CDS_pept        complement(109976..112807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0120"
FT                   /product="D-lactate dehydrogenase (cytochrome)"
FT                   /EC_number="1.1.2.4"
FT                   /note="COGs: COG0277 FAD/FMN-containing dehydrogenase;
FT                   InterProIPR016166:IPR016164:IPR009051:IPR017900:IPR
FT                   016167:IPR012285:IPR017896:IPR006094:IPR004113:IPR001450;
FT                   KEGG: abu:Abu_0032 oxidoreductase, FAD-binding/iron-sulfur
FT                   cluster-binding protein; PFAM: FAD linked oxidase domain
FT                   protein; 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; PRIAM: D-lactate dehydrogenase (cytochrome); SPTR:
FT                   A8EQR2 Oxidoreductase, FAD-binding/iron-sulfur
FT                   cluster-binding protein; PFAM: FAD binding domain; FAD
FT                   linked oxidases, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91787"
FT                   /db_xref="GOA:D5V454"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D5V454"
FT                   /protein_id="ADG91787.1"
FT                   /translation="MLEGKYKDFLESISKDIEHNRIFTDKLHTLVYGTDASFYRLLPKI
FT                   VIKADNSNEVQVIIKEAYKRELPITFRAGGTSLSGQAISDSILIITSRKFTNFKLAEDK
FT                   SYISLEPAITGEQANNILKEFNKKIGPDPASINAAMIGGIAANNASGMCCGTAQNSYKT
FT                   LKSIKLIMADGTRLDTASEKSKKEFKKEHGKLLNDLKELAKITKDNKELSKLIEKKYKI
FT                   KNTCGYSLNALIDYEDEFDILSHLIIGSEGTLAFIEEVTYNTVEDYPNKASALIFFENI
FT                   KDACDAVAKIKLAKDDKKIVVDAVELMDNKALKSVQDKEGMPEYLKEFNNEVTALLVET
FT                   RASKKTLLTKQTKEIETLLSEFTTVREIEFTSKVEEYTLFWKIRKGLFPAVGAVRKIGT
FT                   TVIIEDVAYPIESLSEATLELQSLFEKHGYHEALIFGHALDGNFHFVFTQDFNDEKEIK
FT                   RYDEFMNDVTNSVALKYQGSLKAEHGTGRNMAAFIELEWGKAAFNMMESIKNIFDPSGI
FT                   LNPGVIINHDKQAHLKNLKPLPQTNDLVDTCIECGFCEPMCPSNAITFTPRHRIVANRE
FT                   ISRLESIGEQKEADELKEAYVYDGIETCATCSLCSTACPVGIDTGALTKYLRHERITPT
FT                   QDKIATFIANNFSTTLSGMRVGLKGANLVHNIVGTSLMSGMTSSFRKLLGTPKWSPTLP
FT                   SGLSINKKFVNKASDKKVVYFPSCLSRTMGQSSFSQEEKNLYDTTVEVLQKAGFEIILP
FT                   KELEELCCGMPFSSKGFKKQAEHKSIQLEQALIDASANGEYPILCDTSPCTKKMHESFI
FT                   SDIKIYEPIEFCLDYVVNELELTKIDEPITIHSTCSSRKMGIHEKFINLAKLCANEVIV
FT                   PTDVKCCGFAGDRGFNFPELNDSALNKLKEQTSKAKLAFSTSKTCEIGLSEHSGLDYNS
FT                   ILYLVNRCSSTKV"
FT   gene            complement(112858..112971)
FT                   /locus_tag="Arnit_0121"
FT   CDS_pept        complement(112858..112971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91788"
FT                   /db_xref="UniProtKB/TrEMBL:D5V455"
FT                   /protein_id="ADG91788.1"
FT                   /translation="MSQFLELLLNIILKHSDIMHSFINDPQQRIYTVPRLE"
FT   gene            complement(112984..114345)
FT                   /locus_tag="Arnit_0122"
FT   CDS_pept        complement(112984..114345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0122"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="COGs: COG4664 TRAP-type mannitol/chloroaromatic
FT                   compound transport system large permease component;
FT                   InterPro IPR010656:IPR004681; KEGG: pin:Ping_3148 TRAP
FT                   dicarboxylate transporter, DctM subunit; PFAM: TRAP
FT                   C4-dicarboxylate transport system permease DctM subunit;
FT                   SPTR: A1SZC1 TRAP dicarboxylate transporter, DctM subunit;
FT                   TIGRFAM: TRAP dicarboxylate transporter, DctM subunit;
FT                   PFAM: DctM-like transporters; TIGRFAM: TRAP transporter,
FT                   DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91789"
FT                   /db_xref="GOA:D5V456"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:D5V456"
FT                   /protein_id="ADG91789.1"
FT                   /translation="MIGVVMFFTALFMLLIGFPVAFTFGAVSVFFGLIAGIVEIGFDGS
FT                   LHSLIEGLHEGVLMFDYMPFRIYAIQQNTILMAIPMFIFMGIVLQKTGLAEKLLESMGF
FT                   LFGEVRGGVAISTVLVGTLLAASTGVVGASVVAMGVISLPVMMKYKYNVPLAAGTICAS
FT                   GTLGQIIPPSLVLIILGDVFQVPVGDLFSSAVWPGLALVVAYILFILIVSYFKKDMAPA
FT                   IPKHADMGTKKQQIVQALIAIIPSLTLIVLVLGSIFEGVATPTESAAVGCLGAIFLSLM
FT                   YRTFTTAMVKEAALESVKITSMVFAILIGATAFSMVFSYTGGEDIVHDFMLNLPGGDGK
FT                   WSFIIFTMLAILFLGFFIDFIEISYIIVPILIPVSQTLGIDPVWFAILIAMNLQTSFLT
FT                   PPFGFALFYLKGCAPDGVRTIDIYKGVLPFILIQIIVLALVAFYPQIFGMSITN"
FT   sig_peptide     complement(114271..114345)
FT                   /locus_tag="Arnit_0122"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(114342..114950)
FT                   /locus_tag="Arnit_0123"
FT   CDS_pept        complement(114342..114950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0123"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter DctQ component"
FT                   /note="COGs: COG4665 TRAP-type mannitol/chloroaromatic
FT                   compound transport system small permease component;
FT                   InterPro IPR007387; KEGG: pin:Ping_3149 tripartite
FT                   ATP-independent periplasmic transporter DctQ; PFAM:
FT                   Tripartite ATP-independent periplasmic transporter DctQ
FT                   component; SPTR: A1SZC2 Tripartite ATP-independent
FT                   periplasmic transporter, DctQ component; PFAM: Tripartite
FT                   ATP-independent periplasmic transporters, DctQ component"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91790"
FT                   /db_xref="GOA:D5V457"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:D5V457"
FT                   /protein_id="ADG91790.1"
FT                   /translation="MLLKLEKGFDKFADFIGTITSFTIVLMILNVFYDVIMRYFFRDGS
FT                   IAMQEMEWHLFSVVILLGMSYTLKEDGHVRVDLIYDRLTDRKKAMINMVGVITFILPIA
FT                   ILVGLSSINNAHEAYLSMEQSGDPGGLPYRWIVKSLIPLSFLLLIITSIGYFIKNLNIY
FT                   KGLHPSDDYNLKGEISNLKCDLEQHKFHTIDIDERGDSK"
FT   gene            complement(115060..116133)
FT                   /locus_tag="Arnit_0124"
FT   CDS_pept        complement(115060..116133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0124"
FT                   /product="Extracellular solute-binding protein, family 7"
FT                   /note="COGs: COG4663 TRAP-type mannitol/chloroaromatic
FT                   compound transport system periplasmic component; InterPro
FT                   IPR018389; KEGG: pin:Ping_3150 TRAP dicarboxylate
FT                   transporter-DctP subunit; PFAM: Extracellular
FT                   solute-binding protein, family 7; SPTR: A1SZC3 TRAP
FT                   dicarboxylate transporter-DctP subunit; PFAM: Bacterial
FT                   extracellular solute-binding protein, family 7"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91791"
FT                   /db_xref="GOA:D5V458"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR026289"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:D5V458"
FT                   /protein_id="ADG91791.1"
FT                   /translation="MKMFSKTTKLLVASVVLAGLSTASLAADKVYKWKLATTWGPTLHP
FT                   FIDAPTKMAEMVEKMSNGRLLIRVDAANKHKAPFGVLDMVQGGQYEMGHSASYYWKGKD
FT                   INLLPFTTMPFGMTAPEQYAWFYYGGGMELMEKAYAPHKMLSFPGGNTGAQMGGWFRKE
FT                   IKTLDDLKGLKMRIPGFAGEIMAKLGLTVTNIAPGELYTSLERGTIDALEWVGPGMDIN
FT                   MGFHKIAPYYYTGWHEPATELQFLVNKRAYDKLPKDLQAILVTAMKLSSYDMYIQNYDM
FT                   SATAWEKMKKDYPNIKVETFPKPVMDAMKKANQELRKEMVVGHPLLKEVLDSQEAYQKK
FT                   VREWTKMSDYLYLKDNL"
FT   sig_peptide     complement(116056..116133)
FT                   /locus_tag="Arnit_0124"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(116228..116869)
FT                   /locus_tag="Arnit_0125"
FT   CDS_pept        complement(116228..116869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0125"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="COGs: COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain; InterProIPR011006:IPR016032:IPR011991:IPR001789:IPR
FT                   001867; KEGG: abu:Abu_0034 two-component response
FT                   regulator; PFAM: response regulator receiver;
FT                   transcriptional regulator domain protein; SMART: response
FT                   regulator receiver; SPTR: A8EQR4 Two-component response
FT                   regulator; PFAM: Response regulator receiver domain;
FT                   Transcriptional regulatory protein, C terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91792"
FT                   /db_xref="GOA:D5V459"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D5V459"
FT                   /protein_id="ADG91792.1"
FT                   /translation="MKILLLEDNTKLSQTISKRLALKGYKVDSFSDGQKAYDSISNGYN
FT                   CFLLDINVPNIDGIKILKKIRDYYTEVPIIIISSTVELDIIKEAYDYGCNDYLKKPFFI
FT                   DELEIKIEKLCKITNTIIMFDQNYYFDFKSSLLKIEDQEVRLTKKERLLLNLFVTKKNE
FT                   VITYVAIENYVWEGNFVTLESIRSLIRRLRKILIKDYIHTVVDTGYIFKI"
FT   gene            complement(116869..119067)
FT                   /locus_tag="Arnit_0126"
FT   CDS_pept        complement(116869..119067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0126"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="COGs: COG4191 Signal transduction histidine kinase
FT                   regulating C4-dicarboxylate transport system;
FT                   InterProIPR004358:IPR003594:IPR000014:IPR005467:IPR
FT                   000700:IPR013656; KEGG: abu:Abu_0035 two-component sensor
FT                   histidine kinase; PFAM: ATP-binding region ATPase domain
FT                   protein; PAS fold-4 domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; PAS domain containing
FT                   protein; SPTR: A8EQR5 Two-component sensor histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: ABC transporter
FT                   substrate binding protein; Histidine kinase-, DNA gyrase
FT                   B-, and HSP90-like ATPase; PAS fold; TIGRFAM: PAS domain
FT                   S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91793"
FT                   /db_xref="GOA:D5V460"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5V460"
FT                   /protein_id="ADG91793.1"
FT                   /translation="MKKLLLLYFLIFVTFSFAIDNNKEVLLLHSYHKGYKWSDDISKAI
FT                   EDKFASHGNIELTTRYMDTKRVLGNTYFDELAELYKTQFANRKFDLIIVSDNNAFEFII
FT                   KYHDVLFPKTPVLFCGINNFDKALLDENNIKEYMSGVVEQVDLENNFKLIHKLHPKMKN
FT                   LVIINDKSKTGYAIKRDLRPIIKKYKDEFHVEYIDQWDMETLKKKVKNLDKNDVLLFVL
FT                   LFKDKTGKNFTYKEGLKQVKSISHNPIYGLWDFYLNYGIVGGLVTSATAQGNSVADMAL
FT                   QVLNGKDIKDIPILEKSPNRYIFDYNELKKFDISLNNIHEKYTILNEPSSFYKKYTKFI
FT                   VIVFSIIFILSIMVISMRANIQRRKKLENDLSNRLKFEKVLLDTLPNAIYYKNKDGKFI
FT                   GSNLAFAKLFNITKQEVIGKTAFDFFPKDIAIKNIEIDEKIQKSQETDTSEIVLHFANL
FT                   QMKYFILNKAPYENINGEVGGIVCIMDDITERVQQKQFLIQQTKLAEMGDMVAAIAHQW
FT                   NEPLVELSALVQDIQTSHMLEELQTQDVESFVKSSMVQIQYMSQTLSDFRNFLKPSTKK
FT                   TNFSVKQSFDDILEIVGKQLFYLNIKIDINYQKKNDEFVVYGYKNEFKQVLLNLVNNAK
FT                   NKISEKSLENRCKIMVNVYTNNNYTIIEVIDDAGGIDEKIIHSIFDPYFTTKKDGTGIG
FT                   LYMAKVIIEDKMKGQMFVKNDENKVIFTMKIPKMKKVL"
FT   sig_peptide     complement(119014..119067)
FT                   /locus_tag="Arnit_0126"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(119086..119673)
FT                   /locus_tag="Arnit_0127"
FT   CDS_pept        complement(119086..119673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0127"
FT                   /product="protein of unknown function DUF162"
FT                   /note="COGs: COG1556 conserved hypothetical protein;
FT                   InterPro IPR003741; KEGG: abu:Abu_0036 hypothetical
FT                   protein; PFAM: protein of unknown function DUF162; SPTR:
FT                   A8EQR6 Putative uncharacterized protein; PFAM:
FT                   Uncharacterised ACR, YkgG family COG1556"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91794"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D5V461"
FT                   /protein_id="ADG91794.1"
FT                   /translation="MSSRDEILNAIKSNNVVKDEILPEYDHFGITFENKLEKYGQVLKT
FT                   VGGESLVTTKDKLDETIKDLYKEGLGQVYSNVEFCSLSNFDANAQDDAHNLKDIDLAIV
FT                   KGNFAVAENGAVWLKDENNRHRSLYFIAQNIIIVVNKNDIVNNMHEAYTKIEFENSGYG
FT                   VFVSGPSKTADIEQSLVIGAHGPKSGYVIFVD"
FT   gene            complement(119673..121037)
FT                   /locus_tag="Arnit_0128"
FT   CDS_pept        complement(119673..121037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0128"
FT                   /product="protein of unknown function DUF162"
FT                   /note="COGs: COG1139 conserved hypothetical protein
FT                   containing a ferredoxin-like domain;
FT                   InterProIPR009051:IPR017900:IPR012285:IPR017896:IPR 003741;
FT                   KEGG: abu:Abu_0037 iron-sulfur cluster binding protein,
FT                   putative; PFAM: protein of unknown function DUF162; SPTR:
FT                   A8EQR7 Iron-sulfur cluster binding protein, putative; PFAM:
FT                   Uncharacterised ACR, YkgG family COG1556; TIGRFAM:
FT                   2[4Fe-4S] protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91795"
FT                   /db_xref="GOA:D5V462"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR024569"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D5V462"
FT                   /protein_id="ADG91795.1"
FT                   /translation="MSHPEEAAKFVANDERMHWHDKALWFVREKRDVSSKGIPEWEKLR
FT                   EYANNIKTHTMHKLDFYLEEFEKNATKKGIIVHWAKDAQEHNKIVHEILASHNVTKLVK
FT                   SKSMLTEECHLNPYLESKGIEVIDTDLGERIVQLRKETPSHIVLPAIHLKKMDVSDTFH
FT                   EHLGTEKGNDDPTYLTRAARASLREDFLTAQAGLTGVNFAISETGGIVVCTNEGNADMG
FT                   ASVPKLHIASMGIEKTIPRLKDLSVFTRLLARSATGQAITSYTSHYHGPVEGGEMHIVI
FT                   VDNKRTPILADATYQKSLNCIRCGACMNTCPIYRRSGGHSYKYVIPGPIGSNLGAFRNP
FT                   KEHKSLPFACTLCASCTNVCPVKIDLDSQLYAHRQDLAKKHLIDTKKAVAMKITSWVMD
FT                   HPTLFNIGGKIMRKVIPMLPDSIIYSKANVWGKQRDIPKMPKNSFKELYKQRKDS"
FT   gene            complement(121034..121777)
FT                   /locus_tag="Arnit_0129"
FT   CDS_pept        complement(121034..121777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0129"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="COGs: COG0247 Fe-S oxidoreductase; InterPro
FT                   IPR004017; KEGG: abu:Abu_0038 Fe-S oxidoreductase; PFAM:
FT                   protein of unknown function DUF224 cysteine-rich region
FT                   domain protein; SPTR: A8EQR8 Fe-S oxidoreductase; PFAM:
FT                   Cysteine-rich domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91796"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:D5V463"
FT                   /protein_id="ADG91796.1"
FT                   /translation="MTIGLFIPCFMNELYPEASMATLKLLEKLKFNVEYPMEQTCCGQP
FT                   MANSGCSQDIEKLAHRFVNTFKKYDYVVAPSGSCVTMVKEHYEPFFNDNKDYNKIKTSI
FT                   YEITEFLHDIAKIDKLDSKFNYKVGVHNSCHGHRVLKLGSASELNIPHFNKLENLLSLV
FT                   EGIELVKLNREDECCGFGGTFCVTEEAISVAMGKDRIKDHMDSNVQIMTGADMSCLMHM
FT                   QGIMNRDKNPIKVMHISEILLGETI"
FT   gene            complement(121837..122406)
FT                   /locus_tag="Arnit_0130"
FT   CDS_pept        complement(121837..122406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0130"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0164 hypothetical protein; SPTR:
FT                   C2A059 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91797"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5V464"
FT                   /protein_id="ADG91797.1"
FT                   /translation="MAHKDNKTFYDKTIKKYGISARGVHWNSEYTQYKRFEILTEFIKD
FT                   EIKDSNIIDAGCGFGEYYNYLFDNSLKPKSYIGIDCEKQMIELASKRFLNTKFYLADIL
FT                   LDELEEADYYICSGALSILTKNEIFTFINKCFSASKKGFIFNFLKNDSLTNIKAEDILL
FT                   YVKTLSKIITIKDNYLYNDFSVFMKK"
FT   gene            complement(122407..122841)
FT                   /locus_tag="Arnit_0131"
FT   CDS_pept        complement(122407..122841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0131"
FT                   /product="CMP/dCMP deaminase zinc-binding protein"
FT                   /note="COGs: COG2131 Deoxycytidylate deaminase; InterPro
FT                   IPR016193:IPR016192:IPR016473:IPR002125; KEGG:
FT                   tdn:Suden_0147 CMP/dCMP deaminase, zinc-binding; PFAM:
FT                   CMP/dCMP deaminase zinc-binding; SPTR: Q30UA3 CMP/dCMP
FT                   deaminase, zinc-binding; PFAM: Cytidine and deoxycytidylate
FT                   deaminase zinc-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91798"
FT                   /db_xref="GOA:D5V465"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="InterPro:IPR035105"
FT                   /db_xref="UniProtKB/TrEMBL:D5V465"
FT                   /protein_id="ADG91798.1"
FT                   /translation="MISDKNFINIAHEIASASKCVSKQVGAVIVKDGRILSTGYNGTPA
FT                   GYVNCKEHWNDSYTKEHHDWSKTYEIHAEMNAIIWAARKGISIEGATIYVTLEPCSECS
FT                   KNLIAAGIQRIVFQKAYEHTDSDIVSKFLKDNKVIIEQIS"
FT   gene            123035..123487
FT                   /locus_tag="Arnit_0132"
FT   CDS_pept        123035..123487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0132"
FT                   /product="acetyl-CoA carboxylase, biotin carboxyl carrier
FT                   protein"
FT                   /note="COGs: COG0511 Biotin carboxyl carrier protein;
FT                   InterPro IPR001249:IPR011053:IPR000089; KEGG: abu:Abu_0040
FT                   acetyl-CoA carboxylase, biotin carboxyl carrier protein;
FT                   PFAM: biotin/lipoyl attachment domain-containing protein;
FT                   SPTR: A8EQV1 Acetyl-CoA carboxylase, biotin carboxyl
FT                   carrier protein; TIGRFAM: acetyl-CoA carboxylase, biotin
FT                   carboxyl carrier protein; PFAM: Biotin-requiring enzyme;
FT                   TIGRFAM: acetyl-CoA carboxylase, biotin carboxyl carrier
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91799"
FT                   /db_xref="GOA:D5V466"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:D5V466"
FT                   /protein_id="ADG91799.1"
FT                   /translation="MEFKDIKELIRVFDKSDLNKLKIKDGEFEISMQTGFDGGSIVTTT
FT                   APAVQSAPAPVATTTSVTAETAAPIIGDTINSPMIGTFYASPSPESAAFVKVGDTVKAG
FT                   QTLCILEAMKIMNEVEAEFDCKIVKVLVEDSNPVEYDMPLFVVEKL"
FT   gene            123500..124852
FT                   /locus_tag="Arnit_0133"
FT   CDS_pept        123500..124852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0133"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase"
FT                   /EC_number="6.3.4.14"
FT                   /note="COGs: COG0439 Biotin carboxylase;
FT                   InterProIPR011054:IPR016185:IPR005479:IPR013817:IPR
FT                   013816:IPR011761:IPR011764:IPR005481:IPR005482:IPR004549;
FT                   KEGG: abu:Abu_0041 biotin carboxylase; PFAM:
FT                   Carbamoyl-phosphate synthase L chain ATP-binding;
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   biotin carboxylase domain protein; SPTR: A8EQV2 Acetyl CoA
FT                   carboxylase, biotin carboxylase subunit; TIGRFAM:
FT                   acetyl-CoA carboxylase, biotin carboxylase; PFAM:
FT                   Carbamoyl-phosphate synthase L chain, ATP binding domain;
FT                   Biotin carboxylase C-terminal domain; Carbamoyl-phosphate
FT                   synthase L chain, N-terminal domain; TIGRFAM: acetyl-CoA
FT                   carboxylase, biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91800"
FT                   /db_xref="GOA:D5V467"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D5V467"
FT                   /protein_id="ADG91800.1"
FT                   /translation="MAEIKKILIANRGEIVQRAVRTIREMGKKSVAIYSAGDKEASYLK
FT                   HADEAVCIGGAKSSESYLNIPAIITAAEMTGCDAIFPGYGFLSENQDFVEICRLHNIKF
FT                   IGPSVEVMEKMADKSKAKEEMVRAGVPVVPGSTGAVHNVDEGRKVAREIGYPIMAKASA
FT                   GGGGRGMRLIESEDKFDQLFTAASSEALAAFGDGTMYLERFINNPRHIEVQVVGDSHGN
FT                   AIHIGERDCSLQRRHQKVIEESPAIILNDETRAKLHAVAVKATKYLNYEGAGTFEFLAD
FT                   DKQNIYFMEMNTRLQVEHPVSEMVSGIDIVELMIKVAEGEEVPPQETIKFRGHAIECRI
FT                   TAEDPNTFLPSPGKITQWMVPGGRNVRVDSHIYTNYIVPPYYDSMIGKLIVWGRDREKA
FT                   IKIMKRALNEFEVYGIKTTIPFHIKMMGNKDFNNNTYDTKYLEHYKGLGDI"
FT   gene            125045..126511
FT                   /locus_tag="Arnit_0134"
FT   CDS_pept        125045..126511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0134"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="COGs: COG0513 Superfamily II DNA and RNA helicase;
FT                   InterProIPR000629:IPR014001:IPR001650:IPR014021:IPR
FT                   014014:IPR011545; KEGG: abu:Abu_0042 DEAD-box ATP dependent
FT                   DNA helicase; PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; SMART: DEAD-like helicase;
FT                   helicase domain protein; SPTR: A8EQV3 ATP-dependent RNA
FT                   helicase, DEAD box family; PFAM: Helicase conserved
FT                   C-terminal domain; DEAD/DEAH box helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91801"
FT                   /db_xref="GOA:D5V468"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5V468"
FT                   /protein_id="ADG91801.1"
FT                   /translation="MTFKDFNFKENLQRAIEDAGFKEPSPIQQDAIPVVLSGKDMVGQA
FT                   QTGTGKTAAFGLPMINMMNGNSGVEAVVIVPTRELAMQVSDELFRFGKSSGMNTATVYG
FT                   GQSYNMQLRNIDRASIIVATPGRLIDLLKGKKIDIKPSFVVLDEADEMLDMGFLDDIKE
FT                   IFTYLPKERQTLLFSATMPPAIKKLAQNILKEPEFITVTKAEMTNSKITQLFYVVDEYE
FT                   RDDALIRLFDFKNPEKSIIFCRTKKEVDRLSTYLVSQGHMAKGLHGDMEQRQREEVIRS
FT                   FKKGALDVLIATDVAARGLDVNDVSHVFNYHLPFDSESYVHRIGRTGRAGKEGVAISIV
FT                   TPHEFRMIQKIQHVTGGKMEAKVIPNIDSVKEKKTSTLRGKISEQKVYDSGISLVESLK
FT                   EEFDLSTIAFKLASILSDATIVKGNNYIGKSEIDIKKLFERLKDDKGDDRNRGGQRRGR
FT                   FGGGNRNRNGGGGNRSRSGGDRNGGGRRRD"
FT   gene            complement(126593..126733)
FT                   /locus_tag="Arnit_0135"
FT   CDS_pept        complement(126593..126733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91802"
FT                   /db_xref="UniProtKB/TrEMBL:D5V469"
FT                   /protein_id="ADG91802.1"
FT                   /translation="MTIKVITENEFPKVSKMKKKFNIFSVVGIKNGELESVEFFWEKWS
FT                   V"
FT   gene            126973..128553
FT                   /locus_tag="Arnit_0136"
FT   CDS_pept        126973..128553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0136"
FT                   /product="phosphate transporter"
FT                   /note="COGs: COG0306 Phosphate/sulphate permease; InterPro
FT                   IPR001204; KEGG: abu:Abu_0043 phosphate permease, putative;
FT                   PFAM: phosphate transporter; SPTR: A8EQV4 Phosphate
FT                   permease, putative; PFAM: Phosphate transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91803"
FT                   /db_xref="GOA:D5V470"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:D5V470"
FT                   /protein_id="ADG91803.1"
FT                   /translation="MDFNTIKRMDEARDKSLPSFAKLSLALLFIVIVFLWSYSSHEELP
FT                   NNSFLIIGAVFGAYMAMNIGANDVANNVGPAVGAKAMTLMWAIVIAAIFEALGALVAGG
FT                   DVVNTIKKGIINPDLIDNPQIFVWAMTAALLSAALWLNFATSIGAPVSTTHSIVGGVMG
FT                   AGIAAAGFDIVSWETMGKIAASWVISPILGGIIAALFLYFIKKNIMFKDEKLTSAKKFV
FT                   PLLIAFMTWAFSTYIILKGLKHLIKVDFITALILGFIISIIVFVLVKPMIAKKSSKLLD
FT                   DRISVNSLFNIPLIFAAALLSFAHGANDVANSIGPLAAINDAVMNATISSKVGIPLWVM
FT                   AVGAFGIAIGLALYGPRLIKTVGSEITELDQVRAFSIAMAAAITVILASQLGLPVSSTH
FT                   IAVGGVFGVGFLREWLDSSEEKFLKEIRGKFKKDKSLLDKYQLELSQLAAKDSKSKVDY
FT                   KRIVELYNLIDEKDERVRLEKKEFKTAKRIKYVKRDAIKKIIAAWIITVPAAAFVSATI
FT                   FFMIKGMML"
FT   gene            128619..129536
FT                   /locus_tag="Arnit_0137"
FT   CDS_pept        128619..129536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0137"
FT                   /product="Auxin Efflux Carrier"
FT                   /note="COGs: COG0679 permease; InterPro IPR004776; KEGG:
FT                   nis:NIS_1317 hypothetical protein; PFAM: Auxin Efflux
FT                   Carrier; SPTR: A6Q4L6 Putative uncharacterized protein;
FT                   PFAM: Membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91804"
FT                   /db_xref="GOA:D5V471"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:D5V471"
FT                   /protein_id="ADG91804.1"
FT                   /translation="MQALISVATIYLFILIGFVFKKSFKGEVNERTLVLLNLYFLQPLL
FT                   VFWGLTRAPITEEFLLTPVVSGLSLLLVLVILYLYSLKFFKNDVQDKSIFLASSLVGNT
FT                   GNLGIPLGIAIFGLQSVPYTSIINIVNVFYMYIFSIYFFTGEKFSIKSSLKAIFKMPAI
FT                   HVTFIALLFNYYDFHINSDFEKFFTMGAYTAIVMQLIIFGIFMSDVKIKSANWHLALNI
FT                   SLFKHFILPSVGLCVIFLFDLPPLVSAIIFMELFVPLAVNNVNLASLYKCKPVDATFSV
FT                   LVSSFIFVILTYGYILLINYFFGL"
FT   gene            129538..131319
FT                   /locus_tag="Arnit_0138"
FT   CDS_pept        129538..131319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0138"
FT                   /product="asparagine synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.4"
FT                   /note="COGs: COG0367 Asparagine synthase
FT                   (glutamine-hydrolyzing);
FT                   InterProIPR014729:IPR017932:IPR000583:IPR001962:IPR 006426;
FT                   KEGG: abu:Abu_0045 asparagine synthetase
FT                   (glutamine-hydrolyzing); PFAM: asparagine synthase;
FT                   glutamine amidotransferase class-II; PRIAM: Asparagine
FT                   synthase (glutamine-hydrolyzing); SPTR: A8EQV6 Asparagine
FT                   synthetase (Glutamine-hydrolyzing); TIGRFAM: asparagine
FT                   synthase (glutamine-hydrolyzing); PFAM: Asparagine
FT                   synthase; TIGRFAM: asparagine synthase
FT                   (glutamine-hydrolyzing)"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91805"
FT                   /db_xref="GOA:D5V472"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:D5V472"
FT                   /protein_id="ADG91805.1"
FT                   /translation="MCGILGSNFISNNFDSALSLMNNRGPDYSKVFAHKNYQFGHTRLS
FT                   IIDVDDEANQPMIFDDILIVFNGEIYNYKELIKSENLLCSTSSDTEVIIRLYQKYGIDF
FT                   LNKLNGMFSFVIFDLKQEKYFCARDRYGKKPFFYYFKDNKFIFSSSIKSIIKILGFTPK
FT                   LNKVALSQYLQYFVSLNDMTFYNDINKLEASSYMLLSSNELFIKKYYKINTYKKVVDEK
FT                   QALNDIEELLFKSVESRLVGDVEVGSLLSGGIDSSFISSLYTNITGKRINTFSVGYSDH
FT                   ISYSELDYASLVSKDINSIHHPLEVSRNDFIDVFDEVIDALEEPHADSAAFPLYCLTKL
FT                   INKKGIKVVLSGEGSDELFLGYDNYSKFLKYYKFKESLSADQDGFLKDIISALQNNTKE
FT                   SEYLRRVVTDENIYNSFGEIYTTIQKKRLFKRLPTFKQEKAKKDPVDWMSYIDLKIWLG
FT                   QSLLSKVDRISMANSIEVRTPFLDFRLVDYLFSVDTKLKTGDTNKYLLKKIASKYIPEK
FT                   IINRTKKGFNSPYNEWIFNSHGEDLLKTILNVNYQTNLFNEDYVIMIYNLAKKNKFKQH
FT                   FWSLYIFSYWFNKNYLI"
FT   gene            131330..131635
FT                   /locus_tag="Arnit_0139"
FT   CDS_pept        131330..131635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0139"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1937 hypothetical protein; SPTR:
FT                   Q30P70 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91806"
FT                   /db_xref="UniProtKB/TrEMBL:D5V473"
FT                   /protein_id="ADG91806.1"
FT                   /translation="MTLLIPTDSNNRHECIISSIEENNSWAYVILNDGQIISCDFFDRK
FT                   EDVIEWIDYVIVLNDKEYIWPFLNEKTKVLISNNEKSIDELIESFLLNKLTLYTQN"
FT   gene            131759..132022
FT                   /locus_tag="Arnit_0140"
FT   CDS_pept        131759..132022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0140"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: Q231E8 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91807"
FT                   /db_xref="UniProtKB/TrEMBL:D5V474"
FT                   /protein_id="ADG91807.1"
FT                   /translation="MEKRKVGRPIQKIGRVKIGMSIDGKTNDYLTELSINSGKTKSKII
FT                   EESIALYYENNKELQDKIILANKMKDDPYFHFRDVLKKSLDK"
FT   gene            complement(132023..132763)
FT                   /locus_tag="Arnit_0141"
FT   CDS_pept        complement(132023..132763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0141"
FT                   /product="succinate dehydrogenase and fumarate reductase
FT                   iron-sulfur protein"
FT                   /note="COGs: COG0479 Succinate dehydrogenase/fumarate
FT                   reductase Fe-S protein subunit;
FT                   InterProIPR009051:IPR001041:IPR006058:IPR017900:IPR
FT                   012675:IPR012285:IPR017896:IPR004489; KEGG: tdn:Suden_0038
FT                   succinate dehydrogenase/fumarate reductase iron-sulfur
FT                   protein; PFAM: ferredoxin; SPTR: B6BH33 Fumarate reductase
FT                   iron-sulfur protein; TIGRFAM: succinate dehydrogenase and
FT                   fumarate reductase iron-sulfur protein; TIGRFAM: succinate
FT                   dehydrogenase and fumarate reductase iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91808"
FT                   /db_xref="GOA:D5V475"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:D5V475"
FT                   /protein_id="ADG91808.1"
FT                   /translation="MNISINRLKDKEKYIEEYKINKENITALEALEYIKENIDSTLTYR
FT                   SGCKSGICGSCSILINDKEVLACKCKLYENITVKPLKNSTIIKDLVVDLEQTGKLLTKS
FT                   KAFIEEFQESAIKKEDEKLIDLQSNCILCQNCYSSCPVYGVNKDFLGPFALTRVLRYVN
FT                   DKKEANKAQKLDAIQVNGIWDCTLCGNCTISCPQFIDSKTDIMNLRMKSIQNGYSDPTI
FT                   QSNDFLNEFNNYNDFDTGFNPNSF"
FT   gene            complement(132760..134349)
FT                   /locus_tag="Arnit_0142"
FT   CDS_pept        complement(132760..134349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0142"
FT                   /product="Succinate dehydrogenase (ubiquinone)"
FT                   /EC_number="1.3.5.1"
FT                   /note="COGs: COG1053 Succinate dehydrogenase/fumarate
FT                   reductase flavoprotein subunit; InterPro
FT                   IPR013027:IPR015939:IPR003953:IPR004112; KEGG:
FT                   tdn:Suden_0037 succinate dehydrogenase/fumarate reductase
FT                   flavoprotein subunit; PFAM: fumarate reductase/succinate
FT                   dehydrogenase flavoprotein domain protein; PRIAM: Succinate
FT                   dehydrogenase (ubiquinone); SPTR: Q30UL3 Succinate
FT                   dehydrogenase/fumarate reductase flavoprotein subunit;
FT                   PFAM: domain; FAD binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91809"
FT                   /db_xref="GOA:D5V476"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:D5V476"
FT                   /protein_id="ADG91809.1"
FT                   /translation="MYDVIIIGSGGAGLSAALSAKEKTNKVLVISKTYPTHSQTVQAQG
FT                   GINCVLDYENDSISNHLTDTYKSSKQLGNIKTIKKMCESAQETITWLDRLGVPFSRDTS
FT                   GNIAQRYFGGTKAKRTCYSSDYTGLKIIHTLYDNCIKKDIEFLNEHSLIDLIIKNKKYL
FT                   GINVFNLLNGEEISLYSKTLIIATGGYGNIYSTHTTNSISTTGDGLAIAFKHGIKLSNL
FT                   EFIQFHPTALKGTNTLISESARAEGAFLIDDEGKRFVDELTTRDEVARAIKKKIDNGEN
FT                   VYLDMRHININIIKEKMPQEKKLIKDIMNLDLHKDLIPIVPAVHYTMGGILTNVSCETS
FT                   IKDIFACGEVAQNNTHGANRLGGNSLLEIITFGKIAGSNAAEISLKKEIAIPKNIASNT
FT                   INSILKKKIGKSIYKIKNELSEAMFAYAGLYRTENDLDKLNLLIEKFEKEYKDSGIENK
FT                   SKRYNKNIIDYIELGNLLLLSKLVCQSALKRKESRGSHFRKDYEQINKEYQKISTFQNI
FT                   KGKSEFKLEEPL"
FT   sig_peptide     complement(134290..134349)
FT                   /locus_tag="Arnit_0142"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(134351..134770)
FT                   /locus_tag="Arnit_0143"
FT   CDS_pept        complement(134351..134770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0143"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: abu:Abu_0046 hypothetical protein; SPTR:
FT                   A8EQV7 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91810"
FT                   /db_xref="UniProtKB/TrEMBL:D5V477"
FT                   /protein_id="ADG91810.1"
FT                   /translation="MDKDVLKSLIQYKSNEMIPSTQLIRKSKLVFDSIQNKDIEKAVIL
FT                   RDGKPSFILMDFKKYEEIIDYFLNKNISIDSELELLEEINTKEKEVKISKEIKQDINKQ
FT                   KEEKKSSLLEKLDSIEGIINNDKTNVQENLKDFWE"
FT   gene            complement(134763..135692)
FT                   /locus_tag="Arnit_0144"
FT   CDS_pept        complement(134763..135692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0144"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="COGs: COG1052 Lactate dehydrogenase and related
FT                   dehydrogenase; InterPro IPR016040:IPR006140:IPR006139;
FT                   KEGG: abu:Abu_0274 D-isomer specific 2-hydroxyacid
FT                   dehydrogenase, NAD-binding; PFAM: D-isomer specific
FT                   2-hydroxyacid dehydrogenase NAD-binding; D-isomer specific
FT                   2-hydroxyacid dehydrogenase catalytic region; SPTR: A8ERH5
FT                   D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding;
FT                   PFAM: D-isomer specific 2-hydroxyacid dehydrogenase, NAD
FT                   binding domain; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase, catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91811"
FT                   /db_xref="GOA:D5V478"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5V478"
FT                   /protein_id="ADG91811.1"
FT                   /translation="MKVVILDRSTLGSDMDLSILNQFGELVCYDYTNDDETIARLKECD
FT                   IVITNKVLITKEVIDATELKLICISATGMNNVDIEYAKHKGIEVKNVAGYSTSSVAQLT
FT                   ISFALHFIQKMDYYSNYVKEGNWQKSKIFTHIDEPFMELDGKTWGIIGLGSIGEKVAQI
FT                   ASAFGCNIKYYSTSGMNYNANYDATDLASLISESDIISIHSPLNEKTKDLLNYENMKLL
FT                   KNDSIVINVARGGIINEYDIVEILKEKNIYFALDTVTTEPIEEDSPLNDILENENVIIT
FT                   PHIAWSSIEARKKLIEGVYNNIKGFIDG"
FT   gene            complement(135752..137170)
FT                   /locus_tag="Arnit_0145"
FT   CDS_pept        complement(135752..137170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0145"
FT                   /product="PhoH family protein"
FT                   /note="COGs: COG1875 ATPase related to phosphate
FT                   starvation-inducible protein PhoH; InterPro IPR003714;
FT                   KEGG: abu:Abu_0047 PhoH family protein; PFAM: PhoH family
FT                   protein; SPTR: A8EQV8 PhoH family protein; PFAM: PhoH-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91812"
FT                   /db_xref="GOA:D5V479"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D5V479"
FT                   /protein_id="ADG91812.1"
FT                   /translation="MHNDNFDKYYVLDTNILLEDANNIFKLSDDNKNLIILPETVLDEI
FT                   DAKKSGFEEINFQAREFARILENSTILFTKSEDDFKIVRLRIDNDCPISIDVISKLEYQ
FT                   FVTKTTAPNIANDRRILEIAKFTTKFYNKNSTFLSMDIMARTRAISLDIKAESLIGSNK
FT                   DEFIHEFIKTIQIKFEDLESIENRDIKELDSEYKVSNFSYCFKVKGSDQVVLASIQNEK
FT                   IRVLNEDEVRNQIIAPLNKEQLFFSNAIIQHYFNVLIIEAKAGSGKTLLALSGALKLVK
FT                   NKEYQRIIYIRNSIESLDKGEDVGYLPGLEEKFKIYNHPLMDSIDHIVRSEYKKRRATK
FT                   SKEEQEIDEQELKTRVDQMIQNYFIETMWVGEMRGRTLSNAFVIIDEAQNMSNKTMQMV
FT                   LSRIDNTCKVVILGSNKQIDNFYVNKYTNSLTTLLKSTKTESSLVNIFAIELQKVLRGP
FT                   ITEWAENIFSTKNK"
FT   gene            complement(137160..137681)
FT                   /locus_tag="Arnit_0146"
FT   CDS_pept        complement(137160..137681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0146"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG1981 membrane protein; InterPro
FT                   IPR005265:IPR014351; KEGG: abu:Abu_0048 hypothetical
FT                   protein; PFAM: conserved hypothetical protein; SPTR: A8EQV9
FT                   Conserved hypothetical integral membrane protein; PFAM:
FT                   Uncharacterised protein family (UPF0093); TIGRFAM:
FT                   conserved hypothetical integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91813"
FT                   /db_xref="GOA:D5V480"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:D5V480"
FT                   /protein_id="ADG91813.1"
FT                   /translation="MEYYSWILAFHVISVLSWMAMLFYLPRLFVYHVENSDKKDFVDVV
FT                   KIQEYKIYKYIGMPAMWTTIISGIAMIYLAPELFKSGAWLHAKLTVVFLLIIYSFSLEY
FT                   FRKQLEENKCKRSGKFFRAYNEIPTLFAILIVTYVVVKVVSVTFTLAMVLLFAFIIYMI
FT                   MKPKRVKNAQ"
FT   gene            complement(137682..138863)
FT                   /locus_tag="Arnit_0147"
FT   CDS_pept        complement(137682..138863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0147"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="COGs: COG2256 ATPase related to the helicase subunit
FT                   of the Holliday junction resolvase; InterPro
FT                   IPR003593:IPR003959; KEGG: abu:Abu_0049 recombination
FT                   factor protein RarA; PFAM: AAA ATPase central domain
FT                   protein; SMART: AAA ATPase; SPTR: A8EQW0 ATPase, AAA family
FT                   protein; PFAM: MgsA AAA+ ATPase C terminal; Holliday
FT                   junction DNA helicase ruvB N-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91814"
FT                   /db_xref="GOA:D5V481"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:D5V481"
FT                   /protein_id="ADG91814.1"
FT                   /translation="MTNLSSILRPNSLQDFVGQNHIISKNKVLYKLIIKGEIPHLFFYG
FT                   KPGTGKTTLAKIIAKTINTDYFYFNATSLKIEDLRKVFSKYDNSLIKPIVFIDEVHRLS
FT                   KNQQEVLLPIMENYQAIIIGASTENPFFTLTNAIRSRSFLFEFLPHSREDLTSILEVAQ
FT                   LKLGTKLSDETKEYLINSSSGDARAMLNLLEFAFKVDTNVSCETLKELRQNVIGDGVSS
FT                   SNTHYDLASAMIKSVRGSDIDAALYYLSRLIEGGESVEFITRRLVILASEDIGNANPNA
FT                   LNLAVSTMLATSKIGYPESRIILSQCVIYLASSPKSNSAYEAINKGISEVKNGKILDIP
FT                   KNIDSFHKDYLYPHNFGGYVEQKYLSEPLRLYDSKGIGFEKTLDDWIKKIKDK"
FT   gene            complement(138856..139656)
FT                   /locus_tag="Arnit_0148"
FT   CDS_pept        complement(138856..139656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0148"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="COGs: COG1187 16S rRNA uridine-516 pseudouridylate
FT                   synthase and related pseudouridylate synthase;
FT                   InterProIPR020103:IPR018496:IPR002942:IPR006145:IPR 000748;
FT                   KEGG: abu:Abu_0050 ribosomal large subunit pseudouridine
FT                   synthase B; PFAM: RNA-binding S4 domain protein;
FT                   pseudouridine synthase; SMART: RNA-binding S4 domain
FT                   protein; SPTR: A8EQW1 Pseudouridine synthase; PFAM: RNA
FT                   pseudouridylate synthase; S4 domain; TIGRFAM: pseudouridine
FT                   synthase family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91815"
FT                   /db_xref="GOA:D5V482"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:D5V482"
FT                   /protein_id="ADG91815.1"
FT                   /translation="MKNQPEAKEENTRLNKFISHNSKYSRREADAIIAEGRVKVNKKTI
FT                   TDLSTKVLDSDIVAIDNKPIKFEKNKMYTVLVYNKPKGELVTKNDPQGRRIIFDTLGAK
FT                   YKHFLPIGRLDYASEGVLLLTDSVDVANGLMHSDLQRVYKIKVSGPINKQVEDAMLHGL
FT                   ELEDATKGAWKDSKVKSMSFAPFLGYKIDSVKDTFSKLKVAITEGKNRELRRFFAHFGL
FT                   DVMDLKRVEYGGISLNNLPTGKSRYLTREEYKNLKDYLHTKDND"
FT   gene            complement(139662..140621)
FT                   /locus_tag="Arnit_0149"
FT   CDS_pept        complement(139662..140621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0149"
FT                   /product="KpsF/GutQ family protein"
FT                   /EC_number="5.3.1.13"
FT                   /note="COGs: COG0794 sugar phosphate isomerase involved in
FT                   capsule formation; InterPro
FT                   IPR003016:IPR000644:IPR001347:IPR004800; KEGG: abu:Abu_0051
FT                   carbohydrate isomerase KpsF/GutQ family protein; PFAM:
FT                   sugar isomerase (SIS); CBS domain containing protein;
FT                   PRIAM: Arabinose-5-phosphate isomerase; SMART: CBS domain
FT                   containing protein; SPTR: A8EQW2 Carbohydrate isomerase,
FT                   KpsF/GutQ family; TIGRFAM: KpsF/GutQ family protein; PFAM:
FT                   CBS domain; SIS domain; TIGRFAM: KpsF/GutQ family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91816"
FT                   /db_xref="GOA:D5V483"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:D5V483"
FT                   /protein_id="ADG91816.1"
FT                   /translation="MNYNEIAKEVLLTEAKELERASRDNSFDMNAAVELVYNTKGKLIV
FT                   TGVGKSGLVGTKIAATLASTGTSSFFLHPTEAMHGDLGMIGKDDTVLAISYSGESEELI
FT                   QILPHLKRFDIPMIAMAKNPNSTLAKYADIFFDINVTKEACPLDTAPTSSTTLTMAMGD
FT                   ALAVCLMKKRNFQKSDFASFHPGGSLGKKLFIKVSDLLRTEELPIVSRGTLLKDAIVRM
FT                   SEGRLGNVIITDDNEVIGLLSDGDLRRALMDDNFSLECKVEEIATMNPKVLNNKDLLAS
FT                   DALKIIEDYKIQLLVVVDDSNKLVGVLHIHDLIEAGIK"
FT   gene            complement(140631..142565)
FT                   /locus_tag="Arnit_0150"
FT   CDS_pept        complement(140631..142565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0150"
FT                   /product="RNA-metabolising metallo-beta-lactamase"
FT                   /note="COGs: COG0595 hydrolase of the
FT                   metallo-beta-lactamase superfamily; InterPro
FT                   IPR001587:IPR011108:IPR004613; KEGG: abu:Abu_0052
FT                   hypothetical protein; PFAM: RNA-metabolising
FT                   metallo-beta-lactamase; SPTR: A8EQW3 Putative
FT                   uncharacterized protein; PFAM: Metallo-beta-lactamase
FT                   superfamily; RNA-metabolising metallo-beta-lactamase;
FT                   TIGRFAM: conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91817"
FT                   /db_xref="GOA:D5V484"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001587"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041636"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:D5V484"
FT                   /protein_id="ADG91817.1"
FT                   /translation="MEENKTVQNDTQVVEKTAPEANNTTAKQETTGPSPKKPKPKRPVN
FT                   KRKKTVVPKMEDKSGEGWITDLRKAHVINERIHKERLNPHNKLNLSSTQKVRITPLGGL
FT                   GEIGGNMMVIETEKSAIIVDVGMSFPDEDMHGVDILIPDFTYIREIKDKIAAVIITHGH
FT                   EDHIGAMPYLFKEMQFPIYGTSLPLEMIGSKFDEHKMRQHRGYFHAIQKRTPIKIGDFE
FT                   IEWMHITHSIIDASSLAITTDAGTIIHTGDFKIDHTPIDGFPSDLHRFAHYGEKGVLLL
FT                   MSDSTNSHTAGFTKSESTVGPTFDTLFSKAKGRVIMSTFSSNTHRVAQAIEHGLKYGRK
FT                   VCVIGRSMEKNLELAMALGYIKFPRDQFIEPHEVHKYDDNQILIVTTGSQGESMSALYR
FT                   MSIHEHRHIKIKPGDQIILSAKAIPGNEASVSQIINHLLKAGAEVAYQNFSEIHVSGHA
FT                   AQEEQKLMLRLVKPKFFMPIHGEYNHAVKHQQTGISCGVLERNTYIMSDGEQIEVTPKY
FT                   LKKVKTVKSGKTYIDNQLNNKIADDIILDRQTMANEGVVMIVAQINENDRKLSDKTRVT
FT                   SFGLVPDNQDRFFAKEIEDLLETFFSNAKEGMFKNTKYLEDEIRKVVRKHCVRKFKKYP
FT                   MIVPTIFVY"
FT   gene            complement(142537..143349)
FT                   /locus_tag="Arnit_0151"
FT   CDS_pept        complement(142537..143349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0151"
FT                   /product="dimethyladenosine transferase"
FT                   /note="COGs: COG0030 Dimethyladenosine transferase (rRNA
FT                   methylation); InterPro
FT                   IPR020596:IPR020598:IPR001737:IPR011530; KEGG: abu:Abu_0053
FT                   dimethyladenosine transferase; PFAM: ribosomal RNA adenine
FT                   methylase transferase; SMART: Ribosomal RNA adenine
FT                   methylase transferase-like; SPTR: A8EQW4 Dimethyladenosine
FT                   transferase; TIGRFAM: dimethyladenosine transferase; PFAM:
FT                   Ribosomal RNA adenine dimethylase; TIGRFAM:
FT                   dimethyladenosine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91818"
FT                   /db_xref="GOA:D5V485"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5V485"
FT                   /protein_id="ADG91818.1"
FT                   /translation="MDKIKAKKKYGQNFLKDDTVLSMIIQSMPNNNNHIVEIGPGLGDL
FT                   TKNLVKCKDVTAYEVDTDLFAILKTKFAIPIDSGSLTLIHADVLESWTKQKSLHNSKYD
FT                   LIANLPYYIATNIILRAFEDEACEHIIVMVQKEVAEKFSANEGDKEFSALGVISKLCSI
FT                   ESKILFDVPPESFDPPPKVTSSILYIKKDMSKTMDKNFNSFLKACFQQPRKKLSKNVSS
FT                   IVPKETISSLFEELEISDNIRPHELSASLYSQIYTKAIIDGREQNSTE"
FT   gene            143424..144185
FT                   /locus_tag="Arnit_0152"
FT   CDS_pept        143424..144185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0152"
FT                   /product="imidazoleglycerol phosphate synthase, cyclase
FT                   subunit"
FT                   /note="COGs: COG0107 Imidazoleglycerol-phosphate synthase;
FT                   InterPro IPR011060:IPR013785:IPR006062:IPR004651; KEGG:
FT                   abu:Abu_0054 imidazole glycerol phosphate synthase subunit
FT                   HisF; PFAM: histidine biosynthesis protein; SPTR: A8EQW5
FT                   Imidazole glycerol phosphate synthase subunit hisF;
FT                   TIGRFAM: imidazoleglycerol phosphate synthase, cyclase
FT                   subunit; PFAM: Histidine biosynthesis protein; TIGRFAM:
FT                   imidazoleglycerol phosphate synthase, cyclase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91819"
FT                   /db_xref="GOA:D5V486"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D5V486"
FT                   /protein_id="ADG91819.1"
FT                   /translation="MSNFAKRIIPCLDVKDGRVVKGVNFVGLKDAGDPVEVAKRYNNEG
FT                   ADEITFLDITASHENRDTIVHIVKDVAKEVFIPLTVGGGIRTLDDIYKLLNVGCDKVSV
FT                   NSSAVVNPGFIDESSKRFGSQCIVVAIDVKKVSDGSYHVFVKGGREDTGLDALAWAKEV
FT                   YNRGAGEILLTSMDTDGAKTGFELNITQQISSIIDIPVIASGGAGTMEHMKEAFEHGAS
FT                   AALAASIFHFKEIDIMDLKHYLRDNNIPVRI"
FT   gene            144187..144858
FT                   /locus_tag="Arnit_0153"
FT   CDS_pept        144187..144858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0153"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: abu:Abu_0055 hypothetical protein; SPTR:
FT                   A8EQW6 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF541)"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91820"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:D5V487"
FT                   /protein_id="ADG91820.1"
FT                   /translation="MKKILFLFLPFFLYAFEVDFSKEFTKDLIPNVLSADISVIIEDEK
FT                   EKNVIERLEVFNKEIKAYNKVEKQLGTFNVRPLYQKSSNTPRIYGYSGELSYKIETDDA
FT                   FSMGEFISMITNMKENRDTSVTLNNLSWRVKDDSYNVILDLVRLEAINWVENYAKVLSN
FT                   DLHKECNIKTISLENNIMHTYRAQMTSMKLSSSLKKEDVPVPEVSHQKLSIITNYKLEC
FT                   K"
FT   sig_peptide     144187..144231
FT                   /locus_tag="Arnit_0153"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            144855..145391
FT                   /locus_tag="Arnit_0154"
FT   CDS_pept        144855..145391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0154"
FT                   /product="purine or other phosphorylase family 1"
FT                   /note="InterPro IPR000845; KEGG: abu:Abu_0056 purine
FT                   nucleoside phosphorylase; PFAM: purine or other
FT                   phosphorylase family 1; SPTR: A8EQW7 Putative
FT                   uncharacterized protein; PFAM: Phosphorylase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91821"
FT                   /db_xref="GOA:D5V488"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:D5V488"
FT                   /protein_id="ADG91821.1"
FT                   /translation="MIICAGNIESFKFAEPMGIGLVDMAINLTRRCLFNKPEFILFIGT
FT                   AGSYGNHNILDIVESKRAANLELSFLENNSYTPLDNVLESENKMVRNDTIVNSSNYITT
FT                   NEDIAKKYNEYGIGIENMEFFSVVKVAKEFEIPVAGIFAVTNYTNKNAHEDFKQNHKKA
FT                   METITKYLLEKNIIK"
FT   gene            145436..146503
FT                   /locus_tag="Arnit_0155"
FT   CDS_pept        145436..146503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0155"
FT                   /product="radical SAM enzyme, Cfr family"
FT                   /note="COGs: COG0820 Fe-S-cluster redox enzyme; InterPro
FT                   IPR006638:IPR004383:IPR007197; KEGG: abu:Abu_0057
FT                   hypothetical protein; PFAM: Radical SAM domain protein;
FT                   SMART: Elongator protein 3/MiaB/NifB; SPTR: A8EQW8
FT                   Ribosomal RNA large subunit methyltransferase N; TIGRFAM:
FT                   radical SAM enzyme, Cfr family; PFAM: Radical SAM
FT                   superfamily; TIGRFAM: radical SAM enzyme, Cfr family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91822"
FT                   /db_xref="GOA:D5V489"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/TrEMBL:D5V489"
FT                   /protein_id="ADG91822.1"
FT                   /translation="MQSIYDFTLDELKERLKPSFRAKQVYNWIYKKYANSYDEMKNIPN
FT                   DLKEDLKENYAIDILKIIKKEKSSDGSIKYLFKLHDGHTVETVFLLMREKQIGDDGVVE
FT                   KGEKHTVCISTQVGCKVGCTFCLTAKGGFVRNLTVGEIVAQIVNMKRDNNIDENKSLNI
FT                   VFMGMGEPLDNYKNFVHSVKVFSEEEGLYINRRRQTVSTSGISSKIEKLGNENLGIQLA
FT                   ISLHAVDDELRSELIPMNKAYNIKSIIDAVKKFPVDARKKVMFEYLVIKDKNDDIASAK
FT                   KLLSLLDGIKAKVNLIYFNPYPGTTYQRPESKKMVEFQNYLISKGLLCTIRESKGLDIS
FT                   AACGQLKEKDSNESS"
FT   gene            146592..148004
FT                   /locus_tag="Arnit_0156"
FT   CDS_pept        146592..148004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0156"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /note="COGs: COG0008 Glutamyl- and glutaminyl-tRNA
FT                   synthetase;
FT                   InterProIPR020060:IPR008925:IPR001412:IPR014729:IPR
FT                   020061:IPR020751:IPR020058:IPR004527; KEGG: abu:Abu_0058
FT                   glutamyl-tRNA synthetase; PFAM: Glutamyl/glutaminyl-tRNA
FT                   synthetase, class Ic, catalytic domain; SPTR: A8EQW9
FT                   Glutamyl-tRNA synthetase 1; TIGRFAM: glutamyl-tRNA
FT                   synthetase; PFAM: tRNA synthetases class I (E and Q),
FT                   catalytic domain; TIGRFAM: glutamyl-tRNA synthetase,
FT                   bacterial family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91823"
FT                   /db_xref="GOA:D5V490"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:D5V490"
FT                   /protein_id="ADG91823.1"
FT                   /translation="MTVTRFAPSPTGYLHIGGLRTALYSYLWARRNKGEFRLRIEDTDT
FT                   ARNNEDALGAIMEAFEWVGLDYDGTVEYQSKRNDIYKKYIDQLLSEGKAYLCYMSKEEL
FT                   ETLRETQMANKQTPRYDGTWRPEEGKVLPPIPEGIEPVVRIKAPKDGIITFIDGVRSIM
FT                   NFSSNEVDDFVIARSNGVPTYNFVVAIDDALMGMTDVIRGDDHLSNTPKQIVIYEAFGW
FT                   KPPKFYHIPMINNPSGKKLSKRDGAMDVMQYKRDGFLPEALLNFLVRLGWSNKDQEIFS
FT                   MEEMLELFDPTHINKSASAFNEEKLLWLNSHYIKNVSNERLAKELEFFDCHIGGHDKKE
FT                   IILDLTKERAQTLVELKNAIAAILDAPSEYEAKGVKKFIKDETIIKILDNYVKLLEENA
FT                   DNLNISIDYEGVTKPFIEEFELKFPQLFQPIRLALTGSTQAPSVYDIMGVLGVEVVCER
FT                   IKIACEKNFNKE"
FT   gene            148079..148282
FT                   /locus_tag="Arnit_0157"
FT   CDS_pept        148079..148282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0157"
FT                   /product="heavy metal transport/detoxification protein"
FT                   /note="InterPro IPR006121; KEGG: tdn:Suden_0772 heavy metal
FT                   transport/detoxification protein; SPTR: Q30SI0 Heavy metal
FT                   transport/detoxification protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91824"
FT                   /db_xref="GOA:D5V491"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:D5V491"
FT                   /protein_id="ADG91824.1"
FT                   /translation="MKRTYKSEKINCAKCENLIKVSLEDDFGPIDVDLTKTPKEVTVEI
FT                   TSDEQENNFKEEMKDLGFDILD"
FT   gene            148293..150473
FT                   /locus_tag="Arnit_0158"
FT   CDS_pept        148293..150473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0158"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="COGs: COG2217 Cation transport ATPase;
FT                   InterProIPR001757:IPR001756:IPR006121:IPR018303:IPR
FT                   017969:IPR000150:IPR008250:IPR005834:IPR006403:IPR006416;
FT                   KEGG: ccv:CCV52592_0531 copper-translocating P-type ATPase;
FT                   PFAM: E1-E2 ATPase-associated domain protein; Heavy metal
FT                   transport/detoxification protein; Haloacid dehalogenase
FT                   domain protein hydrolase; SPTR: C6RIF9 Copper-translocating
FT                   P-type ATPase; TIGRFAM: heavy metal translocating P-type
FT                   ATPase; copper-translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase; Heavy-metal-associated domain; haloacid
FT                   dehalogenase-like hydrolase; TIGRFAM: copper-(or
FT                   silver)-translocating P-type ATPase; heavy metal
FT                   translocating P-type ATPase; ATPase, P-type (transporting),
FT                   HAD superfamily, subfamily IC"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91825"
FT                   /db_xref="GOA:D5V492"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D5V492"
FT                   /protein_id="ADG91825.1"
FT                   /translation="MAKEKINLNISGMTCVNCSGGIEKFLNKKKGVISANVSFASSEGE
FT                   FIIDDSLYSKEKLTSDIQKLGYKPEEDLKALEEEQLLSFKRLRKIFFTSITLTFIMFCL
FT                   MFLNIFSEETTKYLVFFIASIVQFYCGLRFYKLGIKSVINRNYDMNVLVALGTSAAYFY
FT                   STVVVFFPHLFPENLRFLYFDGASVIITFVLLGRYLEENSKLKASDFLKKLMNLAPVNA
FT                   NLIDENKNIKTVLASSLKPKDIVLVKSGEKIPTDGIIIEGNADIDTSMITGESMPVFKK
FT                   IGDEVLSGTLNSNGTIKIEVSKESSDTTLSKIITLLKTAQSKQIPISRFADKVANIFVP
FT                   SVIFISILAFLVWGFVFGDFQKAIIASISVLIISCPCALGLATPIAIVSSVSRGAKEGI
FT                   LIKNPEILEEIKEIKYAVFDKTGTLTKGEITVSNTNIDEKYFELIGSIENYSEHPISKA
FT                   IVSFIKDKKYDVNKEIKEIDIIPGKGIKASFDGDEIILGNKKLLDENSVQVDESHEKFY
FT                   LEELEKSNGLIYVAINKKTIGSFSLEDKLKDDAVSVIKELKQLNIEPILLTGDNKITAQ
FT                   KIADKLGIKKIYSEVLPTEKYEVIKELQKKSKVMFIGDGINDAPSIKQANIGITLNSGS
FT                   DITKDAGDIILVHNELSSIIKSINLSIETMKIVKQNLFWAFTYNILGIPLAAGILYPIF
FT                   GLMLNPMYAGIAMSFSSVSVVLNSLRLKIKKL"
FT   gene            150504..151139
FT                   /locus_tag="Arnit_0159"
FT   CDS_pept        150504..151139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0159"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="COGs: COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain; InterPro IPR011006:IPR001789:IPR001867; KEGG:
FT                   abu:Abu_0060 two-component response regulator; PFAM:
FT                   transcriptional regulator domain protein; response
FT                   regulator receiver; SMART: response regulator receiver;
FT                   SPTR: A8EQX1 Two-component response regulator; PFAM:
FT                   Response regulator receiver domain; Transcriptional
FT                   regulatory protein, C terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91826"
FT                   /db_xref="GOA:D5V493"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D5V493"
FT                   /protein_id="ADG91826.1"
FT                   /translation="MILNEIIEEHLLEKGHDVVCTFAGNEAEELLYSQKFDLLLLDVNV
FT                   PEIKGFELLLDLRKNNIKTPAIFLTSLNLTDDIERGFQSGCDDYIKKPFELKELDLRIN
FT                   NIKRIFNISSSNQIELSTTMVLDADNLLVIKESEEIHLSKKEIEVLLYFIRNKNKIISV
FT                   EELSSNVWVYEESPNASTIRTYIKNLRKILEENMITNIRGVGYRFNSK"
FT   gene            151195..152268
FT                   /locus_tag="Arnit_0160"
FT   CDS_pept        151195..152268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0160"
FT                   /product="histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterPro IPR004358:IPR003594:IPR003661:IPR005467; KEGG:
FT                   abu:Abu_0061 two-component sensor histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; SMART: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; SPTR: A8EQX2
FT                   Sensor protein; PFAM: Histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like ATPase; His Kinase A (phosphoacceptor) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91827"
FT                   /db_xref="GOA:D5V494"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5V494"
FT                   /protein_id="ADG91827.1"
FT                   /translation="MTLIAFLYFENQQKLYFDLTKSRMQNIASKIASKIIVAHMNGTKI
FT                   DISGDFEPKDYKLAFYDNSGKKVYGNIDEKIDLKKDIIEEKNSFVLVDKSTFGHLGIYA
FT                   IAIKEHFYSKQIKELEINIIVLFFLIYSIIALIGFYLAKLFIKPIKEERDKLNNFIKDT
FT                   THELNTPISAILMSTEGKELNTKQIERVRLSAKRVSEIYKDLTYVFLQKDFEKEDLKEI
FT                   SLGEVIKEQLLYFEPLANKKKIKINLDIQEYSYKILKEDFIRVFNNLVSNAIKYNKING
FT                   TIFITLKNNKLIIKDTGIGIKQTKINDIFKRYYRATSYQGGFGIGLSIVSEISKKYNIK
FT                   IDINSIYDESTTITLNF"
FT   gene            152332..152715
FT                   /locus_tag="Arnit_0161"
FT   CDS_pept        152332..152715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0161"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: abu:Abu_0062 hypothetical protein; SPTR:
FT                   A8EQX3 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91828"
FT                   /db_xref="InterPro:IPR032693"
FT                   /db_xref="UniProtKB/TrEMBL:D5V495"
FT                   /protein_id="ADG91828.1"
FT                   /translation="MKNIFKLFAGLLVAFNLVHADPLLQEGSKDGYDVKLSSEKSLVMG
FT                   SNEIIIELAKDGAKLSNAKVKIKFFMPEMPGMPYMESEIKGKIVDGKFKASVNFAMGGT
FT                   WQYQLKFKTEDGKVHTVRGSVNI"
FT   sig_peptide     152332..152391
FT                   /locus_tag="Arnit_0161"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            152715..153911
FT                   /locus_tag="Arnit_0162"
FT   CDS_pept        152715..153911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0162"
FT                   /product="outer membrane efflux protein"
FT                   /note="COGs: COG1538 Outer membrane protein; InterPro
FT                   IPR003423; KEGG: abu:Abu_0063 hypothetical protein; PFAM:
FT                   outer membrane efflux protein; SPTR: A8EQX4 Putative
FT                   uncharacterized protein; PFAM: Outer membrane efflux
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91829"
FT                   /db_xref="GOA:D5V496"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:D5V496"
FT                   /protein_id="ADG91829.1"
FT                   /translation="MLRNSFILTCLIITSSFSTSLENIINSAIVNNKNLQAIEKSIQIA
FT                   NEQIKLSNKWDNPILTIGANDLQFDTSRRDLEPMQGQYIGFSQNIPINGKIKLQEEIAM
FT                   KDKAISNLNYEDAKLKLKSKLIEYLYSIKILEKKYLLLNQYQKNIKSLEDLTTSLYESN
FT                   KSNQSMIINLKTDYLKIEIQKENLQNIIKNNYLKLEEITYEKITSIDVSLDVKELIFSK
FT                   DISTHPIIKILEQNNEKFNKQAQLEDAKKLSDIKVSAVYFQRDDKYKDYANVSLSIPLA
FT                   FYGKENIKILQAKIKAREFKDKLDDSKKRFEIKIASLQNDLDSSIKKYKLLKELILPLQ
FT                   EENQEIIEKYNSLELIKSDEILKNLNKIIQNKIAQYDEMKNYFDAYSQAYYYTQGKIR"
FT   sig_peptide     152715..152774
FT                   /locus_tag="Arnit_0162"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            153908..154891
FT                   /locus_tag="Arnit_0163"
FT   CDS_pept        153908..154891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0163"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="COGs: COG0845 Membrane-fusion protein; InterPro
FT                   IPR006143; KEGG: abu:Abu_0064 cation efflux system,
FT                   membrane fusion protein; SPTR: A8EQX5 Cation efflux system,
FT                   membrane fusion protein; TIGRFAM: efflux transporter, RND
FT                   family, MFP subunit; TIGRFAM: RND family efflux
FT                   transporter, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91830"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D5V497"
FT                   /protein_id="ADG91830.1"
FT                   /translation="MKNIFKLLLLLLCISSLDAKILDANQLFNKKIVKVKDESVYETKS
FT                   FYGETLFAEESIKDIVLRFDGYITKLDANKNLMEVKKADKLFSLYSDKIQSIKKEIEVT
FT                   KSINKAMYKSSLEKLDSLDVNLSQLKSKDISFYAPFDGIILNKKINEGSYVKTGSLIMQ
FT                   IANINKLWFISKVYQSDLAFLTNNMDAKIKIDGRDMTFKTKVDYIYPFANKQSKTIDVR
FT                   FVIENKDKTLFPNMFGKAIIKTSSKKVLTLPKTAVLRKGAKYYVFKYISKDEFKPVLID
FT                   AKQISSGKYEIEDGLKVGDEVIDNALFLLDSDAVTNNLYEDEDNDW"
FT   sig_peptide     153908..153964
FT                   /locus_tag="Arnit_0163"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            154898..158017
FT                   /locus_tag="Arnit_0164"
FT   CDS_pept        154898..158017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0164"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="COGs: COG3696 Putative silver efflux pump; InterPro
FT                   IPR001036:IPR004763; KEGG: abu:Abu_0065 heavy metal efflux
FT                   pump; PFAM: acriflavin resistance protein; SPTR: A8EQX6
FT                   Heavy metal efflux pump; TIGRFAM: heavy metal efflux pump,
FT                   CzcA family; PFAM: AcrB/AcrD/AcrF family; TIGRFAM: heavy
FT                   metal efflux pump (cobalt-zinc-cadmium)"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91831"
FT                   /db_xref="GOA:D5V498"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D5V498"
FT                   /protein_id="ADG91831.1"
FT                   /translation="MVEYIINKSVQNKFLVLFSVLILTVASIWAVKNSSLDALPDLSPP
FT                   QVIVQVKWAGQSPKTIEEQVSYPLISNLMSLPNIDTVRAMSSFQNALIYIIFKDGTDIY
FT                   DSRNRILEQLSQLQGTFPDGVNVAIGPDATGVGWAYEYALKSKTKSLDELKTLQDYYYK
FT                   YALLGVDGVSEIASVGGFIKNYEITLNQDKLVQYNLSINDVKKALVSNNDEKGGRIILE
FT                   NGYEHMIQARGYLKSVVDIENITVKTFGSTPLKIKDIADVNITSSNRRGMADLNGEGET
FT                   VGGIVVVRFGENPYKVIKAVKEKLKTLHVDDVEVVETYDRSSLIDKAIDTLKHTLLEES
FT                   IIVIVVTALFLFHFRSALIIIITLPITVLFTFLCMKFFSMGSNIMSLGGIAIAIGAMVD
FT                   ATIVMVENAHKYLQGKENISNKQRIEIIIKSAKQVGRPIFFALLLVVVSFLPIFALTGQ
FT                   EGRLFSPLAFTKSFAMISGAVLSITLVPILMIFFIRGKIMDEKRNYLNKFFIALYSPLL
FT                   KFSLRFRYVVVALFIGTLILAYPVYKKQNWEFMPMMNEQTFMYMPVTPYGIGIDLAKEL
FT                   TQKTDKILKSFPEVQTVFGKAGRADSATDPAPLAMIETIIQFKPQDQWREGMTYKKLMQ
FT                   EMDDKLRVTGLVNSWTYPIRGRIDMLLTGIRTPLGIKLYGNDHQKLEAVALKIEQKLKK
FT                   FDKTLSVSSDKINSGYYLNIDLNEEMLSRYGITKNDILSTVSLGVAGAKISTYLDALER
FT                   YPISLRYETTQREDITSLENLQVKTKLGFQPLRMFAELKYEEGPSVIKSEKGLNVNFIY
FT                   ITPKSDVSVKEYKDKAQELLKDIKLPSGFYYEWAGQSEYLESAMKKLAYIIPLTFVIIF
FT                   ILIFFALRNITYTVIIFFTLPFALTGGIFYLDYLNFNISIAVIVGFLALLGVAAETSIV
FT                   MLVYLHEAMLELKDKCISLDDDKHIFHAIYKGAVLRLRPKLMTLFAILGGLVPIMYIDG
FT                   VGSEVMQRIAAPMIGGMISSAFLTLIIIPSVFFILALKKRDKILEQELSH"
FT   sig_peptide     154898..154987
FT                   /locus_tag="Arnit_0164"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            158091..158405
FT                   /locus_tag="Arnit_0165"
FT   CDS_pept        158091..158405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0165"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_2413 hypothetical protein; SPTR:
FT                   Q080Q7 Putative uncharacterized protein; TIGRFAM:
FT                   pentapeptide MXKDX repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91832"
FT                   /db_xref="UniProtKB/TrEMBL:D5V499"
FT                   /protein_id="ADG91832.1"
FT                   /translation="MKKLIMLVAALLFTVGVAFADGKTGSCGAGKCGDSSKSMMKKGMS
FT                   SKEMKKAGSCGTGKCGDSKKDMMKKDHMKGDMMKKSGNKASGSCGAGKCGDSKMKKDMK
FT                   "
FT   sig_peptide     158091..158150
FT                   /locus_tag="Arnit_0165"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(158440..159795)
FT                   /locus_tag="Arnit_0166"
FT   CDS_pept        complement(158440..159795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0166"
FT                   /product="MATE efflux family protein"
FT                   /note="COGs: COG0534 Na+-driven multidrug efflux pump;
FT                   InterPro IPR002528; KEGG: gsu:GSU2653 MATE efflux family
FT                   protein; PFAM: multi antimicrobial extrusion protein MatE;
FT                   SPTR: Q749T9 MATE efflux family protein; TIGRFAM: MATE
FT                   efflux family protein; PFAM: MatE; TIGRFAM: putative efflux
FT                   protein, MATE family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91833"
FT                   /db_xref="GOA:D5V4A0"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4A0"
FT                   /protein_id="ADG91833.1"
FT                   /translation="MNKTQYLIEEPIPKLIKELAIPASTGMFFNTMYNVVDTFYAGLIS
FT                   TEAIAALSLSFMIYFLITGFGYGFSSAISALIGNSFGKKKNHLASIYAHKGIGFLIILG
FT                   VIFSIIGYFASPMLFKLLGATDAYLDICLKYINVILFGTIFFMANFALNAILVSKGDTK
FT                   TYRNSLIFGFFANLALNPLFMYGFWIIPEMGIGGIAFATILVQFINMFYMLYKVLQTKI
FT                   IHFDRLEYYLPNLRVYKAFFKQGIPSSLNMLTMAFGSIILTYYVTQYGYKAVAGYGIGF
FT                   RVEQLMLLPALGLSTAVLSLVSNNYGAKQFNRVKEIVMLSLKYGFMISTFGIIFLYVFG
FT                   KLIVAQFDDDTAVIQYGFNYLLVEVWIFYAYIILFICVSTLQAIKQPKMIFYIGIYRQL
FT                   IAKAIVSYIIVSYFKLDYIYLFVGMLLMIYSAAIFAYFYTMYKLRVLCNIRV"
FT   gene            complement(159820..161082)
FT                   /locus_tag="Arnit_0167"
FT   CDS_pept        complement(159820..161082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0167"
FT                   /product="Homoserine dehydrogenase"
FT                   /EC_number="1.1.1.3"
FT                   /note="COGs: COG0460 Homoserine dehydrogenase;
FT                   InterProIPR016040:IPR019811:IPR016204:IPR005106:IPR
FT                   001342:IPR002912; KEGG: abu:Abu_0158 homoserine
FT                   dehydrogenase; PFAM: homoserine dehydrogenase; homoserine
FT                   dehydrogenase NAD-binding; amino acid-binding ACT domain
FT                   protein; PRIAM: Homoserine dehydrogenase; SPTR: A8ER68
FT                   Homoserine dehydrogenase; PFAM: Homoserine dehydrogenase;
FT                   Homoserine dehydrogenase, NAD binding domain; ACT domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91834"
FT                   /db_xref="GOA:D5V4A1"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR016204"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4A1"
FT                   /protein_id="ADG91834.1"
FT                   /translation="MLKIAIIGVGTVGASVANILKDNKDIITSRAGVEIVPTIGVVNDL
FT                   SKKRDVSIELTDDLDKALNDDSIDIIVELMGGVERPYEIIKRALSKGKPVVTANKALLA
FT                   YHRYDLEKLAGDIPFEYEAAVAGGIPIINALRDGLSANNIESIRGILNGTCNYMLTRMI
FT                   NDGIDYESILKEAQELGYAEADPTFDVGGFDAAHKLLILASIAYDVDAKPEDILIEGIQ
FT                   NIDTPDIDFANEFNYSIKLLAIAKRVGKQIELRVHPVFIPKTEMIAKVDGVMNGISVIG
FT                   DKVGETMYYGPGAGGNATASAVIANIVDIARRGKGAPMLGFEFDYKANLTIMPKDEIET
FT                   KYYLRLRIEDKVGVLAKVTKILGEHEISIEKMIQKPYNTTCAHLLLSTHVCIEKNINKA
FT                   LKEIENSGVATTKPVMIRIED"
FT   gene            complement(161091..162299)
FT                   /locus_tag="Arnit_0168"
FT   CDS_pept        complement(161091..162299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0168"
FT                   /product="aminotransferase class I and II"
FT                   /note="COGs: COG0436 Aspartate/tyrosine/aromatic
FT                   aminotransferase; InterPro IPR015424:IPR015421:IPR004839;
FT                   KEGG: abu:Abu_0157 aspartate aminotransferase; PFAM:
FT                   aminotransferase class I and II; SPTR: A8ER67 Aspartate
FT                   aminotransferase, aminotransferase, classes I and II; PFAM:
FT                   Aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91835"
FT                   /db_xref="GOA:D5V4A2"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4A2"
FT                   /protein_id="ADG91835.1"
FT                   /translation="MFPEIEFERMKRLPNYVFAEVNNIKMEARRKGEDIIDFSMGNPDG
FT                   PAPQHIIDKLKETADKPKNHGYSASAGIYKLRLAICNWYKRKYGVDYLDPNKHAVATMG
FT                   SKEGYVHLVQAIVNVGDVAVVPDPTYPIHSYAFMLAGGCIHNFELPFGRDFKVDEDEFF
FT                   ARLNKTLRESIPKVKYVVVNFPHNPTCATVTPEFYQKLVDLAKKERFYIISDIAYADIT
FT                   FDGYKTPSIFQAEGALDVAVESFTLSKSYNMAGWRVGFIVGNEKLVGALKRIKSWLDYG
FT                   MFTPIQVAATIALDGPQECVTEHIEKYHYRRDVMLEAFKDAGWDMDKPNASMFIWAKIP
FT                   EKAAHLGSMEFSKQLLTEAKVAVSPGIGFGQYGDQYVRIALIENEKRIRQAAKNIKKYL
FT                   NSL"
FT   gene            complement(162302..163123)
FT                   /locus_tag="Arnit_0169"
FT   CDS_pept        complement(162302..163123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0169"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: abu:Abu_0156 hypothetical protein; SPTR:
FT                   A8ER66 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91836"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4A3"
FT                   /protein_id="ADG91836.1"
FT                   /translation="MIKKILISVFLVMSLSANDLLNQKIENFIGTHSYLTHKNLINFIF
FT                   KKEYQFTTVDGLNYQTILKTLKENGLLTLAFNAPKDIEVTFKINSNPTKSLKILKDTLK
FT                   SLGYYYYFTKHTVYDGTESLTWTIKLKTEAAIDPLVLSNELFQHDFKVTNITKEENDKW
FT                   VYELDTTNASLYDATYVSTNEKISFSKPLSPYFIKIDKASTIFIASKTLNSWLPYVVFY
FT                   DEHLNILKVSKEEKVYRNLTLSIPENTRYIKITDLYTLFNIKRGLTVLIKE"
FT   sig_peptide     complement(163073..163123)
FT                   /locus_tag="Arnit_0169"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(163141..163833)
FT                   /locus_tag="Arnit_0170"
FT   CDS_pept        complement(163141..163833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0170"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="COGs: COG0566 rRNA methylase; InterPro
FT                   IPR013123:IPR001537:IPR004441; KEGG: abu:Abu_0155 TrmH
FT                   family tRNA methyltransferase; PFAM: tRNA/rRNA
FT                   methyltransferase (SpoU); RNA 2-O ribose methyltransferase
FT                   substrate binding; SPTR: A8ER65 tRNA methyltransferase,
FT                   TrmH family; TIGRFAM: RNA methyltransferase, TrmH family,
FT                   group 3; PFAM: SpoU rRNA Methylase family; RNA 2'-O ribose
FT                   methyltransferase substrate binding; TIGRFAM: rRNA
FT                   methylase, putative, group 3"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91837"
FT                   /db_xref="GOA:D5V4A4"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4A4"
FT                   /protein_id="ADG91837.1"
FT                   /translation="MIIYGKQIVLYVLENHPSIIEEVMFSKELDKKIFSKFLKLGKKII
FT                   RLDNKKAQSLAKGGNHQGFFLKLKEEFDYTPINEMKQNNFIVVLDGLTDVGNIGAITRT
FT                   AYALGVDGIVAAGVKSLNESGVIRTSSGAMLDMPFSLYPNSLDLANELKQSGFALIGAT
FT                   MNGTDLKKYGTITKDDKVALFLGSEGEGLSNKIIGKLDLKVSIGMENNFDSLNVSVAAG
FT                   ILIYNLMK"
FT   gene            complement(163913..164728)
FT                   /locus_tag="Arnit_0171"
FT   CDS_pept        complement(163913..164728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0171"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="COGs: COG0313 methyltransferase; InterPro
FT                   IPR000878:IPR018063:IPR014777:IPR008189; KEGG: abu:Abu_0154
FT                   putative methyltransferase; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase; SPTR:
FT                   A8ER64 Putative uncharacterized protein; PFAM: Tetrapyrrole
FT                   (Corrin/Porphyrin) Methylases; TIGRFAM: conserved
FT                   hypothetical protein TIGR00096"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91838"
FT                   /db_xref="GOA:D5V4A5"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4A5"
FT                   /protein_id="ADG91838.1"
FT                   /translation="MLTLVPTPIGNLEDISKRALDALLEAELIFCEDTRVTKKLLTLFA
FT                   SKYNLNFPCTDFKSFHSHNEQQVLKTLSKDMFDKNIVYASDAGMPCVSDPGASLVEYAI
FT                   QNDIKYDVIPGANAVLTAFAMSGFEHTEFTFFGFLAHKGTERKEKLQKVMNSEILPILY
FT                   ESPHRLLKLLEELKDLDENRTVFLAKELTKQYQTTFKDTAINLYKNLKDTNIRGEWVVI
FT                   IQPLLNAGKNLSISDVQELDLPPKVKAKLLSKLTGEKIKDIYQKLLDEN"
FT   gene            complement(164745..164945)
FT                   /locus_tag="Arnit_0172"
FT   CDS_pept        complement(164745..164945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0172"
FT                   /product="ribosomal protein L31"
FT                   /note="COGs: COG0254 Ribosomal protein L31; InterPro
FT                   IPR002150; KEGG: abu:Abu_0153 50S ribosomal protein L31;
FT                   PFAM: ribosomal protein L31; SPTR: A8ER63 50S ribosomal
FT                   protein L31; TIGRFAM: ribosomal protein L31; PFAM:
FT                   Ribosomal protein L31; TIGRFAM: ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91839"
FT                   /db_xref="GOA:D5V4A6"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4A6"
FT                   /protein_id="ADG91839.1"
FT                   /translation="MRKEIHPDYKTCVITCSCGNTFETKSNVESMRIDICSACHPFFTG
FT                   EQKIVDAAGRVEKFKAKYAQK"
FT   gene            complement(165032..165910)
FT                   /locus_tag="Arnit_0173"
FT   CDS_pept        complement(165032..165910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0173"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /EC_number="2.5.1.75"
FT                   /note="COGs: COG0324 tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase; InterPro IPR002627:IPR018022; KEGG:
FT                   abu:Abu_0152 tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase; PFAM: tRNA isopentenyltransferase; PRIAM: tRNA
FT                   isopentenyltransferase; SPTR: A8ER62 tRNA
FT                   Delta(2)-isopentenylpyrophosphate transferase; TIGRFAM:
FT                   tRNA delta(2)-isopentenylpyrophosphate transferase; PFAM:
FT                   IPP transferase; TIGRFAM: tRNA isopentenyltransferase
FT                   (miaA)"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91840"
FT                   /db_xref="GOA:D5V4A7"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4A7"
FT                   /protein_id="ADG91840.1"
FT                   /translation="MKEIAIIGATASGKTGLSIDIAHKTNSIILSLDSLSVYKEIDIAS
FT                   AKPTLKERDGIIHFGIDEVFVNESFDVVEFLQCYKKAKKFAKQNEKNLIIVGGTGFYLK
FT                   ILIEGISEGVGEDVKLDMPHEEIYKMLFDLDKTYMEKIASNDKYRIQKAYSIYKKSGLT
FT                   PSQYFIENPKKPISPELKLFEIYWDREELKKRIALRTKQMIKDGVIDEVLFLEKKYTRK
FT                   PNAMSSIGIIETLEFIDGKLTKEQLEEKISLNTAKLAKRQNTFNKSQFNQKQEINIIEN
FT                   LNSDILKYFTV"
FT   gene            complement(165924..167459)
FT                   /locus_tag="Arnit_0174"
FT   CDS_pept        complement(165924..167459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0174"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="COGs: COG0388 amidohydrolase; InterPro
FT                   IPR003010:IPR016181:IPR000463:IPR000182; KEGG:
FT                   cts:Ctha_0190 nitrilase/cyanide hydratase and
FT                   apolipoprotein N-acyltransferase; PFAM: Nitrilase/cyanide
FT                   hydratase and apolipoprotein N-acyltransferase;
FT                   GCN5-related N-acetyltransferase; SPTR: B3QT18
FT                   Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; PFAM: Acetyltransferase (GNAT) family;
FT                   Carbon-nitrogen hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91841"
FT                   /db_xref="GOA:D5V4A8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4A8"
FT                   /protein_id="ADG91841.1"
FT                   /translation="MDPKHIDKIELVYLKKEDHNSICSLMEDEYRHLDESSWSKEEFEA
FT                   LIEKFPNGQVAIKIDGEFAGFALSIIVDYTKFDDTHSYKEITGNYTFDTHNDNGNMLYG
FT                   VDIFINKKYRGLRLGRRLYDFRKELCEELNLKGIIFGGRIPNYSKYADEITPKEYIQKV
FT                   KEREIYDPVLNFQLSNDFYVKRVIKNYLEGDIDSKEYACLLAWNNIYYAKPTVKPMSQK
FT                   KVIRLGLIQWQMRLYKNYEEVIEQAEYFIDAVSGYRSDFALFPEFFNAPLMAEFNHLSE
FT                   ADAIRELAKYTERFKEDFSRLAIAYNINIITGSMPELIDGTLNNVGFVCKRDGEIEKYA
FT                   KIHVTPDEQKVWGLKGSDKIKAFDTDCGKIGVLICYDSEFPELGRLLAKEGVDILFIPF
FT                   LTDTQNGYSRVKICAQARAIENECYVAIAGCVGNLPKVENMDIQYAQSAVFTPCDFAFP
FT                   ANGIKAESTPNTEMILIADVDLELLTELHSLGSVNNLKDRRTDIYDVIKVEKN"
FT   gene            167574..168434
FT                   /locus_tag="Arnit_0175"
FT   CDS_pept        167574..168434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0175"
FT                   /product="4-hydroxybenzoate polyprenyltransferase"
FT                   /note="COGs: COG0382 4-hydroxybenzoate
FT                   polyprenyltransferase and related prenyltransferase;
FT                   InterPro IPR000537:IPR006371; KEGG: abu:Abu_0150
FT                   prenyltransferase; PFAM: UbiA prenyltransferase; SPTR:
FT                   A8ER60 4-hydroxybenzoate octaprenyltranferase; TIGRFAM:
FT                   4-hydroxybenzoate polyprenyltransferase; PFAM: UbiA
FT                   prenyltransferase family; TIGRFAM: putative
FT                   4-hydroxybenzoate polyprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91842"
FT                   /db_xref="GOA:D5V4A9"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006371"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4A9"
FT                   /protein_id="ADG91842.1"
FT                   /translation="MNNILKKLNDFSELVMFKHSIFSLPFIFIAMVVAANGWFGWRLFF
FT                   LGILAAVTARNFAMAFNRYLDRDIDSLNPRTENRPNVDGRLSAKSILTFTLLNALGFII
FT                   VAAFVNKLALILAVPILLVIGSYSYFKRFSYLAHLILGVSLGLAPIAGVVAVSETITLW
FT                   SICLSIGVMFWVAGFDLLYSLQDIDVDKKLGLHSVPSVFGAKNTMLFSKIAHSFTVLFW
FT                   LLFVINSGSGAFAYLAVIVSAVMLSYEHYLVNKDFRKIDKAFFTVNGYLGIIFFILIII
FT                   DTIAN"
FT   sig_peptide     167574..167675
FT                   /locus_tag="Arnit_0175"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            168501..168577
FT                   /locus_tag="Arnit_R0002"
FT   tRNA            168501..168577
FT                   /locus_tag="Arnit_R0002"
FT                   /product="tRNA-Arg"
FT   gene            169025..169261
FT                   /locus_tag="Arnit_0176"
FT   CDS_pept        169025..169261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0176"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: abu:Abu_1709 hypothetical protein; SPTR:
FT                   B6GDZ7 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91843"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4B0"
FT                   /protein_id="ADG91843.1"
FT                   /translation="MTLEELNFLVPIEQRSCICLNQSQTAHILGVSSSTLSNWRLEDGI
FT                   GPEYKKVGNGTRSRVLYPKTAIIDWISKTIKTA"
FT   gene            169376..169903
FT                   /locus_tag="Arnit_0177"
FT   CDS_pept        169376..169903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0177"
FT                   /product="phage replisome organizer"
FT                   /note="InterPro IPR010056; KEGG: apr:Apre_1793 phage
FT                   replisome organizer; PFAM: replisome organizer putative
FT                   region; SPTR: C7RI59 Phage replisome organizer; TIGRFAM:
FT                   phage replisome organizer; PFAM: N-terminal phage replisome
FT                   organiser (Phage_rep_org_N); TIGRFAM: phage replisome
FT                   organizer, putative, N-terminal region"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91844"
FT                   /db_xref="InterPro:IPR010056"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4B1"
FT                   /protein_id="ADG91844.1"
FT                   /translation="MSKKYYWIKLKESFFSDLRIKKLRKLAGGDTFTIIFQKIMLLSLS
FT                   TNGVIVYQGIESNLSKELALIMDEDEDNVQLTLSYLKQTNILIEEDENNYNIPLISELT
FT                   GTETDWAKKKREYRKRQNEDNVLTMSDKRREEIELEREKYAKLNQILLDKQITKDKKRE
FT                   KVLNQYIGESTC"
FT   gene            169897..170196
FT                   /locus_tag="Arnit_0178"
FT   CDS_pept        169897..170196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0178"
FT                   /product="DNAJ protein"
FT                   /note="KEGG: DNAJ protein; SPTR: C5REK4 Lantibiotic
FT                   dehydratase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91845"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4B2"
FT                   /protein_id="ADG91845.1"
FT                   /translation="MLVIKKLDKKKLDKLFLEHYNDEFREYEIYQEMKEILSKLNKKEL
FT                   IEYILAERTNSTYYIERFKYIEKVLFDMASYVFEDEIDFARNEMMKYIGDKYGE"
FT   gene            170186..171229
FT                   /locus_tag="Arnit_0179"
FT   CDS_pept        170186..171229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0179"
FT                   /product="TrbL/VirB6 plasmid conjugal transfer protein"
FT                   /note="InterPro IPR007688; KEGG: wsu:WS1098 hypothetical
FT                   protein; PFAM: TrbL/VirB6 plasmid conjugal transfer
FT                   protein; SPTR: Q7MRR5 Putative uncharacterized protein;
FT                   PFAM: TrbL/VirB6 plasmid conjugal transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91846"
FT                   /db_xref="GOA:D5V4B3"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4B3"
FT                   /protein_id="ADG91846.1"
FT                   /translation="MENNVITDIYNLVNGILFQSTNEITSGLYNSARIVFDKGFFISAM
FT                   AIAIAYIGWKIAWSKTKNDEALYSAIWMLIMFAIVQLMIKQGNYYQWFIDGVNIPRDTF
FT                   VEMINTIVTNVNPHAGLENILNTLMTTTNSIASASFANGSLTNWLPFAYGIIAYLTGTF
FT                   LIIIIVVMTLFSKFLSNITMALLPFVVVTLLWKKTEYVFFAWVKLYISLSLYAPFTMIF
FT                   GLVSIHVVNLSMSISQNLADDYMNSAEMILILVIVQGIIIIGIFKIPNIINQLIGSANE
FT                   GSSITSGVGTLSTGATLIMGASKYSGLSAGVGAGKAGGSYMAKESLINKGEISQAMDYV
FT                   ASKVKPR"
FT   gene            171502..173031
FT                   /locus_tag="Arnit_0180"
FT   CDS_pept        171502..173031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0180"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: viral A-type inclusion protein; SPTR: A2F531
FT                   Viral A-type inclusion protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91847"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4B4"
FT                   /protein_id="ADG91847.1"
FT                   /translation="MNDLEEEYKKNRGTPKPNEQSMSFYNNRQFAEKSNGTKKGTFYKS
FT                   SFHSQTSTKHSLEHMERKSKVTYLLIQDSSVNDNKQYEDVKKFKEQAEKIYKEKIGQKM
FT                   QPKAKENLVKEAVLNTKPNTSIEDIEKTFKNLNKKFTGHHIIATSIHRDEGVFIDTKYD
FT                   LEDLQYSSSTLSWKHIKLNKDVTNEVIDYAPNRNIFYNQENRSWYFDKNFAGENKADVS
FT                   KYQKKINYHAHVLYSNFNKDTGKTARMDRTNMRELQTIVADSLGMQRGQEFSKNKRMNH
FT                   WQLKRAIDAKRELKLSTQGELAKQKDLQNEMRVLREELKKQGTAKREDYAKIEQLNKVL
FT                   KEQITNKELSLNDMKKIFDEKMKTIEYQNKLLDKQDERIKNQKSDIESLESKVQKRELY
FT                   IDGSIPQKRVKIKDGLLSSKEVYIYDTEGVKTYVEKTKDTEKSLKREVKNLKKENSILK
FT                   DENLELDMFKVFVKKHFKSTDLEKVKEIIKIVMPKIDNSNKINAKNNNIER"
FT   gene            173051..173305
FT                   /locus_tag="Arnit_0181"
FT   CDS_pept        173051..173305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0181"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcg:BCG9842_B0597 hypothetical protein; SPTR:
FT                   Q817L2 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91848"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4B5"
FT                   /protein_id="ADG91848.1"
FT                   /translation="MKKLVLGIVVVFVLIGCGSDNEKSPSKENTKDYINKVIEQEQKAK
FT                   EKVLTPKEKEEAAKAKQKTLNLMNDLIEKGKKVKLPSER"
FT   sig_peptide     173051..173116
FT                   /locus_tag="Arnit_0181"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            173525..174385
FT                   /locus_tag="Arnit_0182"
FT   CDS_pept        173525..174385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0182"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: A0DR44 Chromosome
FT                   undetermined scaffold_6, whole genome shotgun sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91849"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4B6"
FT                   /protein_id="ADG91849.1"
FT                   /translation="MFSKVLNPNFEEDFKIQAKLLKKELFGLGFIMKHAQSLELLSKIG
FT                   GFSNYKERCNYMKEHYPLSKSYKHKKIEYEKKKVLTIEEIYQEVKAEIIYILHNYEEDE
FT                   FLDAVGCSLSELTADIAFSHVLKYIEKYKILILEKGVSAFDEGGVYFILKDNYSYHLQD
FT                   RNIKLTPHGSIVFDDTIIANIRFNTLSDRKKKISMDILSDRLIEYGRLPTDYTWGYKDG
FT                   SSTFNTAMVILDECLVDYNLNDEKCMNLTRKFAEEFLIHFNQDKEANISEYRVIKWVHA
FT                   NSSII"
FT   gene            complement(174457..174597)
FT                   /locus_tag="Arnit_0183"
FT   CDS_pept        complement(174457..174597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0183"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sbp:Sbal223_2179 hypothetical protein; SPTR:
FT                   B8EES1 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91850"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4B7"
FT                   /protein_id="ADG91850.1"
FT                   /translation="MKPIKPGPKPIADSTGKPDQRRRDNKDTEGNTEELKPSKSTKKKS
FT                   D"
FT   gene            174754..175191
FT                   /locus_tag="Arnit_0184"
FT   CDS_pept        174754..175191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0184"
FT                   /product="membrane-flanked domain protein"
FT                   /note="InterPro IPR005182; KEGG: pin:Ping_2576
FT                   membrane-flanked domain-containing protein; PFAM:
FT                   membrane-flanked domain; SPTR: A1SXT2 Membrane-flanked
FT                   domain; PFAM: Bacterial membrane flanked domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91851"
FT                   /db_xref="GOA:D5V4B8"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4B8"
FT                   /protein_id="ADG91851.1"
FT                   /translation="MGYVEKNLMPDEKILFIGKIHWVIYLFGAIVFVVGLVLPLGIVKT
FT                   LIIIVGLFLLIKAFIFAKTTELIITSKRVIAKFGLIRRNTVELNHNQVESLNVKQGIID
FT                   RIVNAGGILIKGTGGSSAPIPSIAKPLEFRKEYFEIVENNK"
FT   gene            175208..175789
FT                   /locus_tag="Arnit_0185"
FT   CDS_pept        175208..175789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0185"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pmi:PMT9312_0461 apocytochrome f; SPTR: B5RPZ7
FT                   Heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91852"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4B9"
FT                   /protein_id="ADG91852.1"
FT                   /translation="MKTIIKLVLIGLLTTCSLNAKELFDLRIQDFSNTLEDKQIDSRYK
FT                   INESIIVETNTLKERKGGYYYTTPSYRKGFFNIELLTPVKSWIYNYSVQYEYGKRLLKF
FT                   IDESGKNLVFEFGNKEFTINEKEYKTNIEDEELFITIEGVNGEFKITMNGQTLNAKVVG
FT                   FGNLKKIETSLTGDGVNRDKLYGATLISHD"
FT   sig_peptide     175208..175267
FT                   /locus_tag="Arnit_0185"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            175782..175997
FT                   /locus_tag="Arnit_0186"
FT   CDS_pept        175782..175997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0186"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: Q54TM4 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91853"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4C0"
FT                   /protein_id="ADG91853.1"
FT                   /translation="MIKYIIVIGLININLFALKIEAVNADIKDNSKNFYIENKRKIYKP
FT                   LKIKTIKPMKSVFLKPNKNIILYPLK"
FT   gene            176017..176124
FT                   /locus_tag="Arnit_0187"
FT   CDS_pept        176017..176124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91854"
FT                   /db_xref="GOA:D5V4C1"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4C1"
FT                   /protein_id="ADG91854.1"
FT                   /translation="MFDFIKIDMPLVLFCLFIIYVILLRNNKQIKKFCD"
FT   gene            176223..176456
FT                   /locus_tag="Arnit_0188"
FT   CDS_pept        176223..176456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0188"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vha:VIBHAR_04938 hypothetical protein; SPTR:
FT                   A6AK10 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91855"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4C2"
FT                   /protein_id="ADG91855.1"
FT                   /translation="MKKGLHVSNGFNVNLENVCTWKVQKEWIQIETNSNDGMNIINIIL
FT                   ETSNETVGFSHRVPVNEFKRIEREISEYMGGK"
FT   gene            176681..177151
FT                   /locus_tag="Arnit_0189"
FT   CDS_pept        176681..177151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0189"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbl:CLK_A0086 hypothetical protein; SPTR:
FT                   B6SBW0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91856"
FT                   /db_xref="GOA:D5V4C3"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4C3"
FT                   /protein_id="ADG91856.1"
FT                   /translation="MEKEDRIELLKCNIGRFDFYYGSVNFKSSFLIIANITILGFLLSN
FT                   VEKLCFPVFVLNAVFIFFSILFVLFAINPYLKSVDAGNSILFFGDIASKKINVYKTNFN
FT                   NVNEDKYIEDLVEQNYYLSTGLKNKFKYLNIATISFIISIICYFIQVIYVSF"
FT   gene            177163..177711
FT                   /locus_tag="Arnit_0190"
FT   CDS_pept        177163..177711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0190"
FT                   /product="protein of unknown function DUF955"
FT                   /note="COGs: COG2856 Zn peptidase; InterPro IPR010359;
FT                   KEGG: rlt:Rleg2_3868 protein of unknown function DUF955;
FT                   PFAM: protein of unknown function DUF955; SPTR: B5ZUD7
FT                   Putative uncharacterized protein; PFAM: Domain of unknown
FT                   function (DUF955)"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91857"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4C4"
FT                   /protein_id="ADG91857.1"
FT                   /translation="MPINITRRNIIADEEHASSLSKKEIKDIAEAYAEILYKPLEDDIK
FT                   DVVTKKLNGSFTEFNPFINQDISGSLEVDMSNETFSITLSQFTSNVRDNFTIAHELGHL
FT                   FLHCNTFNDGELVHFKRFESNRLEWEANWFAGSFLMPKNIFERVCVENEYFIPSIAIRF
FT                   GVSEQAVTIRMKELGIGGV"
FT   gene            177698..178759
FT                   /locus_tag="Arnit_0191"
FT   CDS_pept        177698..178759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0191"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: lbl:LBL_0729 hypothetical protein; SPTR:
FT                   Q054F3 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91858"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4C5"
FT                   /protein_id="ADG91858.1"
FT                   /translation="MEGYDESHLLYFFSVDVINSTAFKNDKQKREVNNSKYCVSSSWAI
FT                   AFKNFYDEIRKILNDKYNEIIKRENIEKENFYFPFQWRIIGDEIVFFSVVKSFVHILYH
FT                   LEASKNTIVDFNKDKKKIPFSVKGTAWIAGFPVNNTIIKSSSEKGLNFNSNGKISDFEN
FT                   VNFLGPSIDIGFRISKYSSSRKFILSIDLAMIVTYLINNKQSISKFKFYFDNNQMLKGV
FT                   GVDGQYPIIWILSEDDIKEKDSFYLEKSSPCCTKLLYDHLKSTLENLNLLPPFIIGCEH
FT                   SEFTIPDEYDSLYKGVIEEFEYAFNVVQDIESKNEKQSESKNEEQSESKNGEQEIKLTV
FT                   EDNIEKWVKKDFE"
FT   gene            complement(178740..179840)
FT                   /locus_tag="Arnit_0192"
FT   CDS_pept        complement(178740..179840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0192"
FT                   /product="integrase family protein"
FT                   /note="COGs: COG4974 Site-specific recombinase XerD;
FT                   InterPro IPR011010:IPR013762:IPR002104; KEGG: sun:SUN_2452
FT                   phage integrase family site specific recombinase; PFAM:
FT                   integrase family protein; SPTR: A6QD27 Site-specific
FT                   recombinase, phage integrase family; PFAM: Phage integrase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91859"
FT                   /db_xref="GOA:D5V4C6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4C6"
FT                   /protein_id="ADG91859.1"
FT                   /translation="MARYTTKYTGVIYRDSITNEKTDKTYYIRYKDINNKTKELKIGKY
FT                   SEGVRENYCNQKRNEIITKLRLGEEPPAMANKKQKNSIAFKYLQDKYFETRRETKSKYS
FT                   DIVTANKHLVPFFEKKNLETLTKEDIKALTKLLKTKTTPKGTQLSPKSRNNILTSFASI
FT                   INYGLKEELIKNDVTKYIEKERIDNERERYLELEEINKLYEEVEHNPRLYLFCKLALTT
FT                   GGRLGTILNISKMDLDFSNQIITLKDFKNNSTYKTFLTDDVTNLLSNYCKNLNQQDKIF
FT                   IEPTTIQRQILKILHSLFNVGIDKEDRKNLVVLHTLRHTFASHLAIKGTPIFTIQKLMN
FT                   HRDIKMTLRYAKLAPDSGRCAIQNLF"
FT   gene            complement(180301..180777)
FT                   /locus_tag="Arnit_0193"
FT   CDS_pept        complement(180301..180777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0193"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lbf:LBF_1603 sensor histidine kinase of a two
FT                   component response regulator; SPTR: A8UEY5 Possible sensor
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91860"
FT                   /db_xref="GOA:D5V4C7"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4C7"
FT                   /protein_id="ADG91860.1"
FT                   /translation="MKNSKQIIINTSDILAVIAVIISLFSLYLSIKPDDTTLTIQTSEL
FT                   KGCMANRPNCYQLFIYNNDKAPCFELNIDFKKKDFNKVLFITNYKESSLFHILPNSNKI
FT                   SFKGMKTIEMNSSWLGYLDKKEIAYFVFFPSQYNKSKKEVTISCIGYSKTIQLN"
FT   gene            180919..181413
FT                   /locus_tag="Arnit_0194"
FT   CDS_pept        180919..181413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0194"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: A2G0B3 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91861"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4C8"
FT                   /protein_id="ADG91861.1"
FT                   /translation="MKKNLIQLFIIGLIGIGFIGCGPGPMQIQGIGPLNTPVFKPVILD
FT                   TVNDGSKEVYFKESVVGLYENKEFKGFGNFVITDNGVYYVRWDATAYIYTTSYQIKIND
FT                   IKMLTTDKVIRSFLPDSDILVIEDKRGQKVGFSIVKKLAAKNIIYELIEKKGKGKLPTN
FT                   K"
FT   gene            181501..182220
FT                   /locus_tag="Arnit_0195"
FT   CDS_pept        181501..182220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0195"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reh:H16_A0885 hypothetical protein; SPTR:
FT                   B0G6Z4 Putative uncharacterized protein; PFAM: Sulfolobus
FT                   plasmid regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91862"
FT                   /db_xref="InterPro:IPR008848"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4C9"
FT                   /protein_id="ADG91862.1"
FT                   /translation="MDKVTLIDDNIDIGIKFRNRTVGPELNLVYDYIDNISNNFKHKTN
FT                   NLAIFIEPLVDTTYPDIVLLEYSPNSIDNWNDIRNKLEKNDIKLLSIIKQFESITSESL
FT                   HKRTNITHKNLLFSLENLLDSGLIDRKKEKWTIKSMKEIFCVKKIISVEAKINQLDNLL
FT                   HQADINNWFSSESYALSSVKKPQKKTLNKFIDYGIGLHSLQDKKVLELTKAKKQSIPNN
FT                   YITWMFNEWVGRYISQR"
FT   gene            182227..183042
FT                   /locus_tag="Arnit_0196"
FT   CDS_pept        182227..183042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0196"
FT                   /product="serine/threonine protein kinase"
FT                   /note="COGs: COG0515 Serine/threonine protein kinase;
FT                   InterProIPR011009:IPR008271:IPR002290:IPR020635:IPR
FT                   000719:IPR017442; KEGG: drm:Dred_0786 protein kinase; PFAM:
FT                   Serine/threonine-protein kinase-like domain; SMART:
FT                   serine/threonine protein kinase; Tyrosine-protein kinase,
FT                   subgroup, catalytic domain; SPTR: A4J2M1 Protein kinase;
FT                   PFAM: Protein kinase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91863"
FT                   /db_xref="GOA:D5V4D0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4D0"
FT                   /protein_id="ADG91863.1"
FT                   /translation="MEECLSKLGLTDISHLKSAGQKDVYSGKSDKYGDIVIKIIRPGQN
FT                   EERIEREIEIIERLDNINTSLIYEHGDIDCPRGKVKYIIESYIEGRCLKDYLKDEKTLS
FT                   YSDVVDYLKQMLEILEILEKNNIVHRDIKPDNIIISESKKYFLIDFGIARDLDKDSITA
FT                   TGADYGPATVLYAPIEQIENKKDLIDSRVDLYSTCIIAYEMITGKNPYYEDGCGMPKIM
FT                   RNVEKGKFKKLVSEEYEDIDTFINTCMNKFIGRRPESAADAKKWFNEII"
FT   gene            183054..184235
FT                   /locus_tag="Arnit_0197"
FT   CDS_pept        183054..184235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0197"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:H16_A0883 hypothetical protein; SPTR:
FT                   B0G6Z6 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91864"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4D1"
FT                   /protein_id="ADG91864.1"
FT                   /translation="MDLFLQIGHGMMSLSKDLIAKWGTGTVILSPRDLTEKQAVSFSDE
FT                   IIKKKGKTLFDPQYYNPHADHKKLTEWRHWFNQYETSLLSEDKYIANLFNEIKSINDDT
FT                   QTYAYIIPGILCDNIDKHWLNPQQLFLDNANKYFTDKEKYATLALEESLITDEDSIEEL
FT                   IQVTSNWDVDGYYIVPEGEYLTNEEFWLSNLALLVAGLKLQNKKVIVGYSNHQMLLLSC
FT                   SNVDAIASGTFLNIRHFSTDKFDETDEDSQSRRATWYYCPQALSEYRKRTLDTAFKKGC
FT                   INLLKPYGKDTDFSSILFKGVTPSSTEYKDTLSFKHYLDTLKTQCLLAKKDTFENTILF
FT                   HYEMADNAYKFIKKLKDEGVRENGRSFTKIYDSYKDAISTVKVQRGPLLKRKW"
FT   gene            complement(184238..184966)
FT                   /locus_tag="Arnit_0198"
FT   CDS_pept        complement(184238..184966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0198"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="COGs: COG0631 Serine/threonine protein phosphatase;
FT                   InterPro IPR001932:IPR014045; KEGG: tpd:Teth39_1314 protein
FT                   serine/threonine phosphatase; PFAM: Protein phosphatase
FT                   2C-like; SMART: protein phosphatase 2C domain protein;
FT                   SPTR: C6PE61 Protein serine/threonine phosphatase; PFAM:
FT                   Protein phosphatase 2C"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91865"
FT                   /db_xref="GOA:D5V4D2"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4D2"
FT                   /protein_id="ADG91865.1"
FT                   /translation="MFNFYGKSTKSYLKEENEDSLLVNKIISNDKPIKGSSIKESILFA
FT                   IADGVGGSKYGKIASNYILSELSKNRNLLNHQIILNIIKNTHQYLIKNYSNDAQTVVSI
FT                   IWIENEKFAIYHIGDTRVYLMTKRNFIQLTNDHTYVQELVDKGIISENMKSSHNKKNII
FT                   TQSLGGSHEIKIDIYNGLIEPEDKLLLSTDGIHDYIDDNKIHEILFKTNNLEKNINTLI
FT                   TLAKDNGSKDDLSGIVVFYK"
FT   gene            complement(185082..185325)
FT                   /pseudo
FT                   /locus_tag="Arnit_0199"
FT   gene            186148..187242
FT                   /locus_tag="Arnit_0200"
FT   CDS_pept        186148..187242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0200"
FT                   /product="Extracellular solute-binding protein, family 7"
FT                   /note="COGs: COG4663 TRAP-type mannitol/chloroaromatic
FT                   compound transport system periplasmic component; InterPro
FT                   IPR017909:IPR018389:IPR006311; KEGG: tcx:Tcr_1416 TRAP
FT                   dicarboxylate transporter-DctP subunit; PFAM: Extracellular
FT                   solute-binding protein, family 7; SPTR: Q31FR3 Tripartite
FT                   ATP-independent periplasmic (TRAP-T) transporter, DctP
FT                   subunit; PFAM: Bacterial extracellular solute-binding
FT                   protein, family 7; TIGRFAM: Tat (twin-arginine
FT                   translocation) pathway signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91866"
FT                   /db_xref="GOA:D5V4D3"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR026289"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4D3"
FT                   /protein_id="ADG91866.1"
FT                   /translation="MTKNRRDFIKKTGLAGITAAVAIPSVASADSKKKFRWKMTNCYGA
FT                   GAPFYSTGPGSASYFCKRVEELTNGRLRIKHYPAGELIPAMEGFDAVSKGTIEMNWGNS
FT                   FFWAGKTFAAQYFTAVPFGMTFEGTNAWLQFGGGQELWDEVYKPFNVIGLAAGNTGTQM
FT                   TGWFKKEINGVKDLNGLRMRVPGLAGKVLEQLGVSVKLLPGGEIFPALERGVIDAAEFV
FT                   GPYQDRRMGFQKAAKYYYTTGWGEPSNTTECLINKDAWATLPKDIQAIVKTVASECNLM
FT                   GLSWSEANNSEALEDLVKNQGVIVKTLPDEVIKKLREVTFSTYDKLTAKDPLVKKVHES
FT                   YFNFKTIHDGWQSKGELVVMTKLL"
FT   sig_peptide     186148..186234
FT                   /locus_tag="Arnit_0200"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            187239..187751
FT                   /locus_tag="Arnit_0201"
FT   CDS_pept        187239..187751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0201"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter DctQ component"
FT                   /note="COGs: COG4665 TRAP-type mannitol/chloroaromatic
FT                   compound transport system small permease component;
FT                   InterPro IPR007387; KEGG: tcx:Tcr_1415 tripartite
FT                   ATP-independent periplasmic transporter DctQ; PFAM:
FT                   Tripartite ATP-independent periplasmic transporter DctQ
FT                   component; SPTR: Q31FR4 Tripartite ATP-independent
FT                   periplasmic (TRAP-T) transporter, DctQ subunit; PFAM:
FT                   Tripartite ATP-independent periplasmic transporters, DctQ
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91867"
FT                   /db_xref="GOA:D5V4D4"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4D4"
FT                   /protein_id="ADG91867.1"
FT                   /translation="MMKQLALLANRLDTLIMRIGQITSWLIFILVLLVAGDVLFRYFFH
FT                   ISSIAEQEFQWHLLAAIAIFGSAYTFQQGEHVRVDLFYHNYSKNVKRWMNILIPLIIIL
FT                   PFSAFIIYLSSDYVLQSYANNEVSPDPGGLPYRYLVKGLIPLGFILIFIQGLAVLLKAI
FT                   TKTESEL"
FT   gene            187755..189080
FT                   /locus_tag="Arnit_0202"
FT   CDS_pept        187755..189080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0202"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="COGs: COG4664 TRAP-type mannitol/chloroaromatic
FT                   compound transport system large permease component;
FT                   InterPro IPR010656:IPR004681; KEGG: tcx:Tcr_1414 TRAP
FT                   dicarboxylate transporter-DctM subunit; PFAM: TRAP
FT                   C4-dicarboxylate transport system permease DctM subunit;
FT                   SPTR: Q31FR5 Tripartite ATP-independent periplasmic
FT                   (TRAP-T) transporter, DctM subunit; TIGRFAM: TRAP
FT                   dicarboxylate transporter, DctM subunit; PFAM: DctM-like
FT                   transporters; TIGRFAM: TRAP transporter, DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91868"
FT                   /db_xref="GOA:D5V4D5"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4D5"
FT                   /protein_id="ADG91868.1"
FT                   /translation="MDPQILAILMVVSLFTLILAGVPVAFAIAGAGLFFGAIGVDMNLF
FT                   NLLPARIFGVLTNYTLLAVPLFVFMGILLEKSRIAEKMLDVLGLLSGKKPGGMAIAIIV
FT                   VGILMGASTGIVGATVVTLTMISLPTLLRRNYSHSVSCGTICASGTLGQILPPSLVLIL
FT                   LADISGEAIGPLFAAALVPGLLLACMYILYIVFLSWFFPQHVPPIDIEERESYSRKELY
FT                   IEFIKSVAPPFILIFAVLGSIIGGLAAPTEAASMGAIGSLVIVFLSKRLSMEVLRETLY
FT                   ETMKVTGMIMFVLLASQIFGLSFRGLEGDYLVEDLFAAIPGGMWGSIIFMMFVLFVLGF
FT                   FLEWIEISYIVLPLVLPIFHALDINMIWLGILVALNLQTSFLTPPFGWSLFFLKGVAPK
FT                   EIKTMEIYKGVLPFIAIQIFVIGLVMLFPDIALWLPKAIGWM"
FT   sig_peptide     187755..187835
FT                   /locus_tag="Arnit_0202"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            189133..190725
FT                   /locus_tag="Arnit_0203"
FT   CDS_pept        189133..190725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0203"
FT                   /product="Gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /note="COGs: COG0405 Gamma-glutamyltransferase; InterPro
FT                   IPR000101; KEGG: tcx:Tcr_1413 gamma-glutamyltransferase;
FT                   PFAM: gamma-glutamyltranspeptidase; PRIAM:
FT                   Gamma-glutamyltransferase; SPTR: Q31FR6
FT                   Gamma-glutamyltransferase 2. Threonine peptidase. MEROPS
FT                   family T03; PFAM: Gamma-glutamyltranspeptidase; TIGRFAM:
FT                   gamma-glutamyltranspeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91869"
FT                   /db_xref="GOA:D5V4D6"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4D6"
FT                   /protein_id="ADG91869.1"
FT                   /translation="MDKLLKTQTSQKGMVVSPHHAASDAGLEILKKGGNAIEASIAVAS
FT                   SLAIHYPHMTGIGGDAFWLVYDPKEGVSFIEASGYSGYDVKKELYEGLNEIPFRGKLAA
FT                   NTAAGAVSAWDLAFEKSKTWGGKMTPATLLSEAISSANSGIKVSKSLSETLKEKQTELQ
FT                   ADTFFESVYYPNKEVPKEGDILIQKALGETLKRISQEGFDTFYRGSLSGDIANDFSKRE
FT                   GFITLNDLNNHQASWNKALELQTSQAKLFNASAPTQGVASLMILGLFDRWVEKLPQLDS
FT                   SSHVHLLVEATKIAFSHRAKMDTSASAEELQAWLEPEYLDKLSEKIDLQKAKAWGKETA
FT                   PGDTTWFGAVDSQGRVVSAIQSIYHEFGSGLMLPNTGIVWQNRGCSFSLDSSHIQTLMP
FT                   HKKPFHTLNPAIALFNDGRVMAYGTMGGDGQPQTQAAVYSRYAYYNDDLQTTINKPRWL
FT                   LGRTWGNSSESLKLESRFPLDCQEDLVKKGHEVEILSSLDSAVGHAGAIVWHPTGKIEG
FT                   ASDPRSDGKASNL"
FT   gene            190744..191550
FT                   /locus_tag="Arnit_0204"
FT   CDS_pept        190744..191550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0204"
FT                   /product="protein of unknown function DUF81"
FT                   /note="InterPro IPR002781; KEGG: tcx:Tcr_1412 hypothetical
FT                   protein; PFAM: protein of unknown function DUF81; SPTR:
FT                   Q31FR7 Putative uncharacterized protein; PFAM: Sulfite
FT                   exporter TauE/SafE"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91870"
FT                   /db_xref="GOA:D5V4D7"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4D7"
FT                   /protein_id="ADG91870.1"
FT                   /translation="MNELLVLLPILLASGVIAGLLAGLLGVGGGIVIVPMLYHIFIYLN
FT                   IDITVAIPLSIGTSLSTIVVTSIMSARSHHKKGGIDWDLTKRWIPLVIIGVLIGSFSSK
FT                   YIDASTLKFMFGILLVVVSLNMIISSFKSIIIAKQLPGNFGQSIFGLLLGGFASLLGIG
FT                   GGTLMVPLLTLFSYPIHKAVSTASIFGLVISIPATIGYIIVGWGAPNLPVGSTGYVNWI
FT                   GFIALVPMTMIFAPLGVKLAYRLNVKQLKVAFAVFLACVGVKMLLV"
FT   sig_peptide     190744..190797
FT                   /locus_tag="Arnit_0204"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(191583..191684)
FT                   /locus_tag="Arnit_0205"
FT   CDS_pept        complement(191583..191684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0205"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: abu:Abu_1173 hypothetical protein; SPTR:
FT                   A8EU09 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91871"
FT                   /db_xref="GOA:D5V4D8"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4D8"
FT                   /protein_id="ADG91871.1"
FT                   /translation="MSDLQNEVIGFVLIAIAVIAFAYYKQRIEDKDK"
FT   gene            complement(191704..191898)
FT                   /locus_tag="Arnit_0206"
FT   CDS_pept        complement(191704..191898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0206"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tko:TK0357 hypothetical protein; SPTR: Q5JCW8
FT                   Hypothetical membrane protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91872"
FT                   /db_xref="GOA:D5V4D9"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4D9"
FT                   /protein_id="ADG91872.1"
FT                   /translation="MLIYLVIFVILGFVLAKFIKKPKVALLIALIISIAIGVFYAPMWG
FT                   IVCLGEMAFGYFAFIFTRD"
FT   gene            complement(191916..194171)
FT                   /locus_tag="Arnit_0207"
FT   CDS_pept        complement(191916..194171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0207"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterProIPR004358:IPR003594:IPR009082:IPR000014:IPR
FT                   001610:IPR005467:IPR000700:IPR013767; KEGG: abu:Abu_1637
FT                   two-component sensor histidine kinase; PFAM: ATP-binding
FT                   region ATPase domain protein; PAS fold domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; PAC
FT                   repeat-containing protein; PAS domain containing protein;
FT                   SPTR: A8EVB1 Sensor protein; TIGRFAM: PAS sensor protein;
FT                   PFAM: Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase; His Kinase A (phosphoacceptor) domain; PAS fold;
FT                   TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91873"
FT                   /db_xref="GOA:D5V4E0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4E0"
FT                   /protein_id="ADG91873.1"
FT                   /translation="MKIREYSLLTKLGIIIITLVVSIMLINSAYNYQKTKSSILKEMKD
FT                   DSKESILSLKSNISILLASYSPNEYEQIITNELKDKDIFAIVIKDYNLGKVLGKNVYIS
FT                   GKIKNKNSIIEDYDDKNEEQNRQLVNSFFSNSSNITDSSNNILGTVTIYLSDSTLNEEL
FT                   DTIIYDSVINTIFLSVLLILFLFISIKYYILKPISNIIDTINNDNTYGIPNKTIPYSKS
FT                   TEINELSSSINKMILSIKDSRAILEKSQHRLEYLLDFSPISIRITKKIKDNKDYVIFAN
FT                   RAYSQLLQIDKDNVYGINPKNYYINKSAYENIEKELLAGNSIYNMTMEVKINNKQVWVL
FT                   ASYMNIEYDGENAVIGWFYDITKEKENEANLHKALELQTTIFDNSGYMMISTNKEGVIQ
FT                   QFNKEAERLLGYEAKEVVNIHTPILFHLKSEIKQRKIYLSKELNINITSSFEVLAAKTN
FT                   LGLKNEHEWTVISKNGEHIPVLVTITTLRNKDNETYGYLSISQDISQRKLLESQSKLAS
FT                   MGEMIGNIAHQWRQPLSVISTIASGILIKNELVEEISPQIVYDMEKIMSQTNYLSQTID
FT                   DFRNFIKDTNQKEKISIVETIEKALTILRPSINNNHINLITNFKSDCEIEGFQNQIIQA
FT                   FINIINNAKDAIKEKLKEDTEKLIFIETHKINNQLILVIKDNAGGIDDSIMHKVFEPYF
FT                   TTKHKSIGTGIGLSMSHQIITEYHDASIEVFNSTYTYDKKQYIGAYFQITFNNFCDT"
FT   sig_peptide     complement(194079..194171)
FT                   /locus_tag="Arnit_0207"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(194175..195143)
FT                   /locus_tag="Arnit_0208"
FT   CDS_pept        complement(194175..195143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0208"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="COGs: COG1879 ABC-type sugar transport system
FT                   periplasmic component; InterPro IPR001761; KEGG:
FT                   vvu:VV2_0872 ABC-type sugar transport system, periplasmic
FT                   component; PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; SPTR: A4U487 ABC-type sugar
FT                   transport system, periplasmic component; PFAM: family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91874"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4E1"
FT                   /protein_id="ADG91874.1"
FT                   /translation="MYIKKLFIIFLFTFISSIEAYGVNVQNKKIAYLVANLEIPFWQIM
FT                   KKGIKTNCNKLGYDLEVLDAQDNQKKELENTVKAIKDKVDGIVLSSINSYTAGTILKLT
FT                   KKANIPVVISDTGTRSKDYISYISSNNKLGAYDLGKYLTKELTKKGFEKGEIGIIALPQ
FT                   KKIITQERTAGFLKALDESPFKSADLKQVKTRTEEETYNLIKNMIIQYPDLHTIWLQSS
FT                   KTYKSAIKAINDFKKQNEILLITFDLEPDFLELIPKNIILASAVQQPFIMGELALEQMD
FT                   NYLKGKKVQKVIELPVNIITADNIKEKTAFINHNVLGIQSN"
FT   sig_peptide     complement(195084..195143)
FT                   /locus_tag="Arnit_0208"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            195325..196113
FT                   /locus_tag="Arnit_0209"
FT   CDS_pept        195325..196113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0209"
FT                   /product="mannosyl-3-phosphoglycerate phosphatase family"
FT                   /note="COGs: COG3769 hydrolase (HAD superfamily); InterPro
FT                   IPR013200:IPR006379:IPR006381; KEGG: pcr:Pcryo_2501 HAD
FT                   family hydrolase YedP; PFAM: Haloacid dehalogenase domain
FT                   protein hydrolase type 3; SPTR: Q1Q7R2 HAD-superfamily
FT                   hydrolase YedP; TIGRFAM: mannosyl-3-phosphoglycerate
FT                   phosphatase family; HAD-superfamily hydrolase, subfamily
FT                   IIB; PFAM: haloacid dehalogenase-like hydrolase; TIGRFAM:
FT                   mannosyl-3-phosphoglycerate phosphatase-related protein;
FT                   mannosyl-3-phosphoglycerate phosphatase family;
FT                   HAD-superfamily hydrolase, subfamily IIB;
FT                   mannosyl-3-phosphoglycerate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91875"
FT                   /db_xref="GOA:D5V4E2"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR006381"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4E2"
FT                   /protein_id="ADG91875.1"
FT                   /translation="MLPKDTKTDYLIFTDLDGTLLDHKTYDFNEAKEILEYISEQKIPL
FT                   IIVTSKTKDEVIELQKRLGISYPFIIENGAGIFIPKEKSFELISLGKSYETTITSFKKY
FT                   SKEFPIKGFHEMSDEEVSLYTGLSKDKSNKAKKRTFSEPFILKDEMNIEKLKQLVLEDG
FT                   FDVVKGGRFYHLITFGQDKAKAVIEMKKYYENLYNKSFKTIALGDGENDITMLKCVDIP
FT                   ILIKKYDGSFINCKINNLIKSRFIGPKGWNDSLKGVLNVK"
FT   gene            196103..197416
FT                   /locus_tag="Arnit_0210"
FT   CDS_pept        196103..197416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0210"
FT                   /product="Glycerate kinase"
FT                   /EC_number="2.7.1.31"
FT                   /note="COGs: COG2379 Putative glycerate kinase; InterPro
FT                   IPR007835; KEGG: pmx:PERMA_1579 putative hydroxypyruvate
FT                   reductase; PFAM: MOFRL domain protein; PRIAM: Glycerate
FT                   kinase; SPTR: C0QRQ0 Putative hydroxypyruvate reductase;
FT                   PFAM: MOFRL family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91876"
FT                   /db_xref="GOA:D5V4E3"
FT                   /db_xref="InterPro:IPR007835"
FT                   /db_xref="InterPro:IPR025286"
FT                   /db_xref="InterPro:IPR037035"
FT                   /db_xref="InterPro:IPR038614"
FT                   /db_xref="InterPro:IPR039760"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4E3"
FT                   /protein_id="ADG91876.1"
FT                   /translation="MLNKKDLENVFLSILDDIHPKKLIKKQCKFENDKFYINAESIEIP
FT                   KNKKIHILGSGKAVLSMAEALYEIMEDKIEKALLVGAYENNLKKQDLTYIKSTHPLPSE
FT                   KSVEGAKALVKEFKSLGEDDFFIYLLSGGNSALVELPADEISLEEFQKTTKLMLENSMP
FT                   IESINCVRKHISQVKGGRLARFTKAKGVVLTLSDVLGDNLEAIGSAPLFFDSSTFQDAF
FT                   DALNKYNIFEKVPDSVQSYLKKALNSKDLETPKSESQKIKHCLIGSNDILLNVAKNLLE
FT                   KENLNPIIVDEKIDDDVEIVCKNLLQFCKEKKEGCFIFGGEATVNVSGTGKGGRNQHLV
FT                   LSFLDSYPKDEDIIFLSAASDGIDGNSDASGAIIDKDTLKKVEELNLDIKAYMKNFDSN
FT                   TFFDKLNQLLKPGPTHNNMLDIVIIFINSNKNKGDKNV"
FT   gene            197409..198620
FT                   /locus_tag="Arnit_0211"
FT   CDS_pept        197409..198620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0211"
FT                   /product="putative glycosyltransferase"
FT                   /note="KEGG: pcr:Pcryo_2502 putative glycosyltransferase;
FT                   SPTR: Q1Q7R1 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91877"
FT                   /db_xref="GOA:D5V4E4"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4E4"
FT                   /protein_id="ADG91877.1"
FT                   /translation="MSDFFQNGVITTLQKLGDRTLEDMERELLRFSQRRRMVLLLPALY
FT                   SEFQTPSMHKIIDELKNVKYLYKIILGLDQATKEQFEEVKELMSILPCEVDILWNDGPN
FT                   IKELYDDLTREGFPGLETPGKGRNVWTMMGYGLADKDAYAFALHDCDIVNYNREIPARL
FT                   FFPIVHPALDFEFNKGFYSRVTNKLHGRATRLLYTPLLNSLKKVYGGNRYLDYMESFRY
FT                   SLSGEFSFIRSLGRGIGISPTWGLEVSTLSEVYKNTSNRRICQTEIMESYEHKHQELSS
FT                   QSEGGGIYKMANDIAKTIFRVMAQEGVVFSSSSFKTLLATYFQESRFEISKYNALSKLN
FT                   ALDYNREKEIEAVNTFQDAIKKAAEEFYEDPMGIPSLSSWITVRSVMPEFSAKFIKYVK
FT                   EDNE"
FT   gene            198617..200365
FT                   /locus_tag="Arnit_0212"
FT   CDS_pept        198617..200365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0212"
FT                   /product="alpha amylase catalytic region"
FT                   /note="COGs: COG0366 Glycosidase;
FT                   InterProIPR017853:IPR013781:IPR006589:IPR016377:IPR 006047;
FT                   KEGG: lmc:Lm4b_02813 sucrose phosphorylase; PFAM: alpha
FT                   amylase catalytic region; SMART: alpha amylase catalytic
FT                   sub domain; SPTR: A6DP96 Sucrose phosphorylase; PFAM: Alpha
FT                   amylase, catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91878"
FT                   /db_xref="GOA:D5V4E5"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR016377"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR033746"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4E5"
FT                   /protein_id="ADG91878.1"
FT                   /translation="MKGPKHISDPKHTINKRLHRLYPEEIAQRAVNDIIDLIFKYKQRI
FT                   KPSDYRLSQKDIILITYGDQVSKLHEPSLETLNNFMNDHLKGVINSIHILPFYPYSSDD
FT                   GFSVVNYNAVDPHMGSWREIESISKDYRLMVDGVINHISQFSDWFKAYLAGDPYFQDFF
FT                   INVDPSIDLSKVVRPRATPLLSEFIDDEGKIKNIWTTFSKDQVDLNYKSHRVLRNVLDA
FT                   LFYYIEKGATLIRLDAIAFIWKEIGTSCVHLPQTHELIQLMREVLHEVAPEVIIITETN
FT                   VPHNENISYFGSGEDEAQMVYNFALPPLLLHSILNSNTKKLTAWAKTLTLPSDKVCFFN
FT                   FTASHDGIGMRPIKGILEDEEIENLVKTVEDHGGLVSYRAEEDGSQTPYELNCSYIDAL
FT                   THPKEDQYLRVKRMLVTQAAVLAMPGVPGIYFHSLVGSKNYHDGVKHTGVNRTINREKY
FT                   NIDWLENELSSQGTLAKTMFDSYKRLISIRISEEAFNPFGEFEILDLDDRLFVIDQSCC
FT                   GNENRIVAIHNFSNEEVMCKLPVSISLPLCDILSSNCMSKNEEKTEKMNEIKLEPYQIM
FT                   WLKGKI"
FT   gene            200387..201238
FT                   /locus_tag="Arnit_0213"
FT   CDS_pept        200387..201238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0213"
FT                   /product="UTP-glucose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.9"
FT                   /note="COGs: COG1210 UDP-glucose pyrophosphorylase;
FT                   InterPro IPR005835:IPR005771; KEGG: abu:Abu_0839
FT                   UTP--glucose-1-phosphate uridylyltransferase; PFAM:
FT                   Nucleotidyl transferase; PRIAM: UTP--glucose-1-phosphate
FT                   uridylyltransferase; SPTR: A8ET30 UTP--glucose-1-phosphate
FT                   uridylyltransferase; TIGRFAM: UTP-glucose-1-phosphate
FT                   uridylyltransferase; PFAM: Nucleotidyl transferase;
FT                   TIGRFAM: UTP-glucose-1-phosphate uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91879"
FT                   /db_xref="GOA:D5V4E6"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4E6"
FT                   /protein_id="ADG91879.1"
FT                   /translation="MNAKDKTITSCLFPAAGYGTRFLPATKAMPKEMLPVLTKPLIQYG
FT                   VEEAMEAGCDIMSVITGRGKRAITDHFDISYELEHQIQGSSKEKMLADIRNIIDKCTFT
FT                   YTRQNEMKGLGDAIYKGKVLVGDINPFAVILADDLCVNPKGDGILAQMVKLYNKYKCCI
FT                   VACMEVPKEDVHKYGVIEGNQIEDGVFMVSNMVEKPDNDKAPSNLAVIGRYILTPDIFE
FT                   VIQNTKPGKNGELQITDALCTQAKKGMVMAYKFQGKRFDCGSVDGFVEATNYFYNLENK
FT                   KK"
FT   gene            201240..202700
FT                   /locus_tag="Arnit_0214"
FT   CDS_pept        201240..202700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0214"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /note="COGs: COG0364 Glucose-6-phosphate 1-dehydrogenase;
FT                   InterPro IPR001282:IPR016040; KEGG: mmw:Mmwyl1_1038
FT                   glucose-6-phosphate 1-dehydrogenase; PFAM:
FT                   glucose-6-phosphate dehydrogenase; PRIAM:
FT                   Glucose-6-phosphate dehydrogenase; SPTR: A6VU40
FT                   Glucose-6-phosphate 1-dehydrogenase; TIGRFAM:
FT                   glucose-6-phosphate 1-dehydrogenase; PFAM:
FT                   Glucose-6-phosphate dehydrogenase, NAD binding domain;
FT                   Glucose-6-phosphate dehydrogenase, C-terminal domain;
FT                   TIGRFAM: glucose-6-phosphate 1-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91880"
FT                   /db_xref="GOA:D5V4E7"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4E7"
FT                   /protein_id="ADG91880.1"
FT                   /translation="MNTKNNLCDFILFGGHGDLAFRKLMPALYHLCKDKYISSESRIIT
FT                   VSRKEISIDEHIKLIEDKLNEFLSEEKIDEEFFKIFKKQLLMVTIDFADEKSYEKLQTI
FT                   LNEHSDRERINYLSTSPDFFGTICKSLNHWNLISQQTRVVLEKPLGRDLKSSQEINKEV
FT                   LKYFEEDQIYRIDHYLGKDTVQNIMALRFSNRLFVPLWNSNHIDHVQITVAESVGVENR
FT                   WGYYNEYGALRDMIQNHLMQLLCLIAMEPPCSLEANSVRDEKVKVLRSFRNINDEDIKT
FT                   KTVRAQYKAGSSDGKTVPGYLDGKEEGSNTETFAAIRVDIDNWRWNGVPFYIRSGKRLQ
FT                   RRNSEIVIQFKTIPHSIFGEDETSINANRLVITLQPKESIELKLMNKIPGLSDSMKLQQ
FT                   VDLELNSPHNSDRKPDAYERLILDVVRSNPTLFMRLDEVETAWKWADKIIEGWEKNLSP
FT                   MKTYTAGSDGPSAAIQLIAKDGRSWNDE"
FT   gene            202675..203385
FT                   /locus_tag="Arnit_0215"
FT   CDS_pept        202675..203385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0215"
FT                   /product="6-phosphogluconolactonase"
FT                   /note="COGs: COG0363
FT                   6-phosphogluconolactonase/Glucosamine-6-phosphate
FT                   isomerase/deaminase; InterPro IPR005900; KEGG:
FT                   saz:Sama_1811 6-phosphogluconolactonase; SPTR: A1S6L0
FT                   6-phosphogluconolactonase; TIGRFAM:
FT                   6-phosphogluconolactonase; TIGRFAM:
FT                   6-phosphogluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91881"
FT                   /db_xref="GOA:D5V4E8"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR039104"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4E8"
FT                   /protein_id="ADG91881.1"
FT                   /translation="MEEVGTMNEFKEFFSSEGLAQNLASDIALILKNSIETEGKATLLV
FT                   SGGNTPKLFFQKLSNINIQWEKVTIGLVDERWVENDSKDSNEVLVKENLLKNLARKAHF
FT                   VGLYVKGLSAESAQNISSKIYENEFEKVDVLVLGMGTDGHTASLFPNNERLKEAYDLTN
FT                   ENFCISIEPTTVPYTRMSLILKKILEAKNIILHIEGKEKLEVYNSAINANDIYKYPISS
FT                   VLNQTDKKIKVYYS"
FT   gene            203382..205202
FT                   /locus_tag="Arnit_0216"
FT   CDS_pept        203382..205202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0216"
FT                   /product="6-phosphogluconate dehydratase"
FT                   /EC_number="4.2.1.12"
FT                   /note="COGs: COG0129 Dihydroxyacid
FT                   dehydratase/phosphogluconate dehydratase; InterPro
FT                   IPR020558:IPR000581:IPR004786; KEGG: cjd:JJD26997_1271
FT                   phosphogluconate dehydratase; PFAM: dihydroxy-acid and
FT                   6-phosphogluconate dehydratase; PRIAM: Phosphogluconate
FT                   dehydratase; SPTR: A7H495 Phosphogluconate dehydratase;
FT                   TIGRFAM: 6-phosphogluconate dehydratase; PFAM: Dehydratase
FT                   family; TIGRFAM: dihydroxy-acid dehydratase;
FT                   6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91882"
FT                   /db_xref="GOA:D5V4E9"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004786"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4E9"
FT                   /protein_id="ADG91882.1"
FT                   /translation="MNKIIEEVTNKIIKRSQKSRKIYLSRINEAKKNSVNRATLDCANL
FT                   AHAIAPMTNEEKAYLSDMKSFNMGIVTAYNDMLSAHEPYAAYPDILKKELLKHSSTAQV
FT                   AGGVPAMCDGVTQGQAGMELSLFSRDNIAMGTAIALSHNTYDGAFYLGICDKIVPGLMI
FT                   GALSFGHLPAIFVPSGPMPSGISNKEKAKVRQEFAQNKIDEKALFEVEKASYHSCGTCT
FT                   FFGTANSNQMLLEMMGLQLPNGSFVNANTPLRYALTKKSAQTLINLCEKKISISDIVNE
FT                   KTFVNAIIGLMATGGSTNHTIHLIAMAKAAGIVLTWEDFDDISKVTPLLCKMYPNGSAD
FT                   VNHFRDAGGMSVVIAQLLDLDLVHNDVQTVVGYGLDNFIKEPVLQDDELIFNDGEKSSK
FT                   NIEVISSAKTPFSKEGGLKLLVGNLGKSVIKTSALKEEYLYIKAPAVVFNSQEELQKEF
FT                   VKGKLEKDFIAVIRYQGPKANGMPELHKLMPPLGALQDKGFKVAIITDGRMSGASGKVA
FT                   SAIHLYPEAIEGGLIAKIENGDMIEMDVKNGTIKLLIDKEVLEKREVKQINLEKNRHGF
FT                   GRELFSSIRENVSSSETGATIFKLVGEENL"
FT   gene            205199..205822
FT                   /locus_tag="Arnit_0217"
FT   CDS_pept        205199..205822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0217"
FT                   /product="2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /EC_number="4.1.2.14"
FT                   /EC_number="4.1.3.16"
FT                   /note="COGs: COG0800 2-keto-3-deoxy-6-phosphogluconate
FT                   aldolase; InterPro IPR000887:IPR013785; KEGG:
FT                   hpa:HPAG1_1037 2-keto-3-deoxy-6-phosphogluconate aldolase;
FT                   PFAM: KDPG and KHG aldolase; PRIAM:
FT                   2-dehydro-3-deoxy-phosphogluconate aldolase; SPTR: Q1CSG8
FT                   2-keto-3-deoxy-6-phosphogluconate aldolase; TIGRFAM:
FT                   2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase; PFAM: KDPG and
FT                   KHG aldolase; TIGRFAM: Entner-Doudoroff aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91883"
FT                   /db_xref="GOA:D5V4F0"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031337"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4F0"
FT                   /protein_id="ADG91883.1"
FT                   /translation="MNANDVMKISPIVPVIALDDIKDALPLAKALSEGGINIMEITLRT
FT                   KAGLKAINLISKEMPSMNVGAGTVCNNVDLMEAKAVGAKFVFSPGISQELIDSAKKYKM
FT                   TIIPGIATASEVMLAQNNGIYNCKLFPATISGGVDILKAFQGPFPKMKFCPTGGVNLEN
FT                   LNDFLSLKNVLCVGGTWIIPKDIIKSGDFNKITELCIEALAKIK"
FT   gene            205835..207469
FT                   /locus_tag="Arnit_0218"
FT   CDS_pept        205835..207469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0218"
FT                   /product="phosphoglucomutase, alpha-D-glucose
FT                   phosphate-specific"
FT                   /note="COGs: COG0033 Phosphoglucomutase;
FT                   InterProIPR016055:IPR016066:IPR005844:IPR005845:IPR
FT                   005846:IPR005843:IPR005852; KEGG: sun:SUN_1277
FT                   phosphoglucomutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; phosphoglucomutase/phosphomannomutase; SPTR:
FT                   A6Q9S1 Phosphoglucomutase, alpha-D-glucose
FT                   phosphate-specific; TIGRFAM: phosphoglucomutase,
FT                   alpha-D-glucose phosphate-specific; PFAM:
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain III; Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain II;
FT                   Phosphoglucomutase/phosphomannomutase, C-terminal domain;
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain I; TIGRFAM: phosphoglucomutase, alpha-D-glucose
FT                   phosphate-specific"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91884"
FT                   /db_xref="GOA:D5V4F1"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR005852"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4F1"
FT                   /protein_id="ADG91884.1"
FT                   /translation="MANELAGKKAPKEILENIPKLLSSYYENKPNINEVSQKVSFGTSG
FT                   HRGSSLKTSFNEDHILAISQALCEYRKDAKITGTLYIGIDTHALSTPAQTTALQVFIAN
FT                   KIKCKIAQNKNFTPTPVISFTILEANKNSKILNDGVVITPSHNPPSDGGFKYNPPNGGP
FT                   ADSDITTIIENRANEILANGLKDVKKVSIEELDGSLFVEEFDFITPYVKALDTIIDMAC
FT                   IKKANLKIGVDPMGGSGIEVYKKIKEIYGLNLEIVNDKVDPTFSFMTCDHDGKIRMDCS
FT                   SKDAMASLIGLKDKYELAFANDPDFDRHGIVTPSVGLMNPNHYLSVAIWYLFSNRPWSD
FT                   DLGIGKTLVSSSMIDRVAKMLNKKLYEVPVGFKWFVDGLYEGTLGFGGEESAGASFLRF
FT                   DGSVWSTDKDGIILNLLAAEITSKLKKDPGTIYKELEEKNGTSYYKRIDAPATIEQKAK
FT                   LKSLSVEDIVSKELAGELIENIFTKAEGNKASIGGLKVVTKNGWFAARPSGTEDIYKIY
FT                   AESFISSEHLELILTQAQEIVTQSIKG"
FT   gene            207473..208681
FT                   /locus_tag="Arnit_0219"
FT   CDS_pept        207473..208681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0219"
FT                   /product="phosphoglucose isomerase (PGI)"
FT                   /note="COGs: COG0166 Glucose-6-phosphate isomerase;
FT                   InterPro IPR001672; KEGG: tdn:Suden_1472
FT                   glucose-6-phosphate isomerase; PFAM: phosphoglucose
FT                   isomerase (PGI); SPTR: B6BKK2 Glucose-6-phosphate
FT                   isomerase; PFAM: Phosphoglucose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91885"
FT                   /db_xref="GOA:D5V4F2"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4F2"
FT                   /protein_id="ADG91885.1"
FT                   /translation="MNYSANFSPRVSDSEIFESIKKEKQDIGYYNLPFQDTTLIKEYAQ
FT                   TVKQKDIAIIGIGGSTLGTFAIYSFLTRTHNFDKKLYFFESTDPIDINTRLERLDLDNT
FT                   LFIVISKSGTTIETISVFKYLYSKVKIDKNNCLIITETDSKLNDFAQSNDIKTFEIPKN
FT                   VGGRFSVFSTVGLVPLAIVGIDIDRLLDGAKEAYSEYFEQEALYKRIMTKARFMAEYKH
FT                   KFNNNVVFSYASELEGFNKWYVQLWGESLGKIDKDNTHQGLTPIGLLGPVDQHSFLQLI
FT                   IQGKRDKTVTFIKIKDFADNSKIPDVKLKGLEELDYINNLKFSELINHQADATIEAVHD
FT                   LQDIPCDTITMDKVDGFSLAKLMYVYELLTSIVGKFLFINAYDQPGVESGKIILKEKLK
FT                   KKK"
FT   gene            208760..209713
FT                   /locus_tag="Arnit_0220"
FT   CDS_pept        208760..209713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0220"
FT                   /product="protein of unknown function DUF523"
FT                   /note="COGs: COG3272 conserved hypothetical protein;
FT                   InterPro IPR017087:IPR007553:IPR013560; KEGG: abu:Abu_0835
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF523; Protein of unknown function DUF1722; SPTR: A8ET26
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF523); Protein of unknown function (DUF1722)"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91886"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="InterPro:IPR013560"
FT                   /db_xref="InterPro:IPR017087"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4F3"
FT                   /protein_id="ADG91886.1"
FT                   /translation="MKLGISSCLIGNLCRYDGAHSRDAFVVNILQKYFEIVPYCPESII
FT                   FGTPRETIRLVRNGEDIKVTTSNGEKDVTKQLDEISVSCAKQIANDDICGFILKSKSPT
FT                   CGMERVKVYQEKNAPSKKEGVGLFAKRIKEFYPYLPLEEEGRLNDAWLKENFLMQIFAY
FT                   RDLHELLKKEDIEFNDLVEFHTSYKYLIYAKSQEFYKELGHIVANHEKKPLEEILAEYK
FT                   QSFLKAISEKSTINKTYNVLLHIFGYFKKHISKEEKELLLVSMDEYKDGIIPLITIVKM
FT                   FKIYISRYDIEYLKKQKFLNPYPAELALRSDLKANK"
FT   gene            209721..210185
FT                   /locus_tag="Arnit_0221"
FT   CDS_pept        209721..210185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0221"
FT                   /product="protein of unknown function DUF420"
FT                   /note="InterPro IPR007352; KEGG: tdn:Suden_1805
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF420; SPTR: Q30PK2 Putative uncharacterized protein;
FT                   PFAM: Protein of unknown function (DUF420)"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91887"
FT                   /db_xref="GOA:D5V4F4"
FT                   /db_xref="InterPro:IPR007352"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4F4"
FT                   /protein_id="ADG91887.1"
FT                   /translation="METVSNNIIPLHMNVMLVFFSVLPFLVMGSIFLAKNKQYKLHFYS
FT                   QGFILVLTILVLVFFEIMIRIDGGFFEFAKQSDMPHGFLVGYLIFHIIIALIAAVLWIR
FT                   LFIKSMLLYQNGKIEEIKASNHIREGQITFIFLLLSCITGVFVYLFLFIF"
FT   gene            210225..210773
FT                   /locus_tag="Arnit_0222"
FT   CDS_pept        210225..210773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0222"
FT                   /product="PhnA protein"
FT                   /note="COGs: COG2824 Uncharacterized Zn-ribbon-containing
FT                   protein involved in phosphonate metabolism; InterPro
FT                   IPR013991:IPR013987:IPR013988; KEGG: tcx:Tcr_1109 PhnA
FT                   protein; PFAM: PhnA protein; SMART: PhnA protein; SPTR:
FT                   Q31GL9 PhnA protein; PFAM: PhnA protein; TIGRFAM:
FT                   alkylphosphonate utilization operon protein PhnA"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91888"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="InterPro:IPR013991"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4F5"
FT                   /protein_id="ADG91888.1"
FT                   /translation="MSIEKDLLDRSGSVCELCGASDGLEAIEVAPKDEKIVVCSTCKEQ
FT                   IEDESKMDSNHFRCLNDSMWSETPAVQVVAYRLLKNLSIDEGWAQDLVEMMYLEPETLE
FT                   WAEAGLTTGEVVKDSNGVTLNSGDSVTIIKDLDVKGAGFTAKRGTVVKGISLGDDPTHI
FT                   EGKVNGVRIFLKTCFLKKS"
FT   gene            complement(210804..211973)
FT                   /locus_tag="Arnit_0223"
FT   CDS_pept        complement(210804..211973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0223"
FT                   /product="phosphoribosylglycinamide formyltransferase 2"
FT                   /note="COGs: COG0027 Formate-dependent
FT                   phosphoribosylglycinamide formyltransferase (GAR
FT                   transformylase);
FT                   InterProIPR016185:IPR011054:IPR013817:IPR013815:IPR
FT                   013816:IPR011761:IPR003135:IPR005862; KEGG: abu:Abu_0145
FT                   phosphoribosylglycinamide formyltransferase 2; PFAM:
FT                   ATP-dependent carboxylate-amine ligase domain protein
FT                   ATP-grasp; SPTR: A8ER56 Phosphoribosylglycinamide
FT                   formyltransferase 2; TIGRFAM: phosphoribosylglycinamide
FT                   formyltransferase 2; PFAM: ATP-grasp domain;
FT                   Carbamoyl-phosphate synthase L chain, N-terminal domain;
FT                   TIGRFAM: phosphoribosylglycinamide formyltransferase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91889"
FT                   /db_xref="GOA:D5V4F6"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005862"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4F6"
FT                   /protein_id="ADG91889.1"
FT                   /translation="MKFGTPLKSNSIKIMLLGSGELGKEVIIEAQRLGIETIAVDSYNN
FT                   APAQLVANKAYTINMKNKNEILDVIRREKPDYILPEVEAINIDALFTAEKEGFHVIPNA
FT                   EAVNKTMNRKNIREFAAEELELPTSKYKFVKSFDELKNAAEYIGFPCVIKPVMSSSGHG
FT                   QSIAKSAKELEKSWEIAKEARGDASELIVEEFIKFDYEITLLTVRNERQTIFCAPIGHI
FT                   QKDGDYIFSWQPMKMSDKAIKKSEEIAKKITDGLGGRGIFGVELFVKGDEVYFSEVSPR
FT                   PHDTGMVTMITQSQSEFALHVRAVLGLPLNYIQYGAGASAAYKAVADTFNPIIDIKDEA
FT                   FSDNSYVRVFGKPQSHVGRRMAVALTFDKDSSDKALKNAKEIIKNFSDC"
FT   gene            complement(211945..212715)
FT                   /locus_tag="Arnit_0224"
FT   CDS_pept        complement(211945..212715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0224"
FT                   /product="Mannosyl-glycoprotein endo-beta-N-acetylglucosami
FT                   dase"
FT                   /note="COGs: COG2992 Uncharacterized FlgJ-related protein;
FT                   InterPro IPR013338:IPR002901; KEGG: nam:NAMH_0062
FT                   mannosyl-glycoprotein endo-beta-N-acetylglucosamidase
FT                   domain protein; PFAM: Mannosyl-glycoprotein
FT                   endo-beta-N-acetylglucosamidase; SMART: Lysozyme subfamily
FT                   2; SPTR: A6DCY7 Putative periplasmic protein; PFAM:
FT                   Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91890"
FT                   /db_xref="GOA:D5V4F7"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4F7"
FT                   /protein_id="ADG91890.1"
FT                   /translation="MKKILFLLSIFFLMNSYAETTGFPDEYYEMRATTKKQDYFFDYLY
FT                   PYIEHANKKILKDREFILKMRLDKHFSRKIENIQRLDLIAKRYKVDSIYDYKKLLFRVN
FT                   IVPPSLALAQAAVESGWGTSRFAKEGNNLFGHWTYGQNGERGMVPLNRDPNATHLVRIF
FT                   DSFEKSISSYMLNLNRTNAYISFRMLRSHFQKMKKKLSGLVLSQTLINYSQIKERYLKI
FT                   LKSVIEKNDLEEYDKRFYKNLKKDKNEIWDSLKI"
FT   sig_peptide     complement(212662..212715)
FT                   /locus_tag="Arnit_0224"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(212724..213461)
FT                   /locus_tag="Arnit_0225"
FT   CDS_pept        complement(212724..213461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0225"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="COGs: COG0253 Diaminopimelate epimerase; InterPro
FT                   IPR018510:IPR001653; KEGG: abu:Abu_0144 diaminopimelate
FT                   epimerase; PFAM: diaminopimelate epimerase; PRIAM:
FT                   Diaminopimelate epimerase; SPTR: A8ER55 Diaminopimelate
FT                   epimerase; TIGRFAM: diaminopimelate epimerase; PFAM:
FT                   Diaminopimelate epimerase; TIGRFAM: diaminopimelate
FT                   epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91891"
FT                   /db_xref="GOA:D5V4F8"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4F8"
FT                   /protein_id="ADG91891.1"
FT                   /translation="MTYTKYSASGNDFVIFHTLIKKDYSQDAINLCNRTEGIGADGLIV
FT                   IVPNQTADFEWLFYNSDGSDAAMCGNGTRAVAHYAYNNGLAPSNMKFLTEAGFITSSVD
FT                   GNIVETQMTKPKIIKEEFEQEGLTWYLIDTGVPHLITIVDDLEKYNHDLCAKMRYEHNA
FT                   NVNFAKIEDGKIFVRTYERGVEGETLACGTGMVACFLRANALGLVDTKAFVYPKSKEEL
FT                   TVSIRDGELFFKGAVKKVFVAQI"
FT   gene            complement(213458..214048)
FT                   /locus_tag="Arnit_0226"
FT   CDS_pept        complement(213458..214048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0226"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="COGs: COG0237 Dephospho-CoA kinase; InterPro
FT                   IPR001977; KEGG: abu:Abu_0143 dephospho-CoA kinase; PRIAM:
FT                   Dephospho-CoA kinase; SPTR: A8ER54 Dephospho-CoA kinase;
FT                   TIGRFAM: dephospho-CoA kinase; PFAM: Dephospho-CoA kinase;
FT                   TIGRFAM: dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91892"
FT                   /db_xref="GOA:D5V4F9"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4F9"
FT                   /protein_id="ADG91892.1"
FT                   /translation="MNNETFKYAIALTGGIATGKSTVCSLFKLHGFLTIDADKIAHRLL
FT                   DRHSDKIASMFGKEYVENGKVLRKKLGPIIFSNQKNKEKLESFIHPLIKEEIEKESLIF
FT                   EQQGKPYLIDIPLFYEKMNYPIKKSLVVYTPKEIQIERLMKRDSISKEEAKLKISNQMD
FT                   IEEKKNLADLVIDNSTNLKNLQKEVERVIGELI"
FT   gene            complement(214110..214664)
FT                   /locus_tag="Arnit_0227"
FT   CDS_pept        complement(214110..214664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0227"
FT                   /product="Spermine synthase"
FT                   /note="COGs: COG0421 Spermidine synthase; InterPro
FT                   IPR001045; KEGG: abu:Abu_0142 spermidine synthase; PFAM:
FT                   Spermine synthase; SPTR: A8ER53 Spermidine synthase; PFAM:
FT                   Spermine/spermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91893"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4G0"
FT                   /protein_id="ADG91893.1"
FT                   /translation="MSSVENKNFAFNEMIIHVPLCTHKEPENILVIGNCDEELKQEVAK
FT                   HRVNVEYGDISLLNSKNEKNIDVIILTDINIDELILANIQKILKDDGLISYKTNSHSKD
FT                   AARLKNDLTITGANFWICMPYSFGHTTCVLASKKYHPTADIILQRSDLLVDLNYYSTEI
FT                   QHASFVFPTHIQKELTGIAKR"
FT   gene            214769..215764
FT                   /locus_tag="Arnit_0228"
FT   CDS_pept        214769..215764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0228"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="COGs: COG0150 Phosphoribosylaminoimidazole (AIR)
FT                   synthetase; InterPro
FT                   IPR016188:IPR010918:IPR000728:IPR004733; KEGG: abu:Abu_0141
FT                   phosphoribosylaminoimidazole synthetase; PFAM: AIR synthase
FT                   related protein domain protein; AIR synthase related
FT                   protein; PRIAM: Phosphoribosylformylglycinamidine
FT                   cyclo-ligase; SPTR: A8ER52
FT                   Phosphoribosylformylglycinamidine cyclo-ligase; TIGRFAM:
FT                   phosphoribosylformylglycinamidine cyclo-ligase; PFAM: AIR
FT                   synthase related protein, N-terminal domain; AIR synthase
FT                   related protein, C-terminal domain; TIGRFAM:
FT                   phosphoribosylaminoimidazole synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91894"
FT                   /db_xref="GOA:D5V4G1"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4G1"
FT                   /protein_id="ADG91894.1"
FT                   /translation="MSTVSYKDAGVDIDAGNQFVENIKPYVKSTMIPGVLGGIGSFAGA
FT                   FELPSGYKKPVLLSGTDGVGTKLKLAIDSKKFDTVGIDLVAMCTNDLLCNFGEPLFFLD
FT                   YYATAKLEVEEATQVVKGIAEGCIRSECALVGGETAEMPGMYKEGDFDLAGFCVGIAEK
FT                   DELNRIDKISIGDTLIALPSSGVHSNGFSLVRKLLLEKLGMSLDDDFQGKPLKDVLLEP
FT                   TRIYVKEFKANKDNINALAHITGGGITENLPRVLPDNFKAVVDRSKIKVLPIFEFMSKH
FT                   VEVEEMYRTFNMGVGMVLVVNPGNVDAILANTDGYVIGEIAEGEKGVEFI"
FT   gene            complement(215823..216464)
FT                   /locus_tag="Arnit_0229"
FT   CDS_pept        complement(215823..216464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0229"
FT                   /product="Iron sulfur domain-containing, CDGSH-type"
FT                   /note="InterPro IPR006622:IPR018967:IPR010693; KEGG:
FT                   mbu:Mbur_2272 hypothetical protein; PFAM: Iron sulphur
FT                   domain-containing, CDGSH-type; protein of unknown function
FT                   DUF1271; SMART: zinc finger CDGSH-type domain protein;
FT                   SPTR: Q12TU4 Zinc finger domain-containing protein; PFAM:
FT                   Iron-binding zinc finger CDGSH type; Protein of unknown
FT                   function (DUF1271)"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91895"
FT                   /db_xref="GOA:D5V4G2"
FT                   /db_xref="InterPro:IPR010693"
FT                   /db_xref="InterPro:IPR018967"
FT                   /db_xref="InterPro:IPR042216"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4G2"
FT                   /protein_id="ADG91895.1"
FT                   /translation="MNELSIIPIENGPLKISNLSNKTLKNIIFYDSLPITLEKSTLICR
FT                   CGKSKNQPFCDGTHLKDNFTSEKKLKEEIIQVYNSKDVTVTFNRSICAGSAQCVNEFPS
FT                   IYSSENSHDWINLDTETTQEIIKSIEGCPSSALSYSIENKQIMQDYEKENINILKNGPI
FT                   TVIGAVDLKIEHWSSFANKTKFTLCRCGASENKPFCDYSHASLKDSSYTF"
FT   gene            complement(216553..217329)
FT                   /locus_tag="Arnit_0230"
FT   CDS_pept        complement(216553..217329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0230"
FT                   /product="Extradiol ring-cleavage dioxygenase class III
FT                   protein subunit B"
FT                   /note="COGs: COG3384 conserved hypothetical protein;
FT                   InterPro IPR004183:IPR014436; KEGG: abu:Abu_0138 LigB
FT                   family protein; PFAM: Extradiol ring-cleavage dioxygenase
FT                   class III protein subunit B; SPTR: A8ER49 Putative
FT                   uncharacterized protein; PFAM: Catalytic LigB subunit of
FT                   aromatic ring-opening dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91896"
FT                   /db_xref="GOA:D5V4G3"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR014436"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4G3"
FT                   /protein_id="ADG91896.1"
FT                   /translation="MFPSLYISHGSPALSIMDNSTTSFLKNLSSNFPEPKFILVISAHW
FT                   LTKNLKILYEESPHTIHDFYNFPKELYQLEYKAKSDLKKCDEIISLIKSSGIEIEKDIS
FT                   RGGFDHGVWSPLSLIYPKANIPIIQLSLPINFDSKKLFELGVILSKLREDTLIIGSGAM
FT                   THNIMNSTWENENAKPNSYAKEFRDWVVGNIQKGNVNSLLNYEKEAPNLQINHPSKEHF
FT                   LPLFVTFGASNNHIGESLHDIYMYGNQSMDTIIFKK"
FT   gene            complement(217339..217779)
FT                   /locus_tag="Arnit_0231"
FT   CDS_pept        complement(217339..217779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0231"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="COGs: COG1846 Transcriptional regulators; InterPro
FT                   IPR011991:IPR000835; KEGG: abu:Abu_0136 MarR family
FT                   transcriptional regulator; PFAM: regulatory protein MarR;
FT                   SMART: regulatory protein MarR; SPTR: A8ER47
FT                   Transcriptional regulator, MarR family; PFAM: MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91897"
FT                   /db_xref="GOA:D5V4G4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4G4"
FT                   /protein_id="ADG91897.1"
FT                   /translation="MVKTYGERTDKSMKTVVRLEKASLKITNKTLSYLSQHGLTFNQFK
FT                   VLEVLYHRGDLNIGSITKLTMSTPGNITVVVKNLKRDEWITSIKDPNDNRASILTITQK
FT                   GKEVIEKVFPEHAKNLYKAMEVLSDEELDTLYSLVNKVYKAN"
FT   gene            complement(217811..218515)
FT                   /locus_tag="Arnit_0232"
FT   CDS_pept        complement(217811..218515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0232"
FT                   /product="Pirin domain protein"
FT                   /note="COGs: COG1741 Pirin-related protein; InterPro
FT                   IPR011051:IPR012093:IPR003829; KEGG: abu:Abu_0139 pirin;
FT                   PFAM: Pirin domain protein; SPTR: A8ER50 Pirin; PFAM:
FT                   Pirin"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91898"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR041602"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4T6"
FT                   /protein_id="ADG91898.1"
FT                   /translation="MLKKLLKENMGTSNLGWLESRFHFSFAEYRNPNNINFGVLRVIND
FT                   DIIHPDSGFGTHPHANMEIISYVIDGEITHKDSMGNEETLKRGEVQYLSAGDGIYHSEY
FT                   NLNKTKDLRLLQIWIIPPKSSLPRLYGSKRYLEEERKNKLLNIVSSQEGDAEIKIHQDV
FT                   NFYVSELEKDKTLEYKIHKNRQVYFVQIEGTSTINNVELNHGDAMEITKENEITINAIS
FT                   NSHFLFIEMKEA"
FT   gene            complement(218519..219022)
FT                   /locus_tag="Arnit_0233"
FT   CDS_pept        complement(218519..219022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0233"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="COGs: COG0431 flavoprotein; InterPro IPR005025;
FT                   KEGG: abu:Abu_1537 putative FMN reductase; PFAM:
FT                   NADPH-dependent FMN reductase; SPTR: A8EV13 Putative FMN
FT                   reductase; PFAM: NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91899"
FT                   /db_xref="GOA:D5V4T7"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4T7"
FT                   /protein_id="ADG91899.1"
FT                   /translation="MILIFVASLNENMKLAKNLQEQLKSEKLESEIINLVELNLPMYDT
FT                   LKEQNDGIPTKIHELSEKMNKAEGFLFISPEYNFSLPPVLVNTIAWLSRIGDDFRALFA
FT                   LKKIQLATHSGSGGQDALNAMRTQFTRLNAIVLPREILTTYTKALDVESSQRIISQFAS
FT                   IVKG"
FT   gene            complement(219119..219685)
FT                   /locus_tag="Arnit_0234"
FT   CDS_pept        complement(219119..219685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0234"
FT                   /product="YceI family protein"
FT                   /note="COGs: COG2353 conserved hypothetical protein;
FT                   InterPro IPR007372; KEGG: tdn:Suden_2032 YceI; PFAM: YceI
FT                   family protein; SPTR: Q30NX5 YceI; PFAM: YceI-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91900"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4T8"
FT                   /protein_id="ADG91900.1"
FT                   /translation="MNIVKLGLISILTAGALFAGTYNVDTVHSNLGFKVKHLMISNVTG
FT                   KFDKFNGSFVFDEKTNTLKSLKGTAEVASINTDNAKRDGHLKSADFFDAANHPELTFDL
FT                   EKIKGDKAYGKLTIRGITKPVVFDYENNGTVTDPWGNKRVGLELSGKINRKDFGLNWNK
FT                   TLEAGGVLVGETVKINVELEGVLAK"
FT   sig_peptide     complement(219629..219685)
FT                   /locus_tag="Arnit_0234"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(219899..220084)
FT                   /locus_tag="Arnit_0235"
FT   CDS_pept        complement(219899..220084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0235"
FT                   /product="putative histone protein"
FT                   /note="KEGG: sml:Smlt3655 putative histone protein; SPTR:
FT                   A6G958 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91901"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4T9"
FT                   /protein_id="ADG91901.1"
FT                   /translation="MSKVLKEKKVAKIATKAASKVAKKKPAKKIAKKITKKVTKLKLTK
FT                   PKAAKKVAKKIAKKAA"
FT   gene            220282..221394
FT                   /locus_tag="Arnit_0236"
FT   CDS_pept        220282..221394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0236"
FT                   /product="aminotransferase class V"
FT                   /note="COGs: COG0075 Serine-pyruvate aminotransferase/
FT                   aspartate aminotransferase; InterPro
FT                   IPR015424:IPR020578:IPR015421:IPR000192; KEGG: abu:Abu_0134
FT                   putative aminotransferase; PFAM: aminotransferase class V;
FT                   SPTR: A8ER45 Putative aminotransferase; PFAM:
FT                   Aminotransferase class-V"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91902"
FT                   /db_xref="GOA:D5V4U0"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4U0"
FT                   /protein_id="ADG91902.1"
FT                   /translation="MLLTPGPTPVPEFVRKAMADITIHHRTPEFESIFGQTRELLLELY
FT                   GMDEVVMLASSGTGAMEACILNLVNKKALTINSGKFGERFGKICKAYNLPYTEIKNEWN
FT                   TPVSVEEVMDTLKNDSEIDAIFIQICESAGGLRHPVEELAKQVKEFNKNIMIVADGITA
FT                   VGVEKIDTTNLDAVITGSQKALMLPPGLAMIGLSNVAVEKIQTLSKGYYFNLATEIKVQ
FT                   KTNTTAWTAATTLIIGLKEILTHIKNNGGFETLYEKTALRAKATREALKAIGCEIYPKM
FT                   PANAMTTIYTENAPAIRKILKTKYNVNIAGGQDHIKNSIFRINHMGLVEDFETAWAVNA
FT                   VELAMDELGLRAFDGTANKIFAMVTFKGNE"
FT   gene            221391..222236
FT                   /locus_tag="Arnit_0237"
FT   CDS_pept        221391..222236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0237"
FT                   /product="tRNA synthetase class II (G H P and S)"
FT                   /note="COGs: COG0124 Histidyl-tRNA synthetase; InterPro
FT                   IPR002314; KEGG: abu:Abu_0133 ATP phosphoribosyltransferase
FT                   regulatory subunit; PFAM: tRNA synthetase class II (G H P
FT                   and S); SPTR: A8ER44 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91903"
FT                   /db_xref="GOA:D5V4U1"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4U1"
FT                   /protein_id="ADG91903.1"
FT                   /translation="MIYAHEIPKGSRLYFGKTAKLKRELESKISDILYSNNFEEIVTPN
FT                   FSYSQHQSIEDEKKLINFSDIKNNQVSLRADSSLDVVRIITKRLGRTTTHKKWFYIQPI
FT                   FSYPSKEQYQIGCEWIDHDNISDILNLTADILKSINVQPILQLSNINIPKLVSKVLNID
FT                   IELFKNGEIAQLFDLDVAWLNSLIRVKSIEDLKQCILLVPSEIKIHLEKLLNTASQIEY
FT                   DNLVIAPLYHGSLKYYDDVYFRVIHNNFVICKGGKYSADGISSLGFALYTDNLLKILED
FT                   "
FT   gene            222241..223494
FT                   /locus_tag="Arnit_0238"
FT   CDS_pept        222241..223494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0238"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="COGs: COG0104 Adenylosuccinate synthase; InterPro
FT                   IPR018220:IPR001114; KEGG: abu:Abu_0132 adenylosuccinate
FT                   synthetase; PFAM: adenylosuccinate synthetase; PRIAM:
FT                   Adenylosuccinate synthase; SMART: adenylosuccinate
FT                   synthetase; SPTR: A8ER43 Adenylosuccinate synthetase;
FT                   TIGRFAM: adenylosuccinate synthetase; PFAM:
FT                   Adenylosuccinate synthetase; TIGRFAM: adenylosuccinate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91904"
FT                   /db_xref="GOA:D5V4U2"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4U2"
FT                   /protein_id="ADG91904.1"
FT                   /translation="MSKADLIVGIQWGDEGKGKMVDMLAQNYDVVCRSQGGHNAGHTIW
FT                   VDGVRYALHLIPSGVLNPKAINIIGNGVVLCPSSIIKEMEQFKNLEGRLFISDKAHLNL
FT                   PYHALIDQAKERLKGDKAIGTTGKGIGPAYAEKISRTGFRVGELLNPSKLASGIIDYFA
FT                   QSRAIFDVLEIATPNKEELIELLTSYKEKLEPFIANTTNMIWDAIDNDKKILLEGAQGT
FT                   LLDIDHGTYPYVTSSSCVSAGACTGLGISPKDIGVVTGIVKAYTTRVGNGPFPSEDFTE
FT                   DGQKIADIGKEVGVTTGRGRRCGWFDAIAVKHAARLNGCDQLSLMKLDVLDGFPKVKIC
FT                   VAYDLEGKRIDYMPSDLNNVKPIYEEFEGWDKLAGIRKFEDLPENAKKYINKIEELTGV
FT                   KVGIISTSPERDDTIIRG"
FT   gene            223500..224051
FT                   /locus_tag="Arnit_0239"
FT   CDS_pept        223500..224051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0239"
FT                   /product="protein of unknown function DUF507"
FT                   /note="COGs: COG2952 conserved hypothetical protein;
FT                   InterPro IPR007463; KEGG: abu:Abu_0131 hypothetical
FT                   protein; PFAM: protein of unknown function DUF507; SPTR:
FT                   A8ER42 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF507)"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91905"
FT                   /db_xref="InterPro:IPR007463"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4U3"
FT                   /protein_id="ADG91905.1"
FT                   /translation="MKMKLHHTPYIARRISRDLVNCEFVEVRKTKEEITREVERILDID
FT                   IEKEHDLDEKVDEILAEQAEEIEFLNADYRQLFWMTKKRLANEFGVILNNDDRFSDISH
FT                   QLLDFLWEEDYIHYTVSDNKVKNVIFDSISQFLEGFEKADDAVYEKIKNYKRKLIQGTD
FT                   EYDIVYHRLYEEELIKRGLM"
FT   gene            224053..225171
FT                   /locus_tag="Arnit_0240"
FT   CDS_pept        224053..225171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0240"
FT                   /product="carbamoyl-phosphate synthase, small subunit"
FT                   /EC_number="6.3.5.5"
FT                   /note="COGs: COG0505 Carbamoylphosphate synthase small
FT                   subunit;
FT                   InterProIPR001317:IPR011702:IPR002474:IPR017926:IPR
FT                   000991:IPR006274; KEGG: abu:Abu_0130 carbamoyl phosphate
FT                   synthase small subunit; PFAM: Carbamoyl-phosphate synthase
FT                   small chain; glutamine amidotransferase class-I; PRIAM:
FT                   Carbamoyl-phosphate synthase (glutamine-hydrolyzing); SPTR:
FT                   A8ER41 Carbamoylphosphate synthase, small subunit; TIGRFAM:
FT                   carbamoyl-phosphate synthase, small subunit; PFAM:
FT                   Carbamoyl-phosphate synthase small chain, CPSase domain;
FT                   Glutamine amidotransferase class-I; TIGRFAM:
FT                   carbamoyl-phosphate synthase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91906"
FT                   /db_xref="GOA:D5V4U4"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4U4"
FT                   /protein_id="ADG91906.1"
FT                   /translation="MQKVWIYLENGTFLEANSFGAKGTTVGEIVFNTSLTGYQEIITDP
FT                   SYAGQFVTFTMPEIGNVGVNKNDMESSTAFCKGILVRNYHHEYSNYRGESDLCSLLKEH
FT                   NVLGIKDIDTRYLTKMIRDEGAMMMIASTEISDKEELAKQLAASPRIEDINYIEEVSTK
FT                   EPYIHKNGAWNHQLLSYNKAVMSDKKIVVIDFGVKRNILNELVESGLEVEVVPSSFNAD
FT                   ELIARYEAKEIGGVFLSNGPGDPLTLVKEKEEVQKLIATDIPIIAICLGNQLLSIAHGF
FT                   DTYKLKFGQHGGNHPVVNNGVVEITAQNHNYNVPDSIVKIAEVTHRNLFDDTIEGVRYN
FT                   NKNIYSIQHHPEASPGPHDSKYIFKQFAEMVK"
FT   gene            225236..225727
FT                   /locus_tag="Arnit_0241"
FT   CDS_pept        225236..225727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0241"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /note="InterPro IPR018490:IPR014710:IPR000595; KEGG:
FT                   tye:THEYE_A0034 putative nucleotidyltransferase family;
FT                   PFAM: cyclic nucleotide-binding; SPTR: C2CK26
FT                   Transcriptional regulator; PFAM: Cyclic nucleotide-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91907"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4U5"
FT                   /protein_id="ADG91907.1"
FT                   /translation="MKTLENNTKDTNKKEIDAMKMLLKLSGKIPFFSILSKDEIEEIIT
FT                   EVQIITYKNKEIIFQEGETTRNYIYYLLKGRLYINRKKQIDSRSSVRIATIDKPALFGE
FT                   MMRLTGEPRSATVESGESNTLVLAFRIKDFREQTSMSKFYKNVIMELSAKIVQMNKKHY
FT                   "
FT   gene            complement(225728..226198)
FT                   /locus_tag="Arnit_0242"
FT   CDS_pept        complement(225728..226198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0242"
FT                   /product="phosphatidylglycerophosphatase A"
FT                   /note="COGs: COG1267 Phosphatidylglycerophosphatase A and
FT                   related protein; InterPro IPR007686; KEGG: abu:Abu_0128
FT                   phosphatidylglycerophosphatase A; PFAM:
FT                   phosphatidylglycerophosphatase A; SPTR: A8ER39
FT                   Phosphatidylglycerophosphatase A; PFAM:
FT                   Phosphatidylglycerophosphatase A"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91908"
FT                   /db_xref="GOA:D5V4U6"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4U6"
FT                   /protein_id="ADG91908.1"
FT                   /translation="MRKAFLTLFYSGLSPKAPGTVGSFVALIIGLFLLQFVHVSTLFLL
FT                   SLLISAIAIKQINIYEKEVGMHDGKEIVIDELAGMWLALSICGITNENMFYLAPLAFLF
FT                   FRLFDIWKPSVIGKIDRDVKGGWGVMGDDLVAGLAAGIASAGVYQLLIKFVL"
FT   gene            complement(226198..227082)
FT                   /locus_tag="Arnit_0243"
FT   CDS_pept        complement(226198..227082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0243"
FT                   /product="response regulator receiver protein"
FT                   /note="InterPro IPR011006:IPR001789; KEGG: abu:Abu_0127
FT                   two-component response regulator; PFAM: response regulator
FT                   receiver; SMART: response regulator receiver; SPTR: A8ER38
FT                   Two-component response regulator; PFAM: Response regulator
FT                   receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91909"
FT                   /db_xref="GOA:D5V4U7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4U7"
FT                   /protein_id="ADG91909.1"
FT                   /translation="MNILIIENEIYLAQKVVSRILDDGHSCDFVEMPNNNLTKDYDMVL
FT                   LSTSLPSEMVKKTIQKYKNSIIILLVSYISDETVTEPINEGAKDYIMKPFIMDELIRKI
FT                   YHYKECRQMKQELATLKTYVEFLLEEIDTTGVNISHSLPMLVETNSQRCTDKLAFEISK
FT                   SLKLPIRFIALDSPTWQKELSTITNKEVVYLTDYHSLKKSAKDNVCIAIEHKNCIISSL
FT                   EKEVDFPFPKIEFMRPDMFMLNNNIMTINDYVKMMVMSFQSKYPDTELSKKLGISRKSL
FT                   WEKRKKLGIEKKK"
FT   gene            complement(227079..228203)
FT                   /locus_tag="Arnit_0244"
FT   CDS_pept        complement(227079..228203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0244"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="2.7.7.60"
FT                   /EC_number="4.6.1.12"
FT                   /note="COGs: COG0245 2C-methyl-D-erythritol 2
FT                   4-cyclodiphosphate synthase; InterPro
FT                   IPR003526:IPR002363:IPR020555:IPR001228; KEGG: abu:Abu_0126
FT                   bifunctional 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase/2-C-methyl-D-erythritol
FT                   2,4-cyclodiphosphate synthase protein; PFAM:
FT                   MECDP-synthase; 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   synthase; PRIAM: 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase., 2-C-methyl-D-erythritol
FT                   2,4-cyclodiphosphate synthase; SPTR: A8ER37 Bifunctional
FT                   enzyme ispD/ispF; TIGRFAM: 2C-methyl-D-erythritol
FT                   2,4-cyclodiphosphate synthase; PFAM: YgbB family;
FT                   Uncharacterized protein family UPF0007; TIGRFAM:
FT                   2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase;
FT                   2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91910"
FT                   /db_xref="GOA:D5V4U8"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR026596"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4U8"
FT                   /protein_id="ADG91910.1"
FT                   /translation="MSKVTLLVLCAGNSTRFGLNCKKQWLRVGDIPLWLFVAKKITSYY
FT                   NFDKVVITASKDELSYMQNFSDEYDFVLGGETRQESMTNALKSIDSDYVMVTDVARTCV
FT                   PKEVILNLISNKEKASCIVPVLNVSDTVIFKDETINRDEVRLIQTPQLSNTKILKKALD
FT                   TDTFFTDDSSAIKNIDEPIFYVKGSIESNKLTFQEDLKSNPCLEGPSNNFFTGFGIDTH
FT                   AFEKNKQMILGGIQIDSDIGFKAHSDGDVLIHSVIDALLGAIGAGDIGDFFPDTDNTYK
FT                   NIDSKILLEKIVNFVYNVGYEIINVDFTILAQKPKINPYKSQIKKSMAQLLNVNMQYVN
FT                   VKATTSEELGFVGRSEGVTVHSVATLKYFDWKNK"
FT   gene            complement(228293..229114)
FT                   /locus_tag="Arnit_0245"
FT   CDS_pept        complement(228293..229114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0245"
FT                   /product="putative signal transduction protein"
FT                   /note="COGs: COG1639 signal transduction protein; InterPro
FT                   IPR013976; KEGG: abu:Abu_0734 hypothetical protein; PFAM:
FT                   Metal-dependent hydrolase HDOD; SPTR: A8ESS5 Putative
FT                   uncharacterized protein; PFAM: HDOD domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91911"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4U9"
FT                   /protein_id="ADG91911.1"
FT                   /translation="MKNDIIEKIESLPPLPNSVIELENFRRRPEKEPLELLKIINQDPL
FT                   IITTLLRVANSAMFGFRSEVETPSRAVNLLGINFTISIALGSVVQDLIKSNLNAYNIST
FT                   DDFLMASNLASNIINNWVGEIDFGLKEDLLLPAFLQETGKFIISEIIQEQNKTEEFQEA
FT                   LKTAEGSLSNIEESFTGFSCSRITANIFKHWNLSHNLIFTIGFVGNVEQCPEEYQRKVK
FT                   ILEVVKVLTDIRNPLGDEQVERALELATKYNLEIEPLVNAIDKIKEKMSEQ"
FT   gene            complement(229123..231567)
FT                   /locus_tag="Arnit_0246"
FT   CDS_pept        complement(229123..231567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0246"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: Q7RG16 Putative
FT                   uncharacterized protein PY04535; PFAM: GGDEF domain;
FT                   TIGRFAM: glutamate--cysteine ligase/gamma-glutamylcysteine
FT                   synthetase, Streptococcus agalactiae type"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91912"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4V0"
FT                   /protein_id="ADG91912.1"
FT                   /translation="MNQNFEDSDFSLSTKEEFENLEDSQIFKIIDKYKIIKTEDKLLDS
FT                   AETNYIALIDYIDNLYYLKKEIPQDLIDLVRNHTYFNKYLILFINKKLENILKNGSALF
FT                   FKDINTIINLLSRGKYYKVFENYNTYNYDEIQNLFREYENSLKQLENEETFDVIFANYL
FT                   CLLKVYTKLCQINSIDIKRKQTITPITDILSETINMLKFTIKLGENYLNSLNNILGQIL
FT                   YYFSHLPFVDAWGKDFDYLIEQYYLLLQKISDGYDISKDTNFAGNSSSKEEEYLIFRKN
FT                   SSYLLLIMLKKLNQNYNTADYFICNSLKRCMHLYEENFSMSFSKNGTITLDSLTEDLLN
FT                   SIALSYKTNDGKVAQIKDYKSAINNFIIEADKFNILNLLPIHDILLLAENINKYYYINI
FT                   GQTLIDSKSLKNDYYEFYKLKTIDTILNYITSSESSKEEESFVKSVHKYIEKNKVASHL
FT                   LPMFSKLYLSISYYFSKFKDVKRIRESREMYSTYVNINGFDLLKNEYKWINQNLLKEFG
FT                   RYHLNELSFKNEDMANDELVSLGKIGTRNYLTYGKLKTKYEINNALVQITNDILSVNNL
FT                   NYEKLNFLICSLLSEQIYYGICEISILGLTKKKSLIVDEGYKMHKIPIDEMYTIQFIFP
FT                   AIYENNFKYINEENEDFILSNLKNIFSIYKKESQTFTNNTTGLENIHKLKLDLSNRSGL
FT                   MTNFVQIFVRSFSKITQDFGFNVGEKYLQTIINKISTLLEEDDSIYYLNEGKIGIIINN
FT                   KNFINTFVDRIMKFKINKNGQEIDMEFVICVTIAQYDLYNKSVKTLDKAIISKNNLLFY
FT                   EE"
FT   gene            231704..233053
FT                   /locus_tag="Arnit_0247"
FT   CDS_pept        231704..233053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0247"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /note="COGs: COG0422 Thiamine biosynthesis protein ThiC;
FT                   InterPro IPR002817; KEGG: abu:Abu_0124 thiamine
FT                   biosynthesis protein ThiC; PFAM: thiamine biosynthesis
FT                   protein ThiC; SPTR: A8ER35 Thiamine biosynthesis protein
FT                   ThiC; TIGRFAM: thiamine biosynthesis protein ThiC; PFAM:
FT                   ThiC family; TIGRFAM: thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91913"
FT                   /db_xref="GOA:D5V4V1"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4V1"
FT                   /protein_id="ADG91913.1"
FT                   /translation="MRDWLDNHKDDEVRTQMYYAKKGMITPEMEYVAKVEKIEPELVRS
FT                   EIARGRLIIPANVNHRHLKPMAIGMASSCKINANIGSSALASDIAGEVEKVDVCLKHGA
FT                   DTIMDLSTGGDLDSIRSAVIEHSTVPIGTVPIYQILHDCKDKIEDLSIEVMLKTLEKQA
FT                   LQGVSYFTIHAGFLLQFMPHVAKRKMGIVSRGGSLMAAWMMHYHKENPFYDAFDEILDI
FT                   CRRHDVSLSLGDSLRPGCLFDASDEAQLSELKILGELTKRAWEKDVQVMIEGPGHVPLN
FT                   QIERNMKLEREYCHEAPFYILGPLTTDIAAGYDHISSAIGAAVGGWHGASMLCYVTPKE
FT                   HLGLPNAQDVREGIIAYKIAAHSADIARGRKGARDIDDEMSDARYSFDWNKQFELCLDP
FT                   DRAKEYHDETLPQDVFKEAEFCSMCGPKFCSYKITQKIVEEHGEAMKTAV"
FT   gene            233064..233276
FT                   /locus_tag="Arnit_0248"
FT   CDS_pept        233064..233276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0248"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sun:SUN_0227 hypothetical protein; SPTR:
FT                   A6Q6S8 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91914"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4V2"
FT                   /protein_id="ADG91914.1"
FT                   /translation="MNVKVLKPCHCIRRFKFDEVFEYYNKEDALKKAEEIIEVMKTKSC
FT                   QSHEFSIIENDDGFEISSKVNYKSW"
FT   gene            233364..234479
FT                   /locus_tag="Arnit_0249"
FT   CDS_pept        233364..234479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0249"
FT                   /product="ATPase-like, ParA/MinD"
FT                   /note="COGs: COG0489 ATPase involved in chromosome
FT                   partitioning; InterPro IPR002744:IPR019591; KEGG:
FT                   abu:Abu_0123 ATP/GTP-binding protein; PFAM: ATPase-like,
FT                   ParA/MinD; protein of unknown function DUF59; SPTR: A8ER34
FT                   ATP/GTP-binding protein; PFAM: ParA/MinD ATPase like;
FT                   Domain of unknown function DUF59; 4Fe-4S iron sulfur
FT                   cluster binding proteins, NifH/frxC family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91915"
FT                   /db_xref="GOA:D5V4V3"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4V3"
FT                   /protein_id="ADG91915.1"
FT                   /translation="MANVADIKKELEKVIYPGFTKSIVEFGFLKNVEVNGDAVSILVEI
FT                   TSSVQEVEHEIRTNIKKVLENIGVTNLDLQVKKPEAPKQTSNSVSGKNIAPQIKNFVMV
FT                   SSGKGGVGKSTTTVNLAVAAAMQGKRVGILDADIYGPNIPRMFGLQGKEVEVIGNKAKP
FT                   FHAYGVDVMSMGSLMEEGQALIWRGAMIMKAIQQLLRDILWEELDILFIDMPPGTGDAQ
FT                   LTLAQSVPVTCGVNVTTPQHVALDDSRRSLDMFKKLHIPVGGIVENMSGFICPTCNTES
FT                   DIFGMGTCEALAKEYGTTVLGNLPIEPAIREGGDNGKPIVYFHPESISAKRYMKAAETL
FT                   IEFIDNVSDKAENASIQPTTPPGVSACSTAK"
FT   gene            234624..235775
FT                   /locus_tag="Arnit_0250"
FT   CDS_pept        234624..235775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0250"
FT                   /product="Cystathionine gamma-lyase"
FT                   /EC_number="4.4.1.1"
FT                   /note="COGs: COG0626 Cystathionine beta-lyase/cystathionine
FT                   gamma-synthase;
FT                   InterProIPR015424:IPR000209:IPR000277:IPR015421:IPR 015422;
FT                   KEGG: abu:Abu_1723 cystathionine gamma-synthase; PFAM:
FT                   Cys/Met metabolism pyridoxal-phosphate-dependent protein;
FT                   PRIAM: Cystathionine gamma-lyase; SPTR: A8EVJ7
FT                   Cystathionine gamma-synthase; PFAM: Cys/Met metabolism
FT                   PLP-dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91916"
FT                   /db_xref="GOA:D5V4V4"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4V4"
FT                   /protein_id="ADG91916.1"
FT                   /translation="MKKHLETKLSHLQDFATIQDQYGASHFPIYNTGTFDLKKQDGEKI
FT                   YDYTRSDNPTREALENLFTDVENGAGCVCTHTGIGAVSLLFETVLKANSEVLVEADCYG
FT                   GTFRLLKVFQGKYNIKVHFADFLSEAELEKILKNNKIDLVLCESPTNPGLKIIDIGMVS
FT                   VLAKKYNALFALDNSLATFISQRPLDMGADFSLFSTTKYISGHGSVVAGAIVAKTKELA
FT                   DELHYYANAHGRSQNPMDVFLISLGIPTLKIRMKEHQKSSIMIAEFLEKQSFIKAVMHP
FT                   ALKSHPQHKLATYQMDYIPGVFCAEFINKDFAEKFIENTKIFGEKCSFGSPDSRVEIPA
FT                   KISHASFSKEELAAIGISDGTVRFSIGLENVEDLIEDIEQALK"
FT   gene            235776..237272
FT                   /locus_tag="Arnit_0251"
FT   CDS_pept        235776..237272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0251"
FT                   /product="Cys/Met metabolism pyridoxal-phosphate-dependent
FT                   protein"
FT                   /note="COGs: COG0626 Cystathionine beta-lyase/cystathionine
FT                   gamma-synthase; InterPro IPR015424:IPR015421:IPR000277;
FT                   KEGG: abu:Abu_1724 cystathionine gamma-synthase; PFAM:
FT                   Cys/Met metabolism pyridoxal-phosphate-dependent protein;
FT                   SPTR: A8EVJ8 Cystathionine gamma-synthase; PFAM: Cys/Met
FT                   metabolism PLP-dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91917"
FT                   /db_xref="GOA:D5V4V5"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4V5"
FT                   /protein_id="ADG91917.1"
FT                   /translation="MENSSFKPIECGETLPQNNVHAVSVSMPKLQDVIDYEEGFGEAME
FT                   KIKSGYPRFTMHPYLRILAKYIKEKYKVSDSYEVVLLSSQKAVDILSDKYYIHNKIDID
FT                   EPFGVILVRNGTCQLQRVLMFIQHVGYNLSSRFAEDYLYNIGLINSKHKEETEKEELAF
FT                   DLVVSTLAKAYNQAKENITLAPSGMNAMYGVVKGLKNIQRKNGRDILVQLGWLYLDTMN
FT                   IVKHYYEQSKVFCDVKNLDLLEEYLKENGFKVSAIITEVPTNPLLLCVDMKRLNSLCKK
FT                   YNIPLVVDSTLATPYNVNLNDYADIYVESLTKFASGNADVLMGAIILNQKSKLSHMNVE
FT                   FFKHCDKAYIKDIQRMAFEIKDYETRVKRISSNTKALVEYFKKCSYIDKIYYCLNDENE
FT                   LEYKQIMKDDNSYTGLISVTFNKSFETIYDNINFAKGPSLGTDFTLLMPYTYLAHYDYI
FT                   KSEEGEKYLDEIGLPKDILRISVGSENINDIIEEFKRLEE"
FT   gene            237275..237622
FT                   /locus_tag="Arnit_0252"
FT   CDS_pept        237275..237622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0252"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR011394; KEGG: abu:Abu_1402 hypothetical
FT                   protein; SPTR: A8EUN3 Putative uncharacterized protein;
FT                   PFAM: MazG nucleotide pyrophosphohydrolase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91918"
FT                   /db_xref="GOA:D5V4V6"
FT                   /db_xref="InterPro:IPR025984"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4V6"
FT                   /protein_id="ADG91918.1"
FT                   /translation="MDMNKIKELILKFSKERDWDKFHNPKNLAMALSVETAELVEIFQW
FT                   LNEDQSLNLDKAKKEHLEEEVADIAVYLLRICYSHNIDLEKAIISKMKKNEIKYPLYDK
FT                   NGEKIDYGKKN"
FT   gene            237935..239439
FT                   /locus_tag="Arnit_R0003"
FT   rRNA            237935..239439
FT                   /locus_tag="Arnit_R0003"
FT                   /product="16S ribosomal RNA"
FT   gene            239556..239632
FT                   /locus_tag="Arnit_R0004"
FT   tRNA            239556..239632
FT                   /locus_tag="Arnit_R0004"
FT                   /product="tRNA-Ile"
FT   gene            239652..239727
FT                   /locus_tag="Arnit_R0005"
FT   tRNA            239652..239727
FT                   /locus_tag="Arnit_R0005"
FT                   /product="tRNA-Ala"
FT   gene            240031..242945
FT                   /locus_tag="Arnit_R0006"
FT   rRNA            240031..242945
FT                   /locus_tag="Arnit_R0006"
FT                   /product="23S ribosomal RNA"
FT   gene            243150..243264
FT                   /locus_tag="Arnit_R0007"
FT   rRNA            243150..243264
FT                   /locus_tag="Arnit_R0007"
FT                   /product="5S ribosomal RNA"
FT   gene            243516..243614
FT                   /locus_tag="Arnit_0253"
FT   CDS_pept        243516..243614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91919"
FT                   /db_xref="GOA:D5V4V7"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4V7"
FT                   /protein_id="ADG91919.1"
FT                   /translation="MYLDKIGILVGIGLLIFMLLSFVVKYFIRKKE"
FT   gene            complement(243618..244301)
FT                   /locus_tag="Arnit_0254"
FT   CDS_pept        complement(243618..244301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0254"
FT                   /product="phosphoribosyl-ATP diphosphatase"
FT                   /note="COGs: COG0139 Phosphoribosyl-AMP cyclohydrolase;
FT                   InterPro IPR002496:IPR008179; KEGG: abu:Abu_0121
FT                   bifunctional phosphoribosyl-AMP
FT                   cyclohydrolase/phosphoribosyl-ATP pyrophosphohydrolase;
FT                   PFAM: phosphoribosyl-AMP cyclohydrolase; phosphoribosyl-ATP
FT                   pyrophosphohydrolase; SPTR: A8ER32 Bifunctional
FT                   phosphoribosyl-AMP cyclohydrolase/ phosphoribosyl-ATP
FT                   pyrophosphohydrolase; TIGRFAM: phosphoribosyl-ATP
FT                   diphosphatase; PFAM: Phosphoribosyl-ATP
FT                   pyrophosphohydrolase; Phosphoribosyl-AMP cyclohydrolase;
FT                   TIGRFAM: phosphoribosyl-ATP pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91920"
FT                   /db_xref="GOA:D5V4V8"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR023019"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4V8"
FT                   /protein_id="ADG91920.1"
FT                   /translation="MNNIENIAWEKMDGLIPVITQDSKTNEVLMLAYMNKEALSLTLST
FT                   KYAHYFSRSKQRIWKKGEESGHTQEIVEILLDCDNDTILIKVIQEGVACHTGRKSCFFT
FT                   NLESNEIISDVEVNTSNKYSVLDNLFHVIQDRKNDDPKKSYTSKLLNGKENSMLKKIVE
FT                   EAGEFTFAVKDDNSEEMIYEAADLVYHTMVALASKDISPDRIKQELARRFGMSGIDEKN
FT                   SRKEE"
FT   gene            complement(244311..244616)
FT                   /locus_tag="Arnit_0255"
FT   CDS_pept        complement(244311..244616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0255"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: major antigen; SPTR: Q6XYT3 Chromosome
FT                   segregation ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91921"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4V9"
FT                   /protein_id="ADG91921.1"
FT                   /translation="MLNKILTIIFIMLSSVILVNAKDQKNSIDLNNIKLVNPKIEPKLK
FT                   TKKDYQKKEDLLTKPINKEVDLTQKNKDDIEIDGTVNVNTEERSIDGVKINLGKNF"
FT   sig_peptide     complement(244554..244616)
FT                   /locus_tag="Arnit_0255"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(244659..245735)
FT                   /locus_tag="Arnit_0256"
FT   CDS_pept        complement(244659..245735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0256"
FT                   /product="band 7 protein"
FT                   /note="COGs: COG0330 Membrane protease subunits
FT                   stomatin/prohibitin homologs; InterPro IPR000163:IPR001107;
FT                   KEGG: abu:Abu_0119 band 7 family protein; PFAM: band 7
FT                   protein; SMART: band 7 protein; SPTR: A8ER30 Putative
FT                   uncharacterized protein; PFAM: SPFH domain / Band 7 family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91922"
FT                   /db_xref="GOA:D5V4W0"
FT                   /db_xref="InterPro:IPR000163"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4W0"
FT                   /protein_id="ADG91922.1"
FT                   /translation="MPIDNDYFKNRQQNKNSGGGSNGGGYQPPFEPPEFFKNFGKKAGF
FT                   IYAIIIVVIMLFVFRPFVIIESGQVGIKVTAGKYESIPLNPGFHLYLPIIQKVIVIDTK
FT                   VRLINYSSVEQMGGYDSGIKLNPAINILDARGLPVSIELTVQYRLTAAGAPTTIANWGL
FT                   SWEEKIINPVVRDIVRNVVGTYTAEELPTKRNEIAVKIEDGIRANIEKLDGKPVSLLSV
FT                   LLREIGLPPKIKEQIERVQIANQESERVKYEVQRTKQEAEKRAAKATGDAEANRIEAKG
FT                   RADAVTIEAKAQAAANKAIAESLTPNLLKMQQIQVQGKFNEALKVNKDAKIFLTPGGST
FT                   PNIWVDTKDRSINSAINK"
FT   gene            complement(245843..246763)
FT                   /locus_tag="Arnit_0257"
FT   CDS_pept        complement(245843..246763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0257"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /note="COGs: COG0115 Branched-chain amino acid
FT                   aminotransferase/4-amino-4-deoxychorismate lyase; InterPro
FT                   IPR001544:IPR005785; KEGG: abu:Abu_0118 branched-chain
FT                   amino acid aminotransferase; PFAM: aminotransferase class
FT                   IV; SPTR: A8ER29 Branched-chain amino-acid
FT                   aminotransferase; TIGRFAM: branched-chain amino acid
FT                   aminotransferase; PFAM: Aminotransferase class IV; TIGRFAM:
FT                   branched-chain amino acid aminotransferase, group I"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91923"
FT                   /db_xref="GOA:D5V4W1"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4W1"
FT                   /protein_id="ADG91923.1"
FT                   /translation="MTEAKYIWMDGKFVDWHDAKVHVLSHTLHYGNGAIEGTKAYKTHD
FT                   GRCAIFKLKEHTKRLLNSSKMTLMDVPFSEDELNKAQVELLQKNELNEGAYIRPLVYLG
FT                   YGVMGLYHKEAPVNVSISAWEWGAYLGEEGLKKGVRVKITSMTRTPNTSGMGKAKAVAN
FT                   YLNSQMAKYEAVEAGYDEALLRDDQGYIAEASGACFFIVRDGIIITPPNDTSLESITQA
FT                   TVIDLAHDLGYKVERRRITREEIYIADEAFFTGTAVEVTPIREVDARIIGAGERGPITE
FT                   KLQSGYFDIVQGKNEKYAKHLTYIN"
FT   gene            246915..247523
FT                   /locus_tag="Arnit_0258"
FT   CDS_pept        246915..247523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0258"
FT                   /product="Tellurite resistance methyltransferase, TehB,
FT                   core"
FT                   /note="InterPro IPR015985; KEGG: amr:AM1_5706 hypothetical
FT                   protein; PFAM: Tellurite resistance methyltransferase,
FT                   TehB, core; SPTR: C2A021 Putative uncharacterized protein;
FT                   PFAM: Tellurite resistance protein TehB"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91924"
FT                   /db_xref="GOA:D5V4W2"
FT                   /db_xref="InterPro:IPR015985"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4W2"
FT                   /protein_id="ADG91924.1"
FT                   /translation="MNQQELWNKKFSRDGYLYGTNPNQFIKNTSANFKKDQTALCLGEG
FT                   EGRNAIFLAKEGFDVEAIDASDIGLNKLFEQSQIENVEIKTNCMDINHWQPSKKYGTIL
FT                   FSYLHLKIDELKNLIKKIESALEENGFFVCEVFSKNQIERNSGGPKDLELLYSMDDFKD
FT                   NIKELKIHKLEEVITTLEEGTGHQGEACVIRLIAQKSKF"
FT   gene            247599..251072
FT                   /locus_tag="Arnit_0259"
FT   CDS_pept        247599..251072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0259"
FT                   /product="methionine synthase"
FT                   /note="COGs: COG1410 Methionine synthase I
FT                   cobalamin-binding domain;
FT                   InterProIPR003726:IPR011005:IPR004223:IPR006158:IPR
FT                   003759:IPR000489:IPR011822; KEGG: abu:Abu_0117
FT                   5-methyltetrahydrofolate--homocysteine methyltransferase;
FT                   PFAM: homocysteine S-methyltransferase; dihydropteroate
FT                   synthase DHPS; Methionine synthase B12-binding module cap
FT                   domain protein; cobalamin B12-binding domain protein;
FT                   Vitamin B12 dependent methionine synthase activation
FT                   region; SPTR: A8ER28 5-methyltetrahydrofolate--homocysteine
FT                   methyltransferase; TIGRFAM: methionine synthase; PFAM:
FT                   Pterin binding enzyme; Vitamin B12 dependent methionine
FT                   synthase, activation domain; B12 binding domain;
FT                   Homocysteine S-methyltransferase; TIGRFAM:
FT                   5-methyltetrahydrofolate--homocysteine methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91925"
FT                   /db_xref="GOA:D5V4W3"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4W3"
FT                   /protein_id="ADG91925.1"
FT                   /translation="MKNRINEIIQNKVLIIDGAMGTQLQNAEIKPEAWKYENQDLEGCN
FT                   ELLNETAPEILEGIHDAYAKAGANLISTNTFGTMPWVLDEYGISSKAYELSKLGAELVK
FT                   KSCKKYETEDEPRFCLGSIGPGTKLPSLGHIRYDEMYEGYKEVANGLADGGCDIYLLET
FT                   CQDPLQIKAALHALTDTHPEIPVMVSVTIELSGTMLIGTDAMTIAAIMSPFNILSLGFN
FT                   CGTGPKQVHKHVKTLSEVCKFPISVHANAGLPQNKGGVSYYPMGPEEFTQLQSSFLEIN
FT                   GVSFLGGCCGTTPEHIEALANKVRGIKPKAPSGFLKASLASLFNTVPLKQDPAPLLIGE
FT                   RSNATGSKAFRDLLKDNNYEGTLSVGQQQVRAGAHIIDVSVGFAGRDETGDMDKVVELY
FT                   SQKVSLPLMPDSTQIKALEAALKQIGGRCIINSVNLEDGEEKFDAVCKLAKKFGAALVC
FT                   LVIDEVGMAKTKEDKIRIAERIYDLCVNRHGFNPEDLVFDMLTFTIGSGDDEYRTAGVE
FT                   TMEAIREFQILHPEVGTTLGLSNISFGLDIKARVYLNSIYLDHCVKAGLTSAIVNVKHI
FT                   LPLNKITEEDRKACDDLIFNNQEDGDPLFKFIDHFSNVEAQEDQSDEEYLKMEPIDKVK
FT                   KLLLDGDKDRLLPLVDELRHTIKAEMIVNEWLIDGMKIIGELFGSGQMQLPFVLQSAET
FT                   MKATVDALNPYLPKEEKASETVLVIGTVKGDVHDVGKNLVDIILSNNGFKVINIGIKAD
FT                   INDFIIAVQKHKAQAIGMSGLLVKSTAVMKENLEELKRQGIDIPVLLGGAALTKSFVNE
FT                   YCRPLYEGPIFYCRDAFDGVVSMQRIESGDSFNTKLAADLIKDADDIKKEKKEVIIPPY
FT                   EEIELPPKAEFTFPPLWGRVTQNKTLLNKDLIFSWINHRVLFRQRWGYKKGAMKADEFL
FT                   AHEEDVVKPLYEKYKEEFFEKDIFDPIAIYGYYPCISHDNKLYIFDNEYAFNSLKEAQN
FT                   VPPLEKAIKVFEFPRQTKAPYRCIADFFANDRLDVVAFTLASSGLKITSYESELYQNSE
FT                   FSKYHQIHGLGVELAEALAEVIHKQIRLDLDIVPKEGHTLYDVQMKQYVGCRYSPGYAA
FT                   CPDLEQSRDIFDLLKPEEFGITLSETFQIDPEQSTCAIVVPHNKANYYNI"
FT   gene            251262..252113
FT                   /locus_tag="Arnit_0260"
FT   CDS_pept        251262..252113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0260"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="InterPro IPR000620; KEGG: cff:CFF8240_0754
FT                   hypothetical protein; PFAM: protein of unknown function
FT                   DUF6 transmembrane; SPTR: A4BKK0 Putative uncharacterized
FT                   protein; PFAM: EamA-like transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91926"
FT                   /db_xref="GOA:D5V4W4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4W4"
FT                   /protein_id="ADG91926.1"
FT                   /translation="MNNNKKGIIITALGVLLMSFESLFIKLTSISPFTFSFYLGIFMFI
FT                   SMLLLLIIKQRDIIREITKTSFYIFLSCSLLMGSANIFFIWAIKSTTAANVVLIIGTGA
FT                   LFTSFFSYLFYKEKIRINVLIASFFMILGLLIIFNDKIGLGSLKGNILALLCTMTFSLS
FT                   FVLMSKYTRINRIAMTAMTGISLAIIAYFVSDTISIDFYNLFVVGVMGLIITPFSRVLI
FT                   FTGTKFINASEVSLLMIIETVMGPIWVWMVLNEVPSSYTFIGGSIILLTLIANSMYIMK
FT                   KE"
FT   gene            complement(252087..252695)
FT                   /locus_tag="Arnit_0261"
FT   CDS_pept        complement(252087..252695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0261"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG3647 membrane protein; InterPro IPR014509;
FT                   KEGG: sun:SUN_1160 hypothetical protein; PFAM: conserved
FT                   hypothetical protein; SPTR: Q1YYD4 Putative uncharacterized
FT                   protein; PFAM: Predicted membrane protein (DUF2238)"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91927"
FT                   /db_xref="GOA:D5V4W5"
FT                   /db_xref="InterPro:IPR014509"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4W5"
FT                   /protein_id="ADG91927.1"
FT                   /translation="MKYLWLIIFITIFIWSGINPKDQFTWLLEVFPAIIGFIILAYTYK
FT                   SFKLTTLTYTLILIHCIILMVGGHYTYAEVPLFDTIKEVLNQSRNNYDKVGHFAQGFIP
FT                   AIIAREILIRENIIPLAKWRNFFIICFCLAFSAFYELIEWFVAMLSGSDATAFLGTQGY
FT                   IWDTQSDMAFALLGSILALILLSKYHDKQLNLFLFHDVH"
FT   gene            complement(252707..253714)
FT                   /locus_tag="Arnit_0262"
FT   CDS_pept        complement(252707..253714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0262"
FT                   /product="Glutamate--ammonia ligase"
FT                   /EC_number="6.3.1.2"
FT                   /note="COGs: COG0174 Glutamine synthetase; InterPro
FT                   IPR008147:IPR008146:IPR014746; KEGG: rbi:RB2501_11032
FT                   glutamine synthetase II; PFAM: glutamine synthetase
FT                   catalytic region; glutamine synthetase beta-Grasp; PRIAM:
FT                   Glutamate--ammonia ligase; SPTR: A2TUQ0 Glutamine
FT                   synthetase; PFAM: Glutamine synthetase, catalytic domain;
FT                   Glutamine synthetase, beta-Grasp domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91928"
FT                   /db_xref="GOA:D5V4W6"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4W6"
FT                   /protein_id="ADG91928.1"
FT                   /translation="MTKTKLEYIWLDGYKPTQSLRSKTMVVSDFSGKLEDCDIWSFDGS
FT                   STKQAVGNNSDCLLKPVALYLDPGRIDAYIVINEVLNSDETPHISNKRATIEENDDFWF
FT                   GFEQEYTLIDLETNRPIGFPVNGYPSPQGQYYCSVGATNAVGRQIIEEHLDTCIEAGLN
FT                   IEGINSEVMMGQWEYQIFSKNATEACDQIWASRYFLERITEQYNVKVDWDPKPVQGDWN
FT                   GSGMHANFSNKQLRESGDKKIFDKICEEFKLTHKEHIAVYGDHNEQRLTGEHETQDINS
FT                   FSYGVSDRSASLRIPIATIKNNWKGRIEDRRPASNANPYDVAAIIIKSVKKALN"
FT   gene            253834..254646
FT                   /locus_tag="Arnit_0263"
FT   CDS_pept        253834..254646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0263"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="COGs: COG2207 AraC-type DNA-binding
FT                   domain-containing protein;
FT                   InterProIPR009057:IPR018062:IPR012287:IPR018060:IPR
FT                   003313:IPR000005; KEGG: vfm:VFMJ11_1150 transcriptional
FT                   regulator, AraC family; PFAM: helix-turn-helix- domain
FT                   containing protein AraC type; AraC protein
FT                   arabinose-binding/dimerisation; SMART: Helix-turn-helix,
FT                   AraC domain; SPTR: A6DBM1 Transcriptional regulator, AraC
FT                   family protein; PFAM: Bacterial regulatory helix-turn-helix
FT                   proteins, AraC family; AraC-like ligand binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91929"
FT                   /db_xref="GOA:D5V4W7"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4W7"
FT                   /protein_id="ADG91929.1"
FT                   /translation="MKKNTFTKIFKDEKIPYLELRYTNSNKHYKKHFHDTFSLGINEQG
FT                   VSIYTNNDKSYTLDENMLSIVNPYAVHSCNACSEVLNIYYMLYLDISWCKEVQKSIDDK
FT                   VNEFTNIPLDILEDKVFYDEYLTLCKFLFSDNHISDKEDILIDFFIKFFSLFLDKTEDA
FT                   NTNKEFDKIVFFLEKNYKENISIKELSKFFNLNPYYIIRLFKSKINLTPHAFLINLKIN
FT                   KAKELLQQGHSISDTALECGFFDQSHFHKNFVKIVATTPKEYKLNFVQ"
FT   gene            254698..255294
FT                   /locus_tag="Arnit_0264"
FT   CDS_pept        254698..255294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0264"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="COGs: COG1280 Putative threonine efflux protein;
FT                   InterPro IPR001123; KEGG: cps:CPS_3087 amino acid
FT                   transporter LysE; PFAM: Lysine exporter protein
FT                   (LYSE/YGGA); SPTR: Q47ZI5 Transporter, LysE family; PFAM:
FT                   LysE type translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91930"
FT                   /db_xref="GOA:D5V4W8"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4W8"
FT                   /protein_id="ADG91930.1"
FT                   /translation="MSFTIFLTMFSFALVMSISPGPVNMMIITSSINNGFARTFSFISG
FT                   ATIGFILLLICIGLGLSKIINTYPDILLYVEIFGFSFIIYLGIKILSSKPSLEVNKNDK
FT                   INLRFHEGFLLQWLNPKAWIACISVVSMYSSSELFTIFVIIYFFVCYLSLSFWGVLGSK
FT                   VTRFFDTDFKLRVLNIIMGLILIFCAISIIFVNIF"
FT   gene            255373..255852
FT                   /locus_tag="Arnit_0265"
FT   CDS_pept        255373..255852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0265"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: abu:Abu_0115 hypothetical protein; SPTR:
FT                   A8ER26 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91931"
FT                   /db_xref="GOA:D5V4W9"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4W9"
FT                   /protein_id="ADG91931.1"
FT                   /translation="MLDKILNFCFSVSKQPVLLKDLLVANVQHNEKMHVDAAKLGFRLS
FT                   IGKAYIVYILIVCIPVIPLSLLAHTIFEKIDAHASIVVSIIFTAIIFIWFNFFRIWIKD
FT                   KMANRVIRKAWMIHFPYFPYDEYRYKIEEIFHKAMKNEIPRKDLERYILDNLVQN"
FT   gene            complement(255858..256589)
FT                   /locus_tag="Arnit_0266"
FT   CDS_pept        complement(255858..256589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0266"
FT                   /product="protein of unknown function DUF752"
FT                   /note="COGs: COG4121 conserved hypothetical protein;
FT                   InterPro IPR008471; KEGG: abu:Abu_0113 hypothetical
FT                   protein; PFAM: protein of unknown function DUF752; SPTR:
FT                   A8ER24 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF752)"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91932"
FT                   /db_xref="GOA:D5V4X0"
FT                   /db_xref="InterPro:IPR008471"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4X0"
FT                   /protein_id="ADG91932.1"
FT                   /translation="MNNPIQTIDGSNTLYSTKYNQHFHDLKTGAIKESLNKHVIPALTL
FT                   KKDLKKLKILDICFGIGYNTFSTIYYILENNLNINLEIYSPELDEELVRSLDKFDFPKE
FT                   FEKIKHIIDSIAKTFSYEDANIKIEVFIGDARKYIRTLNNIDIVYQDAFSSDVNKELWS
FT                   VEYFQDIFKLCKNGAVMTTYSISTNVRLSMYEAGFYIYEINPSGNRKQTIALKNKKDIE
FT                   AKYIDMELKKSRNKEAKAFYD"
FT   gene            complement(256632..257147)
FT                   /locus_tag="Arnit_0267"
FT   CDS_pept        complement(256632..257147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0267"
FT                   /product="quorum-sensing autoinducer 2 (AI-2), LuxS"
FT                   /EC_number="4.4.1.21"
FT                   /note="COGs: COG1854 LuxS protein involved in autoinducer
FT                   AI2 synthesis; InterPro IPR003815:IPR011249; KEGG:
FT                   abu:Abu_0111 S-ribosylhomocysteinase; PFAM: LuxS protein;
FT                   PRIAM: S-ribosylhomocysteine lyase; SPTR: A8ER22
FT                   S-ribosylhomocysteine lyase; PFAM: S-Ribosylhomocysteinase
FT                   (LuxS)"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91933"
FT                   /db_xref="GOA:D5V4X1"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR037005"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4X1"
FT                   /protein_id="ADG91933.1"
FT                   /translation="MPLLDSFKVDHTIMPAPAVRVAKTMKSPSGDIITVFDLRFYVPNK
FT                   DMMSEKGIHTLEHLFAGFIREHLNSPTVEIIDVSPMGCRTGFYMSLLGSPKEETVAAAW
FT                   KAAMEDVLNVAKQEDIPELNIYQCGTCNMHSLEEAKDIAKDILSHKIGVMSNEELYLSD
FT                   DKLASLGN"
FT   gene            complement(257220..257570)
FT                   /locus_tag="Arnit_0268"
FT   CDS_pept        complement(257220..257570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0268"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: avn:Avin_48710 hypothetical protein; SPTR:
FT                   C1DK66 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91934"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4X2"
FT                   /protein_id="ADG91934.1"
FT                   /translation="MDILKKAYDWAYTYNFTPIEIEYAGKLALKMLDDSCQMSSEERRM
FT                   FFYVYDAITDREDIILDDDMNRLILLARDRATIYSKPEYANIVHACKEDIIPNMLKVHM
FT                   KAFKKMVRENLY"
FT   gene            complement(257580..258158)
FT                   /locus_tag="Arnit_0269"
FT   CDS_pept        complement(257580..258158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0269"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: Q7RH94 Putative
FT                   uncharacterized protein PY04095"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91935"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4X3"
FT                   /protein_id="ADG91935.1"
FT                   /translation="MHINTMEENYKLENYERFLGEFKEHGSHWDKIEKRTATLFQVLID
FT                   GDLKELVFVLKYYPKYIEIVCDHFRYLYNYSGVDADIFAASKLLELSEGYHQKQFVRNL
FT                   VRKLEKIDELDISSLNKFLDNLLQNQIKLHPIILNFYKNEIKRNIENNTYHKLQIKVIE
FT                   KNLSKLVVDDSFDFSANDRDANLDIPYMD"
FT   gene            complement(258182..258883)
FT                   /locus_tag="Arnit_0270"
FT   CDS_pept        complement(258182..258883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0270"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: A7TQ63 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91936"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4X4"
FT                   /protein_id="ADG91936.1"
FT                   /translation="MEELFNLTYKEEVELLKDEADFESLGDEKYLNHEDMEARLYWAFC
FT                   RPNGSREEQIADKHPIVSIMAFNHSKLPALKRFQLLHKDVIEKDNLRGKIRNRARMLFR
FT                   SLVDDDFIELNKVLDLVPVYLPVAIDQLKNGRKWNDMLASEIEATKFLQKSKEFIDEEL
FT                   LSALYIKLANFEELDSSEIKELLENTIKIKNDVDNNILNYYKEQTYLWTKNSDLHILQK
FT                   KGLEKLANKLI"
FT   gene            complement(258855..260081)
FT                   /locus_tag="Arnit_0271"
FT   CDS_pept        complement(258855..260081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0271"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG3864 conserved hypothetical protein; KEGG:
FT                   sun:SUN_1504 hypothetical protein; SPTR: A6QAE6 Putative
FT                   uncharacterized protein; PFAM: Predicted metallopeptidase
FT                   (DUF2201)"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91937"
FT                   /db_xref="InterPro:IPR018698"
FT                   /db_xref="InterPro:IPR025154"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4X5"
FT                   /protein_id="ADG91937.1"
FT                   /translation="MDNTSYDEIFQKIRINFLFNHPFLSVLALSIPTIYAQNKFSAFQT
FT                   NGMHISVDLEKLSLYSAQEITYLYAHTLLHIVLKHPYRQKTREKKLWNQACDLVVNLIM
FT                   SKFSNIGEMPKDEILDLDLENKCVEEVYEILYKEQEEDSESSTKEKKEDEEIKTKANEK
FT                   GKLKSYIYDESKLDIEEVNDDKTNQGDREKLDGIIIQALSIAKKSSKEYIGLQVEIDTL
FT                   IKPEISLQDSLKEYLIASLFEKTSTYNRPNRRFIHSGLYLPGNKKSDELIEVYIALDSS
FT                   SSVSLDEYKKFLGVVKDVCDGFYEYKVVVLPFDLKVKEEHIIKFDSFNPLNQEELFIPK
FT                   SDGGTDFDEVLRYLKKSSEIRSENLLMVLSDGEFDINESLVSNTIFIISDRKNLKRFES
FT                   YGRVIQFNL"
FT   sig_peptide     complement(259974..260081)
FT                   /locus_tag="Arnit_0271"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(260062..261069)
FT                   /locus_tag="Arnit_0272"
FT   CDS_pept        complement(260062..261069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0272"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_5"
FT                   /note="COGs: COG0714 MoxR-like ATPase; InterPro IPR011704;
FT                   KEGG: sun:SUN_1058 hypothetical protein; PFAM: ATPase
FT                   associated with various cellular activities AAA_5; SPTR:
FT                   A6Q956 Putative uncharacterized protein; PFAM: AAA domain
FT                   (dynein-related subfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91938"
FT                   /db_xref="GOA:D5V4X6"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4X6"
FT                   /protein_id="ADG91938.1"
FT                   /translation="MITPAIGTQELYKQLQTLIDTDIPVFIHGSPGIGKSYIVNDIAKQ
FT                   NDLEIIDVRLSQLDAIDLRGIPTISNEQTKWMPPIFLPSDENSKGILFLDELNSAPLSV
FT                   QAAIYQLVLDRKIGEYSMPKGWRIVCAGNKIDDKGIVFKLPSPLINRMVHIVLEAKYED
FT                   FKIWAIKNEIHPFIIGFLGFRPDLLSTEVPSSSETNPAFCTPRAWSMLSNIVKSISDIK
FT                   TINPIIYGSVGYGAGIEFISFVKVYKTLPDIDAILKGESDIVPNEPSALYALCAAIIEK
FT                   YKETTQAVNLFEYCNKLPVEFNVMLIKDLIIKDEDIAELEAFDSWMEQYGQYII"
FT   gene            complement(261078..261266)
FT                   /locus_tag="Arnit_0273"
FT   CDS_pept        complement(261078..261266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0273"
FT                   /product="chromosome partition protein"
FT                   /note="KEGG: cdf:CD1250 chromosome partition protein; SPTR:
FT                   A6ESP5 Fructose-6-phosphate aldolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91939"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4X7"
FT                   /protein_id="ADG91939.1"
FT                   /translation="MGLFEDKIKQEIMQNIFADSLKMYETIDNKFTLSPEEKQKILEKI
FT                   STLNNDLNTLIKDIKLS"
FT   gene            complement(261281..261682)
FT                   /locus_tag="Arnit_0274"
FT   CDS_pept        complement(261281..261682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0274"
FT                   /product="hemerythrin-like metal-binding protein"
FT                   /note="InterPro IPR012827:IPR016131; KEGG: avn:Avin_01310
FT                   hemerythrin-like, metal binding protein; SPTR: B6BLR2
FT                   Hemerythrin HHE cation binding domain subfamily, putative;
FT                   TIGRFAM: hemerythrin-like metal-binding protein; TIGRFAM:
FT                   hemerythrin-like metal-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91940"
FT                   /db_xref="GOA:D5V4X8"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR016131"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4X8"
FT                   /protein_id="ADG91940.1"
FT                   /translation="MNTIKEFNKSTHVLNHDQIDTLHKEFLDIYANANINSLESIIQIS
FT                   KELLIHSEKHFQEEETLMEKYNYPTIKEHKDEHYKALAEMEYFIKNSHSTFGKKMLKSY
FT                   FIEKLPQWFDFHLANMDSDLVCHLNKFEH"
FT   gene            261756..262448
FT                   /locus_tag="Arnit_0275"
FT   CDS_pept        261756..262448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0275"
FT                   /product="sugar fermentation stimulation protein"
FT                   /note="COGs: COG1489 DNA-binding protein stimulates sugar
FT                   fermentation; InterPro IPR005224; KEGG: gur:Gura_1121 sugar
FT                   fermentation stimulation protein; PFAM: sugar fermentation
FT                   stimulation protein; SPTR: A5GAS3 Sugar fermentation
FT                   stimulation protein homolog; TIGRFAM: sugar fermentation
FT                   stimulation protein; PFAM: Sugar fermentation stimulation
FT                   protein; TIGRFAM: sugar fermentation stimulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91941"
FT                   /db_xref="GOA:D5V4X9"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4X9"
FT                   /protein_id="ADG91941.1"
FT                   /translation="MRFDKLYKGKLVKRYKRFLADIILDSGEEITAHVPNSGAMTSCIE
FT                   ENCPVWVTFHDNPKRKLKYTLELTKMQDILICTNTGVANKIAIEAIKNGIIKELQGYNS
FT                   LTPEQKYGVNSRIDILLENKDEKCYVEVKSVSLKINDFLAFPDAVTTRGKKHLDELVSM
FT                   VKEGHRAVMLYVIQRTDNLPFTIAKEIDPKYNEALKEAMNSGVEVLVYQSDINLEEINL
FT                   KTKSSLQM"
FT   gene            complement(262455..263519)
FT                   /locus_tag="Arnit_0276"
FT   CDS_pept        complement(262455..263519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0276"
FT                   /product="membrane protein AbrB duplication"
FT                   /note="COGs: COG3180 Putative ammonia monooxygenase;
FT                   InterPro IPR007820:IPR017516; KEGG: abu:Abu_0104 putative
FT                   ammonia monooxygenase; PFAM: putative ammonia
FT                   monooxygenase; SPTR: A8ER15 Putative uncharacterized
FT                   protein; TIGRFAM: membrane protein AbrB duplication; PFAM:
FT                   Putative ammonia monooxygenase; TIGRFAM: membrane protein
FT                   AbrB duplication"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91942"
FT                   /db_xref="GOA:D5V4Y0"
FT                   /db_xref="InterPro:IPR007820"
FT                   /db_xref="InterPro:IPR017516"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4Y0"
FT                   /protein_id="ADG91942.1"
FT                   /translation="MNIDRDSFINASKELLKIVLTLCIGVLGSILFIYLNLPIPWLLGA
FT                   ICATSFAVRYDTLPLKSPKIFSSPARVIIGVTIGSAFSPEIFNYLNVYFFSLLLVIPFT
FT                   IITILLGMFYYYKILHFEKKTAFFCSIPGGLIELVILGEQIKADTRKITLVQSSRLLFI
FT                   VLSLPFIVHYIFNVDVSGNQVITETLSQIDLKQLFYLVCIGTIGAIIGKKLNLFAAFLM
FT                   GPMFLSIFAFSIGFVDSRPPDELLKLVQVIFGTIIGFTFKGIKLDIVIKTLLSTFGHFI
FT                   ILACITTTFTLIVSYFFDFPILSILLAFAPGGQADINLIAIIVGANVPYIAVHHIVRLF
FT                   LVMNLSNIFAKRLE"
FT   gene            complement(263506..264153)
FT                   /locus_tag="Arnit_0277"
FT   CDS_pept        complement(263506..264153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0277"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="COGs: COG0288 Carbonic anhydrase; InterPro
FT                   IPR001765:IPR015892; KEGG: abu:Abu_0103 carbonic anhydrase;
FT                   PFAM: carbonic anhydrase; PRIAM: Carbonate dehydratase;
FT                   SPTR: A8ER14 Carbonic anhydrase; PFAM: Carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91943"
FT                   /db_xref="GOA:D5V4Y1"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4Y1"
FT                   /protein_id="ADG91943.1"
FT                   /translation="MNPINNLIRGNKLFRKYHFEDFKDDLHELINNGQKPEVLFISCCD
FT                   SRITTDFMIGSKPGDLFTLRNIGNFVPPYSADGDFHGNASAIEYAVSVLKVSNIIVCGH
FT                   SHCGACQSLYEDIPNTDDYINIRKWLELGKEAKDMTLENKHLYKNKQDLYKATEKNSII
FT                   CQLKNLLTYPAIKRKVLTKEITIHGWYYNLIDGSIEFYDQENKKYKDINEYR"
FT   gene            complement(264196..266367)
FT                   /locus_tag="Arnit_0278"
FT   CDS_pept        complement(264196..266367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0278"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="COGs: COG4191 Signal transduction histidine kinase
FT                   regulating C4-dicarboxylate transport system; InterPro
FT                   IPR004358:IPR003594:IPR005467:IPR000014; KEGG: abu:Abu_0102
FT                   two-component sensor histidine kinase; PFAM: ATP-binding
FT                   region ATPase domain protein; SMART: ATP-binding region
FT                   ATPase domain protein; SPTR: A8ER13 Sensor protein;
FT                   TIGRFAM: PAS sensor protein; PFAM: Cache domain; Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase; TIGRFAM:
FT                   glutamate--cysteine ligase/gamma-glutamylcysteine
FT                   synthetase, Streptococcus agalactiae type; PAS domain
FT                   S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91944"
FT                   /db_xref="GOA:D5V4Y2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004010"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4Y2"
FT                   /protein_id="ADG91944.1"
FT                   /translation="MKNNYNQTVEQGIKKTTLLSSTIIILIVATIIGIVLIKTEYSNFR
FT                   THIKSFKNTLIEREMFYVKTSVQNLKNDIDFESLSIINSKKQRIKNQSIIAYNLAYSLY
FT                   KSSKNLSKEEQIDLIEKSLKEIAQEKNDINYFILNTKGTLLLNTDYPKNEGINFLDFED
FT                   LDGVKFINKMINANPNTQNFLDYNWYRPNKRITYSRHLKELGLIIGSASNLESNHVELT
FT                   DKLLKKITLQGFNNDEFIFIYKINSLTDIMHKSKLLIQKNIITSNKELEAIKELLIKTN
FT                   YKANEATYYDYNQKLFYATYIKEYRYFIAVGVNLSNINQIVKKETKISLDNLYKNIIKL
FT                   IIIIIVMTIVFFFFSLLFTRKIEELFNQYRKRVKQNEEKYALLFNYSNDGFIISEIINN
FT                   STRILSLNSTALKTIGYESSEILYKDFFNLFDQLSLEEIKQSKSLVKTVKLFTKDKQTR
FT                   TIELNAIIYSYENQNLLFASLRDITERTLLKEEKIKQQNILIQKSKMAAMGEMIGNIAH
FT                   QWRQPLSQVSGLFFDIESAYDYKELDKKYLQNRVDEANDLLEYMSKTIDDFRNFFNPNS
FT                   KKELFYLNEAIDNALKIVKSTLTFHHIELIINIEEDYKIDGYKNEYSQAIMNILSNAKD
FT                   ILLEKNIQNPQIKIYAQKNEKLCLHIEDNAGGIDDTIINKIFDPYFTTKYDYGTGIGLY
FT                   MTKMIIEEKMNGTISVKNSHHGAIFSIEI"
FT   gene            complement(266357..267037)
FT                   /locus_tag="Arnit_0279"
FT   CDS_pept        complement(266357..267037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0279"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="COGs: COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain; InterPro IPR011006:IPR001789:IPR001867; KEGG:
FT                   abu:Abu_0101 two-component response regulator; PFAM:
FT                   response regulator receiver; transcriptional regulator
FT                   domain protein; SMART: response regulator receiver; SPTR:
FT                   A8ER12 Two-component response regulator; PFAM: Response
FT                   regulator receiver domain; Transcriptional regulatory
FT                   protein, C terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91945"
FT                   /db_xref="GOA:D5V4Y3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4Y3"
FT                   /protein_id="ADG91945.1"
FT                   /translation="MDDFKKYTILYIEDDEGVRTINSRFLNRMFNELYEAKDGEEGYEL
FT                   YKKYHPDIILTDIKMPKLDGISLAKKIRQKDTTTKIIISTAFSEKSYLLDAIELNLEKY
FT                   IIKPLTSRNLLPALSKAVEALEKEKDFKITLGDEFYFDNNTSLFYNKGQVINLTKKELL
FT                   FLKLLVLNKNRVVSYEEIEQNVWDGEYMSLNSLRTSLGFLRKKIPFNCIKNISNMGYKL
FT                   NLEK"
FT   gene            complement(267067..268584)
FT                   /locus_tag="Arnit_0280"
FT   CDS_pept        complement(267067..268584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0280"
FT                   /product="protein of unknown function DUF112 transmembrane"
FT                   /note="COGs: COG3333 conserved hypothetical protein;
FT                   InterPro IPR002823; KEGG: abu:Abu_0100 putative
FT                   tricarboxylic transport protein TctA; PFAM: protein of
FT                   unknown function DUF112 transmembrane; SPTR: A8ER11
FT                   Putative uncharacterized protein; PFAM: Tripartite
FT                   tricarboxylate transporter TctA family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91946"
FT                   /db_xref="GOA:D5V4Y4"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4Y4"
FT                   /protein_id="ADG91946.1"
FT                   /translation="MLDGILQGAGTALSAYNILMVAIGCFAGTFIGMLPGLGPISAIAL
FT                   MIPITYGMDPSSGLILIAGVYYGAIFGGSTSSILINAPGVAGTVASSFDGYPMAKNGHA
FT                   GKALAIAAYSSFSGGTIAAIFLLFAAPALASVSLSFQSSDYFALMVLGLTAVAAFAGKG
FT                   KFLKAAIMTVFGLMLATVGSDSDSGIARFTFGRLDLIDGISFLLLAMAAFALSEALMNV
FT                   LESHQTTKEEEEELKKDIGSLRLTREEVKEMIPTIGRSSVLGFFVGVLPGAGATIASFL
FT                   AYGMERSIASVKEKLNFGKGSIKGLAAPESANNAACSGSFVPLLTLGIPGSGTTAIILG
FT                   ALISYGIQPGPTMYVDNPELFWSVIISMYIGNLVLLVLNLPLIPYIAKLLTLPKQLLLP
FT                   LIIFFSLVGVYLVTFNNFDIYMMTIFAVVALFLRIVDFPMAPMILGFILGGMMENNLRR
FT                   ALTISDGSLSFLWERPITLSILIITVILLLVPLFGEFSAKIRKKKEN"
FT   sig_peptide     complement(268504..268584)
FT                   /locus_tag="Arnit_0280"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(268584..269066)
FT                   /locus_tag="Arnit_0281"
FT   CDS_pept        complement(268584..269066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0281"
FT                   /product="putative tricarboxylic transport protein TctB"
FT                   /note="KEGG: abu:Abu_0099 putative tricarboxylic transport
FT                   protein TctB; SPTR: A8ER10 Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91947"
FT                   /db_xref="GOA:D5V4Y5"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4Y5"
FT                   /protein_id="ADG91947.1"
FT                   /translation="MTKNTIGSIFFLAFSSFYFYSVFSIKKMPMAQFEVMTASTFPYYI
FT                   GLTGIIISVILLVLSLLEKNKENLSLTYLRSLDLKTTTFFILLMIFYGFTIRPLGFIFS
FT                   TMIFLAIGFFILKERNIKRIFLISVGVSVGFYVLLNNVLGVYIDAGDFINNLLGVN"
FT   gene            complement(269108..270079)
FT                   /locus_tag="Arnit_0282"
FT   CDS_pept        complement(269108..270079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0282"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG3181 conserved hypothetical protein;
FT                   InterPro IPR005064; KEGG: abu:Abu_0098 putative
FT                   tricarboxylic transport protein TctC; PFAM: conserved
FT                   hypothetical protein; SPTR: A8ER09 Putative uncharacterized
FT                   protein; PFAM: Tripartite tricarboxylate transporter family
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91948"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4Y6"
FT                   /protein_id="ADG91948.1"
FT                   /translation="MKLQISKICKNVALASCLVAGLAMTSVASEIEKIHFLIPGGAGGG
FT                   WDGTARGVGEALKKSGLVDETSFENMSGGGGGKAIAYLIETADKQQDTLMVNSTPIVIR
FT                   SLQGVFPQSFRDLSLISAVVADYGALVVRADSKYKTWADVKAAFDKNPRKVKIAGGSSR
FT                   GSMDHLVAAQIFKAAGGNPTNVRYVPYDAGGKALAGLLTGEVDVLSTGLGEVLEKHKKG
FT                   EVRIIGITSDESIDGIPSFKSMGVDAYFANWRGFFGAPNLPQEKIDAFAKVLGDMYKTK
FT                   EWETVRARNGWANLYKPTTQFKTFLENQEKTISSLMKEMGFL"
FT   sig_peptide     complement(269996..270079)
FT                   /locus_tag="Arnit_0282"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            270930..271841
FT                   /locus_tag="Arnit_0283"
FT   CDS_pept        270930..271841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0283"
FT                   /product="Nucleotide-binding protein, predicted, TIR"
FT                   /note="COGs: COG4271 nucleotide-binding protein containing
FT                   TIR -like domain; InterPro IPR014571:IPR019302; KEGG:
FT                   vvu:VV1_2473 nucleotide-binding protein; PFAM:
FT                   Nucleotide-binding protein, predicted, TIR-like; SPTR:
FT                   A4CFM1 Predicted nucleotide-binding protein; PFAM:
FT                   Predicted nucleotide-binding protein containing TIR-like
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91949"
FT                   /db_xref="InterPro:IPR014571"
FT                   /db_xref="InterPro:IPR019302"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4Y7"
FT                   /protein_id="ADG91949.1"
FT                   /translation="MFNLIVLCGEDSWETSPIELNRSRLFEYTVDEISERYIELTDEVI
FT                   NELKTYPCLFATEQEVSSTKIGYIKKISRRRDEIKIYFEIIELFSSIEKGWLKELSNEL
FT                   DIVKNELRRTHWSIKDEDLFEILLKKSLISKENYIKHLNSYKLLDEPVNIKPSQGEVFN
FT                   TSQVFIVHGHDSVTKMEVSDFVKELGLEPIILHLQASSGMTIIEKIEKYTNVGYALVLY
FT                   TPCDIGTKRDSLIYKRRARQNVVFEHGYLLAKLKRERVAAIVKDELELPNDMSGLVYIS
FT                   YDENDNWKEELKIELKTLGYLG"
FT   gene            complement(271966..272922)
FT                   /locus_tag="Arnit_0284"
FT   CDS_pept        complement(271966..272922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0284"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding protein"
FT                   /note="COGs: COG1013 Pyruvate:ferredoxin oxidoreductase and
FT                   related 2-oxoacid:ferredoxin oxidoreductase beta subunit;
FT                   InterPro IPR011766; KEGG: tdn:Suden_0099 pyruvate
FT                   flavodoxin oxidoreductase subunit beta; PFAM: thiamine
FT                   pyrophosphate protein domain protein TPP-binding; SPTR:
FT                   Q30UF1 Pyruvate:acceptor oxidoreductase beta subunit; PFAM:
FT                   Thiamine pyrophosphate enzyme, C-terminal TPP binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91950"
FT                   /db_xref="GOA:D5V4Y8"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4Y8"
FT                   /protein_id="ADG91950.1"
FT                   /translation="MSNQKVIKNLKTFSTAAERFEGSHVLCPGCAHSIIVREVLNATND
FT                   NLVVSAATGCLEVCTAIYPHTSWDCSWIHIGFENASTAIAGAETMNKVLRKKGRIDPST
FT                   PEPKFVTFGGDGATYDIGFQWISGCFERGHDFMYICLDNEVYANTGGQRSSSTPIGSST
FT                   TTAPAGSTSYGEKRNKKDMLAIMAAHGSPYVAQVAPNKWKDMIKKIQTGFDTKGPVFIN
FT                   AMSACTTEWKFQPHETIEASDLAVDSLVFPLYEIIDGTELNITYRPKNIVPVRDYLAFQ
FT                   PRFKHLFKPENEYIIEEWQKRVDAKWEYLQKREEARV"
FT   gene            complement(272932..274161)
FT                   /locus_tag="Arnit_0285"
FT   CDS_pept        complement(272932..274161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0285"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="COGs: COG0674 Pyruvate:ferredoxin oxidoreductase and
FT                   related 2-oxoacid:ferredoxin oxidoreductase alpha subunit;
FT                   InterPro IPR009014:IPR015941:IPR002880; KEGG: sun:SUN_0200
FT                   pyruvate flavodoxin oxidoreductase subunit alpha; PFAM:
FT                   pyruvate flavodoxin/ferredoxin oxidoreductase domain
FT                   protein; SPTR: A6Q6Q1 Pyruvate:ferredoxin oxidoreductase,
FT                   alpha subunit; PFAM: domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91951"
FT                   /db_xref="GOA:D5V4Y9"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4Y9"
FT                   /protein_id="ADG91951.1"
FT                   /translation="MNSKQMELNKVEVWDGNTCNAQAFRQAAVDVLAAYPITPSTNTVE
FT                   TYASFHANGYVDGEIIMVESEHAAMSGCVGAGAAGGRVATATSSQGCALMVEVLYQCSG
FT                   MRIPVVLCLVNRALAAPLNVNGDHSDMYLTRDAGWIQLDSFNAQEAYDLTLCSFKIGEH
FT                   KDVRLPVISNQDGFLTSHTAQTVRPLSDKVAYDFVGDYLQVNAMLDFTNPVTHGVQTEH
FT                   DWHFEHKAKQHAALMGSLFVVEEVFEEFEKISGRKYNLVESYKVEDADVVIVCLGTTYE
FT                   TAMIAVDAIREETGIKAGVLAPRLFRPFPLTQLASKLQNVKAIACMDRSAPGGTVGTLY
FT                   NEVAGALFNTQARPILKNLVYGLGGRDIIVNELKEIFVSLNEEAKNGKLNGKIQTLHGV
FT                   RGPELSFYEH"
FT   gene            complement(274161..274574)
FT                   /locus_tag="Arnit_0286"
FT   CDS_pept        complement(274161..274574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0286"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase,
FT                   delta subunit"
FT                   /note="COGs: COG1144 Pyruvate:ferredoxin oxidoreductase and
FT                   related 2-oxoacid:ferredoxin oxidoreductase delta subunit;
FT                   InterPro IPR017900:IPR017896:IPR001450:IPR011898; KEGG:
FT                   nis:NIS_1604 pyruvate flavodoxin oxidoreductase subunit
FT                   delta; PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; SPTR: A6Q5F1 Pyruvate:ferredoxin oxidoreductase,
FT                   delta subunit; TIGRFAM: pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase, delta subunit; PFAM: 4Fe-4S binding domain;
FT                   TIGRFAM: 2-oxoacid:acceptor oxidoreductase, delta subunit,
FT                   pyruvate/2-ketoisovalerate family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91952"
FT                   /db_xref="GOA:D5V4Z0"
FT                   /db_xref="InterPro:IPR011898"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4Z0"
FT                   /protein_id="ADG91952.1"
FT                   /translation="MSKSIKEMGWDELVPGAALFSFDQVIDYTLAETNPEDRTYAETNS
FT                   KNLYVGDWRVMKPVWNTELCIDCQNCWIYCPDSAVISRNKEIQGIDYDHCKGCGICVEV
FT                   CPTNPKSLMMFNETEKNELALTKWPVKKEKGEK"
FT   gene            complement(274585..275148)
FT                   /locus_tag="Arnit_0287"
FT   CDS_pept        complement(274585..275148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0287"
FT                   /product="pyruvate/ketoisovalerate oxidoreductase, gamma
FT                   subunit"
FT                   /note="COGs: COG1014 Pyruvate:ferredoxin oxidoreductase and
FT                   related 2-oxoacid:ferredoxin oxidoreductase gamma subunit;
FT                   InterPro IPR002869:IPR019752:IPR011894; KEGG: nis:NIS_1605
FT                   pyruvate flavodoxin oxidoreductase subunit gamma; PFAM:
FT                   Pyruvate/ketoisovalerate oxidoreductase; SPTR: A6Q5F2
FT                   Pyruvate:ferredoxin oxidoreductase, gamma subunit; TIGRFAM:
FT                   pyruvate/ketoisovalerate oxidoreductase, gamma subunit;
FT                   PFAM: Pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   TIGRFAM: 2-oxoacid:acceptor oxidoreductase, gamma subunit,
FT                   pyruvate/2-ketoisovalerate family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91953"
FT                   /db_xref="GOA:D5V4Z1"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011894"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4Z1"
FT                   /protein_id="ADG91953.1"
FT                   /translation="MLEIRWHSRAGQGAVTGAKGLGSVVAETGKEVQAFAFYGSAKRGA
FT                   SMTAYNRIDDKQIINHEKFMEPNFVFILDPALAFTDDFTANETEDTKYIITTHLSKEEL
FT                   IEAIPALHGRENRTFILDCLQISQETIGRPIPNTPMLGAFMKVSGMFELDYFQNAMKSV
FT                   LKKLPQKIIDANMIAIERAYNEVH"
FT   gene            complement(275658..276314)
FT                   /locus_tag="Arnit_0288"
FT   CDS_pept        complement(275658..276314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0288"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="COGs: COG0546 phosphatase; InterPro
FT                   IPR005834:IPR006439; KEGG: abu:Abu_0097 hypothetical
FT                   protein; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; SPTR: A8ER08 Putative uncharacterized protein;
FT                   TIGRFAM: HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: haloacid dehalogenase-like hydrolase; TIGRFAM:
FT                   haloacid dehalogenase superfamily, subfamily IA, variant 3
FT                   with third motif having DD or ED; haloacid dehalogenase
FT                   superfamily, subfamily IA, variant 1 with third motif
FT                   having Dx(3-4)D or Dx(3-4)E"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91954"
FT                   /db_xref="GOA:D5V4Z2"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4Z2"
FT                   /protein_id="ADG91954.1"
FT                   /translation="MENVILFDLDGTLIDSTDAIVSTFHHSFEVMNYQYTGNDEDIKSL
FT                   IGYPLEIMYMELGIEKELAWDYVAAYKQRYKQISTKKTLLLENAKEALEKASKFARLSV
FT                   VTTKTGAYTIPLLEHFDILKYFEVITGREHVENPKPHPEPILKTLNQMNIKKGSNVWMV
FT                   GDTHLDLISANGAEINCVGVLCGYGKEEDLRELTNFVTSNSLAAVELIQKYTLKT"
FT   gene            complement(276327..277844)
FT                   /locus_tag="Arnit_0289"
FT   CDS_pept        complement(276327..277844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0289"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="COGs: COG0747 ABC-type dipeptide transport system
FT                   periplasmic component; InterPro IPR000914; KEGG:
FT                   abu:Abu_0096 oligopeptide ABC transporter, periplasmic
FT                   substrate-binding protein; PFAM: extracellular
FT                   solute-binding protein family 5; SPTR: A8ER07 Oligopeptide
FT                   ABC transporter, periplasmic substrate-binding protein;
FT                   PFAM: Bacterial extracellular solute-binding proteins,
FT                   family 5 Middle"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91955"
FT                   /db_xref="GOA:D5V4Z3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4Z3"
FT                   /protein_id="ADG91955.1"
FT                   /translation="MKKLTLLLFTICCLLNTTNASTLNMSITSSPIRLNTILANDSASS
FT                   EISGWIFNGLFKYDKNGQVTTDLASSYKFIDSTHLVINLKKNVLWQDGKKFTADDVIFT
FT                   YEKINDPKVFTTIKSYFKEVKSLSKINNYTVEVVYKKPYFKALEIWMFGIIPKHILKDE
FT                   KDLMTSSFNKHPIGTGPYKIDGFKLGSDIRLYAFDKYFEGRPKIDELNFKFLPDANTSF
FT                   LYLKQGKLDLGGLSPLQIDRQIDKEFEKHYQIIEKPAFSYDYLGFNLKKKKFQDIRVRR
FT                   ALSLAINREEIIDILFFGHGKVCNGPFLPGTFAYDDTIKPIKQNIKEAKRLLKLAGYDE
FT                   NHPLSFEVITNTGNDIRINATQIIQYQLAKIGVKMKIRVMEWQAFLNTVVHPKNFEAIV
FT                   LGWNLALMPDAYPLWHSESMKKGGFNLVSYSNKEVDELIVKGATTIDKKKLSKIYKKIF
FT                   RIIAHDTPYLFLYIPNSITVVSKKIKNIEPSFIGITHNQKDWIKEDD"
FT   sig_peptide     complement(277785..277844)
FT                   /locus_tag="Arnit_0289"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(277932..278321)
FT                   /locus_tag="Arnit_0290"
FT   CDS_pept        complement(277932..278321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0290"
FT                   /product="ribosomal protein S9"
FT                   /note="COGs: COG0103 Ribosomal protein S9; InterPro
FT                   IPR020568:IPR020574:IPR014721:IPR000754; KEGG: abu:Abu_0095
FT                   30S ribosomal protein S9; PFAM: ribosomal protein S9; SPTR:
FT                   A8ER06 30S ribosomal protein S9; PFAM: Ribosomal protein
FT                   S9/S16"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91956"
FT                   /db_xref="GOA:D5V4Z4"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4Z4"
FT                   /protein_id="ADG91956.1"
FT                   /translation="MAKVYATGRRKSSIAKVWLEAGNGQVSINGQTLDAWLGGHEAIKK
FT                   RVMRPLEVSKQESSVNIVVKTLGGGYSAQADAAKHGISRALVAFDEQFRAVLKPYGLLT
FT                   RDARSVERKKYGKKKARKSTQFSKR"
FT   gene            complement(278327..278746)
FT                   /locus_tag="Arnit_0291"
FT   CDS_pept        complement(278327..278746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0291"
FT                   /product="ribosomal protein L13"
FT                   /note="COGs: COG0102 Ribosomal protein L13; InterPro
FT                   IPR005822:IPR005823; KEGG: abu:Abu_0094 50S ribosomal
FT                   protein L13; PFAM: ribosomal protein L13; SPTR: A8ER05 50S
FT                   ribosomal protein L13; TIGRFAM: ribosomal protein L13;
FT                   PFAM: Ribosomal protein L13; TIGRFAM: ribosomal protein
FT                   L13, bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91957"
FT                   /db_xref="GOA:D5V4Z5"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4Z5"
FT                   /protein_id="ADG91957.1"
FT                   /translation="MKFTQMAKATEIDRDWVIIDATDKVFGRIITEVATILRGKNKTNY
FT                   TPHVDCGDNVIIINATKAKFSGTKLETKNYYTHSGYFGSTKTHKMSDMFEQNPEKLYKL
FT                   AARGMLPKTKLGKSMLKKLKVYAGSEHPHTAQIKG"
FT   gene            complement(278823..280199)
FT                   /locus_tag="Arnit_0292"
FT   CDS_pept        complement(278823..280199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0292"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="COGs: COG2205 Osmosensitive K+ channel histidine
FT                   kinase; InterPro IPR003594:IPR009082:IPR003661:IPR005467;
FT                   KEGG: abu:Abu_0093 two-component sensor histidine kinase;
FT                   PFAM: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein; SMART: histidine kinase A domain
FT                   protein; ATP-binding region ATPase domain protein; SPTR:
FT                   A8ER04 Sensor protein; PFAM: Histidine kinase-, DNA gyrase
FT                   B-, and HSP90-like ATPase; His Kinase A (phosphoacceptor)
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91958"
FT                   /db_xref="GOA:D5V4Z6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR031967"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4Z6"
FT                   /protein_id="ADG91958.1"
FT                   /translation="MLKIHQFFLRSFILIFLSILILISIVIYFWSKTIYLEQIEKNILS
FT                   NINTLSIALPNLDNIDKKVKEIKEATNLRVTIINSKGKVIAETDKDKTLMENHLNREEV
FT                   IDAKLSDYGEISRHSDTLNKDLLYIAKEVKIDGQNYYIRMSSDISTIKEYFIKLSLQLI
FT                   AIFSIFLLLAFIVSYYISNEIKKETDNILHFLISLTKKRESISLSVFHTKEFFTINRLL
FT                   NKVALRLQKKEKTKAKHTAKLKLANKQKDEIISAISHEFKNPIAIITGYVQTLQNDKDL
FT                   PEQMRNKFLSKIDSNANKMTQIIDKLRLVLKLEEGKEHIEKRKIHLKDVCTTLCIDLKD
FT                   KYPNRTIEIKGDNYLLEADETLLSMAISNLVENALKYSENTVTIEITDKYLKVIDLGIG
FT                   ISEMELLKITDKFYRVSQNGWNNSLGLGLFIVNSILVLHDFKLEIHSVYAQGSEFIIKY
FT                   "
FT   gene            complement(280193..280867)
FT                   /locus_tag="Arnit_0293"
FT   CDS_pept        complement(280193..280867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0293"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="COGs: COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain; InterPro IPR011006:IPR011991:IPR001789:IPR001867;
FT                   KEGG: abu:Abu_0092 two-component response regulator; PFAM:
FT                   response regulator receiver; transcriptional regulator
FT                   domain protein; SMART: response regulator receiver; SPTR:
FT                   A8ER03 Two-component response regulator; PFAM: Response
FT                   regulator receiver domain; Transcriptional regulatory
FT                   protein, C terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91959"
FT                   /db_xref="GOA:D5V4Z7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4Z7"
FT                   /protein_id="ADG91959.1"
FT                   /translation="MNSSTLLIIEDEVDILELLEYTLQKEGYETIGFLNASDKVYEVLN
FT                   EEEIDLILMDRNLPGIEGTSFISDIKNKGYNIPVIYVSAKDQDEDILEGFDKHADDYIT
FT                   KPFNLKELIARVKAVIKRTKKDIEIEKIKDITYKKSSKSFFINESKIDLTTLEHDLFLE
FT                   FFKNKDILLSREYLLDTVWEDSLEKKLKTVNVAVKRLKSKIDPKNDKKYIKSVRGEGYM
FT                   FC"
FT   gene            complement(280872..281255)
FT                   /locus_tag="Arnit_0294"
FT   CDS_pept        complement(280872..281255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0294"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: abu:Abu_0091 hypothetical protein; SPTR:
FT                   A8ER02 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91960"
FT                   /db_xref="GOA:D5V4Z8"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4Z8"
FT                   /protein_id="ADG91960.1"
FT                   /translation="MKRAIAKINRYFRSNYEVLIAMILFIAIIVSGLDFSKAIIYMLEF
FT                   IVIMEVVKMISDFIKKEKLRLRFIIDLFIIFLIRDVIIQASHTTIDYVDIIFLLIVIFI
FT                   FFIFRIMSIKYSPGIHKIDEKSE"
FT   sig_peptide     complement(281148..281255)
FT                   /locus_tag="Arnit_0294"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(281278..281949)
FT                   /locus_tag="Arnit_0295"
FT   CDS_pept        complement(281278..281949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0295"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /note="COGs: COG0704 Phosphate uptake regulator; InterPro
FT                   IPR008170; KEGG: abu:Abu_0090 phosphate transport system
FT                   regulatory protein PhoU, putative; PFAM: PhoU family
FT                   protein; SPTR: A8ER01 Phosphate transport system regulatory
FT                   protein PhoU, putative; PFAM: PhoU domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91961"
FT                   /db_xref="GOA:D5V4Z9"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D5V4Z9"
FT                   /protein_id="ADG91961.1"
FT                   /translation="MMLKVYETRREQIQNELLEIGDMVIESLNAALKALKDEDFKALKD
FT                   AELSLKKLTISSNNIDNSIVTALALYQPEARDLRELVSYFKITNELVRAGGNTKGFIKI
FT                   FRTSFSDDLNTKTILEYAIPLLKSTLLSLQTSMSIIKESTTNHIEEKYQRVVVEESKTD
FT                   DLYSMIEKNILKLIAKNLDLSKEYFDILTSLRKLEKISDRSVSIAHLLLFAERGGEIER
FT                   K"
FT   gene            complement(282025..283755)
FT                   /locus_tag="Arnit_0296"
FT   CDS_pept        complement(282025..283755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0296"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="COGs: COG2200 FOG: EAL domain; InterPro
FT                   IPR001633:IPR000160:IPR000644; KEGG: abu:Abu_0086 EAL/GGDEF
FT                   domain-containing protein; PFAM: EAL domain protein; CBS
FT                   domain containing protein; GGDEF domain containing protein;
FT                   SMART: EAL domain protein; GGDEF domain containing protein;
FT                   SPTR: A8EQZ7 EAL/GGDEF domain protein; TIGRFAM: diguanylate
FT                   cyclase; PFAM: EAL domain; CBS domain; GGDEF domain;
FT                   TIGRFAM: diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91962"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:D5V500"
FT                   /protein_id="ADG91962.1"
FT                   /translation="MKIKWNSIVEKLDYAFQPIIHAHSGKIFAVEALLRNVEKIPNINY
FT                   IHDIFDLAYEENYLYEFDLLLREKAIEKFSKISIENLQLYYNLDNRTIHAKNYTKGNTK
FT                   KILKKYNLPKSVICFELSERGTIEDQNNLVEIIQNYNSSNYNIAIDDFGVGVSGLKLLY
FT                   FSQANIIKIDRFFIENINEDAKKRLFCSSIINMAHIMGMKVVAEGVETLKEFYTCKNIG
FT                   ADFIQGYLVQKPTVDIDEIKPIYKDIVKYLLNEKRADDNAPIEQEFIQNIVPINIDSSL
FT                   HSLFLYFKDYSHSSFVPIVDDYDNFIGVIYEVDIKQISYSQYGLALAQNKSYSTKISKY
FT                   VKQVISIEASWGIDKALQIFNQDPNSSGIFITKANKYHGFIDLRSLLQLSHKRTIEIAE
FT                   NQNPLTRLPGNKQIERFIYDSLENKNSYKSHILYFDFDNFKPFNDTYGFRQGDRAILLF
FT                   AELLQKKYPSDTFIAHIGGDDFFIGIKNSDIEDVYERTKEALDEFRWSVKNLYNETDKK
FT                   NGHIKGKDRFGENRIFELLSCSCAIIEISNNSKKANFDYTLNVMKKYSKDLDRPISASF
FT                   "
FT   gene            complement(283953..285020)
FT                   /locus_tag="Arnit_0297"
FT   CDS_pept        complement(283953..285020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0297"
FT                   /product="peptide chain release factor 1"
FT                   /note="COGs: COG0216 Protein chain release factor A;
FT                   InterPro IPR000352:IPR005139:IPR004373; KEGG: abu:Abu_0083
FT                   peptide chain release factor 1; PFAM: Class I peptide chain
FT                   release factor; PCRF domain protein; SPTR: A8EQZ4 Peptide
FT                   chain release factor 1; TIGRFAM: peptide chain release
FT                   factor 1; PFAM: PCRF domain; RF-1 domain; TIGRFAM: peptide
FT                   chain release factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91963"
FT                   /db_xref="GOA:D5V501"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:D5V501"
FT                   /protein_id="ADG91963.1"
FT                   /translation="MLQDKLQLFIDRYEEINGLLASPDISSDIKRMTTLSKEQSAIEPI
FT                   VNKAKEYISVLNDIQDNKLLYDDPELGELAKEELKDLELRKPTIEEEIKVLMIPKDPND
FT                   NKNIFIELRAGAGGDEAGIFVGNLFRAYLRYAELKGWKVEIMNQSENEAGGYKEIVALF
FT                   KGEQVYSRLKYESGTHRVQRVPATESQGRVHTSAITVAVMPEVDDVEVEIDPGDLKIDV
FT                   MRASGNGGQSVNTTDSAVRITHIPSGLVVTNQDQKSQHKNKDKAMKVLKARLYDIQMQE
FT                   KMDSEGASRKEQVGTGDRSGRIRTYNYPQGRISDHRINLTLYRLEAVMNDGVFDEIIDP
FT                   LITDAQSKAIEANGL"
FT   gene            complement(285085..285345)
FT                   /locus_tag="Arnit_0298"
FT   CDS_pept        complement(285085..285345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0298"
FT                   /product="ribosomal protein S20"
FT                   /note="InterPro IPR002583; KEGG: abu:Abu_0082 30S ribosomal
FT                   protein S20; PFAM: ribosomal protein S20; SPTR: A8EQZ3 30S
FT                   ribosomal protein S20; TIGRFAM: ribosomal protein S20;
FT                   PFAM: Ribosomal protein S20; TIGRFAM: ribosomal protein
FT                   S20"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91964"
FT                   /db_xref="GOA:D5V502"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/TrEMBL:D5V502"
FT                   /protein_id="ADG91964.1"
FT                   /translation="MANHKSSAKRAKQTLVKTERNRFYKTRIKNITKDVLSAVEANDKE
FT                   KATVAMKTANKYMHHCIAKGILKKGTAARKVGRLQVKVNAL"
FT   gene            285436..286770
FT                   /locus_tag="Arnit_0299"
FT   CDS_pept        285436..286770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0299"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="COGs: COG1109 Phosphomannomutase;
FT                   InterProIPR005841:IPR016055:IPR016066:IPR005844:IPR
FT                   005845:IPR005846:IPR005843:IPR006352; KEGG: abu:Abu_0081
FT                   phosphoglucosamine mutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; phosphoglucomutase/phosphomannomutase; SPTR:
FT                   A8EQZ2 Phosphoglucosamine mutase; TIGRFAM:
FT                   phosphoglucosamine mutase; PFAM:
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain II; Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain III;
FT                   Phosphoglucomutase/phosphomannomutase, C-terminal domain;
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain I; TIGRFAM: phosphoglucosamine mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91965"
FT                   /db_xref="GOA:D5V503"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D5V503"
FT                   /protein_id="ADG91965.1"
FT                   /translation="MKLFGTDGVRGQAGSFLDAMTVMKLAMAAGIFFRKNSYTNKILVG
FT                   KDTRRSGYMIENALVSGLTAVGYDVIQIGPMPTPAIAFLTESMRCDAGIMISASHNPFE
FT                   DNGIKFFDHNGNKLDIECEKAIEELFFDEESIIQAQKTGKEIGASKRIDDVIGRYIVSI
FT                   KSSFPKDLTLSGLRIVLDCANGAAYKVAPTILEELGAEVFTINAKPNGFNINELSGAMY
FT                   PENVSKVVKEVRADIGLALDGDADRLVIIDENGDTVDGDKLLGALCVYLSNKGLLKGEA
FT                   CVATVMSNKALEDYLDSFDLKLNRTDVGDKNVLVNMKENHINFGGEQSGHVIFSDVSKT
FT                   GDGLATALQVLAYVLESGKKASEALNKFELYPQVLKNIKVNEKIPLDKIEGLKELQAEI
FT                   KSKGMRDLIRYSGTENKLRILIEGRDKKLVNEYIEKLVEFLTKKL"
FT   gene            286767..287228
FT                   /locus_tag="Arnit_0300"
FT   CDS_pept        286767..287228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0300"
FT                   /product="lipoprotein signal peptidase"
FT                   /note="COGs: COG0597 Lipoprotein signal peptidase; InterPro
FT                   IPR001872; KEGG: abu:Abu_0080 lipoprotein signal peptidase;
FT                   PFAM: peptidase A8 signal peptidase II; SPTR: A8EQZ1
FT                   Lipoprotein signal peptidase; TIGRFAM: lipoprotein signal
FT                   peptidase; PFAM: Signal peptidase (SPase) II; TIGRFAM:
FT                   lipoprotein signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91966"
FT                   /db_xref="GOA:D5V504"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:D5V504"
FT                   /protein_id="ADG91966.1"
FT                   /translation="MSKKLTTSVAIFILLVLIDQAIKYGFVFLNFGFESDCISLVLAYN
FT                   YGVAFSMFEFLSEYLKFIQLALIACILIYLYFNKEVFLKYYIPISILMAGGLSNILDRF
FT                   TYGAVVDYVYWHCGFDFAIFNFADVIIDFAIAIILYMQYKQYKEDKKRA"
FT   gene            287307..288575
FT                   /locus_tag="Arnit_0301"
FT   CDS_pept        287307..288575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0301"
FT                   /product="homoaconitate hydratase family protein"
FT                   /note="COGs: COG0065 3-isopropylmalate dehydratase large
FT                   subunit;
FT                   InterProIPR001030:IPR018136:IPR015931:IPR015932:IPR
FT                   011826:IPR006251; KEGG: abu:Abu_0079 3-isopropylmalate
FT                   dehydratase large subunit; PFAM: aconitate hydratase domain
FT                   protein; SPTR: A8EQZ0 3-isopropylmalate dehydratase large
FT                   subunit; TIGRFAM: homoaconitate hydratase family protein;
FT                   3-isopropylmalate dehydratase; PFAM: Aconitase family
FT                   (aconitate hydratase); TIGRFAM: 3-isopropylmalate
FT                   dehydratase, large subunit; homoaconitate hydratase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91967"
FT                   /db_xref="GOA:D5V505"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006251"
FT                   /db_xref="InterPro:IPR011826"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:D5V505"
FT                   /protein_id="ADG91967.1"
FT                   /translation="MGQTITEKIFSEHVGHEVYAGEIVRSPIDMVIGNDITTPISIRAF
FT                   EEGGFEKLANPDGFAIVLDHFIPAKDIASANQARISRDFAEKHNLKLFFDEKDMGIEHA
FT                   LLPEKGLVLPGDVIIGADSHTCTHGALGAFSTGMGSTDISFGMITGGNWFKVPESIKVV
FT                   FKGKPGPYITGKDLILEIIRILGVDGALYKALEFTGDSIPYLSMDDRFSLCNMAIEAGA
FT                   KNGIVAYDEVTKEFLDSRDSLRAQPKIHYSDDDATYCQVIEIDVEALNPVIAYPFLPSN
FT                   GHSVNQAVEDNIRVDQVFIGSCTNGRLSDFKVAAQLLEGKKVARHVRLILTPGTQKILR
FT                   EATKLGYIDTLVDAGGVVSNPTCGACLGGYMGILGDDEVCISTTNRNFVGRMGSRSSKI
FT                   YLSNTAVAAASAISGYITDPRSL"
FT   gene            288576..289154
FT                   /locus_tag="Arnit_0302"
FT   CDS_pept        288576..289154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0302"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein"
FT                   /note="COGs: COG0746 Molybdopterin-guanine dinucleotide
FT                   biosynthesis protein A; KEGG: abu:Abu_0078
FT                   molybdopterin-guanine dinucleotide biosynthesis protein;
FT                   SPTR: A8EQY9 Molybdopterin-guanine dinucleotide
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91968"
FT                   /db_xref="GOA:D5V506"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5V506"
FT                   /protein_id="ADG91968.1"
FT                   /translation="MIKPHFDIPCVILCGGRSSRMGEDKSLLPFSNYNTLTQYQFDRLK
FT                   THFKNIYLSSKTNKFDFLKSDENIIFDNIEDESSPLIALKSIFETIKSDKVFILTVDTP
FT                   FVKIETIAKLINESLNSSTIAITSREHNLCGVYERSCLKIINQMLKENNHKIGFLLKRI
FT                   ELKKIEFFDENEFLNLNKKEDYQKALSLI"
FT   gene            complement(289220..289579)
FT                   /locus_tag="Arnit_0303"
FT   CDS_pept        complement(289220..289579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0303"
FT                   /product="ribosomal protein L20"
FT                   /note="COGs: COG0292 Ribosomal protein L20; InterPro
FT                   IPR005813; KEGG: abu:Abu_0074 50S ribosomal protein L20;
FT                   PFAM: ribosomal protein L20; SPTR: A8EQY5 50S ribosomal
FT                   protein L20; TIGRFAM: ribosomal protein L20; PFAM:
FT                   Ribosomal protein L20; TIGRFAM: ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91969"
FT                   /db_xref="GOA:D5V507"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/TrEMBL:D5V507"
FT                   /protein_id="ADG91969.1"
FT                   /translation="MPRVKTGIVRRRRHKKVLKAARGFFAGRSKHFRKAKEQLERSLVY
FT                   AYRDRRQKKRDIRKLWIIRINAACRLNDINYSRFMNGVKLAGIELDRKILADMAMNDAA
FT                   AFTTVATAAKAALAK"
FT   gene            complement(289681..289878)
FT                   /locus_tag="Arnit_0304"
FT   CDS_pept        complement(289681..289878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0304"
FT                   /product="ribosomal protein L35"
FT                   /note="InterPro IPR001706:IPR018265; KEGG: abu:Abu_0073 50S
FT                   ribosomal protein L35; PFAM: ribosomal protein L35; SPTR:
FT                   A8EQY4 50S ribosomal protein L35; TIGRFAM: ribosomal
FT                   protein L35; PFAM: Ribosomal protein L35; TIGRFAM:
FT                   ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91970"
FT                   /db_xref="GOA:D5V508"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/TrEMBL:D5V508"
FT                   /protein_id="ADG91970.1"
FT                   /translation="MPKMKSVSGALKRFKVKKNGSIKCGSAFRSHILTKMSRKRKVALR
FT                   GPQTIDSTDATRVRRMLCKA"
FT   gene            complement(290022..290549)
FT                   /locus_tag="Arnit_0305"
FT   CDS_pept        complement(290022..290549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0305"
FT                   /product="translation initiation factor IF-3"
FT                   /note="COGs: COG0290 Translation initiation factor 3
FT                   (IF-3); InterPro IPR019813:IPR001288:IPR019815:IPR019814;
FT                   KEGG: abu:Abu_0072 translation initiation factor IF-3;
FT                   PFAM: Translation initiation factor 3-like; SPTR: A8EQY3
FT                   Translation initiation factor IF-3; TIGRFAM: translation
FT                   initiation factor IF-3; PFAM: Translation initiation factor
FT                   IF-3, C-terminal domain; Translation initiation factor
FT                   IF-3, N-terminal domain; TIGRFAM: translation initiation
FT                   factor IF-3"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91971"
FT                   /db_xref="GOA:D5V509"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:D5V509"
FT                   /protein_id="ADG91971.1"
FT                   /translation="MSRGNKKDDVIMNDDITAKEVRCMGDDGANYGIISTAEALKTADE
FT                   QGLDLVLIAPEGKPPVAKIMDYSKFKYQQEKKKKEARKNQKVIVLKEVKFSVKIAENDI
FT                   NYKVKHAIEFLEKGFHVKCRVFLKGREMAHPEAGVEVLEKVWPMLEDYGDRDSEPKLEG
FT                   RFVNMMVLPKKD"
FT   gene            complement(290546..292354)
FT                   /locus_tag="Arnit_0306"
FT   CDS_pept        complement(290546..292354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0306"
FT                   /product="threonyl-tRNA synthetase"
FT                   /note="COGs: COG0441 Threonyl-tRNA synthetase;
FT                   InterProIPR006195:IPR002320:IPR018158:IPR018163:IPR
FT                   004154:IPR012947:IPR002314; KEGG: abu:Abu_0071
FT                   threonyl-tRNA synthetase; PFAM: tRNA synthetase class II (G
FT                   H P and S); Threonyl/alanyl tRNA synthetase SAD;
FT                   Anticodon-binding domain protein; SPTR: A8EQY2
FT                   Threonyl-tRNA synthetase; TIGRFAM: threonyl-tRNA
FT                   synthetase; PFAM: Anticodon binding domain; Threonyl and
FT                   Alanyl tRNA synthetase second additional domain; tRNA
FT                   synthetase class II core domain (G, H, P, S and T);
FT                   TIGRFAM: threonyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91972"
FT                   /db_xref="GOA:D5V510"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:D5V510"
FT                   /protein_id="ADG91972.1"
FT                   /translation="MEPIGVLNDGQIYDLQTAEALNIQGEVIKADNSKESLEILRHSCA
FT                   HLMAQAIKELYPEAKFFVGPVVSEGFYYDFKVESKISDEDLPKIEKKMKELANAKLPIE
FT                   RYEASREEISQKFNSDELKQAVLSRITDDTLTMYKQGDFEDLCRGPHLPNTRMIRSFKL
FT                   TRVAGAYLGGDEKNEMITRIYGIAFFDKQELFDYVKMLEEAKKRDHRKLGTELELFTFS
FT                   DDVGAGLPMWLPNGARLRSKLEHILYKAHRVRGYEPVRGPEILKSKMWDISGHNANYSQ
FT                   NMYYTTIDEQQYAMKPMNCVGHIQIFKNSLVSYKDLPKKLFEYGVVHRHEMSGAMHGLF
FT                   RVREFTQDDSHIFCTQDQMKDVIFEVLEFVDAVLKLFDFKYEIEVSTKPEKAIGDDMFW
FT                   EKTTKGIMDALDEKNITYGIDEGGGAFYGPKIDIKILDAIGRKWQCGTVQVDMNLPSRF
FT                   EAEYINEKGEKEQPVMIHRAILGSFERFIGILTEHCAGEFPFVIAPTQVIFVPIADTHN
FT                   EYAKELQNELLQNSMDSKIFNMNESLNKRIRMAEKQRVPMIVVIGDEEVENKTVALRDR
FT                   RKREQSNMGKTEFIQMLNEINKGSEI"
FT   gene            292464..292976
FT                   /locus_tag="Arnit_0307"
FT   CDS_pept        292464..292976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0307"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: abu:Abu_0070 hypothetical protein; SPTR:
FT                   A8EQY1 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91973"
FT                   /db_xref="UniProtKB/TrEMBL:D5V511"
FT                   /protein_id="ADG91973.1"
FT                   /translation="MIINLSKIKTEALLLLCKDIITSYENIEDENFEIDDEIKIYIKDT
FT                   SKDVLKELKRVTKESDYYLENKNSYTISAILQAYNFLNLELSKEFKEGTQFNPSMLYIS
FT                   LLSMWFKELGKESKSKEYIYFLLYPYSLTYDKLLLNIKDEKFKVLNIKMIDIAERIILK
FT                   YDKYTLK"
FT   gene            292989..294317
FT                   /locus_tag="Arnit_0308"
FT   CDS_pept        292989..294317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0308"
FT                   /product="protein of unknown function DUF814"
FT                   /note="COGs: COG1293 RNA-binding protein homologous to
FT                   eukaryotic snRNP; InterPro IPR008616:IPR008532; KEGG:
FT                   abu:Abu_0067 fibronectin/fibrinogen-binding protein,
FT                   putative; PFAM: protein of unknown function DUF814;
FT                   Fibronectin-binding A domain protein; SPTR: A8EQX8
FT                   Fibronectin/fibrinogen-binding protein, putative; PFAM:
FT                   Domain of unknown function (DUF814); Fibronectin-binding
FT                   protein A N-terminus (FbpA)"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91974"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniProtKB/TrEMBL:D5V512"
FT                   /protein_id="ADG91974.1"
FT                   /translation="MKYYAIKNIVEYLNANCKIIRQIRRVENNTIFIEFNDRNVIYFDM
FT                   AKSNSLIYKKDEKISSKKDFIAPFDTILQKRFNNSRIKNITMHNDDKIIRIYVNSKSSY
FT                   KELTTILQFEFTGKHTNIIILDENEIILEALRHIDEFSSSRVVKVGEKLDEIPKQTFIP
FT                   KMEEIKDTEEFLLNNYLQKEQSLLASLKKQKISQIEKNRAKLLKVLKTLPQKDELEKES
FT                   QLLYEKANLILSNLHLIKAYEKSAKLNNYDGTVVEIDLSECSNPSIYANTLFKKAKKLK
FT                   QKSLHISIEKENLENKIEFLNRMITNVNLCKSIDEVEFLLPKKQKNQTKTKKQEPYESF
FT                   FFDGYRILLGTDEKSNIYLLQNSKASDFWFHMQSTNSSHVIVQNTKKTLPIDVIYKAAE
FT                   LCVKFSTDFSGKYLVDFTQRRNVKVQNGANVLYNPYDTIDVHI"
FT   gene            294408..295166
FT                   /locus_tag="Arnit_0309"
FT   CDS_pept        294408..295166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0309"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /note="COGs: COG0575 CDP-diglyceride synthetase; InterPro
FT                   IPR000374; KEGG: abu:Abu_0160 CDP-diglyceride synthetase
FT                   CdsA; PFAM: phosphatidate cytidylyltransferase; SPTR:
FT                   A8ER70 Phosphatidate cytidylyltransferase; PFAM:
FT                   Cytidylyltransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91975"
FT                   /db_xref="GOA:D5V513"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:D5V513"
FT                   /protein_id="ADG91975.1"
FT                   /translation="MYELISSSSTRIKTALVLFAVFILVSYINTMFVTWLFLGAFMIVG
FT                   IDEAMNLFKVKDSTVFQYAAITWIIAYFYPYPEILVLIALVIFASNLAYKRDIDKKVFL
FT                   PLLYPLISFLTLLTLYNEYGIGVLWWMLFVVASADVGAYYVGRAFGKTKFCETSPNKTL
FT                   EGVAGGIVLAAILGPIFAIDGITYMGTLVISIVVAISSIFGDLFESYLKREAEVKDSGN
FT                   ILPGHGGVLDRTDGFLFASIVMLVLLRAIL"
FT   gene            295163..296230
FT                   /locus_tag="Arnit_0310"
FT   CDS_pept        295163..296230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0310"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number="1.1.1.267"
FT                   /note="COGs: COG0743 1-deoxy-D-xylulose 5-phosphate
FT                   reductoisomerase; InterPro
FT                   IPR003821:IPR016040:IPR013512:IPR013644; KEGG: abu:Abu_0161
FT                   1-deoxy-D-xylulose 5-phosphate reductoisomerase; PFAM:
FT                   1-deoxy-D-xylulose 5-phosphate reductoisomerase domain
FT                   protein; PRIAM: 1-deoxy-D-xylulose-5-phosphate
FT                   reductoisomerase; SPTR: A8ER71 1-deoxy-D-xylulose
FT                   5-phosphate reductoisomerase; TIGRFAM: 1-deoxy-D-xylulose
FT                   5-phosphate reductoisomerase; PFAM: 1-deoxy-D-xylulose
FT                   5-phosphate reductoisomerase; 1-deoxy-D-xylulose
FT                   5-phosphate reductoisomerase C-terminal; TIGRFAM:
FT                   1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91976"
FT                   /db_xref="GOA:D5V514"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5V514"
FT                   /protein_id="ADG91976.1"
FT                   /translation="MIILGSTGSIGVNTLNIAKKFNLNIDVLVAGKNIDLLNTQIKQFN
FT                   PKTVVIASKDDIPKVNHTNVSYGEEAILNAIEQSDAKTVVNSLVGFLGLKPTLKAIKCG
FT                   KKVALANKESLVVAGAFIDQNNLIPIDSEHFGLWYLLQDKKIDSMTITASGGSFRDYSL
FT                   EKLKNVSIKEALNHPNWSMGNKITIDSATMTNKIFELLEAKWLFDTTKLDAIIETKSLI
FT                   HALINFTDGSTTAHIANANMQLPISYAVLGRVDENILKHIDLVEVGTLEFKKIEEQRYP
FT                   IWGIKDEILKNPNLGVVINAANEVAVAKFLNEEIGFLDISKITLDALNHFHNVNPSSLE
FT                   DIFAWDKEVRAYCGS"
FT   gene            296220..296504
FT                   /locus_tag="Arnit_0311"
FT   CDS_pept        296220..296504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0311"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: abu:Abu_0162 hypothetical protein; SPTR:
FT                   A8ER72 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91977"
FT                   /db_xref="GOA:D5V515"
FT                   /db_xref="UniProtKB/TrEMBL:D5V515"
FT                   /protein_id="ADG91977.1"
FT                   /translation="MGLDLLIPFGILLVLVVYLIATRIKFEKQTIKDYEEKFENWKVHA
FT                   KPEEKEVQESKKELVGLVFKKNGKIEIELFDEFTNNKIQRGKFNSKIRE"
FT   gene            296501..296929
FT                   /locus_tag="Arnit_0312"
FT   CDS_pept        296501..296929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0312"
FT                   /product="protein of unknown function DUF1566"
FT                   /note="InterPro IPR011460; KEGG: cja:CJA_0343 rhs repeat
FT                   family; PFAM: protein of unknown function DUF1566; SPTR:
FT                   B6BMA3 Conserved domain protein; PFAM: Protein of unknown
FT                   function (DUF1566); TIGRFAM: Fibrobacter succinogenes major
FT                   paralogous domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91978"
FT                   /db_xref="InterPro:IPR011460"
FT                   /db_xref="UniProtKB/TrEMBL:D5V516"
FT                   /protein_id="ADG91978.1"
FT                   /translation="MKYLLLIISLIAVLNAASLQRDNDRNIVIDDANKLVWMDSELNIT
FT                   TYLNHSAAQEYCEKLSYAGFDDWRLPEIEEFALIVDKKNFPKNINRVFRYSLNEGYWAN
FT                   TAHWRTLWFYADYMYFVSGTPYYDNRDKKKLVRCVRTR"
FT   sig_peptide     296501..296548
FT                   /locus_tag="Arnit_0312"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            296940..297497
FT                   /locus_tag="Arnit_0313"
FT   CDS_pept        296940..297497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0313"
FT                   /product="protein of unknown function DUF1234"
FT                   /note="COGs: COG3545 esterase of the alpha/beta hydrolase
FT                   fold; InterPro IPR010662; KEGG: abu:Abu_0163 hypothetical
FT                   protein; PFAM: protein of unknown function DUF1234; SPTR:
FT                   A8ER73 Putative uncharacterized protein; PFAM: Alpha/Beta
FT                   hydrolase family of unknown function (DUF1234)"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91979"
FT                   /db_xref="GOA:D5V517"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5V517"
FT                   /protein_id="ADG91979.1"
FT                   /translation="MNKRVLILHGLGGSDFPHWQAHLASDLIKDNYIVSFPAFPNRDNP
FT                   DLNEWKEFLKKEIKHFNPEIVVCHSLANILWFHTCSELDIKLDKLMLVAPISRTRIVKE
FT                   VQSFYPYPIAKDLKAKEVIMAASTNDPYMDIEEAIKLQTELNVGMKIMENAGHINAASG
FT                   FGKLDCALAWIKREETCEENAK"
FT   gene            297494..298483
FT                   /locus_tag="Arnit_0314"
FT   CDS_pept        297494..298483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0314"
FT                   /product="metalloendopeptidase, glycoprotease family"
FT                   /EC_number="3.4.24.57"
FT                   /note="COGs: COG0533 Metal-dependent protease with possible
FT                   chaperone activity; InterPro IPR017860:IPR017861:IPR000905;
FT                   KEGG: abu:Abu_0164 putative DNA-binding/iron
FT                   metalloprotein/AP endonuclease; PFAM: peptidase M22
FT                   glycoprotease; PRIAM: O-sialoglycoprotein endopeptidase;
FT                   SPTR: A8ER74 Probable O-sialoglycoprotein endopeptidase;
FT                   TIGRFAM: metalloendopeptidase, glycoprotease family; PFAM:
FT                   Glycoprotease family; TIGRFAM: metalloendopeptidase,
FT                   putative, glycoprotease family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91980"
FT                   /db_xref="GOA:D5V518"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:D5V518"
FT                   /protein_id="ADG91980.1"
FT                   /translation="MILSIESSCDDSSIAITEIATNRLIYHKKISQELQHSVYGGVVPE
FT                   LAARLHVEALPKILEECKEYFPKLKAIAVTNAPGLSVTLMEGVTMAKALAISLNLPLIA
FT                   VNHLKGHIYSLFIEKDSILPLTVLLVSGGHTQIIEVNSLSAMKILASTMDDSFGESFDK
FT                   VAKMMDLGYPGGPVIQELSFNGDSQKFDFPVPLRQSPKIEFSYSGLKNAVRVEIEKQGI
FT                   LSDEMKADICASFQRTAVEHIMQKLKKLFKQHAPKNFAIVGGASANVCLRGEVEKLCGK
FT                   YATALMLSELKYCSDNAAMIGRVAVEQYKVSDFIKIDELDVQTRVKVF"
FT   gene            298483..298812
FT                   /locus_tag="Arnit_0315"
FT   CDS_pept        298483..298812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0315"
FT                   /product="translation initiation factor SUI1"
FT                   /note="COGs: COG0023 Translation initiation factor 1
FT                   (eIF-1/SUI1) and related protein; InterPro
FT                   IPR001950:IPR017228; KEGG: abu:Abu_0165 hypothetical
FT                   protein; PFAM: translation initiation factor SUI1; SPTR:
FT                   A8ER75 Putative uncharacterized protein; PFAM: Translation
FT                   initiation factor SUI1; TIGRFAM: translation initation
FT                   factor SUI1, putative, prokaryotic"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91981"
FT                   /db_xref="GOA:D5V519"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR005872"
FT                   /db_xref="InterPro:IPR036877"
FT                   /db_xref="UniProtKB/TrEMBL:D5V519"
FT                   /protein_id="ADG91981.1"
FT                   /translation="MIFEMGAKLDGDSFDTKKEDKNKKTSNNKIEPKNSHQLVFTYEKR
FT                   KGKPVTLVGRFNVSVDEKKEVLKLLKKKLACGGAIKEEWIELQGDVKEKIIEILSKDGW
FT                   KFKNK"
FT   gene            298824..300209
FT                   /locus_tag="Arnit_0316"
FT   CDS_pept        298824..300209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0316"
FT                   /product="carbohydrate kinase, YjeF related protein"
FT                   /note="COGs: COG0063 sugar kinase; InterPro
FT                   IPR000631:IPR004443:IPR017953; KEGG: abu:Abu_0166 putative
FT                   carbohydrate kinase; PFAM: YjeF-family domain protein;
FT                   protein of unknown function UPF0031; SPTR: A8ER76 Putative
FT                   uncharacterized protein; TIGRFAM: carbohydrate kinase, YjeF
FT                   related protein; PFAM: YjeF-related protein N-terminus;
FT                   Carbohydrate kinase; TIGRFAM: yjeF N-terminal region; yjeF
FT                   C-terminal region, hydroxyethylthiazole kinase-related"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91982"
FT                   /db_xref="GOA:D5V520"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:D5V520"
FT                   /protein_id="ADG91982.1"
FT                   /translation="MKKVFDEVGTLDKRCYEEFSLTEDILMEHAACSMAKFCEEKFEDE
FT                   STILIVCGPGNNGADGIALARLLYKKFDVKLYLPFGAKSQMAQLQEKRAKLLGLEELDF
FT                   VCSCDVVIDCLFGSGLNKDLDENSIELLKRVNYLDAYKIACDIPSGINSLGQINSVAFK
FT                   AHTTITMGAYKKSLFSDISKNYVGEIIVGNLGIQREVYEGSSNTFLLEKSDMKLPFRKD
FT                   KNSHKGTFGHVGIIMGEKCGAGRIACDAAFKFGAGLVTAVCHKELNLPYHIMQSHFIPE
FT                   NCTAVAIGMGLGKYEHAEIKDILALKIPKVIDADLFYEELLVENLNKELVLTPHPKEFC
FT                   SLLKLCNIANIKVEILQKDRFKYVELFTKKYPNVTLLLKGANTIIAKAQKRYINNHGTP
FT                   NLSKGGSGDVLSGLISSLLAQGYNSLDATITASLAHSFAASNFAKNSYALTPQDIIDEV
FT                   TKL"
FT   gene            300206..300517
FT                   /locus_tag="Arnit_0317"
FT   CDS_pept        300206..300517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0317"
FT                   /product="CutA1 divalent ion tolerance protein"
FT                   /note="COGs: COG1324 conserved hypothetical protein
FT                   involved in tolerance to divalent cations; InterPro
FT                   IPR011322:IPR004323; KEGG: abu:Abu_0167 periplasmic
FT                   protein; PFAM: CutA1 divalent ion tolerance protein; SPTR:
FT                   A8ER77 Conserved hypothetical periplasmic protein; PFAM:
FT                   CutA1 divalent ion tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91983"
FT                   /db_xref="GOA:D5V521"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:D5V521"
FT                   /protein_id="ADG91983.1"
FT                   /translation="MKMCIVQTTCKDIQEAKTIAKILLDKKLAACIQISSIESLYIWND
FT                   ELCEDKEKLLSIKTKKKNFKKIQREIKENHSYDLPEIISIDIENASKEYKNFIGENTK"
FT   gene            300514..301293
FT                   /locus_tag="Arnit_0318"
FT   CDS_pept        300514..301293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0318"
FT                   /product="thiazole biosynthesis family protein"
FT                   /note="COGs: COG2022 Uncharacterized protein of thiazole
FT                   biosynthesis; InterPro IPR008867:IPR013785; KEGG:
FT                   abu:Abu_0168 thiazole synthase; PFAM: thiazole biosynthesis
FT                   family protein; SPTR: A8ER78 Thiazole biosynthesis protein
FT                   thiG; PFAM: Thiazole biosynthesis protein ThiG"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91984"
FT                   /db_xref="GOA:D5V522"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:D5V522"
FT                   /protein_id="ADG91984.1"
FT                   /translation="MSDILKIGNYEFNSRLIVGSGKYKDFQTTKDATLASGSELITVAI
FT                   RRVNITNPNEENLLDYFKGTNVKLLPNSAGCFTAEEAITTFRLMREATGIDLIKLEVIG
FT                   DAQKTLYPDVIETIKACEILKKEGFTIMAYTNDDPIIAKRLEEAGADAIMPLAAPIGSG
FT                   LGIQNRYNIAFIKDAVKVPVIVDAGVGCASDAAIAMELGAEAVLTNTAIAGAKDPIAMA
FT                   EAMKYAVIAGRMGYKAGRIPKKPYATASSPIDGLIQF"
FT   gene            complement(301305..301610)
FT                   /locus_tag="Arnit_0319"
FT   CDS_pept        complement(301305..301610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0319"
FT                   /product="branched-chain amino acid transport"
FT                   /note="InterPro IPR008407; KEGG: dsa:Desal_2541
FT                   branched-chain amino acid transport; PFAM: branched-chain
FT                   amino acid transport; SPTR: C6BY67 Branched-chain amino
FT                   acid transport; PFAM: Branched-chain amino acid transport
FT                   protein (AzlD)"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91985"
FT                   /db_xref="GOA:D5V523"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:D5V523"
FT                   /protein_id="ADG91985.1"
FT                   /translation="MSDSNMLLIIFAVAIGTYFLRVSGLLLSTKLKKLKYVNSLLESIP
FT                   ATLLIALIIPPIIKEGMIGIIASLFVIIVMIKSKNIFLSMSIGVFIIYLSRSNLLF"
FT   gene            complement(301603..302286)
FT                   /locus_tag="Arnit_0320"
FT   CDS_pept        complement(301603..302286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0320"
FT                   /product="AzlC family protein"
FT                   /note="COGs: COG1296 branched-chain amino acid permease
FT                   (azaleucine resistance); InterPro IPR011606; KEGG:
FT                   dde:Dde_3176 branched-chain amino acid permease (azaleucine
FT                   resistance)-like; PFAM: AzlC family protein; SPTR: Q9AME3
FT                   Probable branched-chain amino acid transport protein AzlC;
FT                   PFAM: AzlC protein; TIGRFAM: 4-azaleucine resistance
FT                   probable transporter AzlC"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91986"
FT                   /db_xref="GOA:D5V524"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:D5V524"
FT                   /protein_id="ADG91986.1"
FT                   /translation="MKNNMKNGFLSNLPISLSVFSYGIVLGIICNTKSIDYLQLMLMNI
FT                   FIFAGSSQFVIVDMLSNNLSLSTIIGTAILINMRYFLIGTTLDKLFLNSSIKQKLLIMH
FT                   FVTDESWAITMKNIKEKNITVYFLLGGGLCIFLSWILGTSIGYFFAQLIIEPKNYGLDF
FT                   AFYAMFVAILTTMYKTKNDLFTFFITAFIAIIFEKLLDNSIYILISALLGSLFSLIMNK
FT                   KVEDE"
FT   gene            complement(302333..303160)
FT                   /locus_tag="Arnit_0321"
FT   CDS_pept        complement(302333..303160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0321"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="COGs: COG2207 AraC-type DNA-binding
FT                   domain-containing protein;
FT                   InterProIPR018060:IPR018062:IPR009057:IPR003313:IPR
FT                   000005:IPR012287; KEGG: pjd:Pjdr2_4187 transcriptional
FT                   regulator, AraC family; PFAM: AraC protein
FT                   arabinose-binding/dimerisation; helix-turn-helix- domain
FT                   containing protein AraC type; SMART: Helix-turn-helix, AraC
FT                   domain; SPTR: A6DBM1 Transcriptional regulator, AraC family
FT                   protein; PFAM: AraC-like ligand binding domain; Bacterial
FT                   regulatory helix-turn-helix proteins, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91987"
FT                   /db_xref="GOA:D5V525"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:D5V525"
FT                   /protein_id="ADG91987.1"
FT                   /translation="MNNISTLVHNVKYTKPNKEKEIFLYEGDYNNFSFEKHIHEEYTIT
FT                   LIERGNMGAFLRGFNHKFDKSSIITINPDEVHSCGILSKEGFKHHSLYISTQIMDEILK
FT                   ENFNNNLLSFKNFHFSNEIIYQKLYPLMNYNSSLFSKLSWECELIDTINSVLKINTKVS
FT                   NEIVLPNNYKLIQYAKEFINDNYNQNFTLDDFSKEFDISKYHFLRLFKKHTFVSPHTYL
FT                   MIRRVEKAKQFLRKNTNISEIAYLCGFTDQSHLNKKFKLLTGTTPGEYKNFFL"
FT   gene            303316..303393
FT                   /locus_tag="Arnit_R0008"
FT   tRNA            303316..303393
FT                   /locus_tag="Arnit_R0008"
FT                   /product="tRNA-Pro"
FT   gene            303404..303480
FT                   /locus_tag="Arnit_R0009"
FT   tRNA            303404..303480
FT                   /locus_tag="Arnit_R0009"
FT                   /product="tRNA-His"
FT   gene            303497..303573
FT                   /locus_tag="Arnit_R0010"
FT   tRNA            303497..303573
FT                   /locus_tag="Arnit_R0010"
FT                   /product="tRNA-Arg"
FT   gene            303635..303719
FT                   /locus_tag="Arnit_R0011"
FT   tRNA            303635..303719
FT                   /locus_tag="Arnit_R0011"
FT                   /product="tRNA-Leu"
FT   gene            303816..303892
FT                   /locus_tag="Arnit_R0012"
FT   tRNA            303816..303892
FT                   /locus_tag="Arnit_R0012"
FT                   /product="tRNA-Met"
FT   gene            303963..304103
FT                   /locus_tag="Arnit_0322"
FT   CDS_pept        303963..304103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0322"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: abu:Abu_1867 hypothetical protein; SPTR:
FT                   B6BII5 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91988"
FT                   /db_xref="UniProtKB/TrEMBL:D5V526"
FT                   /protein_id="ADG91988.1"
FT                   /translation="MSITNIKLTQKVEVFIRLIQNNENIKDACSKAGIKISTASKLNSS
FT                   K"
FT   gene            complement(304277..305131)
FT                   /locus_tag="Arnit_0323"
FT   CDS_pept        complement(304277..305131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0323"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="InterPro IPR000620; KEGG: swp:swp_4628 membrane
FT                   protein; PFAM: protein of unknown function DUF6
FT                   transmembrane; SPTR: C0GVI2 Putative uncharacterized
FT                   protein; PFAM: EamA-like transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91989"
FT                   /db_xref="GOA:D5V527"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D5V527"
FT                   /protein_id="ADG91989.1"
FT                   /translation="MHLRAILITIFGVLLMSIETLFMKITSIDALTFAFYIGIFMFLSL
FT                   NIILLTTLKKKTIFIYKVNIQPILICGALSGISIVFFINAIKTTTVANTVFILASAPLF
FT                   SAFYSYLLYKEKSKKNIYIVSFFIFVGLTVIFFSQLGSGDMRGNIYALVSANLFSLYFV
FT                   VLSKYNEANRFAIIAFGGLIIATISFFLASNLLIDMSTLMILLLAGLLVVPISRVLISL
FT                   GTKQLPASEVSLLMTLEAVAAPFFVWLILREVPSDGTFTGGFIIILSLFVNSLYLLKVS
FT                   KNT"
FT   gene            305418..306353
FT                   /locus_tag="Arnit_0324"
FT   CDS_pept        305418..306353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0324"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="COGs: COG0834 ABC-type amino acid transport/signal
FT                   transduction systems periplasmic component/domain; InterPro
FT                   IPR001638; KEGG: yen:YE0801 ABC transporter, solute-binding
FT                   component; PFAM: extracellular solute-binding protein
FT                   family 3; SMART: extracellular solute-binding protein
FT                   family 3; SPTR: C4SG74 ABC transporter, solute-binding
FT                   component; PFAM: Bacterial extracellular solute-binding
FT                   proteins, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91990"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:D5V528"
FT                   /protein_id="ADG91990.1"
FT                   /translation="MKKSNLMNLIVDKAGLIKPILNGESKTMKSILFPFQKTLLVASLV
FT                   CTTFVHTAQADLLEDIKAKGEIVIATEARYAPFEMLKDGKIVGYDEDILHEILKDLPGV
FT                   KLTQLDLPFQGILTGLSAKRYDFVVTALTLTKKRMDKYAFTYPISTASLVILKRKGDDR
FT                   IKSPKDMAGMILGIQRGSAQLKTIKAYEKAELSKKGYKKIKEFTDYNEAYTALASGRVD
FT                   VVPQALPNLASVVKERSDIFEIVRPSFGPDLYYGWVGRKDAESASLVQFFSDGIEKLHK
FT                   NGKLAELQMKWFGFKMDFPTGFVPMSQGEK"
FT   sig_peptide     305418..305582
FT                   /locus_tag="Arnit_0324"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            306356..307309
FT                   /locus_tag="Arnit_0325"
FT   CDS_pept        306356..307309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0325"
FT                   /product="agmatinase"
FT                   /EC_number="3.5.3.11"
FT                   /note="COGs: COG0010
FT                   Arginase/agmatinase/formimionoglutamate hydrolase arginase
FT                   family; InterPro IPR006035:IPR000408:IPR005925:IPR005924;
FT                   KEGG: bpy:Bphyt_6362 agmatinase; PFAM:
FT                   Arginase/agmatinase/formiminoglutamase; SPTR: A8TZY1
FT                   Agmatinase; TIGRFAM: agmatinase; PFAM: Arginase family;
FT                   TIGRFAM: agmatinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91991"
FT                   /db_xref="GOA:D5V529"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:D5V529"
FT                   /protein_id="ADG91991.1"
FT                   /translation="MSQDQQQLPRYSGIATFMRCAYEESLEGIDIGLIGVPFDGGVTNR
FT                   TGTRHGPRDIRVQSTLMRSVNQSTGIAPFELCKVADVGDALPESPFELERSHKSIQSFF
FT                   EKVVEAGVLPISAGGDHSISLPILRALAKDEPVALVHFDAHCDTGGDYLGSKFHHGSPF
FT                   RVAVEEGLIDPKKTIQIGIRGSLNHKEMWKFSHDSGMRVIYMDEFYDLGVDGIIKEIHK
FT                   IVGETPTYITFDVDGLDPAFAVGTGTPEVGGFTTFEAIEMIRGLTGLHIVGGDVVEVSP
FT                   PFDPSGSTALVGATMMFELLCIAAESLVARKDSLAC"
FT   gene            307303..307953
FT                   /locus_tag="Arnit_0326"
FT   CDS_pept        307303..307953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0326"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="COGs: COG0765 ABC-type amino acid transport system
FT                   permease component; InterPro IPR000515:IPR010065; KEGG:
FT                   yen:YE0802 ABC transporter, inner-membrane component; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: C4S0S8 Polar amino acid ABC transporter,
FT                   inner membrane subunit; TIGRFAM: polar amino acid ABC
FT                   transporter, inner membrane subunit; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component; TIGRFAM: amine acid ABC transporter, permease
FT                   protein, 3-TM region, His/Glu/Gln/Arg/opine family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91992"
FT                   /db_xref="GOA:D5V530"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D5V530"
FT                   /protein_id="ADG91992.1"
FT                   /translation="MLDFSVVFEHLNDLLNGLWMTTWISLLSILIGFIFSIILCLGRLS
FT                   SNTFINFICRFYISAIRGTPLLVQLTIVFYFLPYWGINIPSIAAAIITLSMNTAAFQAE
FT                   ILRGGFQTIPHGQKETAWSYGYTPFQCLYYIELPQVIRKVLPSLTNEIIDIIKNSALIS
FT                   TIAVIDLMRVTQVYSSTTYRPIEFFVSAGLLYLLLTSCISILGRYIESRLTTH"
FT   gene            307966..308625
FT                   /locus_tag="Arnit_0327"
FT   CDS_pept        307966..308625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0327"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="COGs: COG0765 ABC-type amino acid transport system
FT                   permease component; InterPro IPR000515:IPR010065; KEGG:
FT                   rlt:Rleg2_4635 polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; SPTR: B5ZZV3 Polar amino
FT                   acid ABC transporter, inner membrane subunit; TIGRFAM:
FT                   polar amino acid ABC transporter, inner membrane subunit;
FT                   PFAM: Binding-protein-dependent transport system inner
FT                   membrane component; TIGRFAM: amine acid ABC transporter,
FT                   permease protein, 3-TM region, His/Glu/Gln/Arg/opine
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91993"
FT                   /db_xref="GOA:D5V531"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D5V531"
FT                   /protein_id="ADG91993.1"
FT                   /translation="MDLSLYITYWPLLFKGLLFTIYICSIGIFLAILGGLILYRINRIN
FT                   LLITRLIYSIYLTVFRGTPLLVQVYLVYYGGPFIGLELTAEQVGILGLSLYGAAYFAEI
FT                   FRSGFESIPKGHIEAAYDLGYSRQQILRYIQLPEMLGLILPPSINLTIILIKESAILSI
FT                   ITVSELTTAAVTMGTETFSMVEPYVFLALSYWCITFIVAKIGSWCENRSIIHLQRS"
FT   gene            308647..309444
FT                   /locus_tag="Arnit_0328"
FT   CDS_pept        308647..309444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0328"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1126 ABC-type polar amino acid transport
FT                   system ATPase component; InterPro
FT                   IPR003439:IPR017871:IPR003593; KEGG: bph:Bphy_5107 ABC
FT                   transporter related; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase; SPTR: B2JLW6 ABC transporter related; PFAM: ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91994"
FT                   /db_xref="GOA:D5V532"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:D5V532"
FT                   /protein_id="ADG91994.1"
FT                   /translation="MKIVQHKAIKLINLKKHFGDNEVLKGINFDIDYGKVVCIIGGSGS
FT                   GKSTMLRCMNFLEQYDGGEVQINGKLLGYGSDSQGNLELLPSQFIQKDLAEVCMVFQQF
FT                   NLWPHMSVIDNVMSPLLRVHHLSKKEAEERAVKVLEKVDMLHKRDAYPAQLSGGQQQRV
FT                   AIARALGTEPKIMLFDEPTSALDPELVGEVLKVMKSLAQDGMTMVIVTHEMGFAAQVSD
FT                   KVVFLANGLIEEEGDPKILFSQPKSEKLKSFLSTWTERNSGII"
FT   gene            309671..310549
FT                   /locus_tag="Arnit_0329"
FT   CDS_pept        309671..310549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0329"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="COGs: COG0583 Transcriptional regulator; InterPro
FT                   IPR000847:IPR005119:IPR011991; KEGG: abu:Abu_1053 LysR
FT                   family transcriptional regulator; PFAM: LysR
FT                   substrate-binding; regulatory protein LysR; SPTR: C1ZY52
FT                   Transcriptional regulator, COG0583; PFAM: LysR substrate
FT                   binding domain; Bacterial regulatory helix-turn-helix
FT                   protein, lysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91995"
FT                   /db_xref="GOA:D5V533"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5V533"
FT                   /protein_id="ADG91995.1"
FT                   /translation="MTIREMDIFVNVAELSNLTKVSEKMNLTQPSISMTIKSIEEEFNE
FT                   KMFDRISKKLIVNERGRVLYEEITPILLQLKQFKERFIQNKFSGNINVAASNTIGVYAL
FT                   ADVLYDYKKLHKHVNITHLYPEPDNIISLIYEGKVDIGFIEFELLDKNIVKELLYKDEL
FT                   IVVSSDKSLIEKSFYIDQLFDKEWIVREISSAVTQTFFDYLGEVKSDLNITLALEHTVA
FT                   IKELLIKHKNTISILPAKSVENEIRSNKLYKIDIINMKFERNTYMIYHKNKFKNIIFES
FT                   FRKFALQNIVK"
FT   gene            complement(310585..312456)
FT                   /locus_tag="Arnit_0330"
FT   CDS_pept        complement(310585..312456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0330"
FT                   /product="signal transduction histidine kinase"
FT                   /note="COGs: COG3920 Signal transduction histidine kinase;
FT                   InterPro IPR005467:IPR003594:IPR011623:IPR011495; KEGG:
FT                   tcx:Tcr_1062 diguanylate cyclase; PFAM: histidine kinase
FT                   dimerisation/phosphoacceptor; Diverse 7TM receptor
FT                   transmembrane region; ATP-binding region ATPase domain
FT                   protein; SPTR: Q31GR6 Diguanylate cyclase (GGDEF domain);
FT                   PFAM: Histidine kinase; 7TM diverse intracellular
FT                   signalling; Histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like ATPase; 7TMR-DISM extracellular 2"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91996"
FT                   /db_xref="GOA:D5V534"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR011622"
FT                   /db_xref="InterPro:IPR011623"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5V534"
FT                   /protein_id="ADG91996.1"
FT                   /translation="MRIYYLIILLISFSSVFATEIDLSNKNLTYEGKKMSYFEDKDSSY
FT                   TINKIKELNNKSFTKQEKEVFLRFFTDSTYWFKFDVLNKTNNKLKRYFVFDTPWIDSIN
FT                   IYIYDNQNRLTTYKLGTLLPFKERSMKINLLNQAHNFSKGKSTVYLQIKTRDPFIVPFS
FT                   ILSEKNFYKKIMNMDLIEISTYSIVSAIFIFNILIFIIVRYKPYFYYSLYLLSYLVMSL
FT                   SYHGHTFKYIFYDYPNIQNWMQSIPILFYLIFSLLFAKSFLELKDNFPKINTYTNYILI
FT                   GHIIICILTSILGYKYSVFYASCITPLFSIYMLFLGVYSYLKGNKKAVFFTLATLFGCT
FT                   GAFLTASIAASMIDYNWYLYKGVDIGVSIDSILFSIALAYRYTSLNLILENTKKEVTLL
FT                   NKNLEKKVEERTKELDIQVKNKTVLLKELSHRIKNNLQIISALLYMDKDKLENEKDKDI
FT                   LDENIKRIKSISILYENFLETENPNKIELKKYIEKIISEIKNSYSSLGIQYELNIQKIL
FT                   LNKNSLIPIGLVMNELILNSVKYAFKQTPNPKISIYFSKDDKNINFMYKDNGIGANIDE
FT                   VESGFGFSLMKTLISFQLKGKLNCKNNNGLEYNITLPKDSFIDEKVL"
FT   sig_peptide     complement(312403..312456)
FT                   /locus_tag="Arnit_0330"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            312540..312701
FT                   /locus_tag="Arnit_0331"
FT   CDS_pept        312540..312701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0331"
FT                   /product="response regulator receiver modulated diguanylate
FT                   cyclase with PAS/PAC sensor"
FT                   /note="KEGG: cyp:PCC8801_0428 response regulator receiver
FT                   modulated diguanylate cyclase with PAS/PAC sensor; SPTR:
FT                   B6BL93 Two component transcriptional regulator, winged
FT                   helix family, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91997"
FT                   /db_xref="UniProtKB/TrEMBL:D5V535"
FT                   /protein_id="ADG91997.1"
FT                   /translation="MNIIILEDEAIMMMFLKTTFNSYLVFMDILLKGALDGTQIAKILI
FT                   KKHFLTPF"
FT   gene            312785..313411
FT                   /locus_tag="Arnit_0332"
FT   CDS_pept        312785..313411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0332"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="COGs: COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain; InterPro IPR001789:IPR011006:IPR001867; KEGG:
FT                   abu:Abu_0722 two-component response regulator; PFAM:
FT                   response regulator receiver; transcriptional regulator
FT                   domain protein; SMART: response regulator receiver; SPTR:
FT                   B6BL93 Two component transcriptional regulator, winged
FT                   helix family, putative; PFAM: Response regulator receiver
FT                   domain; Transcriptional regulatory protein, C terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91998"
FT                   /db_xref="GOA:D5V536"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D5V536"
FT                   /protein_id="ADG91998.1"
FT                   /translation="MNIIILEDEAIMMMFLKDSLEKKGHTVKATFNSYLGFFEFIEKEN
FT                   IDLVFMDILLKGALDGTQIAKRLREINKTIKIVFITSYKDSQILQMAKLSKPNGYLIKP
FT                   VSKEDLEAILMVCETNTEIEENNDYITIATYKYHIINKTVEENNELIKLTKNELKCFEL
FT                   LLQNKNTYISPEILINHLWNVEASIKFNSLRELVYRIRKNYQTYI"
FT   gene            complement(313541..313900)
FT                   /locus_tag="Arnit_0333"
FT   CDS_pept        complement(313541..313900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0333"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: abu:Abu_1720 hypothetical protein; SPTR:
FT                   A8EVJ4 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADG91999"
FT                   /db_xref="UniProtKB/TrEMBL:D5V537"
FT                   /protein_id="ADG91999.1"
FT                   /translation="MNKIVLKSNENKKFSLYCPFTNEKLDNDNNSFEIYEGAGNYLFSM
FT                   CEDCLFFDAGNNDEIERYWKDSAIEAIEKFVKNHSDENILIIEISDKNDTYYYGFLNEE
FT                   NLELSTEEIQKKFIK"
FT   gene            314155..315360
FT                   /locus_tag="Arnit_0334"
FT   CDS_pept        314155..315360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0334"
FT                   /product="glycine betaine/L-proline ABC transporter, ATPase
FT                   subunit"
FT                   /EC_number="7.6.2.9"
FT                   /note="COGs: COG4175 ABC-type proline/glycine betaine
FT                   transport system ATPase component;
FT                   InterProIPR003439:IPR017871:IPR005892:IPR003593:IPR 000644;
FT                   KEGG: pmr:PMI0412 glycine betaine/L-proline ABC
FT                   transporter, ATP-binding protein; PFAM: ABC transporter
FT                   related; CBS domain containing protein; SMART: AAA ATPase;
FT                   SPTR: B4EUZ3 Glycine betaine/L-proline ABC transporter,
FT                   ATP-binding protein; TIGRFAM: glycine betaine/L-proline ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter;
FT                   TIGRFAM: glycine betaine/L-proline transport ATP binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92000"
FT                   /db_xref="GOA:D5V538"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5V538"
FT                   /protein_id="ADG92000.1"
FT                   /translation="MSLEKKKKLTIKNVYKVFGEKPKKALEMLKNGLSKEEIFEKTNMT
FT                   IGVQNASFEINEGEIFVIMGLSGSGKSTLVRLLNRLIEPTSGQIIIDETDITNLNDKEL
FT                   IDIRRRKISMVFQSFALMPHMNIIDNASFGLELSGISKEDRYKKAQAALDQVGLSHHAL
FT                   SYPDELSGGMQQRVGLARALANDPDIMLMDEAFSALDPLIRTEMQDELLTLQSEHQRTI
FT                   VFISHDLDEAIRIGDRIAIMQNGEISQVGTPEEIINNPANDYVKSFFKGVDVTTVLTAS
FT                   HIAKKSYPTIIKKDGFGINSAIQYINDYDFDFAYYLTKDNKYLGVLTLEALKEQKKING
FT                   NLEDSLLKQEVVNENDSIADFINIIAESFFPIAVVADNRKYKGVISKRTLLKTIDEGAI
FT                   NG"
FT   gene            315353..316378
FT                   /locus_tag="Arnit_0335"
FT   CDS_pept        315353..316378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0335"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COGs: COG4176 ABC-type proline/glycine betaine
FT                   transport system permease component; InterPro IPR000515;
FT                   KEGG: pmr:PMI0411 glycine betaine transporter membrane
FT                   protein; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: B4EUZ2 Glycine
FT                   betaine/L-proline ABC transporter, permease protein; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92001"
FT                   /db_xref="GOA:D5V539"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D5V539"
FT                   /protein_id="ADG92001.1"
FT                   /translation="MASDPWGNASTAQADKASSVDWSHVAPNTTATPSFDIKNPFDHSI
FT                   IPFDSWVNGGINWIVENFRDFFISAKAPVDVILRFIETFLQSLSPYVVIGFFVLLALQV
FT                   SSKKMAFGTFVSLAFIGFIGAWDASMTTLALVITSVLFSVLIGLPLGIWSAKSDMVEKI
FT                   LRPILDGMQTTPAFVYLIPIVMLFGIGNVPGVIVTIIFALPPLIRLTNLGIRQVPADLI
FT                   EASRSFGASSSQMLFKVQLPVAMPTIMAGINQTLMLSLSMVVIASMIAVGGLGQMVLRG
FT                   IGRLDIGLAAVGGIGIVILAVILDRITQEMGKKDKKKKNKWYEQGPVGLVYNLIKKEKK
FT                   I"
FT   gene            316375..317343
FT                   /locus_tag="Arnit_0336"
FT   CDS_pept        316375..317343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0336"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="COGs: COG2113 ABC-type proline/glycine betaine
FT                   transport systems periplasmic components; InterPro
FT                   IPR007210; KEGG: vex:VEA_003611 L-proline glycine betaine
FT                   binding ABC transporter protein ProX/osmotic adaptation;
FT                   PFAM: Substrate-binding region of ABC-type glycine betaine
FT                   transport system; SPTR: Q1VDW6 ABC superfamily
FT                   (Glycine/betaine/proline transport protein); PFAM:
FT                   Substrate binding domain of ABC-type glycine betaine
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92002"
FT                   /db_xref="GOA:D5V540"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:D5V540"
FT                   /protein_id="ADG92002.1"
FT                   /translation="MKKILIALIAIFLTSNLFGAKVTFLRTSIAEEGFQMYIAADIVKR
FT                   LGYDVEITNDVSYEVAYQTIAQNAKSKDAYIMAAAWIPLHNSKIKGAGGSKKIDIIGSY
FT                   IKNCAQGYLIDKKTAEKYNIKYINDLKDPKIAKLFDSNGDGKADLAGCDAGWGCEKVIE
FT                   YQLDAFGLRDTVEHNQGQYSSIITDTIARYKSGKPILYYTWTPYWVSGKLVPGKDTVFL
FT                   QVTHSAHPVTKSTKLPNGADYGFNVNTQDFAVNASLPKNYKDIAKLLEVMRLDVNDVSG
FT                   ENMLMEQGQNKEADIKRHAQMWLKSNADKVNKWIAEAKEAK"
FT   sig_peptide     316375..316431
FT                   /locus_tag="Arnit_0336"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            317454..317530
FT                   /locus_tag="Arnit_R0013"
FT   tRNA            317454..317530
FT                   /locus_tag="Arnit_R0013"
FT                   /product="tRNA-Met"
FT   gene            317640..318416
FT                   /locus_tag="Arnit_0337"
FT   CDS_pept        317640..318416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0337"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="COGs: COG1414 Transcriptional regulator; InterPro
FT                   IPR005471:IPR014757:IPR000425; KEGG: bbr:BB0415
FT                   transcriptional regulator; PFAM: regulatory protein IclR;
FT                   Transcriptional regulator IclR; SMART: regulatory protein
FT                   IclR; SPTR: Q7WQB8 Probable transcriptional regulator;
FT                   PFAM: IclR helix-turn-helix domain; Bacterial
FT                   transcriptional regulator; TIGRFAM: beta-ketoadipate
FT                   pathway transcriptional regulators, PcaR/PcaU/PobR family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92003"
FT                   /db_xref="GOA:D5V541"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5V541"
FT                   /protein_id="ADG92003.1"
FT                   /translation="MENEINKDIATTFLKGLSVIEAFDHENPSMTLTDVAKKVNITRSS
FT                   ARRFLLSLESLGYATQNDKLFSLTPKIINLGYSYFASLSWTDLAYKYVKMVVKECKLSC
FT                   AVSILDGPHITCIMRVNSSKILKGGIHVGGKLPAPYTATGRLFMAEMNDKELREYLSKT
FT                   PLKKYTSKTIYDPNELFEKIKSERNQPYQVIEEELEDGLLAIAAPIYDSHHKILGCMTI
FT                   GTYMSEENAKYLKEYVLPMLIDAANNATEAIVLLKH"
FT   gene            318659..319630
FT                   /locus_tag="Arnit_0338"
FT   CDS_pept        318659..319630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0338"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG3181 conserved hypothetical protein;
FT                   InterPro IPR005064; KEGG: bpt:Bpet3357 putative secreted
FT                   protein; PFAM: conserved hypothetical protein; SPTR: A9HX25
FT                   Putative secreted protein; PFAM: Tripartite tricarboxylate
FT                   transporter family receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92004"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:D5V542"
FT                   /protein_id="ADG92004.1"
FT                   /translation="MKKFDYISKVIMSAVAFLTLTATVALAKYPDRPITMIVAYSAGGG
FT                   TDIAARTLAPYIEKYIGTSITVINKAGAGGQIGFTELAHSKPDGYTIGFINTPNLLTIP
FT                   IQRKTRYSLKDLTPIANVIYDPGAFSMLATSKIKTLKDLITYAKKNPGAVTYGTTGIGS
FT                   DDHLAALQFERENGIVMTHIPFKGNNKVRAALLGGHIMMASMNISQSIDDFKDGKITIF
FT                   GQMSEKKWPGAPQIPTFKEQGFNIIMGSDRGIGAPAGVDPKIISIISDAVAKAVADPEF
FT                   QEKAKKQSLPLTYMNAKEFKDHLEKLQKNLQQIWDVTPWAKK"
FT   sig_peptide     318659..318739
FT                   /locus_tag="Arnit_0338"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            319695..320168
FT                   /locus_tag="Arnit_0339"
FT   CDS_pept        319695..320168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0339"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fnu:FN2104 hypothetical protein; SPTR: A5TSC6
FT                   TTT family tricarboxylate transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92005"
FT                   /db_xref="GOA:D5V543"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:D5V543"
FT                   /protein_id="ADG92005.1"
FT                   /translation="MIKKIYLEIILSISLIIICLAGLIFEVSTYSGTSSIMPYGVLTIA
FT                   CVLSFFWLIQSILGLKKPQLLVENVFQDSIEGKRFFIFFCITLIYVIGITLIGFFTATI
FT                   IAIPIISISMEYRSLLGIATTTILFTAIIFIVFSLFLKVPLPLEIWNKLLGAS"
FT   gene            320168..321667
FT                   /locus_tag="Arnit_0340"
FT   CDS_pept        320168..321667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0340"
FT                   /product="protein of unknown function DUF112 transmembrane"
FT                   /note="COGs: COG3333 conserved hypothetical protein;
FT                   InterPro IPR002823; KEGG: mes:Meso_1067 hypothetical
FT                   protein; PFAM: protein of unknown function DUF112
FT                   transmembrane; SPTR: Q0FTV9 TRAP-T family transporter,
FT                   fused small and large inner membrane subunits; PFAM:
FT                   Tripartite tricarboxylate transporter TctA family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92006"
FT                   /db_xref="GOA:D5V544"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:D5V544"
FT                   /protein_id="ADG92006.1"
FT                   /translation="MDILNHIMAAIPLVFTVEVFIAMIVGTTIGIAVGALPGLSATMGI
FT                   AVLIPITFTMHPLTALGMIAGIYNGAMYGGSIPAILLRIPGTPAGVATVFDGYPMAQQG
FT                   RAPLALNISLASSAIGSGFSAIALLLLAPPLASIAINFGPADYFWLALFGLTTISVLMS
FT                   NNPVKGLLSACFGLVVGMVGIDFTTGDQRFVFDTTELLGGVNIIIILTGLYAIPPAIEL
FT                   AIKSSSADATGGLKMEQKKERFRWLSLTMVWLKSSAIGIVIGIIPALGGNVAALLAWNE
FT                   QRRSDKDKSKYMNGAPEGVAAAECANNADTAATLIPAITLGIPGNAVAAVILGALLVHG
FT                   LRPGPDLFTENGDIVYGFMLTMFITAILMFIIGRIGAKAYIHVLKVPSALLAPMILSLT
FT                   LIGVYAVHNSMFEVGLMLCFGLIGFIMEKLSIPTAPAVLAVILGPMAEESLRRAMLISR
FT                   DSVGYLFQSYISWIIITMIAITLITPIFKYFRNRSKKTIKE"
FT   gene            321671..322306
FT                   /locus_tag="Arnit_0341"
FT   CDS_pept        321671..322306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0341"
FT                   /product="Dimethylmenaquinone methyltransferase"
FT                   /note="COGs: COG0684 Demethylmenaquinone methyltransferase;
FT                   InterPro IPR005493; KEGG: bpt:Bpet4448 putative
FT                   dimethylmenaquinone methyltransferase family protein; PFAM:
FT                   Dimethylmenaquinone methyltransferase; SPTR: A9IDC7
FT                   Putative dimethylmenaquinone methyltransferase family
FT                   protein; PFAM: Demethylmenaquinone methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92007"
FT                   /db_xref="GOA:D5V545"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:D5V545"
FT                   /protein_id="ADG92007.1"
FT                   /translation="MNNDKLKKLENIATTLISDTRSRMTGIVGLKRIDSGFRTVGRAFT
FT                   IKTRPSDNLAIYEALTKVKPGDFLIVESGNNCTNALVGELITLQLEKLGGVGIIVDGAI
FT                   RDYDKLHASTTLACYARGISHKGPFKTGPGFLNVPISICGQIVNPGDIVVADDDGIVTF
FT                   PEEELDAVLLAVQERIEIEEKVMDEINMTPHSMTWIQDILNVAKSTSK"
FT   gene            322333..323616
FT                   /locus_tag="Arnit_0342"
FT   CDS_pept        322333..323616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0342"
FT                   /product="aminotransferase class V"
FT                   /note="COGs: COG0520 Selenocysteine lyase; InterPro
FT                   IPR015424:IPR000192:IPR015421; KEGG: vap:Vapar_3931
FT                   aminotransferase class V; PFAM: aminotransferase class V;
FT                   SPTR: C5CVP2 Aminotransferase class V; PFAM:
FT                   Aminotransferase class-V"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92008"
FT                   /db_xref="GOA:D5V546"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5V546"
FT                   /protein_id="ADG92008.1"
FT                   /translation="MNDNLKNGELFDNKLLKKIRKKFLHINIDPKSKEQRLFFDNSGGA
FT                   FRLKAASEAFKYIDEYPDCPEHGNKSARWLMKIQEKGYKSIKTMLNFDSGSILTSYTAS
FT                   TVMFNMIRAVIENVPGKNIVTTALEHPSSYDAVVSYAKKNNKEVRVAKTNSKTGGVDVQ
FT                   EIVKLIDKDTSLLVFMYASNISGALLDAQKIVKECRKIKPDLFIIADAVQHAPHGIIDI
FT                   KKVPVDGLNFAPYKFFGPRGFGVGYASKRLAKLSHDKLIAKPEDVWELGSPAPSHFAAL
FT                   TEVVNYVCWIGKHYLKSKNKRKLFEEGMSRIKLHERALMHFMLEGTSKIEGLRNLDGVK
FT                   VYLDCKDLRKKDFIMAIGFDKLGFKKAVKEYEKQGVITFERVISSPYSSRMLESFGLKG
FT                   SIRVSPLHSHSLKDIEKFLKITKKLSKT"
FT   gene            complement(323626..323895)
FT                   /locus_tag="Arnit_0343"
FT   CDS_pept        complement(323626..323895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0343"
FT                   /product="acylphosphatase"
FT                   /note="COGs: COG1254 Acylphosphatase; InterPro IPR001792;
FT                   KEGG: nam:NAMH_0944 acylphosphatase; PFAM: acylphosphatase;
FT                   SPTR: B6BNZ9 Acylphosphatase; PFAM: Acylphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92009"
FT                   /db_xref="GOA:D5V547"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR020456"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:D5V547"
FT                   /protein_id="ADG92009.1"
FT                   /translation="MKSYKFIISGKVQGVFYRKSVTNNANRANFSGYIKNLPNGDVEAV
FT                   VTCKENRLNEFITILKSGSEYSKISNIKQTSIGTLFSNKFEIRY"
FT   gene            complement(323958..324683)
FT                   /locus_tag="Arnit_0344"
FT   CDS_pept        complement(323958..324683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0344"
FT                   /product="carbon-phosphorus lyase complex accessory
FT                   protein"
FT                   /note="COGs: COG1235 Metal-dependent hydrolase of the
FT                   beta-lactamase superfamily I; KEGG: maq:Maqu_2297
FT                   carbon-phosphorus lyase complex accessory protein; SPTR:
FT                   C2A2U5 Metal-dependent hydrolase, beta-lactamase
FT                   superfamily I; PFAM: Metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92010"
FT                   /db_xref="GOA:D5V548"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR035682"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D5V548"
FT                   /protein_id="ADG92010.1"
FT                   /translation="MKLDFLGTADSGGIPVHNCKCLICQEYRENNKINLATSAYLTCKN
FT                   GEIILLDAGIENISTIFDNKKIKAIFLTHFHADHTLGLLRLRYSAQSIECYHPKDKKGF
FT                   ADLFKHTKAINYIENTPFTPIKINELIFTPIPLKHSKNTTGYLIESENKTIAYLTDCAG
FT                   ISKESMNFLLSKNIDECYIDAGLAPNFNNGNHLNYEEATKLLDRINAKKSHLIHASHNT
FT                   LTHIKSNNIKLKYNFMNIS"
FT   gene            complement(324703..325377)
FT                   /locus_tag="Arnit_0345"
FT   CDS_pept        complement(324703..325377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0345"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="COGs: COG3568 Metal-dependent hydrolase; InterPro
FT                   IPR005135; KEGG: hypothetical protein; PFAM:
FT                   Endonuclease/exonuclease/phosphatase; SPTR: B0AA47 Putative
FT                   uncharacterized protein; PFAM:
FT                   Endonuclease/Exonuclease/phosphatase family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92011"
FT                   /db_xref="GOA:D5V549"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:D5V549"
FT                   /protein_id="ADG92011.1"
FT                   /translation="MNHTFNIASYNLWKNCGDFPKRIEEIAPKLKNLDCLCLQEDYCDK
FT                   DFSSSDKINKMLGFNKITLHLRVKKRDGHKSSSNLTILSKYKVSQVEEIYFNKDKEDER
FT                   GALIIELEINNKKVIIVNTHLSNLSFQGRLNQIESIKYALEKYESDIVIICGDMNANAN
FT                   SKEIKKIKRCGYNYVNELATYEDDLMLDYIFYKSNFELKVQSKISIKDLSDHYCLENSF
FT                   IW"
FT   gene            complement(325361..325891)
FT                   /locus_tag="Arnit_0346"
FT   CDS_pept        complement(325361..325891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0346"
FT                   /product="guanylate kinase/L-type calcium channel region"
FT                   /note="COGs: COG3709 Uncharacterized component of
FT                   phosphonate metabolism; InterPro IPR008144:IPR008145; KEGG:
FT                   ara:Arad_0272 phosphonate metabolism
FT                   protein/1,5-bisphosphokinase (PRPP-forming) PhnN; SMART:
FT                   guanylate kinase/L-type calcium channel region; SPTR:
FT                   B9J6P7 Phosphonate metabolism protein/1,5-bisphosphokinase
FT                   (PRPP-forming) PhnN; PFAM: Guanylate kinase; TIGRFAM:
FT                   phosphonate metabolism protein/1,5-bisphosphokinase
FT                   (PRPP-forming) PhnN"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92012"
FT                   /db_xref="GOA:D5V550"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5V550"
FT                   /protein_id="ADG92012.1"
FT                   /translation="MKQIVLIVGASGVGKDTLLKNLQNKIQANFVTRYITRKPDENENN
FT                   YYIDEITFEKLKKDDFFISTWEAHNNKYAIAKNQIKNGLNIISISRGAIKEFEDNFKNV
FT                   TTIEITLPKEILYKRLKNRARENEEEIQKRLNRSYTKIEAKNIIQFDNSDSIEQSTKNF
FT                   ITLLERIKNESYL"
FT   gene            complement(325888..326526)
FT                   /locus_tag="Arnit_0347"
FT   CDS_pept        complement(325888..326526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0347"
FT                   /product="phosphonate metabolim protein, transferase
FT                   hexapeptide repeat family"
FT                   /note="COGs: COG0110 Acetyltransferase (isoleucine patch
FT                   superfamily); InterPro
FT                   IPR018357:IPR017694:IPR011004:IPR001451; KEGG:
FT                   dba:Dbac_0821 phosphonate metabolim protein, transferase
FT                   hexapeptide repeat family; SPTR: B9QUX9 Phosphonate
FT                   metabolim protein, transferase hexapeptide repeat family;
FT                   TIGRFAM: phosphonate metabolim protein, transferase
FT                   hexapeptide repeat family; TIGRFAM: phosphonate metabolim
FT                   protein, transferase hexapeptide repeat family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92013"
FT                   /db_xref="GOA:D5V551"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR017694"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:D5V551"
FT                   /protein_id="ADG92013.1"
FT                   /translation="MYKIESFNTKAKKILTKEPNIDPTSVIKTCSFGKYVEIGANNNIQ
FT                   DSVIDDYSYTSENCQIIHSTIKKFVNIASYVRLNPSQHPMSWASQHHMQYRKEMYGFGK
FT                   DDDSFFDWRRERKVEIGNDVWLGHNVVIMGSVTIGNGAVIGSSSVVTKNIPPFAIAVGN
FT                   PARIIKFRFDQETIEALQSIAWWDWKHEKIKSSIEDFKSIELFIEKYKK"
FT   gene            complement(326526..327671)
FT                   /locus_tag="Arnit_0348"
FT   CDS_pept        complement(326526..327671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0348"
FT                   /product="amidohydrolase"
FT                   /note="COGs: COG3454 Metal-dependent hydrolase involved in
FT                   phosphonate metabolism; InterPro IPR011059:IPR006680; KEGG:
FT                   tcx:Tcr_2088 amidohydrolase-like; PFAM: amidohydrolase;
FT                   SPTR: Q31DU6 Phosphonate metabolism protein; PFAM:
FT                   Amidohydrolase family; TIGRFAM: phosphonate metabolism
FT                   protein PhnM"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92014"
FT                   /db_xref="GOA:D5V552"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR012696"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D5V552"
FT                   /protein_id="ADG92014.1"
FT                   /translation="MQTIIRSTNVLIDGKFQGADIVIQGEKITAVCPYKSDDVAIDLGD
FT                   RRVVPGFVDLHGDAIEKELEPRPGAKFPTKMAVIELDKKLSMAGVTSMYHAIGFNDEEL
FT                   SKGRGTEQSRELIEEIYQANKAHLGVDNLVHVRFEITSESSLETIKKLISEKKVDMLSI
FT                   MDHSPGQGQFKTMEAWKKYHLSAYTIDDEDVEEYLEKKLSKDKVGIVEDLVKFGLKHNI
FT                   PVLSHDDDCEDKLNTLKALGVTFSEFPLSIEVAQKAKELGISTGMGAPNVVRGGSQSGN
FT                   IAAKELIKKGVCDYLCSDYHPASLLLSPYRLKEDVNLELEKGFAMISSTPAKLANLKNR
FT                   GEIQEGKLADIVVIDESHFPKVVLTFKNGEVVYNGIRGFKI"
FT   gene            complement(327655..328359)
FT                   /locus_tag="Arnit_0349"
FT   CDS_pept        complement(327655..328359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0349"
FT                   /product="phosphonate C-P lyase system protein PhnL"
FT                   /note="COGs: COG4778 ABC-type phosphonate transport system
FT                   ATPase component; InterPro
FT                   IPR003439:IPR017871:IPR012701:IPR003593; KEGG:
FT                   pin:Ping_3687 ABC phosphonate transporter ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   SPTR: A6GN51 ABC transporter related protein; TIGRFAM:
FT                   phosphonate C-P lyase system protein PhnL; PFAM: ABC
FT                   transporter; TIGRFAM: phosphonate C-P lyase system protein
FT                   PhnL"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92015"
FT                   /db_xref="GOA:D5V553"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012701"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5V553"
FT                   /protein_id="ADG92015.1"
FT                   /translation="MEKLKIRNLHKEFTVHTRGGLKINGYHDINFELNKGEFLSLYGPS
FT                   GLGKSSVLKALYRTYTTTSGEILFNYEDGSSLDIAKASESEILHLRKEHLGYVSQFLQV
FT                   LPRISAVDIVAQPLIEKGESENKAKDKAKEMLSFLNIKEELFDISPLTFSGGEQQRVNI
FT                   AKGIIAPKSVLLLDEPTASLDKTNTNKVIDKLLEIKKDGVTMIGIFHDMDCMKRISDKI
FT                   YDMKEKRYADNH"
FT   gene            complement(328369..329205)
FT                   /locus_tag="Arnit_0350"
FT   CDS_pept        complement(328369..329205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0350"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG4107 ABC-type phosphonate transport system
FT                   ATPase component;
FT                   InterProIPR003439:IPR017871:IPR012700:IPR003593:IPR 013563;
FT                   KEGG: cdl:CDR20291_3369 phosphonate ABC transporter,
FT                   ATP-binding protein; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; SPTR: Q181D3 Phosphonate ABC
FT                   transporter, ATP-binding protein; PFAM: ABC transporter;
FT                   Oligopeptide/dipeptide transporter, C-terminal region;
FT                   TIGRFAM: phosphonate C-P lyase system protein PhnK"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92016"
FT                   /db_xref="GOA:D5V554"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012700"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5V554"
FT                   /protein_id="ADG92016.1"
FT                   /translation="MVLQIKDLSKIFGVSCPKCLEDTGAKTNSSICPHCNAVVGVNNVN
FT                   LELKKGEVLGIVGESGSGKSTLLQLIYQDQKASMGEIFIEDFKDKNGKKRDINKASLND
FT                   MNYLRNTLMSMIYQNPRLGLNYRFSAGGNIAEKVIMGGNKKYDDIRNIAKYFLDKTEIP
FT                   VSRMDDYPDRFSGGQQQRIQISKALSSNPKLLLLDEPTTGLDLSVQAKILDLIKVLQKE
FT                   IGFSMVIVSHDLGVIKHLTDITVVMKNGQIVEKGLTDQILEDPQHPYTQLLVSSIL"
FT   gene            complement(329205..330032)
FT                   /locus_tag="Arnit_0351"
FT   CDS_pept        complement(329205..330032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0351"
FT                   /product="phosphonate metabolism PhnJ"
FT                   /note="COGs: COG3627 Uncharacterized protein of phosphonate
FT                   metabolism; InterPro IPR010306; KEGG: cdl:CDR20291_3370
FT                   putative phosphonate metabolism protein; PFAM: phosphonate
FT                   metabolism PhnJ; SPTR: Q181D5 Putative phosphonate
FT                   metabolism protein; PFAM: Phosphonate metabolism protein
FT                   PhnJ"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92017"
FT                   /db_xref="GOA:D5V555"
FT                   /db_xref="InterPro:IPR010306"
FT                   /db_xref="UniProtKB/TrEMBL:D5V555"
FT                   /protein_id="ADG92017.1"
FT                   /translation="MRYAFLDEDAKKEIRRATLKAVAIPGYIVSFASREMPIARGWGTG
FT                   GIQLTLSLIKEDDTLKVIDQGCDGSVNAVNIRNFVTSVTQNKTTTDTLKASLIQTRHRI
FT                   PEEPLSEGQILVFQVPMPDILETVEPDTYKARVMHANADYSKLWVLLYEDTSLFGDSRI
FT                   SNRYPVIVENRYAMDPSPIPKYDTTKLGNSKALQLFGAGREKKIYAIPPYSDVKPLKFE
FT                   DREFKVETFEDKHCKRCGNSGVFLDQVYDKEGKVNYYCSDTSYCDKILEKKGK"
FT   gene            complement(330029..331078)
FT                   /locus_tag="Arnit_0352"
FT   CDS_pept        complement(330029..331078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0352"
FT                   /product="phosphonate metabolism"
FT                   /note="COGs: COG3626 Uncharacterized protein of phosphonate
FT                   metabolism; InterPro IPR008773; KEGG: tcx:Tcr_2084
FT                   phosphonate metabolism; PFAM: phosphonate metabolism; SPTR:
FT                   Q31DV0 Phosphonate metabolism protein; PFAM: Bacterial
FT                   phosphonate metabolism protein (PhnI)"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92018"
FT                   /db_xref="GOA:D5V5I2"
FT                   /db_xref="InterPro:IPR008773"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5I2"
FT                   /protein_id="ADG92018.1"
FT                   /translation="MGYVAIKGGEEAIENSLNFYEETLQSSNKIKTEDVTTGLRFAVDK
FT                   VMSEGSLYSKKLASIAIKKSAGDLLNAAFFLRAHRSSCQRIGIAKTIDTNEMHIQRRIS
FT                   SAFKDIQGGQILGASNDYEVKLILNNIHQSKKWEHFNEEDNIIKSALEPLRAKNLVKKL
FT                   KADNEISDITRVFPEPPYPRSAVMQTMSRGEGGSMLGFAYTSIRGYGDVHPTIGDIRTG
FT                   TSTVKFIHPFTKKEVKVATLDVTACESAGTFEKQENGEVKLTTGFGFCFGFNETKAISM
FT                   SILDLTLYSAKFSVGEKEFASDIEMMIHHIDGVDSMGFTNHFKLPHYVTFQSDLQVFSN
FT                   ASDFAKDKK"
FT   gene            complement(331078..331614)
FT                   /locus_tag="Arnit_0353"
FT   CDS_pept        complement(331078..331614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0353"
FT                   /product="putative phosphonate metabolism protein"
FT                   /note="COGs: COG3625 Uncharacterized protein of phosphonate
FT                   metabolism; KEGG: cdf:CD3537 putative phosphonate
FT                   metabolism protein; SPTR: Q181D8 Putative phosphonate
FT                   metabolism protein; PFAM: Bacterial phosphonate metabolism
FT                   protein (PhnH); TIGRFAM: phosphonate C-P lyase system
FT                   protein PhnH"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92019"
FT                   /db_xref="GOA:D5V5I3"
FT                   /db_xref="InterPro:IPR008772"
FT                   /db_xref="InterPro:IPR038058"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5I3"
FT                   /protein_id="ADG92019.1"
FT                   /translation="MNTTDIEKNNRENFRYLLDTLSMPGTIKTVNKLFDSYTLAVASVL
FT                   LYSEVSYLNNTKEDFSVIDAITNSKVDTIENTDYLFCDNLDDALLLVKKGTFLNPDYSC
FT                   TIICLCDSFNGETITLKGPGIDKQKDETYPVNKGFIEEFNNNNIFYPLGNEIIFLNKNN
FT                   GQIKSLCRTTKLEIA"
FT   gene            complement(331618..332043)
FT                   /locus_tag="Arnit_0354"
FT   CDS_pept        complement(331618..332043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0354"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cdl:CDR20291_3373 putative phosphonate
FT                   metabolism protein; SPTR: Q181D7 Putative phosphonate
FT                   metabolism protein; PFAM: Phosphonate metabolism protein
FT                   PhnG; TIGRFAM: phosphonate C-P lyase system protein PhnG"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92020"
FT                   /db_xref="GOA:D5V5I4"
FT                   /db_xref="InterPro:IPR009609"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5I4"
FT                   /protein_id="ADG92020.1"
FT                   /translation="MEIQREDLNYILQEAQLEKLEKLYKKIDNEFGVTILSNPSSQTLL
FT                   VPVKDPISGGEFYAGEVLVTSTIVEVNKNKGWSMVQDENDQLSLYIATLDAVFENKEFK
FT                   DDIIKLCKKTKKQIQEKKNILNKKVNSTRVSFDLMEG"
FT   gene            complement(332045..332902)
FT                   /locus_tag="Arnit_0355"
FT   CDS_pept        complement(332045..332902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0355"
FT                   /product="phosphonate ABC transporter, inner membrane
FT                   subunit"
FT                   /note="COGs: COG3639 ABC-type phosphate/phosphonate
FT                   transport system permease component; InterPro
FT                   IPR000515:IPR005769; KEGG: dde:Dde_3326 phosphonate ABC
FT                   transporter inner membrane protein; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: Q30W26 Phosphonate uptake transporter;
FT                   TIGRFAM: phosphonate ABC transporter, inner membrane
FT                   subunit; PFAM: Binding-protein-dependent transport system
FT                   inner membrane component; TIGRFAM: phosphonate ABC
FT                   transporter, permease protein PhnE"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92021"
FT                   /db_xref="GOA:D5V5I5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005769"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5I5"
FT                   /protein_id="ADG92021.1"
FT                   /translation="MSVDRLKKESNPFKLFNMVLLFVFIFIVVQSWIDTEMSFKGLFDG
FT                   WGDMMSYIQGNPDIEGSSYFPPTTYKSDLLTYFWAMLETVQMAIIALVLSVIVAIPLSY
FT                   ITSRNILQILVPGKKIYHEIIRKALYAFGTFIANVCRSVNELVWALIFVSAVGLGPMAG
FT                   ILALGIHTAGVLSKLLSEGNEAIDPGPVEALASSGAGFVKILAYAVVPQTMPHFVSMVL
FT                   YRFESDVRSASILGFVGAGGIGYYLFDKLRSFENGSVCTILIFIIITVWLLDKLSAVIR
FT                   KRFI"
FT   gene            complement(333011..333880)
FT                   /locus_tag="Arnit_0356"
FT   CDS_pept        complement(333011..333880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0356"
FT                   /product="phosphonate ABC transporter, periplasmic
FT                   phosphonate binding protein"
FT                   /note="COGs: COG3221 ABC-type phosphate/phosphonate
FT                   transport system periplasmic component; InterPro
FT                   IPR006311:IPR005770:IPR017797; KEGG: dde:Dde_3325
FT                   phosphonate-binding periplasmic protein; SPTR: Q30W27
FT                   Phosphonate-binding periplasmic protein; TIGRFAM:
FT                   phosphonate ABC transporter, periplasmic phosphonate
FT                   binding protein; phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein; PFAM: NMT1/THI5 like; TIGRFAM:
FT                   phosphate/phosphite/phosphonate ABC transporters,
FT                   periplasmic binding protein; phosphonate ABC transporter,
FT                   periplasmic phosphonate binding protein; Tat (twin-arginine
FT                   translocation) pathway signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92022"
FT                   /db_xref="GOA:D5V5I6"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="InterPro:IPR017797"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5I6"
FT                   /protein_id="ADG92022.1"
FT                   /translation="MRRDFLKKLGLATLALTLSASTLSANPQNWPKEINFGVIPVAGAT
FT                   SMKDTFGGLTKYLESKLGIKVNLQTAGDYAGVITAMQHNHVQLAYFGPKSYVEAHKRAK
FT                   AEAIVIDVDAESGLPGYYGMIITKKGSGLKTLEDIKGKTWAFTDTNSTSGTLVPSVMFS
FT                   KKGINPQKYFSKVLYSGGHEASILSVKAGKVDAASTNNLDFNRGVGRNWKRDDFNVIWE
FT                   SSLIPGAPMAVRSDLPESLKMAIKGAFISYNDVEGLKKLKLKGYAATDDSQYDSVRDLI
FT                   ELKKSLKK"
FT   sig_peptide     complement(333806..333880)
FT                   /locus_tag="Arnit_0356"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(334043..334801)
FT                   /locus_tag="Arnit_0357"
FT   CDS_pept        complement(334043..334801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0357"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG3638 ABC-type phosphate/phosphonate
FT                   transport system ATPase component; InterPro
FT                   IPR003439:IPR012693:IPR017871:IPR003593; KEGG:
FT                   lba:Lebu_0264 phosphonate ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase; SPTR:
FT                   C7NDM2 Phosphonate ABC transporter, ATPase subunit; PFAM:
FT                   ABC transporter; TIGRFAM: phosphonate ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92023"
FT                   /db_xref="GOA:D5V5I7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012693"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5I7"
FT                   /protein_id="ADG92023.1"
FT                   /translation="MIKMKNLTLGYKKEKILDKLNLKIEKGEFIGIIGPSGAGKSTLLM
FT                   SIVGGIKVFNGHFEVLNHNMENIKKKDLVNLREQIGIIFQGYNLVDRLSVLDNIVSGML
FT                   KDIPMARAVIKYYKEKELKKVQKLLEIVDIQKHSSKRCDELSGGQRQRVAIARALASEP
FT                   KIILADEPISALDQKSAKKVMEILEKINKELKVTIIANLHHLDVAEKYCTRILGINGGE
FT                   VVFDGKPSQLNEKIIEKIYKGESEDMDSTD"
FT   gene            complement(334798..335520)
FT                   /locus_tag="Arnit_0358"
FT   CDS_pept        complement(334798..335520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0358"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="COGs: COG2188 Transcriptional regulators; InterPro
FT                   IPR000524:IPR011663:IPR011991; KEGG: cpf:CPF_2963 GntR
FT                   family transcriptional regulator; PFAM: UbiC transcription
FT                   regulator-associated domain protein; regulatory protein
FT                   GntR HTH; SMART: regulatory protein GntR HTH; SPTR: B1RSY9
FT                   Transcriptional regulator, GntR family; PFAM: Bacterial
FT                   regulatory proteins, gntR family; UTRA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92024"
FT                   /db_xref="GOA:D5V5I8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5I8"
FT                   /protein_id="ADG92024.1"
FT                   /translation="MKKTFDYELVYNYIFKLINTKLNDHDKIPSENTLCEKFSLSRLTV
FT                   RQGINKLKNEGYLYSKRGSGNFVNPKKIIYTISSHTTFTNEILKLKKTPSIKLLEMKII
FT                   KADEEISKILDIREAEDIVYMKNMRFVDDTPFLYAEYYMNKSLLSGIEKILPTATSISK
FT                   IYKDIYNLKPKRDKSEIDITSTNYISKQIFNIQNDLPIIKISTKTIDKNSNKTIDYCYS
FT                   YFRSDMAKIIVDYKENIA"
FT   gene            335662..339924
FT                   /locus_tag="Arnit_0359"
FT   CDS_pept        335662..339924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0359"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="COGs: COG0642 Signal transduction histidine kinase;
FT                   InterProIPR005467:IPR001789:IPR000014:IPR000700:IPR
FT                   004358:IPR003594:IPR011006:IPR009082:IPR008207:IPR001610:I
FT                   PR003661:IPR013767:IPR013656; KEGG: shl:Shal_0720
FT                   multi-sensor hybrid histidine kinase; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; response regulator receiver; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; PAS domain containing protein; PAC
FT                   repeat-containing protein; response regulator receiver;
FT                   SPTR: B0TSX0 Sensor protein; TIGRFAM: PAS sensor protein;
FT                   PFAM: Response regulator receiver domain; Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase; His Kinase A
FT                   (phosphoacceptor) domain; PAS fold; TIGRFAM: PAS domain
FT                   S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92025"
FT                   /db_xref="GOA:D5V5I9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5I9"
FT                   /protein_id="ADG92025.1"
FT                   /translation="MKKISYKSKEIIFIFLIFSFILIFVNIIVEKFFFVDNIQKIAMET
FT                   ALGKAREREHTLNEFLNESKHLIKFLRRIKAFNNYLENENSKSEVEEIFLTYIQSHKRF
FT                   MQVRYIDKNGLEKIRVQRDNENGVSYKVSNDKLQNKANRDYFIISKTKPLEKVWFSKID
FT                   LNIENNSVEKPFNPTLRVVLPIKYKNKFDGILIINYFLKEFLNDFVHTSLYDMTIIDDK
FT                   GFPLLHHKKDKSWSFYTSEKYNISQEYPKDYKKILSSESLVSNTYVSKRINTAISDNLI
FT                   LILKLKEKYIEEQRENLAFKYAIIATVIPLFIFTLTLFLIKLFGDRLFNTKKLSQLNDN
FT                   LQLISKIAKVGLWEVDWKTRSINFSDELYDIFEIEDKNSVITMEKLFTYFPKNLKNEYE
FT                   QEIQSSIDEKREYFITQAIITEKGNIKYLQRRGKHYFDDNGILIKSVGTSYDITEQYLS
FT                   EKKYKDLLDYASDAIHILDKEGNLIEFSQSFAQSLGYTNEEMWELNIVDWDIFILEVEV
FT                   KNRIKELIDFPSSFEAKHKRKDGSIIDVQINAKGIEINGEEYLYASQRDITKQKKLEKE
FT                   ILSEKDFISTIIDNANAIIAVIDSMGRMIKINKYAQDFVGYAEEEIASEPYFWSRFLPK
FT                   DKKQKVLEIVKKANKGEIVKNFKNSWISKDGEEKVFEWSNMLVQKDDGSMNYIATIGID
FT                   VTENHELLEELKGAKKNAEKANVVKSEFLANMSHEIRTPISGVTGLISLILDMPLEPLQ
FT                   RDYLNKAKKSSNALLSIINDILDYSKIEAGKLDIIEQDFSLEEIFKNISNLFGYETYKK
FT                   QLEFTFVLDGNIPSLIIGDSLRLTQILNNLVGNAIKFTENGYVALKSEIKEINEDVVVL
FT                   RFCIEDTGIGISKEGQKKLFNTFEQLDTSNKRKYSGSGLGLSITKQLIELMHGKIWLES
FT                   EEGKGSKFYFEIKFKYIKKFYKKKKNKTINNDKFLIIDDNKIESEYIKNILNSWKLDSI
FT                   IESSEVNALEIINNEKIDCLIINWNTSTTSRLIFLEKLKNIDKEIEYIVLVTPYNKKLI
FT                   LDLFEKQEFKVTKLLEKPFTPSILHNTIFDKNNKDIKNKEGSTQVVLLNKKRALLVEDN
FT                   ETNQIVSKAILEKLGFIIDIANDGEEAIKSAKDFSYDIIFMDLQMPNIDGFEATQRIRE
FT                   FDKKIPIIALSAAVMQKDKMLTKEVGMNAHIPKPIIKEELEGVISEFFEVTYKDTCKIK
FT                   INNKLHNIYGINFRKLMEILSFDDKEALSLIKKYYKNYSNIESELEVFSLKSDDFNSFI
FT                   HRLKGVSGNIQAMKVYDICFEIEKISDAKKVSELISNLKNEMKKIFESIEVNILKKKNE
FT                   EKSNHSNTQIDKMIEELIKDVNEDNFIKNSIVEELINSLRDKIEENLLEKVDNSFSNYE
FT                   YENLIEDLKSIQNILKKG"
FT   gene            339927..340607
FT                   /locus_tag="Arnit_0360"
FT   CDS_pept        339927..340607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0360"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="COGs: COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain; InterPro IPR001789:IPR011006:IPR001867:IPR011991;
FT                   KEGG: abu:Abu_1118 two-component response regulator; PFAM:
FT                   response regulator receiver; transcriptional regulator
FT                   domain protein; SMART: response regulator receiver; SPTR:
FT                   B6BKU8 Two component transcriptional regulator, winged
FT                   helix family; PFAM: Response regulator receiver domain;
FT                   Transcriptional regulatory protein, C terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92026"
FT                   /db_xref="GOA:D5V5J0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5J0"
FT                   /protein_id="ADG92026.1"
FT                   /translation="MGKLTILVVDDESINIQIISEILTDIYNIKIAKNGKSGYEAYEKY
FT                   SPSLIISDINMPLMNGIEMVSKIRQKDQNTKVIFTTSHSELDYLLQSSSLKLTKYILKP
FT                   IQREELLEAVNTAVEELQKYKIVSSHILQLNKEYIWDFKTLNLMKSEESIALTPTERKI
FT                   LNYLFSNVGSMLTYDDILYEAWEDYDMPSKQTLKTMMTNLRKKIPENIIHNIYGIGYKI
FT                   LTTS"
FT   gene            340682..341470
FT                   /locus_tag="Arnit_0361"
FT   CDS_pept        340682..341470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0361"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="COGs: COG3338 Carbonic anhydrase; InterPro
FT                   IPR001148:IPR018338; KEGG: tdn:Suden_1236 carbonate
FT                   dehydratase; PFAM: carbonic anhydrase; PRIAM: Carbonate
FT                   dehydratase; SPTR: B4W0E2 Eukaryotic-type carbonic
FT                   anhydrase, putative; PFAM: Eukaryotic-type carbonic
FT                   anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92027"
FT                   /db_xref="GOA:D5V5J1"
FT                   /db_xref="InterPro:IPR001148"
FT                   /db_xref="InterPro:IPR018338"
FT                   /db_xref="InterPro:IPR023561"
FT                   /db_xref="InterPro:IPR036398"
FT                   /db_xref="InterPro:IPR041891"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5J1"
FT                   /protein_id="ADG92027.1"
FT                   /translation="MKKYVISLLVSGILLAANASENGEAKTSNETHKKHDSHWSYEGNN
FT                   GPKFWGTINPSFQTCENGERQSPINITKEATVATNSLGNLFFDYKDTSISIINNGHTIQ
FT                   VNSDNQSSALFQGKKFKLLQFHFHSKSEHTVNGEYYPLELHLVHQAEDGELGVVGVFFK
FT                   LGDYNSSLQKVLKFMPKDAGGKNEIDKFSINPNDFLPKDRGYYHYLGSLTTPPCTQIVE
FT                   WYVMKNPITLSQKQLEQFQNLYNGNFRPTYPLNKRIVLEK"
FT   sig_peptide     340682..340738
FT                   /locus_tag="Arnit_0361"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            341480..343393
FT                   /locus_tag="Arnit_0362"
FT   CDS_pept        341480..343393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0362"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="COGs: COG0840 Methyl-accepting chemotaxis protein;
FT                   InterPro IPR004089; KEGG: abu:Abu_0789 methyl-accepting
FT                   chemotaxis protein; PFAM: chemotaxis sensory transducer;
FT                   SMART: chemotaxis sensory transducer; SPTR: A8ESY0
FT                   Methyl-accepting chemotaxis protein; PFAM: Methyl-accepting
FT                   chemotaxis protein (MCP) signaling domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92028"
FT                   /db_xref="GOA:D5V5J2"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5J2"
FT                   /protein_id="ADG92028.1"
FT                   /translation="MINNMKIKIKIFLLLAITLTSLLIVSVSSYVGISSVGHEIEELAE
FT                   SHIPLNRVITNIEAGILKEEVLTYELIIASEDVFSEKFQEVKGKIEKIEKTSQKNIKEC
FT                   EEIASKAINKSNEDDVKKSYEEFLKECKELEKKQKMFELGISKLVHDLESGNIQDVEKE
FT                   KEELHKLLLGLDKFVLNLTKQIQGLVKKATTKAEEDESTITMIIEIISILAFIVSITFG
FT                   IYLANNIKNLINTFQTGLLGFFTYLNRESDEVKAIEINSNDEIGLMSKVVNENIIKTKD
FT                   LLEEDRELIEEVKKIVTKVNSGIFKQEITKNTSNESLNELKSLLNEMLKILTANVSEDL
FT                   NKIQVALDHYQNLDFRHRIEGCNGKTSVGLTKLAEIINTMLVENKKSGVSLNISAQALL
FT                   KNITTLNTSSNQAAASLEETAAALEEITSTIVSNTENVVKMSNYANELSNSANEGQSLA
FT                   TQTTTSMDEINEQVSAINEAISVIDQIAFQTNILSLNAAVEAATAGEAGKGFAVVAGEV
FT                   RNLASRSAEAAKEIKNLVENATQKASLGKEIATRMINGYSGLNENVDKTLAIIKDIELA
FT                   SKEQQTGIVQINDAVNQLDQQTQANASAASEAQEVANNTSTIANRIIEDANEKEFIGKE
FT                   DI"
FT   sig_peptide     341480..341572
FT                   /locus_tag="Arnit_0362"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            343524..344357
FT                   /locus_tag="Arnit_0363"
FT   CDS_pept        343524..344357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0363"
FT                   /product="UTP-glucose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.9"
FT                   /note="COGs: COG1210 UDP-glucose pyrophosphorylase;
FT                   InterPro IPR005771:IPR005835; KEGG: abu:Abu_0839
FT                   UTP--glucose-1-phosphate uridylyltransferase; PFAM:
FT                   Nucleotidyl transferase; PRIAM: UTP--glucose-1-phosphate
FT                   uridylyltransferase; SPTR: A8ET30 UTP--glucose-1-phosphate
FT                   uridylyltransferase; TIGRFAM: UTP-glucose-1-phosphate
FT                   uridylyltransferase; PFAM: Nucleotidyl transferase;
FT                   TIGRFAM: UTP-glucose-1-phosphate uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92029"
FT                   /db_xref="GOA:D5V5J3"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5J3"
FT                   /protein_id="ADG92029.1"
FT                   /translation="MKEKLIRKCLFPAAGYGTRFLPATKATPKEMLPILTKPLIQYGVE
FT                   EAIAAGMDTMAIVTGRGKRAIEDHFDISYELEHQIKGTSKEHYLTEIRSVIEKCTFSYT
FT                   RQIEMKGLGHAILTGGETLIGNEPFAVILADDLCDHEGNGVLAQMVELYEKYKCSIVAI
FT                   EEVPKDETYKYGVIEGKEIEEGIFMISNMVEKPDPKDAPSNLAIIGRYILTPDIYEIIK
FT                   NTKPGKNGELQITDSLMIQAKENMVIGYKFKGKRFDCGSIDGFVEATNHFYNKAK"
FT   gene            344359..345555
FT                   /locus_tag="Arnit_0364"
FT   CDS_pept        344359..345555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0364"
FT                   /product="phosphoglucose isomerase (PGI)"
FT                   /note="COGs: COG0166 Glucose-6-phosphate isomerase;
FT                   InterPro IPR001672; KEGG: tdn:Suden_1472
FT                   glucose-6-phosphate isomerase; PFAM: phosphoglucose
FT                   isomerase (PGI); SPTR: B6BKK2 Glucose-6-phosphate
FT                   isomerase; PFAM: Phosphoglucose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92030"
FT                   /db_xref="GOA:D5V5J4"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5J4"
FT                   /protein_id="ADG92030.1"
FT                   /translation="MKYNKNFYQIKSNKEIFEKIEKEKGYIGYYNLPYQDTSYIKEFAK
FT                   NVTQKDIVVVGIGGSSLGTFAIHKFLQHKENDKKLHFLESTDPLDLQRRISKINLNDAL
FT                   FIIISKSGTTVETVSILKYLHTLVNIDSSNTICITENDSKLKTFAKSRDIKTFEIPKDV
FT                   GGRFSVFSTVGLVPLAIMGLDIDELLSGCKEVSDSFFSQDEYYSLLMEKARFLVENKNR
FT                   FNINVVFSYSLLLEGFNKWYVQLWGESLGKININGTKQALTPIGLVGPIDQHSFLQLIV
FT                   EGKRDKTVTFIKIEDFQDEMTIPHLSLEGLEELDYLNDIKFKDLINKQADATIEAIEGL
FT                   DDIPCDVITIQSQDEFNIGKLMFSYELLTSIVGKFVQINTYDQPGVETGKIILKEKLK"
FT   gene            345557..348328
FT                   /locus_tag="Arnit_0365"
FT   CDS_pept        345557..348328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0365"
FT                   /product="type III restriction protein res subunit"
FT                   /note="COGs: COG1061 DNA or RNA helicase of superfamily II;
FT                   InterPro IPR014021:IPR001650:IPR014001:IPR006935; KEGG:
FT                   abu:Abu_0181 DNA/RNA helicase; PFAM: type III restriction
FT                   protein res subunit; helicase domain protein; SMART:
FT                   DEAD-like helicase; helicase domain protein; SPTR: A8ER84
FT                   DNA/RNA helicase (DEAD/DEAH BOX family); PFAM: Helicase
FT                   conserved C-terminal domain; Type III restriction enzyme,
FT                   res subunit; Domain of unknown function (DUF3427)"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92031"
FT                   /db_xref="GOA:D5V5J5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR021835"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5J5"
FT                   /protein_id="ADG92031.1"
FT                   /translation="MNSLITNGSNSNFYTHLTKLLRECKSYYFSVAFINFSGLQLLLDS
FT                   LEFCQKNAIKGKILTSTYLNFTQPKALKKLLEYENIDLKIYDTNHFQKGFHTKAYIFEF
FT                   EDDYKILLGSSNITASAFKSNVEWNIKTVSKKDDIFTNEILSEFDTLFKQSFEVNTSFI
FT                   NEYENFYNKNKIEEFSYKRSFTLNSMQEEALYNLQHLRDKRQTKALVLAATGTGKTYLA
FT                   AFDVKAYEPKRVLFIVHRENILIKAKNSFEKIISNKTMGLYTGNKKEIDKEYLFTTIQT
FT                   MSSNYENFLKEEFDYIIIDEAHHITSPSYEKVCDYFEPKFLLGLTATPNRSDEGNIYEV
FT                   FDENIACDIRLNNALEHNLISSFHYYGISDIESIDYENIDILNISQLSKALMVNKRVDY
FT                   IIEKMDFYSFDGKKRKALAFCASKEHANFMAEEFSKKGIMSIALTSGDSIEKREEYIKN
FT                   LEDDNNDLEVICSVDIFNEGIDIPSINSVLFLRPTNSSIVFVQQLGRGLRKHKNKEFVT
FT                   ILDFIGNHNRAYMVAFGLLGDKIIDKESLKIALSNDFANIAHAFISMDEISKKRVLEQI
FT                   EKENFYSMRYLKQKYYEFKSLLSNKIPMLEDYIAFSDHISPLDFISESKSYIEFLQKVE
FT                   DKDEFKILCQDENFLKAIRFCEFLLPIKRVYEFVILKYLLTYKSCSEKQIFDLLNKELD
FT                   FVCKDTIKHSFRYLNQEFFDKLQVQRYLKLVDLKENKLFITKEFEKILEKDTAKTFMEH
FT                   SLNYGIITYKQTFKEKNYGLPFLKLYEKYNMLNIALVCNLDKIHTSFRGSGFLKHKDDF
FT                   FLFITLQKDKMSKSSKYKNNFLSKKLITYVSKPNMSSDKSDGLRLSQNIKYKTRLHLFV
FT                   RKISHEDKKVQAFIYLGLCNSKSYEGNKPINITLELEREVRDELYEEFTKLP"
FT   gene            complement(348334..349449)
FT                   /locus_tag="Arnit_0366"
FT   CDS_pept        complement(348334..349449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0366"
FT                   /product="Cytochrome-c peroxidase"
FT                   /EC_number="1.11.1.5"
FT                   /note="COGs: COG1858 Cytochrome c peroxidase; InterPro
FT                   IPR009056:IPR011031:IPR004852; KEGG: abu:Abu_1742 diheme
FT                   cytochrome c peroxidase; PFAM: Di-haem cytochrome c
FT                   peroxidase; PRIAM: Cytochrome-c peroxidase; SPTR: A8EVL6
FT                   Diheme cytochrome c peroxidase; PFAM: Di-haem cytochrome c
FT                   peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92032"
FT                   /db_xref="GOA:D5V5J6"
FT                   /db_xref="InterPro:IPR004852"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR026259"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5J6"
FT                   /protein_id="ADG92032.1"
FT                   /translation="MTKSILLTSLLFVSMYGSNLTPQETLGKSLFFDKNLSKNKTMACA
FT                   TCHNPDMGFTDHRGNGVSNMASLGDNGKSVGGRNAPTASYANQTPSFHYDKKEKAYVGG
FT                   QFWDGRASTLEDQAGGPPLNPVEMEMPNEKTVMSRVLENPYYVSAFKDIYGKDIFKDPK
FT                   KAFAALTKSIASFERTSEFSPFDSKYDRYLKDEYDLTPLEDLGKALFFSNNNNSCSSCH
FT                   VLKGEDKAGETFTNHQYFNIGVPANPALNKKSGMKGADEGLLANPAVTDVNQKGKFKVP
FT                   TLRNVAVTGPYMHNGVFKDLRTVIEFYDKYNNPDRTINPETGKKWADPEVEKTIAKEEL
FT                   KAQKLTDRKVDALVAFLKLLTDKKYEYLIKK"
FT   sig_peptide     complement(349393..349449)
FT                   /locus_tag="Arnit_0366"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(349446..350351)
FT                   /locus_tag="Arnit_0367"
FT   CDS_pept        complement(349446..350351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0367"
FT                   /product="fatty acid hydroxylase"
FT                   /note="COGs: COG3000 Sterol desaturase; InterPro IPR006694;
FT                   KEGG: abu:Abu_1743 sterol desaturase-related protein; PFAM:
FT                   fatty acid hydroxylase; SPTR: A8EVL7 Sterol
FT                   desaturase-related protein; PFAM: Fatty acid hydroxylase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92033"
FT                   /db_xref="GOA:D5V5J7"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5J7"
FT                   /protein_id="ADG92033.1"
FT                   /translation="MNDLMVFEYLINPNKRIFWVYIISSILITFIYFIYTKKSNKLILS
FT                   SKLWLHPSAKLDYSYFFLGYFINVFLLIPFILSAKSVAFAVSRFLYLNFGMVQNTFFSY
FT                   KETLLLYTLALFVCSDFTRYVLHRLLHEVKFLWEFHKVHHSAKVLNPLTFYRVHPVENI
FT                   LFGLRYSLSVGFVTGIFVYFFGAMIDIYMIFGANIFIVVFSLLGSNLRHTHVPISYGKY
FT                   LEKIFISPKQHQIHHSNKHFDKNYGGYLAIWDYMFGSLKLSKDVKVLKFGLRKEQMKDY
FT                   STIRGILFFPFKNLLNRRQL"
FT   gene            complement(350353..351240)
FT                   /locus_tag="Arnit_0368"
FT   CDS_pept        complement(350353..351240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0368"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: abu:Abu_1744 hypothetical protein; SPTR:
FT                   A8EVL8 Putative uncharacterized protein; PFAM: Imelysin"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92034"
FT                   /db_xref="InterPro:IPR018976"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5J8"
FT                   /protein_id="ADG92034.1"
FT                   /translation="MKKIFLILIISFMSLFAKDTMLDSILKNVSIVNVDNTIKDAQILK
FT                   KDYSAKNFTKFIKSWKKVEAFYFAGDIDDNYIDTPRYIDVFHNLKENLDVQMQRVIDSN
FT                   DEPQIALFKNSFKTVNALEYVLFNDKTITKREKAIADVILDSIISNLKDIKEVYEGYLT
FT                   RTKKDDLWENSLVMNTLIASTYKLKEWRIKVPHKEQEYILSNNTNAAIVAILEANEEII
FT                   GEQKYYNFANMAKENGAKKETIEAQALLNKALKLAKNNSKDLYNAVNELHISYFLSLIE
FT                   QLSITAKILEADGD"
FT   sig_peptide     complement(351190..351240)
FT                   /locus_tag="Arnit_0368"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(351240..352526)
FT                   /locus_tag="Arnit_0369"
FT   CDS_pept        complement(351240..352526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0369"
FT                   /product="protein of unknown function DUF1111"
FT                   /note="COGs: COG3488 thiol oxidoreductase; InterPro
FT                   IPR009056:IPR010538; KEGG: abu:Abu_1745 hypothetical
FT                   protein; PFAM: protein of unknown function DUF1111; SPTR:
FT                   A8EVL9 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF1111)"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92035"
FT                   /db_xref="GOA:D5V5J9"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR010538"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5J9"
FT                   /protein_id="ADG92035.1"
FT                   /translation="MKLNFNLLSLLLLFTTTLYSSQQEMNNEDYDKYILGRSFFTIPWV
FT                   EAPSATTARDGLGPLFNANACVACHPNTARGVLYNKKNEASKSLIPKLSIKSDNSKLHK
FT                   DILKRDGSLPDPIYGAQISISSVHDVPYEARVNLDFEKIKLFFDGEEHYIYKPKYTLID
FT                   LHYGKLKKSTNISYRIAPTLYGMGLLSKIDKKSILANVDENDSNHDGISGRANFVYSKI
FT                   TKKEELGRFTYKASVAFVKEQIANAAFNDMGLTTSFLKGENCTKSQTACLNSPKARDEI
FT                   DITDKRLDAITYYLENLPTYTPTKGKNFEKGIEIFSKIGCTSCHVPSLKAKDGTSVYTF
FT                   SDLLLHDMGDGLSDGRSEFQASKNEFRTTPLWGYAVEKKAYRLLHDGRAKTFQEAILWH
FT                   GGEATKAKENYVALDKKEKKLLTEFLKGL"
FT   sig_peptide     complement(352461..352526)
FT                   /locus_tag="Arnit_0369"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(352510..353865)
FT                   /locus_tag="Arnit_0370"
FT   CDS_pept        complement(352510..353865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0370"
FT                   /product="Peptidase M75, Imelysin"
FT                   /note="COGs: COG3487 Uncharacterized iron-regulated
FT                   protein; InterPro IPR018976; KEGG: abu:Abu_1746
FT                   hypothetical protein; PFAM: Peptidase M75, Imelysin; SPTR:
FT                   A8EVM0 Putative uncharacterized protein; PFAM: Imelysin"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92036"
FT                   /db_xref="InterPro:IPR018976"
FT                   /db_xref="InterPro:IPR038352"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5K0"
FT                   /protein_id="ADG92036.1"
FT                   /translation="MNNTKKLLVSLSVVTAIALTGCATGTNAASTPNKEVVKSNTILEA
FT                   YANIALDSYTNALNDAKALEKAINKFAANPTEKTLQEAKDAWLTSRETYGQTESFRLSN
FT                   GPIDAEEGWIAKDYGSLEGQINAWPLDENMIDYTIDANGKKTSGNIIDTVGKFNPGGED
FT                   AKAVDVTKITPEAISELNEDGGEANVASGYHAVEFLLWGQDQDYSNFLKDSITHGPLTA
FT                   GQRPLSDFTSSVDAPRRLEYLKSASQKIVSDLEIVTSAWAKNLNGTKGLYRAAILDQLK
FT                   GDNASKNISRNDALKQIIAGMGVFMKSELANERIAVAVLTPSEEDEHSCFSDNTHRDIA
FT                   MNYQSFKNILTSTYDGKKYGPSLLDKVDGSAKAKIEKLMSSIEEKIALIDKTAKTKEHF
FT                   DYQIKPTSPMSKVIVKLKNEMRKLGDTMVDVASANGISLTKDDVTDADETKL"
FT   sig_peptide     complement(353782..353865)
FT                   /locus_tag="Arnit_0370"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(353888..354052)
FT                   /locus_tag="Arnit_0371"
FT   CDS_pept        complement(353888..354052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0371"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: si:dkey-274c14.3; SPTR: Q5EG54 Vitellogenin"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92037"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5K1"
FT                   /protein_id="ADG92037.1"
FT                   /translation="MSDLLLKREIRKVVRESGFEKSSKMACSIVKVLNMKHKNIDSSKA
FT                   HLFAKQLLA"
FT   gene            354270..355457
FT                   /locus_tag="Arnit_0372"
FT   CDS_pept        354270..355457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0372"
FT                   /product="outer membrane efflux protein"
FT                   /note="COGs: COG1538 Outer membrane protein; InterPro
FT                   IPR003423; KEGG: abu:Abu_0706 hypothetical protein; PFAM:
FT                   outer membrane efflux protein; SPTR: A8ESP7 Conserved
FT                   hypothetical membrane protein; PFAM: Outer membrane efflux
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92038"
FT                   /db_xref="GOA:D5V5K2"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5K2"
FT                   /protein_id="ADG92038.1"
FT                   /translation="MYKLIIMLVFCSLLSANELSILKDSKKQLRQTEKQRIEEKYNSAN
FT                   KDWIAPITISSGIKRGHSFSSQSDNLTKSVSIGFTQSIYKSGGIEFTIKNAKDVLNSDL
FT                   INWEIENNAILETIYETLLQIKQLKIQIEQNKYSLKNKEIQLELKKIQYEAGNADITEL
FT                   NNAIIDKNSQFKQNIATENALKDKEYELSKYTNLKYDQIELLDFKGINKKDFINNNLNI
FT                   KYEKAQVESLDSSYKKLKSTYLPQVTLGTSYAYSKNNDMVNDYETSSKDGSISLNVSMP
FT                   IYDINKSSTLEESRLSLLKQKLNLNDIKEQIKYEYDQILNQIDTYEKQAKVIKDNLNLY
FT                   TELINANKSSNDAGMSADYDLEILQNTKKINEYDLSINQINIKLQYSKLYFKTRV"
FT   sig_peptide     354270..354317
FT                   /locus_tag="Arnit_0372"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            355463..356716
FT                   /locus_tag="Arnit_0373"
FT   CDS_pept        355463..356716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0373"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="COGs: COG0845 Membrane-fusion protein; InterPro
FT                   IPR006143; KEGG: abu:Abu_0707 HlyD family secretion
FT                   protein; PFAM: secretion protein HlyD family protein; SPTR:
FT                   A8ESP8 HlyD family secretion protein; TIGRFAM: efflux
FT                   transporter, RND family, MFP subunit; PFAM: HlyD family
FT                   secretion protein; TIGRFAM: RND family efflux transporter,
FT                   MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92039"
FT                   /db_xref="GOA:D5V5K3"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5K3"
FT                   /protein_id="ADG92039.1"
FT                   /translation="MDENLQKELDKYKNKKSKKRTIFILLLSLFIIGGVCYYYFIANKN
FT                   QQKEVHYNTSKIKKGDLEVLVSATGNLKPTNSVDIGIEVSGTIKNIYVDFNDEVKVGQV
FT                   LAKLDTTKLQAQVDSSKASLTIAKANLKENEVNVKSKKLTYTRTLKMYKQSNGKYPSKN
FT                   VLDEAKFNYESALSAYDSMKARVTQAEFNLKTDEQNLDKAVVKSSINGIVLNRAVEVGQ
FT                   TVAASMSTPVLFTLAKDLSKMDLVVSIDEADVANIKKGLKVTFTVDAYPKETFKGTIKQ
FT                   VRLNPIEVNGVVTYETVVLVDNEKLLLRPGMTASAEIITKESKNKLLVPNSALRFKPVI
FT                   TNKKSKVSLVGPKRPMKKREAKDVNKNEFGIVWVLKDNKPQKVRVKVLDTNGTLTSVES
FT                   NELKVGDEVIVSQSSDDE"
FT   gene            356709..357413
FT                   /locus_tag="Arnit_0374"
FT   CDS_pept        356709..357413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0374"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1136 ABC-type antimicrobial peptide
FT                   transport system ATPase component; InterPro
FT                   IPR003439:IPR017871:IPR003593; KEGG: abu:Abu_0708 ABC
FT                   transporter, ATP-binding protein; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase; SPTR: A8ESP9 ABC transporter,
FT                   ATP-binding protein; PFAM: ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92040"
FT                   /db_xref="GOA:D5V5K4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5K4"
FT                   /protein_id="ADG92040.1"
FT                   /translation="MNDNEVIIEFKNIVKTYGKGEAKTHALNGINFAIKKGEFISIMGS
FT                   SGSGKSTSMNIIGCLDSPSSGEYLFNNINVEKLNRNQLALIRKNYIGFVFQGFNLLGRT
FT                   SALENVELPLIYRKVPSKQRKELAMNALKKVGLESVSHHAPSQLSGGQQQRVAIARALV
FT                   SDPLILLADEPTGNLDSIKSVEILNLLKQLNEELNITIIMITHEEEMAAYSNRIIYFRD
FT                   GHIDDSLKRGFK"
FT   gene            357413..358624
FT                   /locus_tag="Arnit_0375"
FT   CDS_pept        357413..358624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0375"
FT                   /product="protein of unknown function DUF214"
FT                   /note="COGs: COG0577 ABC-type antimicrobial peptide
FT                   transport system permease component; InterPro
FT                   IPR000630:IPR003838; KEGG: abu:Abu_0709 ABC transporter,
FT                   permease protein; PFAM: protein of unknown function DUF214;
FT                   SPTR: A8ESQ0 ABC transporter, permease protein; PFAM:
FT                   Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92041"
FT                   /db_xref="GOA:D5V5K5"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5K5"
FT                   /protein_id="ADG92041.1"
FT                   /translation="MLLKAFLIAIKEIRRNILRSILTVLGIVIGVASVIGMVMLGDGTT
FT                   ASVKANIEKLGTNMLILRVGQERRGGPRTDNSAKPFKLTDVAAIKNQIDNLKAVAPDNS
FT                   TGVNLIYLNKSYTSSVVGTNNDYFVIKDWKLKDGRYFDDSELNSGKSSCILGTTIVKQL
FT                   FGDENPVGAKIRLKSFSCNVIGVLESKGASTFGQDQDEIVVVPIRMLQRKIQGNKDVKS
FT                   IVISVNSNKNIKRAKEDIKLLMQNRRAIKVGESDNFYIRDMEDLLSSMTSTTKMLTYLL
FT                   GSIAAISLLVGGIGIMNIMLVSVTERTKEIGIRLAIGAMESEVLLQFLVEAIVLSTLGG
FT                   IIGIILGISIGYLGVSSFDLPFIINEKIILIAFLFSTLIGVVFGYFPARKAARLNPIDA
FT                   LRYE"
FT   sig_peptide     357413..357532
FT                   /locus_tag="Arnit_0375"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            358835..358990
FT                   /pseudo
FT                   /locus_tag="Arnit_0376"
FT   gene            359004..360134
FT                   /locus_tag="Arnit_0377"
FT   CDS_pept        359004..360134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0377"
FT                   /product="PepSY-associated TM helix domain protein"
FT                   /note="COGs: COG3182 Uncharacterized iron-regulated
FT                   membrane protein; InterPro IPR005625; KEGG: abu:Abu_0730
FT                   sulfite reductase, flavoprotein component; PFAM:
FT                   PepSY-associated TM helix domain protein; SPTR: A8ESS1
FT                   Sulfite reductase, flavoprotein component; PFAM:
FT                   PepSY-associated TM helix"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92042"
FT                   /db_xref="GOA:D5V5K6"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5K6"
FT                   /protein_id="ADG92042.1"
FT                   /translation="MHKKFLFKVHMILGLTAGVILLIMGITGAMLSYQKEILKYINKDS
FT                   FIVEVPSTKRLSGKEILEKFEQKFPDAKINAFIFSSSANRSVVINVKANGEGKQARRGI
FT                   NYYINPYTSEVLPSTQGYTFFKLIERIHRGLIIGEVGKQISGICTFALLILMFSGIYVY
FT                   WKRIKNSFFKSFTFSFKNKKRAFLSNMHFAIGMWVIPFYLLLCITGVTMTYDWVKDGLY
FT                   KVSGVEKPIRQKRMPAANNKKGEVTVSISNGDVEKIVQLFNKNVKEYENATLQIGKKSD
FT                   VVKISYFAKNAIHDRARSEITLNTKTNKVIKDDKFEDKALNDRLMRSIIPLHTGEYFGL
FT                   LVQGILGISSLMMVLFTITGFMMYFKRKEKKSAKKI"
FT   sig_peptide     359004..359090
FT                   /locus_tag="Arnit_0377"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            360204..361535
FT                   /locus_tag="Arnit_0378"
FT   CDS_pept        360204..361535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0378"
FT                   /product="Deoxyribodipyrimidine photo-lyase"
FT                   /EC_number="4.1.99.3"
FT                   /note="COGs: COG0415 Deoxyribodipyrimidine photolyase;
FT                   InterProIPR018394:IPR002081:IPR005101:IPR006050:IPR 014729;
FT                   KEGG: abu:Abu_0834 deoxyribodipyrimidine photolyase; PFAM:
FT                   DNA photolyase FAD-binding; DNA photolyase domain protein;
FT                   PRIAM: Deoxyribodipyrimidine photo-lyase; SPTR: A8ET25
FT                   Deoxyribodipyrimidine photolyase; PFAM: FAD binding domain
FT                   of DNA photolyase; DNA photolyase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92043"
FT                   /db_xref="GOA:D5V5K7"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5K7"
FT                   /protein_id="ADG92043.1"
FT                   /translation="MRQILWFRRDLRIIDNKILEKASNEVLPIFIFDKNILEKLDFDDK
FT                   RVTFIYDAVLALKKSLQELGLDLYIFFDTPKNVFTKLKNEGFDEVLCSCDFDSYSIKRD
FT                   KQINEILPLKRYLDSFLINPNKNLKKDGTPYKVFTPFYKSLSWLTSSDKIGEAMINPNL
FT                   KLSKYENKTPTLDELGFERVTLPEFLKKSPQNRLDDFKEKVKEYEKNRDIFYKDGTSNL
FT                   GVDLRFGTLSPRMIFNEIKKSDKENSEAFIRQLFWREFYNYILFHFPNSENENWNGIEI
FT                   SWSEDEEDFQKWCEGKTGVPIIDAAMRHFNKTGMMHNRLRMIVSSFLCKNLLIDWKKGE
FT                   QYFAKKLLDYEASSNIGSWQWAASTGADSVPYFRIFNPYLQSAKFDKEAIFIKSVMPEL
FT                   KDVDAKLIHIEGALKDKYVNSIVDIKYSRDRAMRIFKEAKNAKV"
FT   gene            361522..362940
FT                   /locus_tag="Arnit_0379"
FT   CDS_pept        361522..362940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0379"
FT                   /product="carotenoid isomerase, putative"
FT                   /note="COGs: COG1233 Phytoene dehydrogenase and related
FT                   protein; KEGG: abu:Abu_0833 carotenoid isomerase, putative;
FT                   SPTR: A8ET24 Carotenoid isomerase, putative; PFAM: Flavin
FT                   containing amine oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92044"
FT                   /db_xref="GOA:D5V5K8"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5K8"
FT                   /protein_id="ADG92044.1"
FT                   /translation="MQKYDLAIIGSGIGGALIAALNKDKSHILFEKDSNLGGCASTFKR
FT                   FGNYYNTGATTFVGYEENHILKNMFDKIKYVPNISESKIAIRTIQNKKVVDRVRDFEEF
FT                   LTQIQENYPNENNRIFWEKIKDIDEKFWQIKDIHFAKYSLNSYIKSLSTFKDMIKVFKL
FT                   DLLKSASSFIKETLGEITQGYQSFIDAQLLITVQSKSKDISLLSMALGLAYPFHKVFYV
FT                   NNGMGSIIEEILKEVNVHKKEEILKIKKSKDSYVITSSKGEYQAKKIVLNTTVYDSKNL
FT                   FGEKIKKYYEKFEFSDQSAFTSYLTINSKEKFLDHYQIILEPDIPNCISNSFFISFSKL
FT                   SDEKMSQNGYSVTISTHTKVSTWKALSKDDYKKQKELTQNFILEHFLDYFDNISSEQIT
FT                   KIFSATCLTFQRFIGRANCGGKALNIKSALQIPSCKTPFEGLYNVGDTVFAGQGWPGVA
FT                   IGVNILNKELNEKL"
FT   gene            362927..363916
FT                   /locus_tag="Arnit_0380"
FT   CDS_pept        362927..363916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0380"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /note="COGs: COG3275 Putative regulator of cell autolysis;
FT                   InterPro IPR010559; KEGG: abu:Abu_0832 two-component sensor
FT                   histidine kinase; PFAM: histidine kinase internal region;
FT                   SPTR: A8ET23 Two-component sensor histidine kinase; PFAM:
FT                   Histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92045"
FT                   /db_xref="GOA:D5V5K9"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5K9"
FT                   /protein_id="ADG92045.1"
FT                   /translation="MKSFELQISYKDWLYIIIIGILFGFLISLVFYYTNEEIRYLSTIA
FT                   FSTSCAFFISFFSFLFISISNFYILPNVKKRYWYFISFIFSFLAGWCGFSLTYILFSDS
FT                   YPIVKLISQYWLDISTTIGLLTFLIGLILHQFISMKYKNEITHSEILQTKLQALEGELN
FT                   PHFLFNALNSISELIYQDQKKAEESVLKLSKFLRNAITKKGLIDLKSEIDMLNTYLHIE
FT                   NIRFDKKIVFNLNCDEKYYDMLLPKFSIQLLVENAIKHGFTGESLLIDVNVTDKKIEVI
FT                   NSGKVTSKVTFGVGLNNLQKRLQILKIGYLKSSIENNKMKFTIYRSNR"
FT   gene            363913..364623
FT                   /locus_tag="Arnit_0381"
FT   CDS_pept        363913..364623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0381"
FT                   /product="two component transcriptional regulator, LytTR
FT                   family"
FT                   /note="COGs: COG3279 Response regulator of the LytR/AlgR
FT                   family; InterPro IPR001789:IPR007492:IPR011006; KEGG:
FT                   abu:Abu_0831 two-component response regulator; PFAM:
FT                   response regulator receiver; LytTr DNA-binding region;
FT                   SMART: response regulator receiver; SPTR: A8ET22
FT                   Two-component response regulator; PFAM: Response regulator
FT                   receiver domain; LytTr DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92046"
FT                   /db_xref="GOA:D5V5L0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5L0"
FT                   /protein_id="ADG92046.1"
FT                   /translation="MKVMIVDDEKLALSRLTRLLNEEGIKDIVSFDSPSLALVEATKSK
FT                   FDVVFLDISMPQMNGLELANVILSMEPKTFIVFQTAYSEYAIEALKIGGIDYLMKPIES
FT                   DDIKRVLEKIKSFKQSNEASDEKLLGKRGNKIYLIKLDDIYFIKADLDEVLVRIKDADV
FT                   YVKRKIGDLEKLLDKKKFFRIHRSIIVNVDKIKSMESVEQSKLTISFENIDSVVTSSKD
FT                   GAKEFREYLERRSL"
FT   gene            364690..365223
FT                   /locus_tag="Arnit_0382"
FT   CDS_pept        364690..365223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0382"
FT                   /product="Peroxiredoxin"
FT                   /EC_number="1.11.1.9"
FT                   /EC_number="1.11.1.15"
FT                   /note="COGs: COG0386 Glutathione peroxidase; InterPro
FT                   IPR000889:IPR012336:IPR012335; KEGG: hch:HCH_02304
FT                   glutathione peroxidase; PFAM: glutathione peroxidase;
FT                   PRIAM: Peroxiredoxin; SPTR: C2A1D5 Glutathione peroxidase;
FT                   PFAM: Glutathione peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92047"
FT                   /db_xref="GOA:D5V5L1"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR029760"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5L1"
FT                   /protein_id="ADG92047.1"
FT                   /translation="MKKLLSILLFFIPILGISQTSIYDFKVKTIDNKEISLSKYKNRVM
FT                   LIVNVASKCGFTYQYEGLEKLHEKYSSKGLSILGFPCNQFLNQEPGTNEDIKEFCSLTY
FT                   QVKFDMFSKIDVNGDDASPLYKYLKSSQSGLFGTGIIKWNFTKFLVNRDGKVVKRYSPS
FT                   TNPSEIEDDIKELL"
FT   sig_peptide     364690..364749
FT                   /locus_tag="Arnit_0382"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            365220..365675
FT                   /locus_tag="Arnit_0383"
FT   CDS_pept        365220..365675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0383"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG4276 conserved hypothetical protein; KEGG:
FT                   chu:CHU_1334 hypothetical protein; SPTR: B5JNV4 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92048"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5L2"
FT                   /protein_id="ADG92048.1"
FT                   /translation="MKKYEKTSLISCTLDELFEFHLDSNNIKKITPKDTKVELLSKDFV
FT                   PSEGKVLKIKTTKFCIPTLWEVEISLIKKPSMLVDTAVQSPFEFWRHSHIFTKKGNVCE
FT                   LKDVIEYEMPFGFIGNIFSTFMEKQLDNMFSYRHKQTKLILEKKDEA"
FT   gene            365672..366604
FT                   /locus_tag="Arnit_0384"
FT   CDS_pept        365672..366604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0384"
FT                   /product="ferrochelatase"
FT                   /EC_number="4.99.1.1"
FT                   /note="COGs: COG0276 Protoheme ferro-lyase
FT                   (ferrochelatase); InterPro IPR001015; KEGG: tdn:Suden_0918
FT                   ferrochelatase; PFAM: ferrochelatase; PRIAM:
FT                   Ferrochelatase; SPTR: Q30S35 Ferrochelatase; TIGRFAM:
FT                   ferrochelatase; PFAM: Ferrochelatase; TIGRFAM:
FT                   ferrochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92049"
FT                   /db_xref="GOA:D5V5L3"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5L3"
FT                   /protein_id="ADG92049.1"
FT                   /translation="MKKAVVLMNMGGPNNLDEVKVFLTNMFNDKYIIGAPQPIRAMIGF
FT                   LITSMRNKEAKKNYALLGGMSPIVGHTKRLVRRLNERIEDKDVFYAMRYTPPFSKEVVK
FT                   ELKEYDEIIAFPMYPHYSSTTTKSSIEDFEKALKKAKINTPVKTINSYYDNEKYNKVIV
FT                   ERIKERLNGDNSEEFELVFSAHGLTQRVIDKGDLYQKHILANVECAKKELEKQGIKFKD
FT                   IHVAYQSRLGPMEWLRPYMDDKLRELGDKVLVYPISFTVDNSETEFELVMEYKEIADEV
FT                   GIKDYRVARAPNHHPLFMEALSELFEQAV"
FT   gene            complement(366606..368141)
FT                   /locus_tag="Arnit_0385"
FT   CDS_pept        complement(366606..368141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0385"
FT                   /product="ABC-1 domain protein"
FT                   /note="COGs: COG0661 unusual protein kinase; InterPro
FT                   IPR000719:IPR011009:IPR004147; KEGG: tdn:Suden_0932
FT                   hypothetical protein; PFAM: ABC-1 domain protein; SPTR:
FT                   Q30S21 ABC-1; PFAM: ABC1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92050"
FT                   /db_xref="GOA:D5V5L4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5L4"
FT                   /protein_id="ADG92050.1"
FT                   /translation="MNNYSPKRILSVFFFLLTIYLVIKRKESFLFLKPLKPKSLKNTIV
FT                   KLGASFIKLAQVLATRSDFFSKDYLDELKNLHDQIPPMNEKSYEKIYNKAFKDLTFKSF
FT                   DKKAIASASIGQVHVAYLNSGEKVAVKLRRDGIKKQILADIKIISFFNFLFKPLFSHYT
FT                   KNSIEAVIVEFSKMIKEEVSLNKELANLKKFSHVYENSGIKFPKPYEEYCSDDAIVMSY
FT                   EEGFRFDDKENIFKHKIDFKNIIAKLVDFYTTQMLINGYFHADPHPGNLLVNKKGELIL
FT                   LDFGMVKTVPNDKRIAIIELIKAANEQNYELYIAASKRLGTISYEAPTSELAEFTSNMF
FT                   DIFSNDNLSSESMQKLAFEILETTRNMPFKLPSDAIYILRVSAIVEGLGTTYIENFNGI
FT                   KDILPILQNNLPKALGAKDTITETIIDEVKDLPFFVKELKDVVKKASEGTLQIEVSNNQ
FT                   IEYLAKELKSYVKGITNSLILILSSFFILLYDKDLKSFALVLFLAGIIKLFYK"
FT   gene            complement(368138..368401)
FT                   /locus_tag="Arnit_0386"
FT   CDS_pept        complement(368138..368401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0386"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: abu:Abu_0829 hypothetical protein; SPTR:
FT                   A8ET20 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92051"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5L5"
FT                   /protein_id="ADG92051.1"
FT                   /translation="MLKELLNTGFGAAAVIREKVEEEIKALEKKGKLKKDDAKSFLESL
FT                   EQKGKDEEQKAKDEIKRILKEVIDELGLATKEDLEKLKEDLK"
FT   gene            complement(368482..369252)
FT                   /locus_tag="Arnit_0387"
FT   CDS_pept        complement(368482..369252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0387"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="COGs: COG0351
FT                   Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase;
FT                   InterPro IPR004399:IPR013749; KEGG: abu:Abu_1756
FT                   phosphomethylpyrimidine kinase; PFAM:
FT                   Phosphomethylpyrimidine kinase type-1; PRIAM:
FT                   Phosphomethylpyrimidine kinase; SPTR: A8EVM9
FT                   Phosphomethylpyrimidine kinase; TIGRFAM:
FT                   phosphomethylpyrimidine kinase; PFAM:
FT                   Phosphomethylpyrimidine kinase; TIGRFAM:
FT                   phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92052"
FT                   /db_xref="GOA:D5V5L6"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5L6"
FT                   /protein_id="ADG92052.1"
FT                   /translation="MKVVLTIAGSDCSAGAGIQADLKTFEAFGVFGCSVITVLTAQNTK
FT                   GVTNIQEVSPSFIKDQIDAVLDDFDVACIKIGMLFSNDIIDVVRDSIKDLNIPIVFDPV
FT                   FISKAGSKLLNEDAIENLKTLFPYSKVTTPNLYEAKELFGNDALKKIINIPCEILIKNH
FT                   TQQIDNKKVSIDTLFYKNGQKKIFQSDFIDTSNTHGTGCSFSSAIAANLALGKTLEESI
FT                   SISKEFIFHAIKNAPSLGSGKGPIAHKVAGEIIN"
FT   gene            369427..371997
FT                   /locus_tag="Arnit_0388"
FT   CDS_pept        369427..371997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0388"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="COGs: COG0840 Methyl-accepting chemotaxis protein;
FT                   InterPro IPR004089:IPR013163; KEGG: abu:Abu_1307
FT                   methyl-accepting chemotaxis protein; PFAM: chemotaxis
FT                   sensory transducer; Cache type 2 domain protein; SMART:
FT                   chemotaxis sensory transducer; SPTR: A8EUE0
FT                   Methyl-accepting chemotaxis protein; PFAM: Cache domain;
FT                   Methyl-accepting chemotaxis protein (MCP) signaling domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92053"
FT                   /db_xref="GOA:D5V5L7"
FT                   /db_xref="InterPro:IPR004010"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5L7"
FT                   /protein_id="ADG92053.1"
FT                   /translation="MLKSLSIKARLLLIVISSIVIVSAVMLAQSVISLQETSATVIEKF
FT                   KQNAYATKEEELKNYVSLVMKTVESYYARTAPEKIKVEVQARLKEQTEFMLSIMQGEYD
FT                   KYNGKVPEDELRNIIKTSVQKARYGSTGYFWINDLDAKIIMHPIKPALDGKDMSEYRDK
FT                   GGKRIFYEFAQVAKKSGSGFVDYVWPKPGFEKPQEKVSFVKLFEPFGWVIGTGEYVDNV
FT                   TDKLKKEALNAISQMKYGKAGYYWINDSNHVVVMHAMKPSLVGKDMSDLQDPKGKYIYR
FT                   EIVKTANEKEEGGLVKYMWPKPGKKLDQPKFSYVQRFAPWDWIIGTGAYVDDIEDKILQ
FT                   MHDETEAQIEAVIIRNCVIIFVIMVILAIVMGMLSNRSIFVPLNKFQDGLLGFFRYLNK
FT                   EQPDVDNLDDSANDEIGAMAKIINQNLGKTKSLIKQDDELIQDVTRVVGEIEKGYLFNR
FT                   VEKRTENESLQKLQNKLNEMLDNLETNIGKDTNVILDCLSKYGKLDFRDNIQNAQGKVE
FT                   VAINELSDIINNMLKENKQNGLTLDASSDILLKNVDTLNKNSTSTAASLEETAAALEEI
FT                   TSAIVSNTNNISTMAIYSDELVDSINLGKTLAESTVVAMDEINSQTEAIADAIVLIDQI
FT                   AFQTNILSLNAAVEAATAGEAGKGFAVVAQEVRNLASRSADAAKEIKALVENATQKTNA
FT                   GKEGTDKMIKGYETLHLNIKKTTETIQSIAESSKEQRAGIEQINDAVNRLDQQTQENVS
FT                   ISNTTHAIAVETDELAKLIVTVTNEKEFRGKNDLKAKISNYETPKVTIPAKKVEVKKTE
FT                   VKKVEKPSDTKKEVKREDSSKIESKPKVEIIKSQSSSDDEWESF"
FT   sig_peptide     369427..369507
FT                   /locus_tag="Arnit_0388"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(372027..372383)
FT                   /locus_tag="Arnit_0389"
FT   CDS_pept        complement(372027..372383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0389"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiX
FT                   protein"
FT                   /note="COGs: COG2138 conserved hypothetical protein;
FT                   InterPro IPR002762; KEGG: abu:Abu_1192 hypothetical
FT                   protein; PFAM: cobalamin (vitamin B12) biosynthesis CbiX
FT                   protein; SPTR: C0N2C2 Sirohydrochlorin cobaltochelatase;
FT                   PFAM: CbiX"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92054"
FT                   /db_xref="GOA:D5V5L8"
FT                   /db_xref="InterPro:IPR002762"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5L8"
FT                   /protein_id="ADG92054.1"
FT                   /translation="MKALILVAHGSKKYKSNQEFKDLVEEIRKLNSIKYEKIETAFLEF
FT                   AKPSIEEIVEQLNSKNITEISLYPYFLNSGKHVVNDIPNIIEELGSNYQNIKFKLFPHF
FT                   GSSKKISTIISEEI"
FT   gene            complement(372414..373514)
FT                   /locus_tag="Arnit_0390"
FT   CDS_pept        complement(372414..373514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0390"
FT                   /product="response regulator receiver protein"
FT                   /note="COGs: COG2204 Response regulator containing
FT                   CheY-like receiver AAA-type ATPase and DNA-binding domains;
FT                   InterPro IPR001789:IPR011006; KEGG: tdn:Suden_0968 response
FT                   regulator receiver domain-containing protein; PFAM:
FT                   response regulator receiver; SMART: response regulator
FT                   receiver; SPTR: B6BNX1 Response regulator receiver protein;
FT                   PFAM: Response regulator receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92055"
FT                   /db_xref="GOA:D5V5L9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5L9"
FT                   /protein_id="ADG92055.1"
FT                   /translation="MSNLKALKEVAKDLSALIVEDSIAIQNQMRVFLEKLFDKVFVAKN
FT                   GLEALEICKNYDPNIILTDIQMPKMDGHEFIENLNKTKHSSKIIVCSAYGYSENIEKFS
FT                   KEGITNFIQKPVNFDQLTNTLLKVIVGEKDEDNFEDELLKNLVIIKKNKAPITLINHYK
FT                   GLPFIHEGIITLVKEDSIKVQTLNVQVKVILKEKTSTIETNNSTIKVRLKEFDEQNNEL
FT                   IFDNLEKLEHSPKKREVIRVVPDENFTASVFKKDDRYSFEVSTISTKAISFEVKFFDEK
FT                   IKLNESVNLTLSFNTYYGTSYHDTQTHKERVDTKATILKIEKLENNLTKIVMLLDLSIA
FT                   NKKILEKYIYQREVAIVKEFKQISLE"
FT   gene            complement(373519..375741)
FT                   /locus_tag="Arnit_0391"
FT   CDS_pept        complement(373519..375741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0391"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="COGs: COG4191 Signal transduction histidine kinase
FT                   regulating C4-dicarboxylate transport system;
FT                   InterProIPR005467:IPR000014:IPR000700:IPR004358:IPR
FT                   003594:IPR009082:IPR001610:IPR003661:IPR013655; KEGG:
FT                   tdn:Suden_0966 multi-sensor signal transduction histidine
FT                   kinase; PFAM: PAS fold-3 domain protein; histidine kinase A
FT                   domain protein; ATP-binding region ATPase domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; PAC
FT                   repeat-containing protein; PAS domain containing protein;
FT                   histidine kinase A domain protein; SPTR: B6BLE0 Sensor
FT                   protein; TIGRFAM: PAS sensor protein; PFAM: Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase; His Kinase A
FT                   (phosphoacceptor) domain; Protein of unknown function
FT                   (DUF3365); PAS fold; TIGRFAM: PAS domain S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92056"
FT                   /db_xref="GOA:D5V5M0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR021796"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5M0"
FT                   /protein_id="ADG92056.1"
FT                   /translation="MNKTKAILLTIFFVILGNIITFYFIDKSASSQINISKKMVLNESR
FT                   AHFKDTIHIKDWNTQFDGVYVQSNTLKPNKYLVNNHIFTQNNKLLIKINHAWMTKQISE
FT                   ISNKQGDYYYKLTSLRPINPDNAPDKFEKVALKKFEKDKINEYYSFSKNLKRFTYVGAL
FT                   KVDANCMACHYQQNYKIGDYIGGVRITIPTSDYKNFYESLQNKVSITKIIIVLLSIFVL
FT                   LVLIWFINNIYTRQDLIQEMAKKQEELYQRYKLAVDGSNSGLWDWDLVKNKVYFSKEWK
FT                   EMLGYKADELLNDIKTWENLINPEDKENAVCDIQNNHNKVTKYYENTHRLRHKDGHWVW
FT                   ILDRGKTFFNKEDEPVRMLGFHTDITQQKELEMSLSNSQQTLLKAEKIANLAHWSLNIS
FT                   TMEITVSENTRRLFGLKEDATFGMKELFNTFVYEEDREEVSEKLTNSVKEKSSYAIEYR
FT                   FKKYNENDIRYIHCNVEHEIISGKIVNTIGTIQDITKEVYLKQELQDKEELMIAQSRHA
FT                   AMGEMISMIAHQWRQPIAVVAMGANNILADIELDSVNNDSLKENLDDIISQTEYLSQTI
FT                   DDFKNFFKPNKEKDLVTVKSVFNETFKVMGKMLENNNITILQEYKSQNEIYTYSKELLQ
FT                   VFINIIKNAKEALIEKRQKDRIIKINEFMDNNQIIIQISDNAGGIDEDILNKIFDPYFT
FT                   TKDELGTGLGLYMSKVIIEKHLNGQIQASNKDDGACFEIRFSAKDI"
FT   gene            complement(375862..375937)
FT                   /locus_tag="Arnit_R0014"
FT   tRNA            complement(375862..375937)
FT                   /locus_tag="Arnit_R0014"
FT                   /product="tRNA-Phe"
FT   gene            complement(375943..376027)
FT                   /locus_tag="Arnit_R0015"
FT   tRNA            complement(375943..376027)
FT                   /locus_tag="Arnit_R0015"
FT                   /product="tRNA-Tyr"
FT   gene            complement(376093..376725)
FT                   /locus_tag="Arnit_0392"
FT   CDS_pept        complement(376093..376725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0392"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sun:SUN_1324 hypothetical protein; SPTR:
FT                   B6BN48 Putative uncharacterized protein; PFAM:
FT                   Leucyl/phenylalanyl-tRNA protein transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92057"
FT                   /db_xref="GOA:D5V5M1"
FT                   /db_xref="InterPro:IPR004616"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR042203"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5M1"
FT                   /protein_id="ADG92057.1"
FT                   /translation="MEENYYACEQFSPSLYIKLAKAGFISTTATLANNRSYLLPEIQFE
FT                   YAILYFENLHISKKIKKLLKKDDYLFVKNRNLNEVIKQINEFHKDSWINEDYKDMLLDI
FT                   FSNKYDNFELLTFELYDKKDSTLIAGEIGYKIGKVYTSLTGFSNREKKYNNYGKLQLVL
FT                   LAKLLQKENYEFWNLGHACLQYKIDLGSNILKRDEFLSQWLKYTKKD"
FT   gene            complement(376850..377689)
FT                   /locus_tag="Arnit_0393"
FT   CDS_pept        complement(376850..377689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0393"
FT                   /product="flagellin domain protein"
FT                   /note="COGs: COG1344 Flagellin and related hook-associated
FT                   protein; InterPro IPR001492:IPR001029; KEGG: abu:Abu_2254
FT                   flagellin; PFAM: flagellin domain protein; SPTR: A8BSL7
FT                   Flagellin A; PFAM: Bacterial flagellin N-terminal helical
FT                   region; Bacterial flagellin C-terminal helical region"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92058"
FT                   /db_xref="GOA:D5V5M2"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5M2"
FT                   /protein_id="ADG92058.1"
FT                   /translation="MTISNDYSNYLYVPEELQGVRSSNPLEKIATNKELTKASDDPALL
FT                   AISDQLNYEQSGLTQGVQNINSALSYLQIGDSALGEQSDILNTIREKTLQAATDTTSDD
FT                   QRNIIRNDISKLLEQFDNIASSTSYGDNSILQKNQDDKGESNTFDAQTGTDSQDSTSLN
FT                   PLQSNTQGLGLDGFLQDGTFSADDARTFLDTIDQASAKLQDFRSDIGSTAQQLESSYTS
FT                   MSAQVVNNSSALSTISNVDFAKEVSSFSKQNILAQIGSFGQSQANNINQQSVLRLLS"
FT   gene            378015..379013
FT                   /locus_tag="Arnit_0394"
FT   CDS_pept        378015..379013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0394"
FT                   /product="tRNA pseudouridine synthase D TruD"
FT                   /note="COGs: COG0585 conserved hypothetical protein;
FT                   InterPro IPR011760:IPR020119:IPR020103:IPR001656; KEGG:
FT                   abu:Abu_2117 tRNA pseudouridine synthase; PFAM: tRNA
FT                   pseudouridine synthase D TruD; SPTR: A8EWK8 tRNA
FT                   pseudouridine synthase; PFAM: tRNA pseudouridine synthase D
FT                   (TruD); TIGRFAM: conserved hypothetical protein TIGR00094"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92059"
FT                   /db_xref="GOA:D5V5M3"
FT                   /db_xref="InterPro:IPR001656"
FT                   /db_xref="InterPro:IPR011760"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR020119"
FT                   /db_xref="InterPro:IPR042214"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5M3"
FT                   /protein_id="ADG92059.1"
FT                   /translation="MKRVFLQNYKPLEFKFYQNIDDFVVTENPINFTNRGNFIILKIEK
FT                   ERLGTWDLIDSLARNLNIYDNEIGYAGLKDKNATTTQHISIPRKYAKDIKKFKHPKIKI
FT                   LETYLHSTKLNIGDLIGNSFEINLHEVESCDVGIIEKRLHELAKNGMPNFFGYQRFGKD
FT                   VKENLEKANKIIYGDLKIRDRKLEKMLISIYQSDLFNKWLAKRVEMSDGKFKLLDGEVM
FT                   KSLDDLKFFTPNKINEKIIKDFEDKKIVPTGLLCGREVYRARNEAQLIEKEFDDTYIQE
FT                   KGLRRDAIIFPKDIFVNYDVENKKCKLKFTLPKASYATVVVENIANQNLRV"
FT   gene            complement(379002..381101)
FT                   /locus_tag="Arnit_0395"
FT   CDS_pept        complement(379002..381101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0395"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="COGs: COG4191 Signal transduction histidine kinase
FT                   regulating C4-dicarboxylate transport system;
FT                   InterProIPR005467:IPR000014:IPR004358:IPR003594:IPR
FT                   009082:IPR003661; KEGG: abu:Abu_1637 two-component sensor
FT                   histidine kinase; PFAM: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; SPTR: A8EVB1 Sensor protein; TIGRFAM: PAS
FT                   sensor protein; PFAM: Histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like ATPase; His Kinase A (phosphoacceptor) domain;
FT                   TIGRFAM: PAS domain S-box; glutamate--cysteine
FT                   ligase/gamma-glutamylcysteine synthetase, Streptococcus
FT                   agalactiae type"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92060"
FT                   /db_xref="GOA:D5V5M4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5M4"
FT                   /protein_id="ADG92060.1"
FT                   /translation="MHSSIKPIYIILLSIIIISAFISVNYFLSNKIEGLSENKYIEMSN
FT                   SLKSQINEAIFNKKNSTFNVALTLSEDNNFKKFLENEKIPYSNLNVVSEKIKKYSNFKN
FT                   LWIQLINKDGISKYRSWTNKKGDNIATIRKELPPLLKNPRVVSIISVGIFDITFKNIVP
FT                   IYDGDKFLGLVEVITKMNSIAEEFKSKGIDLIILADKKYKNQIKKPFTKDFIGDYYVAN
FT                   LDAKSELKNLIKENINEFLTIKSYKLLDKYIVTTYVLKSLEDQNIGYCIIFKQKKEIDL
FT                   SDIYEFDKFIKFIGILLALAVLAIFTSIHFYNKSKYATELEKNVKKRTQELNELTKKYH
FT                   QIFEGSKAIKIIYDPTTLNIIDINAAASKFYGYKRTDFLKLKADDISMSTADNQRKEFL
FT                   DILENKQNVFISKNILSSGEIKDVEIYASAIQIDKKTFVYSIIRDITDELKEKDEFNKK
FT                   QKLFYQQAKMASMGEMLENIAHQWRQPLSTITTAASGAKIKKEFGDLDDDFFYDSVDLI
FT                   VRAASYLSQTIDDFRDFFKQSKNKERFKLSTLLNTSIKLANIKNTDIEIVTLYEDCEIL
FT                   GYKNELIQVLLNFFSNAKDALNTARNTNKLIKIEIKKVDKNIIFSILDNAGGISESNIE
FT                   KIFEPYFTTKHQAQGTGIGLYMSEQIITKHFDGEISVQNINYFYKNKEYSGANFKIKIP
FT                   IVLNS"
FT   gene            complement(381198..381506)
FT                   /locus_tag="Arnit_0396"
FT   CDS_pept        complement(381198..381506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0396"
FT                   /product="Rieske (2Fe-2S) iron-sulfur domain protein"
FT                   /note="COGs: COG2146 Ferredoxin subunits of nitrite
FT                   reductase and ring-hydroxylating dioxygenase; InterPro
FT                   IPR017941; KEGG: hba:Hbal_2780 nitrite reductase (NAD(P)H),
FT                   small subunit; PFAM: Rieske [2Fe-2S] iron-sulphur domain;
FT                   SPTR: C6XQF4 Nitrite reductase (NAD(P)H), small subunit;
FT                   PFAM: Rieske [2Fe-2S] domain; TIGRFAM: nitrite reductase
FT                   [NAD(P)H], small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92061"
FT                   /db_xref="GOA:D5V5M5"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5M5"
FT                   /protein_id="ADG92061.1"
FT                   /translation="MKTWIQALKIDEVPIMGSRVLYYKEEEIAIFKTKDGEIHAINNIC
FT                   PHKKGKLSEGLVHESMVTCPLHNWDIDLKNGEAKGENCNYSTIYETQLKDNYIYLKI"
FT   gene            complement(381508..383967)
FT                   /locus_tag="Arnit_0397"
FT   CDS_pept        complement(381508..383967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0397"
FT                   /product="nitrite reductase (NAD(P)H), large subunit"
FT                   /note="COGs: COG1251 NAD(P)H-nitrite reductase;
FT                   InterProIPR006066:IPR012744:IPR013027:IPR017121:IPR
FT                   005117:IPR007419:IPR006067; KEGG: hna:Hneap_1114 nitrite
FT                   reductase (NAD(P)H), large subunit; PFAM: nitrite and
FT                   sulphite reductase 4Fe-4S region; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; BFD domain protein
FT                   [2Fe-2S]-binding domain protein; nitrite/sulfite reductase
FT                   hemoprotein beta-component ferrodoxin domain protein; SPTR:
FT                   C0N4M3 Nitrite reductase (NAD(P)H), large subunit; TIGRFAM:
FT                   nitrite reductase [NAD(P)H], large subunit; PFAM: Pyridine
FT                   nucleotide-disulphide oxidoreductase; Nitrite and sulphite
FT                   reductase 4Fe-4S domain; BFD-like [2Fe-2S] binding domain;
FT                   Nitrite/Sulfite reductase ferredoxin-like half domain;
FT                   TIGRFAM: nitrite reductase [NAD(P)H], large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92062"
FT                   /db_xref="GOA:D5V5M6"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5M6"
FT                   /protein_id="ADG92062.1"
FT                   /translation="MKEKLVVIGNGMSGLRTIEDLLELEKNKYDITIYGEEPYVNYNRI
FT                   MLSYLLSGEKSFEDTIINHETWYEQNNIILNKGDKVISIDKNSKTITSQNGKIESYDKL
FT                   LIATGSKPFIPNTFGSNLKNVIAFRTKEDSDTILRLIDKEKTAVVVGGGLLGLEAAYGI
FT                   AMHGIKTILVHRSASILSQQLDSTGGKLLQQNLEKYGIEFKLNTTVSEIYGDEVVEKVN
FT                   FSDGTLVDSNIVVFATGIIPNTSLAKEAELECNKGIVVNDYLKTSDDSIYAIGECVEHS
FT                   GNTYGLVAPLYEQAKVLAKVLATKQTVGYSGSTLSTRLKISGVDLFSAGDYLGDETTEN
FT                   LILLDEKVGIYKKLVIYNNKIIGMVLYGETADASWYLKLLKEETDISDLRTKILFGKSA
FT                   LGDSGHGGNDINSISDDEEICGCNGVCKGDIVSAIKEKDLKSLSDVKSCTKAGASCGSC
FT                   LGLVEQILVNTLGDEYKNIEEGICDCTTLGHKEIKSTIDNGEFKTVYDVFKKLDWKTQD
FT                   GCVKCRPAINYYLLVKYNDDKYKNDKRSALVNDRVLANIQKDGTYSVVPRIWGGLTSPQ
FT                   ELKDIADIAVKYDVPTVKFTGGQRLDMLGVKKEQLEPMWKDLNDCGFVSGQAYAKGLRT
FT                   VKTCVGNTWCRFGTQDSMGMGVIIEKLTWGSWTPHKFKIAVSGCPRNCAEATIKDLGVI
FT                   GVDSGWEIHIAGNGGIKVRVTDLLCKVETDEELLEYVKAFMQFYREDAYYLERTAHWVE
FT                   RVGLEYVKDVMLDKQKVNFYAKRFEESQKHAQIDPWAKAIEEGFTKEFSPIVLNPEESH
FT                   SFEAKEI"
FT   gene            complement(384117..385838)
FT                   /locus_tag="Arnit_0398"
FT   CDS_pept        complement(384117..385838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0398"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="COGs: COG0631 Serine/threonine protein phosphatase;
FT                   InterProIPR000719:IPR008266:IPR011009:IPR001932:IPR
FT                   020635:IPR002290:IPR014045:IPR017442; KEGG: dar:Daro_0820
FT                   serine/threonine protein kinase; PFAM:
FT                   Serine/threonine-protein kinase-like domain; Protein
FT                   phosphatase 2C-like; SMART: serine/threonine protein
FT                   kinase; protein phosphatase 2C domain protein;
FT                   Tyrosine-protein kinase, subgroup, catalytic domain; SPTR:
FT                   Q47HV5 Serine/threonine protein kinase; PFAM: Protein
FT                   kinase domain; Protein phosphatase 2C"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92063"
FT                   /db_xref="GOA:D5V5M7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5M7"
FT                   /protein_id="ADG92063.1"
FT                   /translation="MNNQLKVSIGQYSIKGIKDINQDFYDIYIPSEPLLTSKGIAIAIA
FT                   DGISSSKVSQEASKLSVISFLQDYYSTSESWSVKNSANKVLKATNSWLYSQNRQSKYHL
FT                   DKDKGFVCTFSALIIKSNTAHIFHVGDTRVYKLKNNNLEQLTTDHRTWISNEKSYLSRA
FT                   LGIDSQLTIDYETTEIEKDDIFLLMTDGVYEFIDVEFINKSLKNCDDYNEAAKVIVQKA
FT                   LKNHSDDNLTIQIIKIDSLANKDSNEIHQQILNKAIPPILEARKEFEGYFIIRELSATS
FT                   RSHVYLAKDNDNNQTVVIKTPSIDLQDDKAYLERFLMEEWIAKRVNNPYVAKAYNANRK
FT                   QNYIYTVFEYIDAITLSQWMIDNPKPKIEVVRNILEQIARGLMAFHRLEMIHQDIRPEN
FT                   IMIDKTGSVKIIDFGSTRIEGILEINTFMQQEKLLGTALYSAPEYFLGEEGSVKSDIFS
FT                   LGAITYQMLSNKLPYGVQVARANTKSAQNKLKYITLYPEFPLWIDGAIRKALNINPNER
FT                   YSELSEFLFDLKQPNKKFLNKKLPPLIEKSPIVFWQSISLILFLIILLLINNLIKI"
FT   gene            complement(385866..386306)
FT                   /locus_tag="Arnit_0399"
FT   CDS_pept        complement(385866..386306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0399"
FT                   /product="cyanate lyase"
FT                   /EC_number="4.2.1.104"
FT                   /note="COGs: COG1513 Cyanate lyase; InterPro
FT                   IPR008076:IPR003712:IPR010982; KEGG: ttu:TERTU_4160
FT                   cyanase; PFAM: Cyanate lyase domain protein; PRIAM:
FT                   Cyanase; SPTR: A4BAX9 Cyanate lyase; TIGRFAM: cyanate
FT                   lyase; PFAM: Cyanate lyase C-terminal domain; TIGRFAM:
FT                   cyanate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92064"
FT                   /db_xref="GOA:D5V5M8"
FT                   /db_xref="InterPro:IPR003712"
FT                   /db_xref="InterPro:IPR008076"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR036581"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5M8"
FT                   /protein_id="ADG92064.1"
FT                   /translation="MNKVEMTEEIILAKKNLDISWEEIAAKVGLAPVFLTSACLGMNSL
FT                   KEEYAKKLCEVLELSDEIAILLQEYPMKNWDKTIPNDPVIYRFYEIVGVYGETIKEIIG
FT                   EKFGDGIMSAIDFSMDIDKEKNPAGDRVKITMNGKFLPYKSW"
FT   gene            complement(386360..387196)
FT                   /locus_tag="Arnit_0400"
FT   CDS_pept        complement(386360..387196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0400"
FT                   /product="formate/nitrite transporter"
FT                   /note="COGs: COG2116 Formate/nitrite family of transporter;
FT                   InterPro IPR000292; KEGG: tdn:Suden_0716 formate/nitrite
FT                   transporter; PFAM: formate/nitrite transporter; SPTR:
FT                   Q30SN6 Formate/nitrite transporter; PFAM: Formate/nitrite
FT                   transporter; TIGRFAM: formate/nitrite transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92065"
FT                   /db_xref="GOA:D5V5M9"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5M9"
FT                   /protein_id="ADG92065.1"
FT                   /translation="MAYLEPSEFVTKMVDSGESKIYMSTKDTLIRGYMAGAILALAAIF
FT                   AITVAMKSGSPILGACLFPVGFIMLYLMKFDLLTGVFMLVPLALLDKRPGVTVKQVLRN
FT                   WGLVALGNLLGALTVAFMMAFIFTYGFNTDGGPIAKKVAGIGEARTLGYSAYGLEGWIT
FT                   VFIRAMLCNWMVSMGVVGAMISTTVSGKAIAMWMPIMLFFFMGFEHSIVNMFLFPFSLI
FT                   MGGNFTIADYLLWNELPVAAGNLVGGLAFTGLTLYATHIKTGEKRTLNNSLSNNAA"
FT   gene            387392..388879
FT                   /locus_tag="Arnit_0401"
FT   CDS_pept        387392..388879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0401"
FT                   /product="histidine kinase"
FT                   /note="COGs: COG4191 Signal transduction histidine kinase
FT                   regulating C4-dicarboxylate transport system; InterPro
FT                   IPR005467:IPR004358:IPR003594; KEGG: abu:Abu_0362
FT                   two-component sensor histidine kinase; PFAM: ATP-binding
FT                   region ATPase domain protein; SMART: ATP-binding region
FT                   ATPase domain protein; SPTR: A8ERR3 Sensor protein; PFAM:
FT                   Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase;
FT                   Protein of unknown function (DUF3365)"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92066"
FT                   /db_xref="GOA:D5V5N0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR021796"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5N0"
FT                   /protein_id="ADG92066.1"
FT                   /translation="MSLFFLIGITIKNSYQLQEKSLIDNLRNKAQTIFNLIVDVRHWNA
FT                   QYNGVYVKSEDLKPNPYLNPNFIKSKNDETMVWINPAFMTRQISDIASQRDGFKLKITS
FT                   NKLINKNNAPDEYEKILLDYFEKNPNKQSYWDIKDNKFKFMGALKIEKDCLKCHAKQGY
FT                   KVGDIRGGISVTFDVSNEFEQLKEINKEKKLTIIFLIIAAIGGVITLIIHETMKRRDEQ
FT                   KISKLNESLETKVNELDDFNKTLHKKVQEEVKKQREKENLLIQQSKMAALGEMIGNIAH
FT                   QWRQPISAVSAIMMNIKWTAIAEGMNKKFIDDRMKEANEQLGYMSQTIDDFRNFFKPNK
FT                   EKELFDLDLEVRKTYKILKDTLQNNNINFQIFSNKEIIVFGYPSEFSQVVLNIISNAKD
FT                   VLIERNTDKPKIEVHILKDEENIYCKITDNAGGIEEEIINKIFEPYFTTKESRGTGIGL
FT                   YISKEIIQKHMNGLLIVKNNEVGAEFTISIPKKEEEV"
FT   gene            388876..389559
FT                   /locus_tag="Arnit_0402"
FT   CDS_pept        388876..389559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0402"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="COGs: COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain; InterPro IPR001789:IPR011006:IPR001867:IPR011991;
FT                   KEGG: abu:Abu_0363 two-component response regulator; PFAM:
FT                   response regulator receiver; transcriptional regulator
FT                   domain protein; SMART: response regulator receiver; SPTR:
FT                   C1ZXM7 Response regulator with CheY-like receiver domain
FT                   and winged-helix DNA-binding domain; PFAM: Response
FT                   regulator receiver domain; Transcriptional regulatory
FT                   protein, C terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92067"
FT                   /db_xref="GOA:D5V5N1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5N1"
FT                   /protein_id="ADG92067.1"
FT                   /translation="MTDIISRLKSKTILLVEDEKVIRENIASMLKFFFKEVYIANDGYD
FT                   GIEKYENYLPDIVMTDLKMPNMGGFELITELKNRKSTSFTIIVSAHTDTDLLINAIHNG
FT                   VDRYIVKPVIEDDLFDTFKAFLEKLDNVMPQIIKLSENLFIDIDKSEIILDEKSIHLNK
FT                   KENMLLKLLCKDLNKTISYEEIEYQVWGSESMSLSAIRSVVRDLRKKIGQEYISNVSGV
FT                   GYRMK"
FT   gene            complement(389607..391601)
FT                   /locus_tag="Arnit_0403"
FT   CDS_pept        complement(389607..391601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0403"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="COGs: COG0243 Anaerobic dehydrogenase typically
FT                   selenocysteine-containing; InterPro
FT                   IPR009010:IPR006963:IPR006656:IPR006657; KEGG:
FT                   dfe:Dfer_2062 molybdopterin oxidoreductase; PFAM:
FT                   molybdopterin oxidoreductase; molybdopterin oxidoreductase
FT                   Fe4S4 region; molydopterin dinucleotide-binding region;
FT                   SPTR: A6DC81 Nitrate reductase narB; PFAM: Molybdopterin
FT                   oxidoreductase; Molydopterin dinucleotide binding domain;
FT                   Molybdopterin oxidoreductase Fe4S4 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92068"
FT                   /db_xref="GOA:D5V5N2"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5N2"
FT                   /protein_id="ADG92068.1"
FT                   /translation="MIKSVCGYCGVGCGIEFDTSKLIGDISYPTNEGLLCAKGASELHT
FT                   IETSSRLLRPQIKQDGKFNTIDWDTSIKYISSKIKKSEPERVVFYLSGQLLTEDYYIAN
FT                   KLAKGFINTNNVDTNSRTCMASAVVAHKKAFGVDYVPVRMRDIKKANLLILVGSNAAEA
FT                   HVVFFNKIKKELKRGLKLVVIDPRVTPTTKAAHLHLQINVGSDIDFFNLVCQRLITDEK
FT                   IDSNYIEKYTNNFETYKNKLSREAKTKMLKRTGLSKEQFEEFITMFYENENIISAWTMG
FT                   LNQSVQGVDKNLSLINMHLITGKINKEGNGPFSLTGQPNAMGGREVGGLATTLAVHLDF
FT                   EAESIKKVEEFWKTSGIKNKRGLTSCEIVDEALKGNVEVLIISHTDPIYHLPNRAKVEK
FT                   AFRNIPLIVEINAYENSETSEFSHIRLPASPWGEKDGTQTNMDRTITKQKKVTRTSIDC
FT                   KPDWEVFKLIAWELGFKKSFDYSTVEDIFNEFKEMTKISKKRHLDMHNMKGETFIWGEK
FT                   LFKDNKFLTQNEKANLHFVKNENLSEKTSKEFPFILLTGRTRDQWHSGTKTALLDNLKK
FT                   FKALEYVEIHPNDAKNLEIEDGDMVDVTSVRGEITLEAKITPDVKEKTVFIPVSVRKIN
FT                   YLTLDLVDKESFEPDYNHSAVRVKSITRL"
FT   gene            391764..393143
FT                   /locus_tag="Arnit_0404"
FT   CDS_pept        391764..393143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0404"
FT                   /product="NMT1/THI5 like domain protein"
FT                   /note="COGs: COG0715 ABC-type nitrate/sulfonate/bicarbonate
FT                   transport systems periplasmic components; InterPro
FT                   IPR015168; KEGG: aeh:Mlg_1703 nitrate transporter; PFAM:
FT                   NMT1/THI5 like domain protein; SPTR: B6BK92 Nitrate
FT                   transporter; PFAM: NMT1/THI5 like"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92069"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5N3"
FT                   /protein_id="ADG92069.1"
FT                   /translation="MLKQVLKIGLGISVVASTLMATPEKTKLKIGFIALTDCAPLVIAK
FT                   EKGFFKAEGLDVHVVKEGGGWPGIQQKVISGEYDFSHALAGMPIAATLGINGNANLVAL
FT                   LSLDLNGNAITYGNNIIKEMEKYGLDKTKRPVSAESLKKYIDAKHKAEGANYKPLTFGM
FT                   VHPVSTHNYELRYWMAASGIKPDEDCTIKPFPPPTMPSNLIAGNIEGYCVGEPWNSRIV
FT                   LKGEGSALVTNYDIWNNNPEKVLQARADFVKKNPETTKAVMRAVLKAQMWLDESWEHRE
FT                   EAIKYLAQNNYVKAPVSVLRKSMSGTFLYNKGVDSKNPMFNVFANDYAAYPFYSHGMWF
FT                   ITQMYRWGQLDHAVNMKEVIEKVYRPDLFAVVAKEVGYTLPPSPWKKDGVDEYNKFLDG
FT                   KVWDPNKAVDYIYDFKVQNSLVSKEELAKANNWTVETKQPAYVCPYGPAGCADPKYVTK
FT                   K"
FT   sig_peptide     391764..391826
FT                   /locus_tag="Arnit_0404"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            393250..394059
FT                   /locus_tag="Arnit_0405"
FT   CDS_pept        393250..394059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0405"
FT                   /product="nitrate ABC transporter, inner membrane subunit"
FT                   /note="COGs: COG0600 ABC-type nitrate/sulfonate/bicarbonate
FT                   transport system permease component; InterPro
FT                   IPR000515:IPR005889; KEGG: aeh:Mlg_1704 nitrate ABC
FT                   transporter, inner membrane subunit; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: B6BK94 Nitrate ABC transporter, inner
FT                   membrane subunit; TIGRFAM: nitrate ABC transporter, inner
FT                   membrane subunit; PFAM: Binding-protein-dependent transport
FT                   system inner membrane component; TIGRFAM: nitrate ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92070"
FT                   /db_xref="GOA:D5V5N4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005889"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5N4"
FT                   /protein_id="ADG92070.1"
FT                   /translation="MNTNNLKKIVLPAIVFFIIVAIWSTIAQNVHNFPTPTDTFVHAFG
FT                   GTDSNGDEVIGVLSDPFYITNQDDKGIFWQVLNSLERVFSGFILAIIIGVPVGLAIGMS
FT                   KNFQIALEPFIQIFKPVSPLAWLPLLLFVFQDINATAISTIFVTSIWPIIINTSLGVKS
FT                   VSEDYMNVAKVLQFTPLEKIRKIILPVAVPYIFTGMRLSLGIAWLVIVAAEMLTGGIGI
FT                   GFWIWDEYNNLNYFNIIIGIIIVGLVGFMLDIIMGKIADFFDYRKRV"
FT   sig_peptide     393250..393330
FT                   /locus_tag="Arnit_0405"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            394062..394856
FT                   /locus_tag="Arnit_0406"
FT   CDS_pept        394062..394856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0406"
FT                   /product="nitrate ABC transporter, ATPase subunits C and D"
FT                   /note="COGs: COG1116 ABC-type nitrate/sulfonate/bicarbonate
FT                   transport system ATPase component; InterPro
FT                   IPR003439:IPR017871:IPR005890:IPR003593; KEGG:
FT                   vha:VIBHAR_05590 hypothetical protein; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase; SPTR: B6BK95
FT                   Nitrate transporter system, ATPase component; TIGRFAM:
FT                   nitrate ABC transporter, ATPase subunits C and D; PFAM: ABC
FT                   transporter; TIGRFAM: nitrate transport ATP-binding
FT                   subunits C and D"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92071"
FT                   /db_xref="GOA:D5V5N5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005890"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5N5"
FT                   /protein_id="ADG92071.1"
FT                   /translation="MEKKFLSLEFVDKVFPLPNGKEYVAVKDVNLQIKKDEIVAIIGHS
FT                   GCGKSTLLNMIAGLDTVSCGGVFLNNKEVNGPGPERAVVFQNHSLLPWLTVFQNIELAV
FT                   KKVMPELSKKELEERVDKFVNMVNLTHARDKFPSEISGGMKQRVGIARALSIRPEVLLM
FT                   DEPFGALDSLTRANLQEHLMRIQQSVKNTVIVITHDIDEAVLLSDRVVMMTNGPSATIG
FT                   EVLEVNLPHPRNRVELQKDPEYIRCRETILSFLYEKFAKEDE"
FT   gene            394873..396801
FT                   /locus_tag="Arnit_0407"
FT   CDS_pept        394873..396801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0407"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="COGs: COG0840 Methyl-accepting chemotaxis protein;
FT                   InterPro IPR004089; KEGG: abu:Abu_1984 methyl-accepting
FT                   chemotaxis protein; PFAM: chemotaxis sensory transducer;
FT                   SMART: chemotaxis sensory transducer; SPTR: A8EW83
FT                   Methyl-accepting chemotaxis protein; PFAM: Methyl-accepting
FT                   chemotaxis protein (MCP) signaling domain; TIGRFAM:
FT                   glutamate--cysteine ligase/gamma-glutamylcysteine
FT                   synthetase, Streptococcus agalactiae type"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92072"
FT                   /db_xref="GOA:D5V5N6"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5N6"
FT                   /protein_id="ADG92072.1"
FT                   /translation="MNTILNAINLKSKLILLMICPLLAYLIVAIGFISENYTKYNDYGK
FT                   MKIDIQKKAELSKEDQINLLFMKQNEKIDYIKIIDQRIESSYNKFIVSSIMAVVILILC
FT                   FLFFVIILKDISQSIFLIRDGMSRFFNYLTSTEKHLKEIELNSKDDFGKMANELNLNIQ
FT                   KVKDGLVLDNEVIAEAKFVSKMVGRGFLVYRINSQASNSYINELKDNVNHMIDSLRFNI
FT                   VNSFQTSVNYANCDFKVKADKSDIGAIVNTLLSCLNMIGTNISEFLAMVNMNGKILDKH
FT                   SQELLELVNQLHTASINQAASLEQTTASIHDITNSITETSSKAVNMLEIANSTKSYANE
FT                   GIKLVENTQNSMAEINDSTKAIYEAISIIDNISFQTNILSLNAAVEAATAGEAGKGFAV
FT                   VAQEVRNLATKSAEAAKDIKNLVEIANTKSAEGKKYSEEMMNSFNKLNSMIEENRNIID
FT                   EVASANETQMLNLSQINETMNSLDKITQENANMASNTKNVAVLTNKVAKEMIYAVSQNE
FT                   YDPSVEKRVVNFAFTQKLNNIKIEFTKYKQAILNQVNNNSNTIDMDINHRRNIEKFIKE
FT                   YDSKMKSKTQLWTTFKDKTELLNKELNEYGIYLKNKDEINILESSSRLEAILDEVYENI
FT                   NMFKELN"
FT   sig_peptide     394873..394944
FT                   /locus_tag="Arnit_0407"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(396813..397784)
FT                   /locus_tag="Arnit_0408"
FT   CDS_pept        complement(396813..397784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0408"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR011044; KEGG: abu:Abu_2118 hypothetical
FT                   protein; SPTR: A8EWK9 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92073"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5N7"
FT                   /protein_id="ADG92073.1"
FT                   /translation="MRHLLILISAIILFTACSKKQYFEPEDTLSFNKSTKSIDSDIVSF
FT                   NRDGATLENGQFISAKGVSKIKIPEGFQFLNLSEGKVLSTNIKDKIYVDKKEIVTNTAV
FT                   VAASLKDDILAIVNSDNSIMAYDLRDGKIIFKEYLTKSLANDTRIAAPYFMQNLILFPT
FT                   LDGKILVVSAQNYKVVRNIIVDADSQFNNIIYLNVVNDTLIAATSKKVISVGDGVLNIK
FT                   QYDLRDIIAHGKDIYLATIDGQIIKTDISLNVMNRKKYKFAKFYALAYGDSLYALESQG
FT                   YMINISDDFKTDKIYDFSFDEEDRVIAFGDTMYINDEYVKLK"
FT   sig_peptide     complement(397731..397784)
FT                   /locus_tag="Arnit_0408"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(397794..398372)
FT                   /locus_tag="Arnit_0409"
FT   CDS_pept        complement(397794..398372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0409"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: abu:Abu_2119 hypothetical protein; SPTR:
FT                   A8EWL0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92074"
FT                   /db_xref="GOA:D5V5N8"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5N8"
FT                   /protein_id="ADG92074.1"
FT                   /translation="MSLKDNMDFVKEGLNSEEKFLESFVRVERIFKKYKLIIISAIVII
FT                   VLAIIAISLTSYFKEQNTIKANIIFQELLKNPNDEKALETLKGLNSNLYDIILYSQRDT
FT                   KKDISINAKFFKELYAYEKAMKEQNVNKLGDLSMENDFLLKEFAIFNKALILAENGKYK
FT                   ESKDALKLIPETSKVKDLVALLNHYLITK"
FT   gene            398481..399779
FT                   /locus_tag="Arnit_0410"
FT   CDS_pept        398481..399779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0410"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.102"
FT                   /note="COGs: COG0793 Periplasmic protease; InterPro
FT                   IPR001478:IPR004447:IPR005151; KEGG: abu:Abu_2120
FT                   carboxyl-terminal protease family protein; PFAM: peptidase
FT                   S41; PDZ/DHR/GLGF domain protein; PRIAM: C-terminal
FT                   processing peptidase; SMART: peptidase S41; PDZ/DHR/GLGF
FT                   domain protein; SPTR: A8EWL1 Carboxyl-terminal protease
FT                   family protein; TIGRFAM: carboxyl-terminal protease; PFAM:
FT                   Peptidase family S41; PDZ domain (Also known as DHR or
FT                   GLGF); TIGRFAM: C-terminal peptidase (prc)"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92075"
FT                   /db_xref="GOA:D5V5N9"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5N9"
FT                   /protein_id="ADG92075.1"
FT                   /translation="MNKFILSIIVLVISLNFLHADVKADKKEEQSRFESLSKLTNVIGT
FT                   VEKYYVDDLKLQQIVDKALKGLMQELDAHSTYMDKKYFKEMQIQTDGEFGGLGITVGMR
FT                   DGALTVISPIDGTPAFEAGVKSEDIILKIDDKSTLNMSLDEAVSLMRGKPKTSITLTVV
FT                   RKDVRKPLEIKIVRDIIKIESVKAKTIGKDILYLRVTSFDKNVVDGLTKAIKDAKGIKG
FT                   IILDLRNNPGGLLTQAIGTTDLFVDKGIIVSQKGRDDSSEETFNANYSKTLTRVPLIVL
FT                   VNGGSASASEIVSGALQDHKRAILVGEKTFGKGSVQVVLPITADKSEAIKLTIAKYYLP
FT                   SGRTIQATGITPDVIAYPGEAVKAPDMDFMIKEADLKKHLKSELEKVDGKDKDVKKETK
FT                   KDDKKIITDEELFKDNQLKTGVDILKSLIIINK"
FT   sig_peptide     398481..398540
FT                   /locus_tag="Arnit_0410"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            399804..400772
FT                   /locus_tag="Arnit_0411"
FT   CDS_pept        399804..400772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0411"
FT                   /product="SAICAR synthetase"
FT                   /note="COGs: COG0152
FT                   Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR)
FT                   synthase; InterPro IPR001636:IPR013816; KEGG: abu:Abu_2121
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase;
FT                   PFAM: SAICAR synthetase; SPTR: A8EWL2
FT                   Phosphoribosylaminoimidazole-succinocarboxamide synthase;
FT                   PFAM: SAICAR synthetase; TIGRFAM:
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92076"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5P0"
FT                   /protein_id="ADG92076.1"
FT                   /translation="MNISDIVALGLWPQSKKTTTKKGIQELEDLGYNLFYIGKNADLYT
FT                   CPGDEAKVLLVRSDRCSVFDIPLNLEIKEKGVWQTAISNSGAKFAEKSGIKTAVLSENV
FT                   DPSLIIAPRCQIMELCKALEAQIDGDVVQFEFIFRNYLTGSLFEATKNGNDPYGLNLPS
FT                   TLNEWHKFETPIFTPTTKGVKDIPLNSQNVREKFPEIISSLEKLFKEFTQYAQDNGIVV
FT                   VDTKLEVFVNAKGEWILGDEILTPESSRFISKENFDAKNFISMDKQILRNFAKENNWKE
FT                   KAKDLKAGEKLDVEVPDSIKNEVLKGYKTIHERLSSSIIDQ"
FT   gene            400854..401099
FT                   /locus_tag="Arnit_0412"
FT   CDS_pept        400854..401099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0412"
FT                   /product="phosphoribosylformylglycinamidine synthase, purS"
FT                   /note="COGs: COG1828 Phosphoribosylformylglycinamidine
FT                   (FGAM) synthase PurS component; InterPro IPR003850; KEGG:
FT                   abu:Abu_2122 phosphoribosylformylglycinamidine synthetase;
FT                   PFAM: phosphoribosylformylglycinamidine synthetase PurS;
FT                   SPTR: A8EWL3 Phosphoribosylformylglycinamidine synthetase;
FT                   TIGRFAM: phosphoribosylformylglycinamidine synthase, purS;
FT                   PFAM: Phosphoribosylformylglycinamidine (FGAM) synthase;
FT                   TIGRFAM: phosphoribosylformylglycinamidine synthase, purS
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92077"
FT                   /db_xref="GOA:D5V5P1"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5P1"
FT                   /protein_id="ADG92077.1"
FT                   /translation="MKAIVNVALKQGVLDDQGKATHHALDTLGFKEVVKDVRIGKQIIL
FT                   ELNSSSKEEAQAEVTKMCEKLLANTVIEDYNITITE"
FT   gene            401104..401778
FT                   /locus_tag="Arnit_0413"
FT   CDS_pept        401104..401778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0413"
FT                   /product="phosphoribosylformylglycinamidine synthase I"
FT                   /EC_number="6.3.5.3"
FT                   /note="COGs: COG0047 Phosphoribosylformylglycinamidine
FT                   (FGAM) synthase glutamine amidotransferase domain; InterPro
FT                   IPR017926:IPR010075:IPR011698; KEGG: abu:Abu_2123
FT                   phosphoribosylformylglycinamidine synthase I; PFAM:
FT                   CobB/CobQ domain protein glutamine amidotransferase; PRIAM:
FT                   Phosphoribosylformylglycinamidine synthase; SPTR: A8EWL4
FT                   Phosphoribosylformylglycinamidine synthase I; TIGRFAM:
FT                   phosphoribosylformylglycinamidine synthase I; PFAM:
FT                   CobB/CobQ-like glutamine amidotransferase domain; TIGRFAM:
FT                   phosphoribosylformylglycinamidine synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92078"
FT                   /db_xref="GOA:D5V5P2"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5P2"
FT                   /protein_id="ADG92078.1"
FT                   /translation="MNVAVLQFPGTNCEYDTKYAFEKIGANVQIIWHKESKLPENIDLV
FT                   VIPGGFSYGDYLRSGAIARFANIMESVKEYAANGGKILGICNGFQILLEAGLLPGAMKR
FT                   NSSLHFISKFNHLKVINNNNKFLNKLEINDVVNIPIAHHDGNYFIDEAGLKELEENTQI
FT                   LLKYCDENGSLANVNGSVSNIAGICNKEKNIYGLMPHPERAIETLLGCDDGVKMLEGFL
FT                   NN"
FT   gene            401815..403014
FT                   /locus_tag="Arnit_0414"
FT   CDS_pept        401815..403014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0414"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: abu:Abu_2124 hypothetical protein; SPTR:
FT                   A8EWL5 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92079"
FT                   /db_xref="GOA:D5V5P3"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5P3"
FT                   /protein_id="ADG92079.1"
FT                   /translation="MKNIFYLLLISLTLFANEPQDSTDLTNKETSVFDTTNSVKAEEIK
FT                   PDYYQEITKPDTQDISAEKNIYLTYKSFPNKIFKNQRFEIILKAIITSDDYDKIETRFI
FT                   NSKNMNVLNPESPWTEVEDKTFENMFYFKANQADFVLPTFQVAIYKNNVLIEVESIQPK
FT                   EVSFTEIGKNIENFSSVIAKDLVINAYKTKQYNNDELITIMDINAKESNLEDFYIKNVK
FT                   EQGVSTIDDKYPEQNLLYYLVLPVHTKKIDFSYYNSDQKKFITINIPIVLENELVSTQT
FT                   DLNPNKSNILFYKRVVFGSLFVLFFIIFIWKRKKIYLIIALISAVILLLYSIPNKTEIL
FT                   KKDSYIYILPTKKSTIFQKTDTEHEVQVSIKRGDFVKVILGEGDKSMIGWVKENDLSKN
FT                   "
FT   sig_peptide     401815..401862
FT                   /locus_tag="Arnit_0414"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            402995..403684
FT                   /locus_tag="Arnit_0415"
FT   CDS_pept        402995..403684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0415"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="COGs: COG0204 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase; InterPro IPR002123; KEGG: abu:Abu_2125
FT                   1-acyl-sn-glycerol-3-phosphate acyltransferase PlsC; PFAM:
FT                   phospholipid/glycerol acyltransferase; SMART:
FT                   phospholipid/glycerol acyltransferase; SPTR: A8EWL6
FT                   1-acyl-sn-glycerol-3-phosphate acyltransferase PlsC; PFAM:
FT                   Acyltransferase; TIGRFAM: 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92080"
FT                   /db_xref="GOA:D5V5P4"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5P4"
FT                   /protein_id="ADG92080.1"
FT                   /translation="MILARIRGIIVLIQFTISVAFVVIGMYTFKNHVHKIIKLWMRLQI
FT                   YFLGITFEQVGKMDESCDMVIMNHQSLLDIIVIEHIHNKHLAWVGKKEITNLIFFGHIM
FT                   KAPNMITIDRENKTGLLKLIKDAKDRLAKNRPIAIFPEGTRGDGKTMGTFKPGAAMVAN
FT                   KLNLRVQPLIIINTKNILDSQKLDANPGVVKIIYLEPIQADKATNWYKETEEKMREILA
FT                   KEMKKEQ"
FT   gene            403684..404070
FT                   /locus_tag="Arnit_0416"
FT   CDS_pept        403684..404070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0416"
FT                   /product="Camphor resistance CrcB protein"
FT                   /note="COGs: COG0239 Integral membrane protein possibly
FT                   involved in chromosome condensation; InterPro IPR003691;
FT                   KEGG: abu:Abu_2126 camphor resistance CrcB protein; PFAM:
FT                   Camphor resistance CrcB protein; SPTR: A8EWL7 Protein crcB
FT                   homolog; PFAM: CrcB-like protein; TIGRFAM: crcB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92081"
FT                   /db_xref="GOA:D5V5P5"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5P5"
FT                   /protein_id="ADG92081.1"
FT                   /translation="MTLSWQTILAVGCGGFFGAISRVYITHSMNVSMKSEFPWGVLTVN
FT                   VVGSFIIGVLFAIFLHYTVSDTLKSFLTTGFLGAFTTYSTFAIESYFLLNTSIFLAATS
FT                   MFLNLFGTIVAAGGGYKLIHFLLR"
FT   gene            404148..404381
FT                   /locus_tag="Arnit_0417"
FT   CDS_pept        404148..404381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0417"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family subunit"
FT                   /note="InterPro IPR006312:IPR003369; KEGG: abu:Abu_2128
FT                   twin arginine-targeting protein translocase; PFAM:
FT                   sec-independent translocation protein mttA/Hcf106; SPTR:
FT                   A8EWL9 Twin-arginine translocation protein, TatA/E family;
FT                   TIGRFAM: twin-arginine translocation protein, TatA/E family
FT                   subunit; PFAM: mttA/Hcf106 family; TIGRFAM: twin
FT                   arginine-targeting protein translocase, TatA/E family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92082"
FT                   /db_xref="GOA:D5V5P6"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5P6"
FT                   /protein_id="ADG92082.1"
FT                   /translation="MGMPGGMEWILIALVVLLLFGGKKIPELAKGLGSGIKNFKKAVKE
FT                   DDEEEVVKADKADEIEDKKAEKSVNTEDTKKV"
FT   gene            404392..405984
FT                   /locus_tag="Arnit_0418"
FT   CDS_pept        404392..405984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0418"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="COGs: COG0018 Arginyl-tRNA synthetase;
FT                   InterProIPR001412:IPR001278:IPR015945:IPR009080:IPR
FT                   005148:IPR008909:IPR014729; KEGG: abu:Abu_2129 arginyl-tRNA
FT                   synthetase; PFAM: Arginyl-tRNA synthetase, class Ic, core;
FT                   arginyl tRNA synthetase domain protein; DALR anticodon
FT                   binding domain protein; PRIAM: Arginine--tRNA ligase; SPTR:
FT                   A8EWM0 Arginyl-tRNA synthetase; TIGRFAM: arginyl-tRNA
FT                   synthetase; PFAM: DALR anticodon binding domain; Arginyl
FT                   tRNA synthetase N terminal domain; tRNA synthetases class I
FT                   (R); TIGRFAM: arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92083"
FT                   /db_xref="GOA:D5V5P7"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5P7"
FT                   /protein_id="ADG92083.1"
FT                   /translation="MQILVKKNIEEILELENLVLEKPKDISLGHFATPVAFSLAKELRK
FT                   NPMQIAQELADKFKDSEIFDSVTAVKGFVNFKLSNTFLENLISKLFEDENSFAKGENKN
FT                   EKILLEYVSANPTGPLHIGHARGAIFGDTLARVGRHLGYDVQTEYYINDAGAQMDMLGL
FT                   SVSLAGREFLLNETVEYPESYYRGEYLVDIAKEIQKNFGDDIFNDESRFREMAMFAKDE
FT                   VLKIIKKDLKDIGIEFDTFISENSLYSSWEDTKNVLEKNGSLYEKDEKVFLRSTAHGDD
FT                   SDRVVVRDNGIPTYLAGDIIYHKNKYDRNFDRYINIWGADHHGYITRVKAAIEFLGNDS
FT                   SKLEIILSQMVQLLKGGEPYKMSKRKGNFILMSDISEEIGADALRFVFLTRKSDTHLEF
FT                   DLETLKNQDSSNPVFYINYAHARINQVFVKANLTPKDVLNEKFGDLNEDSINLIYEALL
FT                   LPTVISEAFEKRDMQKITDYLYNLASSVHKFYNEHKILETQEQNSYLKVLSVVSLSIRT
FT                   GLKLLGIEAKEVM"
FT   gene            405984..406100
FT                   /locus_tag="Arnit_0419"
FT   CDS_pept        405984..406100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92084"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5P8"
FT                   /protein_id="ADG92084.1"
FT                   /translation="MKWVIIIFAAIITFAIVTGYMGGAKEAAGNYGKVMRGG"
FT   sig_peptide     405984..406061
FT                   /locus_tag="Arnit_0419"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(406102..406428)
FT                   /locus_tag="Arnit_0420"
FT   CDS_pept        complement(406102..406428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0420"
FT                   /product="iojap-like protein"
FT                   /note="COGs: COG0799 Iojap protein; InterPro IPR004394;
FT                   KEGG: abu:Abu_2130 hypothetical protein; PFAM:
FT                   Iojap-related protein; SPTR: A8EWM1 Putative
FT                   uncharacterized protein; TIGRFAM: iojap-like protein; PFAM:
FT                   Domain of unknown function DUF143; TIGRFAM: iojap-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92085"
FT                   /db_xref="GOA:D5V5P9"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5P9"
FT                   /protein_id="ADG92085.1"
FT                   /translation="MTREETIVKVLEDKKAVNVEVINLQDKDYIVDFVVIATTLNAKHG
FT                   FALLNYLKEELKPAGEEFLRVDENDDWTVIDLGDAFIHLMTEKTREKYSLEEFLSELEI
FT                   TKEG"
FT   gene            complement(406442..406978)
FT                   /locus_tag="Arnit_0421"
FT   CDS_pept        complement(406442..406978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0421"
FT                   /product="nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /note="COGs: COG1057 Nicotinic acid mononucleotide
FT                   adenylyltransferase; InterPro
FT                   IPR004821:IPR005248:IPR004820:IPR014729; KEGG: abu:Abu_2131
FT                   nicotinate (nicotinamide) nucleotide adenylyltransferase;
FT                   PFAM: cytidylyltransferase; PRIAM: Nicotinate-nucleotide
FT                   adenylyltransferase; SPTR: A8EWM2 Probable
FT                   nicotinate-nucleotide adenylyltransferase; TIGRFAM:
FT                   nicotinate (nicotinamide) nucleotide adenylyltransferase;
FT                   cytidyltransferase-related domain protein; PFAM:
FT                   Cytidylyltransferase; TIGRFAM: nicotinate (nicotinamide)
FT                   nucleotide adenylyltransferase; cytidyltransferase-related
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92086"
FT                   /db_xref="GOA:D5V5Q0"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5Q0"
FT                   /protein_id="ADG92086.1"
FT                   /translation="MQIAIFGGSFDPVHIAHETIVIEALNKLDLDLIILVPTFLNPQKI
FT                   TSHLSPNERLYLLSKNFKDHEKVIVSDYEINKNRPVYSIETIQYLKEHYKPDKTYFIIG
FT                   ADNYEKLNTWYKVDEILDEVELVVVTRNGFCNDIYDNILTLDVDIDISSTELRKNLDLS
FT                   FVPDKIKDDVKKFWH"
FT   gene            407069..408067
FT                   /locus_tag="Arnit_0422"
FT   CDS_pept        407069..408067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0422"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /EC_number="1.2.1.13"
FT                   /EC_number="1.2.1.12"
FT                   /note="COGs: COG0057 Glyceraldehyde-3-phosphate
FT                   dehydrogenase/erythrose-4-phosphate dehydrogenase;
FT                   InterProIPR020830:IPR006424:IPR020832:IPR020831:IPR
FT                   016040:IPR020828:IPR020829; KEGG: tdn:Suden_1754
FT                   glyceraldehyde-3-phosphate dehydrogenase; PFAM:
FT                   Glyceraldehyde 3-phosphate dehydrogenase, NAD(P) binding
FT                   domain; Glyceraldehyde 3-phosphate dehydrogenase, catalytic
FT                   domain; PRIAM: Glyceraldehyde-3-phosphate dehydrogenase
FT                   (phosphorylating); SPTR: B6BIF6 Glyceraldehyde-3-phosphate
FT                   dehydrogenase, type I; TIGRFAM: glyceraldehyde-3-phosphate
FT                   dehydrogenase, type I; PFAM: Glyceraldehyde 3-phosphate
FT                   dehydrogenase, C-terminal domain; Glyceraldehyde
FT                   3-phosphate dehydrogenase, NAD binding domain; TIGRFAM:
FT                   glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92087"
FT                   /db_xref="GOA:D5V5Q1"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5Q1"
FT                   /protein_id="ADG92087.1"
FT                   /translation="MAIKVAINGFGRIGRCVARIIEQRDDVELVAINDTASTEMLEYIT
FT                   KYDTVHGTFNGEVKVVNGFLKMGKINAKLYSTRDAKELTFTKECGADVVLECTGAYLTQ
FT                   ESCQVHIDNGAKKVVMSAPAKDNTPTFVLGVNEKEYKGQLIVSNASCTTNCLGPIAKII
FT                   DDAFGIEKGLMTTIHSYTNDQNILDVKHNKDKRRARAGAQNMIPTTTGAAKAMKLIMPQ
FT                   LDGKLHGQSVRVPTPNVSMVDVNFVVKKDTTKEELNTLFESKAKEFAGIVAVDNEMMVS
FT                   SDLVGNTNSTIIASDLTQVIGGNMIKVMSWYDNEWGYSSRLIDMAVYVAKN"
FT   gene            408076..409272
FT                   /locus_tag="Arnit_0423"
FT   CDS_pept        408076..409272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0423"
FT                   /product="Phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="COGs: COG0126 3-phosphoglycerate kinase; InterPro
FT                   IPR001576:IPR015824:IPR015901; KEGG: abu:Abu_2133
FT                   phosphoglycerate kinase; PFAM: phosphoglycerate kinase;
FT                   PRIAM: Phosphoglycerate kinase; SPTR: A8EWM4
FT                   Phosphoglycerate kinase; PFAM: Phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92088"
FT                   /db_xref="GOA:D5V5Q2"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5Q2"
FT                   /protein_id="ADG92088.1"
FT                   /translation="MKLQELKNIDISGKKIFIRCDFNVPMDEDNNITDDRRIRSALNTI
FT                   RYCIDHDCSVILASHFGRPKEPFDEKYSLKPIAKRLHTLLKQEIKMAKNIVQDDTLEIA
FT                   KNLEIGDILLLENLRFHEGETKNDEEFAKKLASMADVYVNDAFGVSHRAHASVEGITNY
FT                   FDMQHKAAGFLLAKEIKFFHHIVHNPKRPFVSIVGGSKVSGKLEALHNLVPKVDKILIG
FT                   GGMAFTFLKALGLEVGKSLVEEHLIPEAIKIMDEAKNLGVKLYLPVDVVAAEAFDAEAI
FT                   AKLVTVQEIPKNWFGLDIGPATAQLFKLALNDANTILWNGPMGVYEMDKFAKGSTRVSH
FT                   AVAQSFATTVVGGGDTADLVRITGDEDEMTFISTGGGASLELIEGKILPGVKALLLEE"
FT   gene            409275..409979
FT                   /locus_tag="Arnit_0424"
FT   CDS_pept        409275..409979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0424"
FT                   /product="triosephosphate isomerase"
FT                   /note="COGs: COG0149 Triosephosphate isomerase; InterPro
FT                   IPR020861:IPR000652:IPR013785; KEGG: abu:Abu_2134
FT                   triosephosphate isomerase; PFAM: triosephosphate isomerase;
FT                   SPTR: A8EWM5 Triosephosphate isomerase; TIGRFAM:
FT                   triosephosphate isomerase; PFAM: Triosephosphate isomerase;
FT                   TIGRFAM: triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92089"
FT                   /db_xref="GOA:D5V5Q3"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5Q3"
FT                   /protein_id="ADG92089.1"
FT                   /translation="MIIAANFKTNHTRASAKEYISFVNEYLTKEKDVEVIIFPTATALD
FT                   NYETNPNLTIGTQNAYSVNKGSFTGEIGTQQLDEFDIKTILIGHSERRHILGESQEEIA
FT                   KKYAFYKELGYKIVYCIGEPLEVKEQGLEQTLEYIYDQFVGIDTNYENLILAYEPVWAI
FT                   GTGVTATTEDIKSVHSVIKSKIDKPLLYGGSVKVENVAQICSLDGVDGALIGTASWVKE
FT                   DFVQILENIKGL"
FT   gene            409981..410808
FT                   /locus_tag="Arnit_0425"
FT   CDS_pept        409981..410808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0425"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /EC_number="1.3.1.9"
FT                   /note="COGs: COG0623 Enoyl-(acyl-carrier-protein); InterPro
FT                   IPR002347:IPR016040:IPR002198; KEGG: abu:Abu_2135
FT                   enoyl-(acyl carrier protein) reductase; PFAM: short-chain
FT                   dehydrogenase/reductase SDR; SPTR: A8EWM6 Enoyl-(Acyl
FT                   carrier protein) reductase; PFAM: short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92090"
FT                   /db_xref="GOA:D5V5Q4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5Q4"
FT                   /protein_id="ADG92090.1"
FT                   /translation="MIMNGKKGVILGVANNKSIAYGIAKACAAQGAKIAFTYLNDSLKK
FT                   RVEPIAAEFDSEDLVYPCDVSNPDEIKALKVSLEKDLGQIDFIVHSIAFAPKEGLSGRF
FT                   YDITKSAFDVAMDVSVYSLIEVTRELKPLMSENSSILTLTYYGGAKYIPNYNLMGIAKA
FT                   ALEMTTKYLAEDLGKDGIRVNAISAGPIKTLAAAGISDFRFMLKWNEAHSPLKKNVTTD
FT                   EVGNSGMYLLSDLSSAVTGEIHYVDCGFNVMGMPAVEFNEEGRPTIAWNGTDK"
FT   gene            411018..412226
FT                   /locus_tag="Arnit_0426"
FT   CDS_pept        411018..412226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0426"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /note="COGs: COG0019 Diaminopimelate decarboxylase;
FT                   InterPro IPR000183:IPR002986:IPR009006; KEGG: abu:Abu_2136
FT                   diaminopimelate decarboxylase; PFAM: Orn/DAP/Arg
FT                   decarboxylase 2; SPTR: A8EWM7 Diaminopimelate
FT                   decarboxylase; TIGRFAM: diaminopimelate decarboxylase;
FT                   PFAM: Pyridoxal-dependent decarboxylase, C-terminal sheet
FT                   domain; Pyridoxal-dependent decarboxylase, pyridoxal
FT                   binding domain; TIGRFAM: diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92091"
FT                   /db_xref="GOA:D5V5Q5"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5Q5"
FT                   /protein_id="ADG92091.1"
FT                   /translation="MNINFKELANKYKTPYYVYDFDHITSQYNELKDAFRARKSLVAYA
FT                   VKANSNLSVIKHLANLGAGADCVSIGEVRRALKVGIAPYKIIFSGVGKIDAEIREALSL
FT                   DILMINVESDAELNRVEMIAKELDKIARISIRVNPNIDPQTHPYISTGLHENKFGVDID
FT                   TAKRMYIQCKNSDNLDPVGIHLHIGSQLTQLDPIKESVKIVADLVRNLKAIKIELSFMD
FT                   IGGGLGIVYDNEKLIDTNEYAQSVLETMFGLDITVVCEPGRFMVGNAGIFITKVLYEKV
FT                   NGNKRFVIVDGAMNDLIRPALYNAQHKIEVIDKSSDISDCNLVGPICESGDFFAKNIEL
FT                   PKTEHNDLVAIYSAGAYCFTMASNYNTRGRVAEIAVENGKDRLIRKRETFEDIIALEEE
FT                   FIK"
FT   gene            412227..413006
FT                   /locus_tag="Arnit_0427"
FT   CDS_pept        412227..413006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0427"
FT                   /product="HAD-superfamily hydrolase, subfamily IIA"
FT                   /note="COGs: COG0647 sugar phosphatase of the HAD
FT                   superfamily; InterPro IPR006357; KEGG: nam:NAMH_1104
FT                   HAD-superfamily hydrolase, subfamily IIA; SPTR: C1ZYC3
FT                   Predicted sugar phosphatase of HAD superfamily; TIGRFAM:
FT                   HAD-superfamily hydrolase, subfamily IIA; TIGRFAM: Haloacid
FT                   Dehalogenase Superfamily Class (subfamily) IIA"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92092"
FT                   /db_xref="GOA:D5V5Q6"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5Q6"
FT                   /protein_id="ADG92092.1"
FT                   /translation="MNKAYFIDVQGTLIDDINKDPINGAIEFIDTLNEKNIPYVVITNN
FT                   TKFKSEDFKKFLNDKGFNIKNYIDPFYILNTVTKEKRVAAFGVDEFLKTMVDLGYVLDY
FT                   ENPKELIVSIKKDYTNEDYASMIEIALRVNSIIGMHDTSIYSKDGRRYPGVGAIMKMIK
FT                   FATNKDYKVVGKPSIGFFQSAKNIINVDFKDIMIVSDDMIGDLIGAQNLGMSSCLVLSG
FT                   KIKSEEEILSTLDEKDKPNFVCKDMGGVLNLLNKGEI"
FT   gene            413003..414070
FT                   /locus_tag="Arnit_0428"
FT   CDS_pept        413003..414070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0428"
FT                   /product="chorismate mutase"
FT                   /note="COGs: COG0077 Prephenate dehydratase;
FT                   InterProIPR002701:IPR001086:IPR010957:IPR008242:IPR
FT                   020822:IPR002912; KEGG: abu:Abu_2137 bifunctional
FT                   chorismate mutase/prephenate dehydratase; PFAM: prephenate
FT                   dehydratase; Chorismate mutase, type II; amino acid-binding
FT                   ACT domain protein; SPTR: A8EWM8 Bifunctional chorismate
FT                   mutase/prephenate dehydratase; TIGRFAM: chorismate mutase;
FT                   PFAM: Prephenate dehydratase; ACT domain; Chorismate mutase
FT                   type II; TIGRFAM: chorismate mutase domain of
FT                   proteobacterial P-protein, clade 2; monofunctional
FT                   chorismate mutase, gram positive-type, clade 2"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92093"
FT                   /db_xref="GOA:D5V5Q7"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR010957"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5Q7"
FT                   /protein_id="ADG92093.1"
FT                   /translation="MSEAGLLELRKKLDAIDDELLELINKRMDLVHEVGLLKAKSGGAI
FT                   YRPEREKAIIDRLDTLNKGKLNRAAIEAFFLEIFAISRNFELPENIAYLGPEGSFTHQA
FT                   AEARFGAMSSYISIGSIKGVFREVNTKKARFGVIPIENSSNGIVSDTINCLSTYDLKII
FT                   AEVVLNIHHTLATTCDKVKDIKKIYSKDIAFEQCRRFLENFGLDEVEHIPVESTTKAAK
FT                   LALNEPNSAAICSHVGAKLYNLPILFENIEDKDNNKTRFFIISDFENAQSGNDKTSILV
FT                   KLPNLQGVLVEFLTDFDKAKINLTKIKSHIVEGDSIFFIDFNGHKDDENVKEIFKKHKE
FT                   SIKFLGSYVKEIDDI"
FT   gene            414085..415191
FT                   /locus_tag="Arnit_0429"
FT   CDS_pept        414085..415191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0429"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /note="COGs: COG0079 Histidinol-phosphate/aromatic
FT                   aminotransferase and cobyric acid decarboxylase;
FT                   InterProIPR001917:IPR005861:IPR015424:IPR004839:IPR 015421;
FT                   KEGG: abu:Abu_2138 histidinol-phosphate aminotransferase;
FT                   PFAM: aminotransferase class I and II; SPTR: A8EWM9
FT                   Histidinol-phosphate aminotransferase; TIGRFAM:
FT                   histidinol-phosphate aminotransferase; PFAM:
FT                   Aminotransferase class I and II; TIGRFAM:
FT                   histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92094"
FT                   /db_xref="GOA:D5V5Q8"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5Q8"
FT                   /protein_id="ADG92094.1"
FT                   /translation="MKFNEVLENVTTYEAGKPIELVVREYGVNPKDVIKLASNENPYGT
FT                   SSKVTAKIQELAKNMFVYPDDSMYELKEALGKKFDVDSSNVIIGSGSDQIIEFCVHAKC
FT                   EKDSKLLMAKTTFAMYEIYGKQTGAKIIKTESHTHDLAQFLALYKEHGADVIFLCLPNN
FT                   PLGEAVDTKDVYEFLEQIDSETLVVVDGAYQEYAAYKDENKRIVPKDLITKFSNCIYLG
FT                   TFSKAYALGGMRVGYGIAQPEIIKTLYKLRAPFNITTLTLAAAIEALKDEEFVTACIAK
FT                   NFEEMTRYEEYAKSRGFEYIPSYTNFITIKMGDKFVSKEVAQKLLEVGIIVRDLTGYGQ
FT                   NAIRITIGTNEQNTKVFSVLDEVLEKLK"
FT   gene            415205..417007
FT                   /locus_tag="Arnit_0430"
FT   CDS_pept        415205..417007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0430"
FT                   /product="deoxyxylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /note="COGs: COG1154 Deoxyxylulose-5-phosphate synthase;
FT                   InterProIPR005474:IPR020826:IPR005477:IPR009014:IPR
FT                   005475:IPR005476:IPR015941; KEGG: abu:Abu_2139
FT                   1-deoxy-D-xylulose-5-phosphate synthase; PFAM:
FT                   Transketolase central region; Transketolase domain protein;
FT                   SPTR: A8EWN0 1-deoxy-D-xylulose-5-phosphate synthase;
FT                   TIGRFAM: deoxyxylulose-5-phosphate synthase; PFAM:
FT                   Dehydrogenase E1 component; Transketolase, thiamine
FT                   diphosphate binding domain; Transketolase, C-terminal
FT                   domain; Transketolase, pyrimidine binding domain; TIGRFAM:
FT                   1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92095"
FT                   /db_xref="GOA:D5V5Q9"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5Q9"
FT                   /protein_id="ADG92095.1"
FT                   /translation="MKIKNKSPKELEEISQKIRDRIIDVVSRKGGHFSSTLGAVELTVG
FT                   MHYVFDSSKDPFIFDVSHQCYPHKLITGRWEEFETIRQFNGLSGFTKPKESDADYFVAG
FT                   HSSTSLSLAVGAAKAIKLKKEDRVPVVMIGDGSMTAGMVYEALNEIGDLKLPMVIILND
FT                   NEMSIAKPIGAISKYLSKLLAGKYYQGFKTKVDKFIKNNMPEGTTYIAKRMEEAMKLIT
FT                   PGILFEEMGVDYIGPIDGHDIKEVIETLEIAKAMKKPVIVHAHTVKGKGYKIAEGQHEC
FT                   WHGVGPFNVEDGAFVKKEAPKSATAVFADALLDLASKHENVVGVTAAMPSGTGIDKLMK
FT                   EFPERFWDVAIAEQHAITSMAAMAKEGFKPFITIYSTFLQRGFDQIIHDVCLMSMPVVF
FT                   AIDRAGIVGNDGETHQGAFDISFLRFIPNMILFAPRCNETLKLALEFAYTLKSPSAIRY
FT                   PRGAFKEVCAPASPFELGKAELLKEGTSNKLFIAYGAGVGRACETEKLHSEDIAILDLR
FT                   FVKPLDKDTLKELAKKYDDWYIFSDSQKQGGVGSAILEFLNEEKVCVNLTSFEYEDDFI
FT                   PHGDTKVVEESLGLLPAQLADRVK"
FT   gene            417199..417357
FT                   /locus_tag="Arnit_0431"
FT   CDS_pept        417199..417357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0431"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: C1I4U2 Glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92096"
FT                   /db_xref="GOA:D5V5R0"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5R0"
FT                   /protein_id="ADG92096.1"
FT                   /translation="MKILFNSIIIILGFIILFNEIFIPDNLFYSYKLLGIPFIGFGFIN
FT                   LKKELKD"
FT   gene            complement(417598..418146)
FT                   /locus_tag="Arnit_0432"
FT   CDS_pept        complement(417598..418146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0432"
FT                   /product="Maf family protein"
FT                   /note="COGs: COG0424 Nucleotide-binding protein implicated
FT                   in inhibition of septum formation; InterPro IPR003697;
FT                   KEGG: abu:Abu_2141 Maf-like protein; PFAM: Maf family
FT                   protein; SPTR: A8EWN2 Septum formation protein Maf homolog;
FT                   PFAM: Maf-like protein; TIGRFAM: MAF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92097"
FT                   /db_xref="GOA:D5V5R1"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5R1"
FT                   /protein_id="ADG92097.1"
FT                   /translation="MIRLGSKSPTRAKILKAHNIEFIQSGGEFDEDTITTQNPKSFAYQ
FT                   ATLGKFDELYKKYGIEEYPLLVSDSVVTANNLLLRKAKDKNDAKRMLELQSGNQTSVIS
FT                   CMKYKSKTLELIDISITTYIFEKFDEKDMQNYLDSNEWMGKAGAIMVEGFCKPYIKEVI
FT                   GYESTAMGLCVEKLKVFLD"
FT   gene            418186..419358
FT                   /locus_tag="Arnit_0433"
FT   CDS_pept        418186..419358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0433"
FT                   /product="drug resistance transporter, Bcr/CflA subfamily"
FT                   /note="COGs: COG2814 Arabinose efflux permease; InterPro
FT                   IPR005829:IPR004812:IPR016196:IPR011701; KEGG: abu:Abu_2157
FT                   major facilitator superfamily transporter; PFAM: major
FT                   facilitator superfamily MFS_1; SPTR: C1ZYY1 Drug resistance
FT                   transporter, Bcr/CflA subfamily; TIGRFAM: drug resistance
FT                   transporter, Bcr/CflA subfamily; PFAM: Major Facilitator
FT                   Superfamily; TIGRFAM: drug resistance transporter, Bcr/CflA
FT                   subfamily; Multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92098"
FT                   /db_xref="GOA:D5V5R2"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5R2"
FT                   /protein_id="ADG92098.1"
FT                   /translation="MKQNIKYNLPKGFVFILAMLGSITPLAIDVYLPAFKNIANYFYTS
FT                   IDEVEITLSVYLLGFSLGQLIGGPLSDRYGRKIFIFTGLCIYITFSLLISQASSIHELW
FT                   TFRFFQAIGGGFAVVNTNAIIRDIYHGKESARVFSIISMIMMVAPMIAPIIGTTILSFY
FT                   SWKYIFIFLAIYTFCIIYFITKLPETSPKTKNKNIFKSYGRIFLNKKAILLILAGGFGF
FT                   SGMFVYITKSSFIYMDYFGVDAKYFTFLFGLNVFTLIIFSRLNMHFLKKYATFTLLRFG
FT                   VSLQLLSAIGLYTFNEHNTIISVAIFIMIYVGALGFIFANAIALVLEDFGDISATTNSL
FT                   YGVIGFIIASFVGFLASYFHDDTLSPIFILMATTSTLSFLILLYIKKFKV"
FT   sig_peptide     418186..418266
FT                   /locus_tag="Arnit_0433"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            419362..420255
FT                   /locus_tag="Arnit_0434"
FT   CDS_pept        419362..420255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0434"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="InterPro IPR000620; KEGG: ppd:Ppro_1999 hypothetical
FT                   protein; PFAM: protein of unknown function DUF6
FT                   transmembrane; SPTR: A1AQI7 Putative uncharacterized
FT                   protein; PFAM: EamA-like transporter family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92099"
FT                   /db_xref="GOA:D5V5R3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5R3"
FT                   /protein_id="ADG92099.1"
FT                   /translation="MRYYIYLVLAVLFWSGNVVVGRYVSTDISPMELSFFRWFFVVLIL
FT                   SPYTIKNRKRLISIFKQNPLLYLLCGTLGISAYNTFIYLGVEHLTATNTLLINSSIPIF
FT                   IIILSSILINTKITKLQGFGIFLSTIGVIYLLLKGEYEALMKLEFTRYDLWIILACITW
FT                   AIYSIYLKFKPKDIKPLEFLSIITFIGVVILFLVCVIFGFKFEYGFLHDDKLLFTLMYV
FT                   SIFPSVLSFYFWNSATYEVGATKAGQFIHLMPVFGFILAYIFLNESLHPYHIVGIAFIA
FT                   TGIYLSIFFKRVPVVK"
FT   gene            420245..421519
FT                   /locus_tag="Arnit_0435"
FT   CDS_pept        420245..421519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0435"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: abu:Abu_2143 hypothetical protein; SPTR:
FT                   A8EWN4 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92100"
FT                   /db_xref="GOA:D5V5R4"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5R4"
FT                   /protein_id="ADG92100.1"
FT                   /translation="MLNSISGVLIFLSFLFTNIAYFIDSNLLIYASCFAWIAFLLLFIT
FT                   LGKKKIIVTLLVLSLLCFLFSYIKGFDINIIKALSINQYLLTLLIGVTFLKLIATPKFE
FT                   KKAKVESGKSSFFKTYLGVHLFGSVINLSSLILIADKMYKKGPLSKLQLVVLTRAFSSD
FT                   AYWSPFFVAFAAALTYLPNFDKSTIFFTGIILALIALIVTYLEVGKKFELESFQGYPIS
FT                   LETLYIPVLLVIFILITKYYEENLKVIILVSIYSLLLTIFISLIKVNFTKTLHLFKQHI
FT                   TSDLPKMKMEISLFLVAGLFGVSVSTILNGYHVSVPFTQFTYIEAAITLFTFIILSFIG
FT                   IHPIITIAVIASFLLQFNHTLLAVTFLMAWAITVSSSPFSGLNLTIQARYNVEAKEVFL
FT                   LNLPFVIKMYIVCVIALYILDKFIL"
FT   gene            421592..422521
FT                   /locus_tag="Arnit_0436"
FT   CDS_pept        421592..422521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0436"
FT                   /product="Auxin Efflux Carrier"
FT                   /note="COGs: COG0679 permease; InterPro
FT                   IPR000215:IPR004776; KEGG: cps:CPS_0767 auxin efflux
FT                   carrier family protein; PFAM: Auxin Efflux Carrier; SPTR:
FT                   Q488J8 Auxin efflux carrier family protein; PFAM: Membrane
FT                   transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92101"
FT                   /db_xref="GOA:D5V5R5"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5R5"
FT                   /protein_id="ADG92101.1"
FT                   /translation="MSLFFLILLKVFPIYINVILGYLATKYLHVKRESIAALLIYILGP
FT                   IVVFSATLSVKINFAVAFLPIFLYIFCSVLAFGSLYLFKNSWSDPTGNILAFSAGTGNT
FT                   GYFGIPLAIIFFPPALADIYIFTVLTSLLYESTTGFYVTAKGNFTVSQALKKMSKLPIL
FT                   YAFILGIILNLVGFEIPQAISSYTAQFKGAYGILGMMMLGMGLIGLKNSDDNFDVKFIS
FT                   IAFFMKFIFWPLSIVGFIYLDKTFFMFLNEDLYKVLFLFAIVPLAGNTVTLAVLLNAKP
FT                   EKASLAVFLSTVVSVIAIPLYIFWYGGF"
FT   gene            complement(422518..423018)
FT                   /locus_tag="Arnit_0437"
FT   CDS_pept        complement(422518..423018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0437"
FT                   /product="NLP/P60 protein"
FT                   /note="COGs: COG0791 Cell wall-associated hydrolase
FT                   (invasion-associated protein); InterPro IPR000064; KEGG:
FT                   vsa:VSAL_I1387 putative lipoprotein; PFAM: NLP/P60 protein;
FT                   SPTR: B6EKI6 Putative lipoprotein; PFAM: NlpC/P60 family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92102"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5R6"
FT                   /protein_id="ADG92102.1"
FT                   /translation="MRTIIFSIFLLFFITACSTKNPYTPTKPLSAYKTNTTYNHINVSD
FT                   ALLAHYRQWQGVGYKYGGQDRSGIDCSYLVYDVYRKELRKNIPRTTYYQSISGKSVKKK
FT                   DLKTGDLVFFLTNKKGSRHVGIYLSHGDFMHVSTSNGVMISSLSNPYWRAHYWKARRIL
FT                   NTN"
FT   sig_peptide     complement(422962..423018)
FT                   /locus_tag="Arnit_0437"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(423076..423555)
FT                   /locus_tag="Arnit_0438"
FT   CDS_pept        complement(423076..423555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0438"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sun:SUN_0347 hypothetical protein; SPTR:
FT                   A6Q748 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92103"
FT                   /db_xref="GOA:D5V5R7"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5R7"
FT                   /protein_id="ADG92103.1"
FT                   /translation="MKELFLAMPNMIIFLHVVSAVLWVGGMIAIRFAIHYSMQNIEDPK
FT                   IKLGRTLENLQRFFNMVIPAILILLLTAIMMILGLELKATPLYSFAIAKEIIWTVMTLI
FT                   FIYIYIKRIKAQKYFDKGELPLAKATLEPIAKIFIPTNIILGLIAIFIGVTLRGF"
FT   gene            complement(423565..426117)
FT                   /locus_tag="Arnit_0439"
FT   CDS_pept        complement(423565..426117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0439"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /note="COGs: COG0013 Alanyl-tRNA synthetase;
FT                   InterProIPR018165:IPR002318:IPR018164:IPR018162:IPR
FT                   018163:IPR012947:IPR003156; KEGG: abu:Abu_2092 alanyl-tRNA
FT                   synthetase; PFAM: Alanyl-tRNA synthetase, class IIc-like;
FT                   Threonyl/alanyl tRNA synthetase SAD; phosphoesterase DHHA1;
FT                   PRIAM: Alanine--tRNA ligase; SPTR: A8EWI6 Alanyl-tRNA
FT                   synthetase; TIGRFAM: alanyl-tRNA synthetase; PFAM: DHHA1
FT                   domain; Threonyl and Alanyl tRNA synthetase second
FT                   additional domain; tRNA synthetases class II (A); TIGRFAM:
FT                   alanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92104"
FT                   /db_xref="GOA:D5V5R8"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5R8"
FT                   /protein_id="ADG92104.1"
FT                   /translation="MDIRKEYLDFFKNKGHEVISSMPLVPDDPTLLFTNAGMVQFKDIF
FT                   TGAIPAPKNPTATSCQLCIRAGGKHNDLENVGYTARHHTLFEMLGNFSFGDYFKEDAIA
FT                   YAWEFITVNLALPIDKLWVTIHESDDEAFNIWKKYIEPSRIKRFGDKDNFWAMGDTGPC
FT                   GPCSEIFYDQGVENFGSDEDYLGGEGDRFLEIWNLVFMQYEQSNGVRTPLPKPSIDTGM
FT                   GLERVIAIKEGVLNNFDSSNFKPLVNEVAKLAKKQPTKETIGSYRVIADHLRAVSFMLS
FT                   QGILFGNEGRPYVNRRILRRAVRHGYLLGFREAFMSKLVDVLIKIMGEHYTDLKEQASF
FT                   IKEQIMLEEERFFKTIASGMTLFNEELINTKKLFSGEVAFKLYDTYGFPLDLTEDMLRE
FT                   KDLKVDIETFDKLMNAQKAKAKAAWKGSGDEASEGDFKVLLEKYGVNEFVGYENTSYKS
FT                   TIVTLLDEKFNEVDSLEKGQTGWIMLDKTPFYATSGGQSGDIGALEDKQHIAIIEETSK
FT                   FHGINLSKIKVETSSLEKGEVVNAVVVNRYEIAKHHSATHLLQSALKMVLGDTVSQAGS
FT                   LNNSSRLRFDFTYPKAMTNEQIEEVQDLVNSMITRGLKGSVEELPIEEAKQRGAIAMFG
FT                   EKYGDMVRVVNFGDVSVEFCGGTHVRNTLDIGSFYILKESGVSAGVRRIEAVCGSAAIK
FT                   YTNSIISKMNEIESEIKNVDVISGIKKLKEQIKTLKQEVIEAQSASTTPIAEEMIGDTK
FT                   VIVDIVKNGDIKKIVDDAKNGNEKVAILLIQAKDDKVMLVAGSKNTNIKAGNWIKEIAP
FT                   IVGGGGGGRPDFAQAGGKDVSKVDEAKAKALTYAKENL"
FT   gene            426256..426573
FT                   /locus_tag="Arnit_0440"
FT   CDS_pept        426256..426573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0440"
FT                   /product="thioredoxin"
FT                   /note="COGs: COG3118 Thioredoxin domain-containing protein;
FT                   InterProIPR017936:IPR017937:IPR005746:IPR006662:IPR
FT                   012336:IPR013766:IPR012335; KEGG: abu:Abu_2091 thioredoxin;
FT                   PFAM: Thioredoxin domain; SPTR: A8EWI5 Thioredoxin;
FT                   TIGRFAM: thioredoxin; PFAM: Thioredoxin; TIGRFAM:
FT                   thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92105"
FT                   /db_xref="GOA:D5V5R9"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5R9"
FT                   /protein_id="ADG92105.1"
FT                   /translation="MGKYKELTQDNFEATVKEGISMVDFWAPWCGPCRMLAPVIDELAG
FT                   DFEGKANICKVNTDEEQDLAVKFGVRSIPTVIFLKDGEVVDQMIGAASKQAFSDKINSL
FT                   L"
FT   gene            426773..427702
FT                   /locus_tag="Arnit_0441"
FT   CDS_pept        426773..427702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0441"
FT                   /product="thioredoxin reductase"
FT                   /note="COGs: COG0492 Thioredoxin reductase;
FT                   InterProIPR008255:IPR005982:IPR000103:IPR013027:IPR 016040;
FT                   KEGG: abu:Abu_2090 thioredoxin reductase; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; SPTR: A8EWI4 Thioredoxin reductase;
FT                   TIGRFAM: thioredoxin reductase; PFAM: Pyridine
FT                   nucleotide-disulphide oxidoreductase; TIGRFAM:
FT                   thioredoxin-disulfide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92106"
FT                   /db_xref="GOA:D5V5S0"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5S0"
FT                   /protein_id="ADG92106.1"
FT                   /translation="MLDLAIIGGGPAGLTAGLYATRGGLKNVTMFEMGMPGGQITGSSE
FT                   IENYPGQVEIVSGMDLMESWPKQAMRFGLKHEMNQVSKVTKSGDVFTVELSDGTKQEAR
FT                   SVLLATGSVPKKGGFKGEKELFGRGVSTCATCDGFFYKNKEVAVIGGGDSALEEAVYLA
FT                   KMCSKVYLVHRRDTYRAAPSTIEHMKACENIEEVTNVIVEEVYGDASGVLGLKVKSKET
FT                   GEIRDLEVPGVFTFVGRDVLSDSLKQDDGSYLCEVNEATEVVVDLKMRTNVPGLYAAGD
FT                   VRIDAAKQVVCAAADGATAAVNIIEYLG"
FT   gene            427859..429265
FT                   /locus_tag="Arnit_0442"
FT   CDS_pept        427859..429265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0442"
FT                   /product="anion transporter"
FT                   /note="COGs: COG0471 Di- and tricarboxylate transporter;
FT                   InterPro IPR001898; KEGG: dsa:Desal_0910 anion transporter;
FT                   PFAM: sodium/sulphate symporter; SPTR: C6BZR8 Anion
FT                   transporter; TIGRFAM: anion transporter; PFAM:
FT                   Sodium:sulfate symporter transmembrane region; TIGRFAM:
FT                   anion transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92107"
FT                   /db_xref="GOA:D5V5S1"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR030676"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5S1"
FT                   /protein_id="ADG92107.1"
FT                   /translation="MSNNMKMVLPILVAIIVALLPTPEGLAVNAQYFFAVFLGVIVGLI
FT                   LEPIPPALIGLVGVAFSATFGLVGDSAKASAKWALSGFSNGVIWLIFAAFMFALGYKKS
FT                   GLGKRIALILVKKLGKTTLGLGYAVAFADGILAPFMPSNTARSAGTIFPIAINIPQMFD
FT                   SLPDHEPRKIGSYISWVAIAATCVTSSMFLTALAPNLLAVSLVEKNIGVSISWGSWFGT
FT                   LAVIMIPLFLLVPYLAYIVYPPEQKVSPEAPTWAAKQLKEMGSITKKEITMLFLGLLAL
FT                   AMWIFGSTIGVNSTVAAIAVLCLLVLFDVINWEDVITNKAAINVFIWFATLVAMASGLK
FT                   EVGYLKWASGLISSWLVGMDPIMIGVVLLVLFFLFHYLFASVTAHTVALLPLFLGIAAN
FT                   LVPAAMLQPLAILFVGSLGLMGIITPYGTGPSPIWYGAGYISQATWWKLGFIFGAIYLG
FT                   ALVALGFVIL"
FT   sig_peptide     427859..427939
FT                   /locus_tag="Arnit_0442"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            429283..431502
FT                   /locus_tag="Arnit_0443"
FT   CDS_pept        429283..431502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0443"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="COGs: COG4191 Signal transduction histidine kinase
FT                   regulating C4-dicarboxylate transport system;
FT                   InterProIPR005467:IPR000014:IPR004358:IPR003594:IPR 013767;
FT                   KEGG: wsu:WS0658 two component sensor kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; PAS fold domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   PAS domain containing protein; SPTR: Q7M9U6 Sensor protein;
FT                   TIGRFAM: PAS sensor protein; PFAM: ABC transporter
FT                   substrate binding protein; Histidine kinase-, DNA gyrase
FT                   B-, and HSP90-like ATPase; PAS fold; TIGRFAM: PAS domain
FT                   S-box"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92108"
FT                   /db_xref="GOA:D5V5S2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5S2"
FT                   /protein_id="ADG92108.1"
FT                   /translation="MVSTLAPFFIKYDYNSLMKKLLIFLILQTFLFANSSILIINSYHK
FT                   GYEFSDSIINGIEKVIYPHSNIDVNILYMDSKRVTSKEYYDSLEKLYRVQLKNRKYDLI
FT                   IAIDRFAYDFVLDIYKEFFKNEPILAVGIENFSFKKAKYYGVEDKVSALLEKRDLEGNV
FT                   DIIRTIFPSIRKLYIINDKSLNAQHTEPLIEKLINDFKGKFDIEYIIEDNLEILKKKFS
FT                   KKEENSAALFIRFYKNKDGKLYKNQEIADFIKNAQIPIFVTDSIFIKKGATGGKVIDLK
FT                   DFGKLSGNMALDILNKKAHKVVTYKNLTYIFDSQKLSQFYLPVDGLSIPYKLINKRLTY
FT                   YEKHRGFINFVFTISPLLLFLILGLIHNIYMRKQVEKDLRRRIEFDETLLNAIESPIFW
FT                   QDSKGIVVDSNKTFCKLLGMKCDDLYGKKLEDFIENRNVEKIIKVIENYNLDSEENNEF
FT                   NFVNSNKKKKIYLLKQERFKDEKTKSEGYVTIFTDITKEREITIEKQKNRQFVIQQSKL
FT                   AEIGEVFSSIAHQWKSPLVEITAIAQELFYTKKCEEVKEDDSFVKDIMNQVSYMTNTIN
FT                   EFQRFIMPSNKKIDFNIKEAIERMLEIINHNIKYNSININLDIKDDTNLIVYGYKNEFM
FT                   QSFLNIVNNAKDALLHNDYKNRKIEIKVFNEDNQLIITIKDNAGGINDKSMDKIFGAYY
FT                   TTKEDGHGIGLYMTKVIIEDKMNGKISVENIDGGAMFTIKLEQNQ"
FT   gene            431499..432155
FT                   /locus_tag="Arnit_0444"
FT   CDS_pept        431499..432155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0444"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="COGs: COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain; InterPro IPR001789:IPR011006:IPR001867; KEGG:
FT                   wsu:WS0657 two component response regulator; PFAM: response
FT                   regulator receiver; transcriptional regulator domain
FT                   protein; SMART: response regulator receiver; SPTR: C2A0S1
FT                   Response regulator with CheY-like receiver domain and
FT                   winged-helix DNA-binding domain; PFAM: Response regulator
FT                   receiver domain; Transcriptional regulatory protein, C
FT                   terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92109"
FT                   /db_xref="GOA:D5V5S3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5S3"
FT                   /protein_id="ADG92109.1"
FT                   /translation="MKILVLEDNERLSNVIKQALVNENYKVDCFYDGEKASEALGNGYS
FT                   CFILDINVPNLDGISILEYIRFNHAKTPVIIISSNHDLEKVQTSYEKGCDDYLKKPFYI
FT                   LELVQKVKKLCVVPKQYLQFDENCKYDFINHKLYKDNEEIELTKKEILFLELFSNNLHH
FT                   VATYDELEEYVWEGEETTLVNIRSMIKRLRKKLPEDGIIIVKGLGYSLNKDVKIY"
FT   gene            complement(432270..433760)
FT                   /locus_tag="Arnit_0445"
FT   CDS_pept        complement(432270..433760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0445"
FT                   /product="hydro-lyase, Fe-S type, tartrate/fumarate
FT                   subfamily, alpha subunit"
FT                   /note="COGs: COG1951 Tartrate dehydratase alpha
FT                   subunit/Fumarate hydratase class I N-terminal domain;
FT                   InterPro IPR004646:IPR004647:IPR011167; KEGG: abu:Abu_1928
FT                   fumarate hydratase, class I; PFAM: Fe-S type hydro-lyase
FT                   tartrate/fumarate alpha region; Fe-S type hydro-lyase
FT                   tartrate/fumarate beta region; SPTR: A8EW27 Fumarate
FT                   hydratase, class I; TIGRFAM: hydro-lyase, Fe-S type,
FT                   tartrate/fumarate subfamily, alpha subunit; hydro-lyase,
FT                   Fe-S type, tartrate/fumarate subfamily, beta subunit; PFAM:
FT                   Fumarase C-terminus; Fumarate hydratase (Fumerase);
FT                   TIGRFAM: hydro-lyases, Fe-S type, tartrate/fumarate
FT                   subfamily, beta region; hydro-lyases, Fe-S type,
FT                   tartrate/fumarate subfamily, alpha region"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92110"
FT                   /db_xref="GOA:D5V5S4"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR011167"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5S4"
FT                   /protein_id="ADG92110.1"
FT                   /translation="MKKITEEDIIESIADACQYISFYHPEDFVKGMVEAYNVEKGEAAK
FT                   NAIGQILINSKMCAMGHRPLCQDTGSVNIFVKVGLNAPLDIKKELVDLLNEGVAKGYTD
FT                   PDNTLRYSVVADPAGKRVNTKNNTPAVIHVSVDNSDEIDITVAAKGGGSENKSKFAVLN
FT                   PSDSIYDWVMENVRNMGAGWCPPGILGIGIGGNPEKSMLLAKESLMSHVDIHELKARGP
FT                   KNALEELRLKLYEDINKVGIGAQGLGGITTVLDVKILDYPCHAASLPVAMIPNCAATRH
FT                   IHFKLKGDGPAVFNKPDLDLWPDIELPMDTIKRVNIEDLTKENLSQFKSGDTLLLSGKI
FT                   LTARDAAHKKIVEYKNAGKDLPNGVKLEDRFIYYVGPVDPVRDEAVGPAGPTTSTRMDK
FT                   FTKDMMEIGIMGMIGKAERKQPTIDLIKEYKSMYLIATGGAAYLISQSIKSAKVLAFEE
FT                   LGMEAIYEFEVKDMPVTVAVDTEGVSIHTTGPAKWRTI"
FT   gene            complement(433771..434496)
FT                   /locus_tag="Arnit_0446"
FT   CDS_pept        complement(433771..434496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0446"
FT                   /product="succinate dehydrogenase and fumarate reductase
FT                   iron-sulfur protein"
FT                   /note="COGs: COG0479 Succinate dehydrogenase/fumarate
FT                   reductase Fe-S protein subunit;
FT                   InterProIPR001041:IPR017896:IPR006058:IPR017900:IPR
FT                   004489:IPR009051:IPR012675:IPR012285; KEGG: hhe:HH0687
FT                   fumarate reductase iron-sulfur subunit; PFAM: ferredoxin;
FT                   SPTR: Q7VIC0 Fumarate reductase; TIGRFAM: succinate
FT                   dehydrogenase and fumarate reductase iron-sulfur protein;
FT                   PFAM: 2Fe-2S iron-sulfur cluster binding domain; TIGRFAM:
FT                   succinate dehydrogenase and fumarate reductase iron-sulfur
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92111"
FT                   /db_xref="GOA:D5V5S5"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5S5"
FT                   /protein_id="ADG92111.1"
FT                   /translation="MSRELTFKILRYDPQDKENVRAYFEEFKIQEAPSMTIYIALTQIR
FT                   ESQDAGLSFDFVCRAGICGSCAMMINGRPKLACRTLTRDLPKEIILLPLPTFNLIKDLS
FT                   VNTGVWMDEMSKRVESWVHSSHEVDIANIEMPIEPEVADAVFELDRCIECGCCVAGCGT
FT                   KLIKEDFVGAVGLNRIARFECDPHDERTIEDYYELVGDDNGIFGCMTLLGCEDTCPKHL
FT                   PLQTKIAYMRRKLATVKGS"
FT   gene            complement(434496..436478)
FT                   /locus_tag="Arnit_0447"
FT   CDS_pept        complement(434496..436478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0447"
FT                   /product="succinate dehydrogenase or fumarate reductase,
FT                   flavoprotein subunit"
FT                   /note="COGs: COG1053 Succinate dehydrogenase/fumarate
FT                   reductase flavoprotein subunit;
FT                   InterProIPR003952:IPR014006:IPR015939:IPR003953:IPR 004112;
FT                   KEGG: cff:CFF8240_0415 fumarate reductase flavoprotein
FT                   subunit; PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; PRIAM: Succinate
FT                   dehydrogenase; SPTR: A0RN34 Fumarate reductase flavoprotein
FT                   subunit; TIGRFAM: succinate dehydrogenase or fumarate
FT                   reductase, flavoprotein subunit; PFAM: domain; FAD binding
FT                   domain; TIGRFAM: succinate dehydrogenase or fumarate
FT                   reductase, flavoprotein subunitGram-negative/mitochondrial
FT                   subgroup"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92112"
FT                   /db_xref="GOA:D5V5S6"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5S6"
FT                   /protein_id="ADG92112.1"
FT                   /translation="MKIKYCDALVIGGGLAGLRSAVAAAQKGLSTTVLSLVPVKRSHSA
FT                   AAQGGMQASLGNAKMSEGDNEDVHFSDTVKGSDWGCDQEVARMFVTTAPKAIRELAAWG
FT                   VPWSRIKKGNHEAVINTKKTNIFEEDDKHGLINSRDFGGTKKWRTCYTSDATGHTMLFA
FT                   VANESLKLNVNIEDRKEAIGLIHHNNKCYGAIVRDLITGDIVAYVSKGTLIATGGYGRI
FT                   YEITTNAVICEGIGTAIALETGIAKLGNMEAVQFHPTPLFPSGILLTEGCRGDGGVLRD
FT                   VDGHRFMPDYEPEKKDLASRDVVSRRMMEHMRKGKGIDSVYGTHLWLDISILGREHIEK
FT                   NLRDVQEICESFAGIDPADEGQKGWAPVHPMQHYSMGGIRTKPTGESQTLQGLFSCGEA
FT                   ACWDMHGFNRLGGNSVSETVVAGMIVGNYFADYCINTQIDIQTDVIEKFVHEKEAYMKN
FT                   LVSKNSGDDVFKIKNRMKKIMQDYVGIFRDGEGLEKAVKELEELYIKSKNVAVRNKQLT
FT                   ANPELEEAYRVPMMLKVALCVAKGALDRTESRGAHTREDYPKRDDANWLKRTLTSWKEG
FT                   DTMPTVEYEPLDIMKMEIPPGFRGYGAKGNLIENPISAIRQNEVDEMVEKMELEGKDRY
FT                   EIQDKLMPFPLQDEYKRKNIRLGDL"
FT   sig_peptide     complement(436410..436478)
FT                   /locus_tag="Arnit_0447"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(436489..437256)
FT                   /locus_tag="Arnit_0448"
FT   CDS_pept        complement(436489..437256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0448"
FT                   /product="Fumarate reductase respiratory complex"
FT                   /note="InterPro IPR004224:IPR018956; KEGG: wsu:WS0832
FT                   fumarate reductase cytochrome b-556 subunit; PFAM: Fumarate
FT                   reductase respiratory complex; SPTR: P17413 Fumarate
FT                   reductase cytochrome b subunit; PFAM: Succinate
FT                   dehydrogenase/Fumarate reductase transmembrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92113"
FT                   /db_xref="GOA:D5V5S7"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR004224"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5S7"
FT                   /protein_id="ADG92113.1"
FT                   /translation="MNEVIEAYTGQNPDGNKSRMPAKLDKALTASGVVLAIFMMAHMFF
FT                   VSTILFGENAMYTITKMFELDFIFDGGLPIIVSIFVGIITVIFVVHALLGIRKFPTSYK
FT                   AYIKIREHSKMMKHSDTSLWMFQWISGLIMMFIATIHLYIMFTQPENIGPYSSAYRVVN
FT                   QNMWLLYMVLLICVELHGSIGLYRAAMKWGWFDGKNPKETRKTMMKAKKILSIFFLTLG
FT                   VVTLFAYIKIGMDRIDHAPMKYNPNDSIQLMKK"
FT   gene            437557..438486
FT                   /locus_tag="Arnit_0449"
FT   CDS_pept        437557..438486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0449"
FT                   /product="thioredoxin reductase"
FT                   /note="COGs: COG0492 Thioredoxin reductase;
FT                   InterProIPR008255:IPR005982:IPR000103:IPR013027:IPR 016040;
FT                   KEGG: abu:Abu_2090 thioredoxin reductase; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; SPTR: A8EWI4 Thioredoxin reductase;
FT                   TIGRFAM: thioredoxin reductase; PFAM: Pyridine
FT                   nucleotide-disulphide oxidoreductase; TIGRFAM:
FT                   thioredoxin-disulfide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92114"
FT                   /db_xref="GOA:D5V5S8"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5S8"
FT                   /protein_id="ADG92114.1"
FT                   /translation="MLDLAIIGGGPAGLTAGLYATRGGLKNVTMFEMGMPGGQITGSSE
FT                   IENYPGQVEIVSGMDLMESWPKQAMRFGLKHEMNQVSKVTKSGDVFTVELSDGTKQEAK
FT                   SVLLATGSVPKKGGFKGEKELFGRGVSTCATCDGFFYKNKEVAVIGGGDSALEEAVYLA
FT                   KMCSKVYLVHRRDTYRAAPSTIEHMKACENIEEVTNVIVEEVYGDASGVLGLKVKSKET
FT                   GEIRDLEVPGVFTFVGRDVLSDSLKQDDGSYLCEVNEATEVVVDLKMRTNVPGLYAAGD
FT                   VRIDAAKQVVCAAADGATAAVNIIEFLG"
FT   gene            438493..439266
FT                   /locus_tag="Arnit_0450"
FT   CDS_pept        438493..439266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0450"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="COGs: COG0289 Dihydrodipicolinate reductase;
FT                   InterPro IPR000846:IPR011770:IPR016040; KEGG: abu:Abu_2089
FT                   dihydrodipicolinate reductase; PFAM: dihydrodipicolinate
FT                   reductase; PRIAM: Dihydrodipicolinate reductase; SPTR:
FT                   A8EWI3 Dihydrodipicolinate reductase; TIGRFAM:
FT                   dihydrodipicolinate reductase; PFAM: Dihydrodipicolinate
FT                   reductase, N-terminus; Dihydrodipicolinate reductase,
FT                   C-terminus; TIGRFAM: dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92115"
FT                   /db_xref="GOA:D5V5S9"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5S9"
FT                   /protein_id="ADG92115.1"
FT                   /translation="MINVGILGSTGRVGSLLIDDLQNDEQVKLSACHVSNKLNKTVPQG
FT                   TVVTNDINTLLESSDVVIDFSVPAATELLLTEVIEGKNKKPLVIATTGFSKHQQNLLIE
FT                   ASKLVPILYATNMSLGVAVLNKLVSLASKTLKDFDIEIVEQHHRNKVDSPSGTALTLAE
FT                   HAASARDLNLDDVRVSGRDGIIGARSKDEIAVMSLRGGDIVGRHTVGLYNEGEFIELNH
FT                   TATSRNTFSKGAIKAAKWLVNKEAGLYSINDCLGL"
FT   gene            439276..440625
FT                   /locus_tag="Arnit_0451"
FT   CDS_pept        439276..440625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0451"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="COGs: COG0034 Glutamine phosphoribosylpyrophosphate
FT                   amidotransferase; InterPro
FT                   IPR017932:IPR005854:IPR000583:IPR000836; KEGG: abu:Abu_2088
FT                   amidophosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase; glutamine amidotransferase
FT                   class-II; SPTR: A8EWI2 Amidophosphoribosyltransferase;
FT                   TIGRFAM: amidophosphoribosyltransferase; PFAM:
FT                   Phosphoribosyl transferase domain; Glutamine
FT                   amidotransferases class-II; TIGRFAM:
FT                   amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92116"
FT                   /db_xref="GOA:D5V5T0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5T0"
FT                   /protein_id="ADG92116.1"
FT                   /translation="MCAIVGIFGNEKASRLASLALFSMQHRGQEATGISSSSDGKIYTI
FT                   KNRGLVSEVFDNNALEYLKGNMAIGHNRYSTAGGDSILDAQPVFAKYKLGEISIVHNGN
FT                   LINKKAVRQELIDNGAIFQTGMDTENLVHLIAKNSKDRLRDRIKEALDKTIGAYCFIIQ
FT                   SRSKQFVIRDRYGIRPLSIGKLKSGGYIVASETCAFDLVDAEFIRDVRPGEMLIFSEKV
FT                   EEPESIQLYEPEYRPCAFEYVYFARPDSVIDGKSVYKAREDMGKTLAINDRGNDIKIDM
FT                   VIPVPDSGVPAAIGYAAESGIPFELGIIRNHYVGRTFIEPTQEMRDLKVKMKLSPMKSL
FT                   IAGKSLLVIDDSIVRGTTSRRIVKILKEAGAKEVHFRVASPEIKFPCYYGIDTPTKEEL
FT                   ISHRMNKEEIREHIQADTLEYLSIEDLKNSIGNDRNYALESFDGDYFVTK"
FT   sig_peptide     439276..439359
FT                   /locus_tag="Arnit_0451"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            440600..441601
FT                   /locus_tag="Arnit_0452"
FT   CDS_pept        440600..441601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0452"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG1242 Fe-S oxidoreductase; InterPro
FT                   IPR005911:IPR006638:IPR007197; KEGG: abu:Abu_2087
FT                   hypothetical protein; PFAM: Radical SAM domain protein;
FT                   SMART: Elongator protein 3/MiaB/NifB; SPTR: A8EWI1 Putative
FT                   uncharacterized protein; TIGRFAM: conserved hypothetical
FT                   protein; PFAM: Radical SAM superfamily; TIGRFAM: radical
FT                   SAM protein, TIGR01212 family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92117"
FT                   /db_xref="GOA:D5V5T1"
FT                   /db_xref="InterPro:IPR005911"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5T1"
FT                   /protein_id="ADG92117.1"
FT                   /translation="MVTISLQNNKTKQKKSLEELLTIGKYFRSKFGETIYKVPISISGF
FT                   TCPNIDGTVAKGGCSFCENDSFSPNLQEKKTKFKLHPSNPSNPYLDRQLKQLEMQFNAT
FT                   KERLGNKFGTKKFIVYFQSFTNTYAPFETLKALYTKALSFENVIGLSIGTRTDCVTDEI
FT                   LDYLATLSKEKEIWIEYGIQSFYDETLEKINRGDTSANIKKWIKKSKEKGLNVCGHLIY
FT                   GLPNETQEMMFETLRQTIELDIDSIKFHPLYVVKNTLLTNEYKKGRFTPISEELYIDTV
FT                   VKSIKMLPRNISIQRITAGISDDSLLAPQWCKDKHTQIQKIKKALIKEGLRY"
FT   gene            complement(441625..442524)
FT                   /locus_tag="Arnit_0453"
FT   CDS_pept        complement(441625..442524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0453"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="COGs: COG0583 Transcriptional regulator; InterPro
FT                   IPR000847:IPR005119:IPR011991; KEGG: abu:Abu_2086 LysR
FT                   family transcriptional regulator; PFAM: regulatory protein
FT                   LysR; LysR substrate-binding; SPTR: A8EWI0 Transcriptional
FT                   regulator, LysR family; PFAM: Bacterial regulatory
FT                   helix-turn-helix protein, lysR family; LysR substrate
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92118"
FT                   /db_xref="GOA:D5V5T2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5T2"
FT                   /protein_id="ADG92118.1"
FT                   /translation="MLNDFAKVNTFLTVVREKSFSKASAKLGISQPAVTQQMKFIEEYL
FT                   EVQLLDRKKNGIKVTKEGEMLYNIAQKIERTVSNCEKELLKIMNKDVTFMFGASFIIGN
FT                   YILPRFLNQLKRDIHNDVSINVSVSHKTIADLLDKKIDIALVENYITNDDIIYREWMED
FT                   EIVIFSNQKLPARAKPEDLLSYKWVCRNPDSNTRMIFKENLDKENFPDCDQFDITSEVT
FT                   SATTIIQTVLHSEITGTPTVSIVSRNAIDSLLKSNTLFESRIGNSRMTRKLYIAYRKDR
FT                   KHDAFIENVVDYLLKIKS"
FT   gene            442641..444695
FT                   /locus_tag="Arnit_0454"
FT   CDS_pept        442641..444695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0454"
FT                   /product="UvrD/REP helicase"
FT                   /note="COGs: COG0210 Superfamily I DNA and RNA helicase;
FT                   InterPro IPR014016:IPR014017:IPR000212; KEGG: abu:Abu_2085
FT                   ATP-dependent DNA helicase UvrD; PFAM: UvrD/REP helicase;
FT                   SPTR: A8EWH9 ATP-dependent DNA helicase, UvrD/PcrA family;
FT                   PFAM: UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92119"
FT                   /db_xref="GOA:D5V5T3"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5T3"
FT                   /protein_id="ADG92119.1"
FT                   /translation="MSEIFLSGLNESQQKAAKHIDGSLLILAGAGSGKTKTITTRLAYL
FT                   ISIGIDPTSILTLTFTNKAATEMRERAYAMIGSNMSTPPILCTFHKFGLLFLKFYMSEL
FT                   KRKNNFIIIDTDDKKRILRTIEKDIPVAMLVSEISKYKNTLLTPTQVKAGAELKIYQQI
FT                   ADVYEKYENYLLKNNLVDFDDLLLLPYKILSNNEALAKETSGKYQYIMVDEYQDTNELQ
FT                   YKLLRLLCMTHSNLCVVGDDDQSIYGWRGATIKNILNFTEHFENTLVVKLEENYRSTDT
FT                   ILDHANQLIEHNRDRLGKRLIGTRAKGDSVRVYESHDENEETRKIILDVKKLLDSGVRG
FT                   RDIAVLFRVNALSRSLEEGFNKAGLNYKLVGGMKFYERAEIKDLIAYFRIITNSYDNFS
FT                   FKRIINKPKRGIGKTTVDKLEAKSVELKKPIFEIIDEFSPDELNAIVGKKNSRTLKVFL
FT                   ASILDLKDTLEESKMRFLDIFEDTFDFRASFENLPDGFERQANIDEFYGYVRDYFIQNP
FT                   LLELDNFLNEIALGTEDTELENEAISMMSIHASKGLEYKNLFIIGMEEGFFPIVGDGSD
FT                   TEEERRLGYVAFTRAMDNLTCSFVHSRFYKGKRTSLLKSRFLAESGLIKGSLMIQQQSS
FT                   SYKKGDLVQHKIFGMGRVQKAVKAGKDFKLTINFGGTKRDILSAFVEKA"
FT   gene            444703..445551
FT                   /locus_tag="Arnit_0455"
FT   CDS_pept        444703..445551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0455"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /note="COGs: COG0130 Pseudouridine synthase; InterPro
FT                   IPR000253:IPR014780:IPR020103:IPR002501; KEGG: abu:Abu_2084
FT                   tRNA pseudouridine synthase B; PFAM: pseudouridylate
FT                   synthase TruB domain protein; SPTR: A8EWH8 tRNA
FT                   pseudouridine synthase B; TIGRFAM: tRNA pseudouridine
FT                   synthase B; PFAM: TruB family pseudouridylate synthase (N
FT                   terminal domain); TIGRFAM: tRNA pseudouridine 55 synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92120"
FT                   /db_xref="GOA:D5V5T4"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5T4"
FT                   /protein_id="ADG92120.1"
FT                   /translation="MQKRIYNKEALNKLIVVNKPMFMSSNSYLNRIKRKYKNKKAGFSG
FT                   TLDPFAKGCLIVAFGQYSKLFQFFKKTPKTYRAVIWLGTVSESFDIENVTSIKEHSKLK
FT                   TDDIKKELNNLQREIEYYPPKFSAKKIDGERAYKLAREGKEVELKKSTMKVFSTKFISY
FT                   NHPFITFESSVSEGSYIRSLAQILLENLSSTGTLSYLNRLNEGEFFYQNEKDLNPLDYL
FT                   DIKQINYKGEKSYFEQGKKILCEYLDEKEDGKYLVKFDDFFSIIEINNCEVKYILNKVM
FT                   I"
FT   gene            445552..446328
FT                   /locus_tag="Arnit_0456"
FT   CDS_pept        445552..446328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0456"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritolkinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="COGs: COG1947
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol 2-phosphate
FT                   synthase; InterPro IPR004424:IPR020568:IPR006204:IPR014721;
FT                   KEGG: abu:Abu_2083
FT                   4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; PFAM:
FT                   GHMP kinase; PRIAM: 4-(cytidine
FT                   5'-diphospho)-2-C-methyl-D-erythritol kinase; SPTR: A8EWH7
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase; TIGRFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase; PFAM:
FT                   GHMP kinases N terminal domain; TIGRFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92121"
FT                   /db_xref="GOA:D5V5T5"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5T5"
FT                   /protein_id="ADG92121.1"
FT                   /translation="MNISAKSYAKVNIFLKIAGKRDNYHELVSRFVRVKNLYDTITFIP
FT                   ENSTNEFNLIGDFGCETQKNTIYKAFLALRDNCPKIDAYFRIYSIKVDKKIPEFAGLGG
FT                   GSSNAATFLIMANKLFDLYYSKEKLAKIGAKIGADVPFFIYEYDSANVTGIGEIVEKYE
FT                   EEALDIEVVTPKIECNTGKIFTSFRESFYKEISSEDKSRLLNMSSKDILKELDIFEAND
FT                   LYEPAIQSYSQLGDYAKKDWFFSGSGSSFFKVKDNG"
FT   gene            446321..446791
FT                   /locus_tag="Arnit_0457"
FT   CDS_pept        446321..446791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0457"
FT                   /product="SsrA-binding protein"
FT                   /note="COGs: COG0691 tmRNA-binding protein; InterPro
FT                   IPR020081:IPR000037; KEGG: abu:Abu_2082 tmRNA-binding
FT                   protein SmpB; PFAM: SmpB protein; SPTR: A8EWH6 SsrA-binding
FT                   protein; TIGRFAM: SsrA-binding protein; PFAM: SmpB protein;
FT                   TIGRFAM: SsrA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92122"
FT                   /db_xref="GOA:D5V5T6"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5T6"
FT                   /protein_id="ADG92122.1"
FT                   /translation="MAKKEKNINLTFKNKKAYHDYFILESFEAGIELLGSEVKSIREGR
FT                   VNLKDSYIRIIKNEVFVLNMHISYLETTHAMYRPEETRPRKLLLHRKQIDKLFEKVTKD
FT                   GITIVPLKLYFNAKNFAKLQIATAQGKKLYDKRADLKEKSLKRESEQAIKNW"
FT   gene            446994..448460
FT                   /locus_tag="Arnit_0458"
FT   CDS_pept        446994..448460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0458"
FT                   /product="cytochrome c oxidase, cbb3-type, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="COGs: COG3278 Cbb3-type cytochrome oxidase subunit
FT                   1; InterPro IPR000883:IPR004677; KEGG: abu:Abu_2081
FT                   cytochrome c oxidase, cbb3-type, subunit I; PFAM:
FT                   cytochrome c oxidase subunit I; PRIAM: Cytochrome-c
FT                   oxidase; SPTR: A8EWH5 Cytochrome c oxidase, cbb3-type,
FT                   subunit I; TIGRFAM: cytochrome c oxidase, cbb3-type,
FT                   subunit I; PFAM: Cytochrome C and Quinol oxidase
FT                   polypeptide I; TIGRFAM: cytochrome c oxidase, cbb3-type,
FT                   subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92123"
FT                   /db_xref="GOA:D5V5T7"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR004677"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5T7"
FT                   /protein_id="ADG92123.1"
FT                   /translation="MQNGAQIEYDYSIAKAFTFATILFGIIGMLVGVILAFQLAFPQLN
FT                   ELAGEYGTFSRLRPLHTNGVAFGFTLSGIFATWYYISQRVLKVSLKESPFLMAIGKLHF
FT                   LLYFITILLAVVTLLAGITTSKEYAELEWPIDILVVLWWVLWGVSIFGLIGIRRERTLY
FT                   ISIWYFIASFLAVAMLYLFNNMEVPTALVSGYGSWMHSVSMYAGTNDALVQWWYGHNAV
FT                   GFVFTVPIIAMIYYFLPKESGQNVYSYKLSILAFWGLLFVYLWAGGHHLIYSTVPDWMQ
FT                   TMGSVMSIVLILPSWGSAINMLLTMKGEWQQLQTNTLIKFMILASTFYMLSTIEGPIQS
FT                   IKSVNAIAHFTDWIPGHVHDGTLGWVTFMVMAALYHMAPRMYGRELYSKSLMDTQFWLQ
FT                   TTGIVLYFTSMWIAGITQGMMWRAYDEYGSLLYSFIDTVTVLKPYYTIRAVGGLLYLIG
FT                   FFMFAYNMYKTATAGRVLDKEPINATPVAA"
FT   gene            448476..449159
FT                   /locus_tag="Arnit_0459"
FT   CDS_pept        448476..449159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0459"
FT                   /product="cytochrome c oxidase, cbb3-type, subunit II"
FT                   /note="COGs: COG2993 Cbb3-type cytochrome oxidase
FT                   cytochrome c subunit; InterPro IPR009056:IPR003468; KEGG:
FT                   abu:Abu_2080 cytochrome c oxidase, cbb3-type, subunit II;
FT                   PFAM: cytochrome C oxidase mono-heme subunit/FixO; SPTR:
FT                   A8EWH4 Cytochrome c oxidase, cbb3-type, subunit II;
FT                   TIGRFAM: cytochrome c oxidase, cbb3-type, subunit II; PFAM:
FT                   Cytochrome C oxidase, mono-heme subunit/FixO; TIGRFAM:
FT                   cytochrome c oxidase, cbb3-type, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92124"
FT                   /db_xref="GOA:D5V5T8"
FT                   /db_xref="InterPro:IPR003468"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5T8"
FT                   /protein_id="ADG92124.1"
FT                   /translation="MFHWFEQRPFFFAVLVFIFVAFAGIVEVIPDFAKQSRPTVGTKPY
FT                   TVLELAGRNVYIKDSCNACHSQLIRPFKSETDRYGMYSLSGEYVYDRPFLWGSKRTGPD
FT                   LHRVGNYRTTDWHENHMMDPASVVPGSIMPSYAHQFKNIADIDTAYGEAVTVKKVFNTP
FT                   YDVDLNGDGKIDVPLGTYEEAKAETLKEAKAIAADMKNQAVKDAVANGQIPEIVALIAY
FT                   LNSLK"
FT   sig_peptide     448476..448544
FT                   /locus_tag="Arnit_0459"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            449169..449393
FT                   /locus_tag="Arnit_0460"
FT   CDS_pept        449169..449393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0460"
FT                   /product="Cytochrome c oxidase cbb3-type CcoQ"
FT                   /note="InterPro IPR014107; KEGG: abu:Abu_2079 cytochrome c
FT                   oxidase, cbb3-type, subunit IV; PFAM: Cytochrome c oxidase
FT                   cbb3-type CcoQ; SPTR: A8EWH3 Cytochrome c oxidase,
FT                   cbb3-type, subunit IV; PFAM: Cbb3-type cytochrome oxidase
FT                   component FixQ; TIGRFAM: cytochrome c oxidase, cbb3-type,
FT                   CcoQ subunit, epsilon-Proteobacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92125"
FT                   /db_xref="GOA:D5V5T9"
FT                   /db_xref="InterPro:IPR008621"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5T9"
FT                   /protein_id="ADG92125.1"
FT                   /translation="MSHQELVDLQGYLKFFLLLVVFVIFYSYAYSIYKRDKKGKRDFEK
FT                   YSNLVHDDSIDSKPLEERNNNLDEKEKEK"
FT   sig_peptide     449169..449255
FT                   /locus_tag="Arnit_0460"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            449395..450285
FT                   /locus_tag="Arnit_0461"
FT   CDS_pept        449395..450285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0461"
FT                   /product="cytochrome c class I"
FT                   /note="InterPro IPR009056:IPR008168:IPR004678:IPR003088;
FT                   KEGG: abu:Abu_2078 cytochrome c oxidase, cbb3-type, subunit
FT                   III; PFAM: cytochrome c class I; SPTR: A8EWH2 Cytochrome c
FT                   oxidase, cbb3-type, subunit III; PFAM: Cytochrome c;
FT                   TIGRFAM: cytochrome c oxidase, cbb3-type, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92126"
FT                   /db_xref="GOA:D5V5U0"
FT                   /db_xref="InterPro:IPR004678"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR032858"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="InterPro:IPR038414"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5U0"
FT                   /protein_id="ADG92126.1"
FT                   /translation="MKSMVIGGIILIVALMAGTYFVAGDAFNSDDYINSLTMLGAVAII
FT                   TITVFVALKYINQMKNDTASGDLAEEKWDGIGEYKNPIPTGWGLAFIGTIVWLFWYWTI
FT                   GYPTNGFSQIGQWNEETIEFNKKFESKWENPSIDTLTAMGESVFLVQCSPCHGVDAEGI
FT                   NGKAQNLTKRISQTSVEYVIKNGANNFKTVYPGGMPPMMLTDEKDIKDVSSYVAGGFKG
FT                   EQPAAFGVCAGCHGADGKGMAYVAPNIRNYTTDLISAVLENGKKGAIGQMPAFKGRLNA
FT                   TQEKAVAAYIKSLGE"
FT   sig_peptide     449395..449460
FT                   /locus_tag="Arnit_0461"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            450287..450529
FT                   /locus_tag="Arnit_0462"
FT   CDS_pept        450287..450529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0462"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: abu:Abu_2077 hypothetical protein; SPTR:
FT                   A8EWH1 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92127"
FT                   /db_xref="GOA:D5V5U1"
FT                   /db_xref="InterPro:IPR025065"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5U1"
FT                   /protein_id="ADG92127.1"
FT                   /translation="MAKNSQMNENERGLFALSGITGMLIATVLLLSILAFLTINAIGVQ
FT                   QNESQNFYKINQDLNGLKANSPDNSSQYELVGKVK"
FT   gene            450540..450632
FT                   /locus_tag="Arnit_0463"
FT   CDS_pept        450540..450632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0463"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: abu:Abu_2076 hypothetical protein; SPTR:
FT                   A8EWH0 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92128"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5U2"
FT                   /protein_id="ADG92128.1"
FT                   /translation="MDKIIGLLLLGSALLSAYLAFFDSSRIFVG"
FT   sig_peptide     450540..450596
FT                   /locus_tag="Arnit_0463"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            450633..451271
FT                   /locus_tag="Arnit_0464"
FT   CDS_pept        450633..451271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0464"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: abu:Abu_2075 hypothetical protein; SPTR:
FT                   A8EWG9 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92129"
FT                   /db_xref="GOA:D5V5U3"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5U3"
FT                   /protein_id="ADG92129.1"
FT                   /translation="MKAFNMLKIAVLSLLFFLIPLNASINKYVLSDDVVIDPRTAQKIF
FT                   EIGSEVKNKTNVNLYVYVKTDLGIDKNIPIKEKMQLIKKEETELTSMLVKPYAVLTIAV
FT                   EQMHVNLLMSEKLKSIINKDDILDGYVVPLLASKDKNTLFTKISAAVLNGYSEMADDVA
FT                   HANGIEKLESGIPSSGKTAGTIWKVFMYTLVILGVFLYTFAVLRSKKKK"
FT   sig_peptide     450633..450701
FT                   /locus_tag="Arnit_0464"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            451279..451839
FT                   /locus_tag="Arnit_0465"
FT   CDS_pept        451279..451839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0465"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: abu:Abu_2074 hypothetical protein; SPTR:
FT                   A8EWG8 Putative uncharacterized protein; PFAM: FixH"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92130"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5U4"
FT                   /protein_id="ADG92130.1"
FT                   /translation="MKKRNYWPLFFIAIFTFTLSMVIWTVMSAIKTPVHEDKSFLSSYH
FT                   IMDVEFNDIVDYNKNFSKKYNLKMKINDKEFDDLLLNDVFLSQRVIDQKSMHKDIFKKG
FT                   INNISFDLTTKDGVKVPNFKISFKVTRTTNSYSDIDINNDENKNEKFTFNLEKAGNWNI
FT                   TGILDTNDGEKGFFYIKSNATDK"
FT   sig_peptide     451279..451362
FT                   /locus_tag="Arnit_0465"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            451823..454183
FT                   /locus_tag="Arnit_0466"
FT   CDS_pept        451823..454183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0466"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG3893 Inactivated superfamily I helicase;
FT                   InterPro IPR011604; KEGG: abu:Abu_2073 hypothetical
FT                   protein; SPTR: A8EWG7 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92131"
FT                   /db_xref="GOA:D5V5U5"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5U5"
FT                   /protein_id="ADG92131.1"
FT                   /translation="MLQTSKILIVFPTSRAIRESIKRRSNENLLLPSYLTIDEFLKKSI
FT                   SIKNKKYIDEEQRFLYLKNASDIKNLSKLGISNNFTSFLKQSDYLFRFFGELAAEKVSI
FT                   DSIDEVDTYEYYKEHISILKKIYNNYVTILDTNNVVDKINLPNNYEINQNFLNRYESIE
FT                   IYFEGYFTNFELEIIFEISKYTKIIVNLFSNKYNQKSIQSFINFGFELEEGYEYKIDLT
FT                   NKSIIEKHKEVSNLENTKAVAFTSRINQIAFIKESITNAVKSGIKAENIALIVPDEKFV
FT                   EILEQFDDEQYFNYAMGKSINNSKLYKVINSIYSYLNENERKTKESIEFYKINTEMIDS
FT                   IKKIWNKKLDKNNFDILIEYLKSIEHNKELTEKFDELTYKLDHLFFNTSQNILFKEAVK
FT                   ILIQKIQKITLDDINSGLITVMGLLETRAVEFEAVIICDFNENYIPKSSIKDKFLSSII
FT                   KKRVKLPTQKDRENLQKYYYYRLMNKAKNLYISYTQNETMQVSRFADELFKDEINPSTK
FT                   DKQYKQILYKNKSIEHFNETIEYEIDLSKQEWSATSLKKYLECKRKYYLEYICKIKEHN
FT                   ISLKPKGFELGSMVHKTLESAYKSFQVQNINYELIKSLFEKQMNENPFLLLDKEIFLRK
FT                   LNIFVEFENKRFEDKNLSVLEIEKDFKFDYNGIVLKGSIDRIDKQDDKYLLIDYKTSAS
FT                   LKIDSIKTYENSVDFQLEFYYLACLELFGYDKIKAYYYDLNNSKLLEEVVLLEKLELLK
FT                   NIFIELKTKKVNFEKCEKTSTCQYCEFKTICDR"
FT   gene            complement(454208..455302)
FT                   /locus_tag="Arnit_0467"
FT   CDS_pept        complement(454208..455302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0467"
FT                   /product="peptide chain release factor 2"
FT                   /note="COGs: COG1186 Protein chain release factor B;
FT                   InterPro IPR000352:IPR004374:IPR005139; KEGG: abu:Abu_2071
FT                   peptide chain release factor 2; PFAM: Class I peptide chain
FT                   release factor; PCRF domain protein; SPTR: A8EWG5 Peptide
FT                   chain release factor 2; TIGRFAM: peptide chain release
FT                   factor 2; PFAM: PCRF domain; RF-1 domain; TIGRFAM: peptide
FT                   chain release factor 2"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92132"
FT                   /db_xref="GOA:D5V5U6"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5U6"
FT                   /protein_id="ADG92132.1"
FT                   /translation="MDAYEYSELLKLLNKKLQNIKDILKPDVLKSRLKEIEELESSQDF
FT                   WNDVETATKIGIEKNRILSKLSKFKKANESLSGTNELYEMALEEKDEDTFELLHGEAEE
FT                   LDNLIRSTEISVMLSNPDDSSNAIISIHPGAGGTESQDWASMLYRMYLRWAERMDFKIE
FT                   VLDYQDGEEAGLKDVSFIIKGENAYGYLKAENGIHRLVRISPFDSNAKRHTSFASVMVS
FT                   PEIDDNIDIVVEDKDIRIDTYRSSGAGGQHVNKTESAIRITHIATNIVVQCQNDRSQHK
FT                   NKASAMKMLKSRLYEYELEKQQAVKDGVEKSEIGWGHQIRSYVMQPYQQIKDTRSNIGY
FT                   SNVEAILDGDITKMIEDVLIATAR"
FT   gene            complement(455378..456004)
FT                   /locus_tag="Arnit_0468"
FT   CDS_pept        complement(455378..456004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0468"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR009056; KEGG: abu:Abu_2070 hypothetical
FT                   protein; SPTR: A8EWG4 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92133"
FT                   /db_xref="GOA:D5V5U7"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5U7"
FT                   /protein_id="ADG92133.1"
FT                   /translation="MNLIKPLSILTFLISSSFAQTTMCYKQNHSDFSTIESTKLDGGLC
FT                   AGKKSLNDMKKDGWITSDIKIDGNNYIYILKKDVPTVDNIDMQALENQIIKRLEQKDIE
FT                   SNKMAIMEKRAKMSISGKNFYIKKCQFCHGKNGEEKPGQSRAIDQLSLFDFMTTIRDYN
FT                   TSSYNRGTAFQMIPYAGIMDKNDINNVYIYLQSINQKDEKKTKSN"
FT   sig_peptide     complement(455948..456004)
FT                   /locus_tag="Arnit_0468"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(456120..457313)
FT                   /locus_tag="Arnit_0469"
FT   CDS_pept        complement(456120..457313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0469"
FT                   /product="major outer membrane protein"
FT                   /note="InterPro IPR008439:IPR005318; KEGG: abu:Abu_2032
FT                   major outer membrane protein; PFAM: major outer membrane
FT                   protein; outer membrane porin; SPTR: A8EWC6 Major outer
FT                   membrane protein; PFAM: Campylobacter major outer membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92134"
FT                   /db_xref="InterPro:IPR008439"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5U8"
FT                   /protein_id="ADG92134.1"
FT                   /translation="MKKFVKMSLIAAIAVAGTTASAQPLAEAIKNVDVSGTMVYRYDDA
FT                   KDKVLSSTGADQDKTTNGYKIATTLKSKVNDDVTANVRILAGSGNNASDVASLNTSSDG
FT                   DANLTVQITNANFAYTGIANTTVIVGKQGLTTPWTVATDSFGNEQTGTGILALSTLGPV
FT                   TLAGAYFNQTNLGDSGDVTTLNGNSAGQFGGRDIYTAGIMAKVGPVSLSAWYLDMDESF
FT                   DTYTLDANASFDLDAVTLGADVRYTSLDLDKSDTDNNLLQTTLTAKMGIFNAKLAYAAT
FT                   DKQGGTVALDSDAATSISAWGVNANTLIDADYYNVVFGAQVLPSLHVSANYAQAKYKAT
FT                   STATEKTKYDETYAQLTYQMSKNFMGYIRYGVAEKKAGSVKSQDLGNRGRLYVKYSF"
FT   sig_peptide     complement(457248..457313)
FT                   /locus_tag="Arnit_0469"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(457512..457823)
FT                   /locus_tag="Arnit_0470"
FT   CDS_pept        complement(457512..457823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0470"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="COGs: COG1539 Dihydroneopterin aldolase; InterPro
FT                   IPR006157; KEGG: abu:Abu_2033 dihydroneopterin aldolase;
FT                   PFAM: dihydroneopterin aldolase; SPTR: A8EWC7
FT                   Dihydroneopterin aldolase; PFAM: Dihydroneopterin aldolase;
FT                   TIGRFAM: dihydroneopterin aldolase; FolB domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92135"
FT                   /db_xref="GOA:D5V5U9"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:D5V5U9"
FT                   /protein_id="ADG92135.1"
FT                   /translation="MKVKIEDLTFDCIIGILPFEREKEQRVIINCSFSYNFTNSEFIDY
FT                   SKVASDIENLMKKNKFELIEDALLNLKKHLKDKYCIKKLNLTIQKPDILPNCKVSVSL"
FT   gene            complement(457823..458443)
FT                   /locus_tag="Arnit_0471"
FT   CDS_pept        complement(457823..458443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0471"
FT                   /product="acyl-phosphate glycerol-3-phosphate
FT                   acyltransferase"
FT                   /note="COGs: COG0344 membrane protein; InterPro
FT                   IPR020788:IPR003811; KEGG: abu:Abu_2034 putative
FT                   glycerol-3-phosphate acyltransferase PlsY; PFAM: protein of
FT                   unknown function DUF205; SPTR: A8EWC8 UPF0078 membrane
FT                   protein Abu_2034; PFAM: Domain of unknown function
FT                   (DUF205); TIGRFAM: conserved hypothetical integral membrane
FT                   protein TIGR00023"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92136"
FT                   /db_xref="GOA:D5UZ99"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/TrEMBL:D5UZ99"
FT                   /protein_id="ADG92136.1"
FT                   /translation="MDFLNTNLIFYILAYLIGSIPFGLLLAKTFAGVNIKEHGSKSIGA
FT                   TNVLRVVKETNPSLAKKLGLATVILDAIKGTIILLIAQAYGVSEATLWTIAVLAVIGHC
FT                   YSIYLGLEGGKGVATGLGVFLVLIPIPTLIGAIVWGFCAKVLKISSLSSLLGLLAVIIA
FT                   AIIFNNGLGVGSNAPMYLISFIIFYKHIPNIVRLIKKEELKAV"
FT   gene            458546..459535
FT                   /locus_tag="Arnit_0472"
FT   CDS_pept        458546..459535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0472"
FT                   /product="quinolinate synthetase complex, A subunit"
FT                   /note="COGs: COG0379 Quinolinate synthase; InterPro
FT                   IPR003473; KEGG: abu:Abu_2035 quinolinate synthetase; PFAM:
FT                   Quinolinate synthetase A; SPTR: A8EWC9 Quinolinate
FT                   synthetase A protein; TIGRFAM: quinolinate synthetase
FT                   complex, A subunit; PFAM: Quinolinate synthetase A protein;
FT                   TIGRFAM: quinolinate synthetase complex, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92137"
FT                   /db_xref="GOA:D5UZA0"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:D5UZA0"
FT                   /protein_id="ADG92137.1"
FT                   /translation="MNLKDEIIKLKEEIDVTLVAHFYQRDEVFELADITGDSLELAKKA
FT                   METSSKYIVFCGVGFMGESVKVMSPQKRVLMPKIACCAMARMIDVDYFDESLAKLNAMG
FT                   VSSEELLPITYINSSAAVKARVGEMGGMVCTSSNAYKIIEKGLKSGKKIFFVPDRCLGQ
FT                   NFAKSLNLKSTVIGDGTDPKEADIICYDGFCSVHQLFSTDDIEFYRNKYPDILIAVHPE
FT                   CDPKICDMADFVGSTSQLIKFIKELPVEQKVAVGTEYNMVNRLREKNTYILSSTKPECP
FT                   TMNETTLQDVYNCLKEIKDGKEVFSNEIFVNDNVIKWAKVALQRMFEV"
FT   gene            459532..460353
FT                   /locus_tag="Arnit_0473"
FT   CDS_pept        459532..460353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0473"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /note="COGs: COG0157 Nicotinate-nucleotide
FT                   pyrophosphorylase; InterPro IPR004393:IPR002638:IPR013785;
FT                   KEGG: abu:Abu_2036 nicotinate-nucleotide pyrophosphorylase;
FT                   PFAM: Quinolinate phosphoribosyl transferase; PRIAM:
FT                   Nicotinate-nucleotide diphosphorylase (carboxylating);
FT                   SPTR: A8EWD0 Nicotinate-nucleotide pyrophosphorylase;
FT                   TIGRFAM: nicotinate-nucleotide pyrophosphorylase; PFAM:
FT                   Quinolinate phosphoribosyl transferase, C-terminal domain;
FT                   Quinolinate phosphoribosyl transferase, N-terminal domain;
FT                   TIGRFAM: nicotinate-nucleotide pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92138"
FT                   /db_xref="GOA:D5UZA1"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:D5UZA1"
FT                   /protein_id="ADG92138.1"
FT                   /translation="MINIKKFVKNAIIEDNGRGDLFFDVAPKGRFTAKVISKDDGILAG
FT                   EIYAKALSKTEKFDCKFLKHDGEQIKKGDIIAKLDGKAAVLLSSERTFLNMLQHASGIA
FT                   TMANSYASLIKDLDVVLLDTRKTRPQLRDFEKYASRVGGAINHRLGLDDCLMLKDTHLR
FT                   TIINLKEFIQRARKRISWVTKIEIECETLDQVKDAMEAGGDIIMCDNMTPDQIREVVKF
FT                   RNENYPHIVLEASGNINLKTVREYALSGVDALSSGSIIHQATWLDFSMKFD"
FT   gene            460415..461395
FT                   /locus_tag="Arnit_0474"
FT   CDS_pept        460415..461395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0474"
FT                   /product="phosphoesterase RecJ domain protein"
FT                   /note="COGs: COG0618 Exopolyphosphatase-related protein;
FT                   InterPro IPR001667:IPR003156; KEGG: abu:Abu_2037
FT                   exopolyphosphatase-related protein; PFAM: phosphoesterase
FT                   RecJ domain protein; phosphoesterase DHHA1; SPTR: A8EWD1
FT                   Exopolyphosphatase-related protein; PFAM: DHH family; DHHA1
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92139"
FT                   /db_xref="GOA:D5UZA2"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:D5UZA2"
FT                   /protein_id="ADG92139.1"
FT                   /translation="MSKDFLTNNKVNTASFVSALKLIEKSKYILIITHVNPDPDTICSG
FT                   LALSNYLSENKIKHKVFNAGKNLPAKCDFIKRYEKITDQIPKFYDLVISVDCGTSNRFG
FT                   ITLPEDIPLINFDHHKSNDNFGTINIVDINKSSTSEIVYDFFRFNGLYITKNTAEALYV
FT                   GIYDDSLAFTTPRCDEFTYEKINFLVKCGASPVYIADKFIKRDSLAKYRILPKIFNSLE
FT                   LLDEGKVATIYATKEWFEESGATTLETEVALDMVLNIAIVKVAIYFRIVNDKVRVSLRS
FT                   KEKIDVSKVASTFGGGGHLNAAGCVIQTEDIFEAKEIILKEILEK"
FT   gene            461385..462755
FT                   /locus_tag="Arnit_0475"
FT   CDS_pept        461385..462755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0475"
FT                   /product="Peptidase M23"
FT                   /note="COGs: COG0739 Membrane protein related to
FT                   metalloendopeptidase; InterPro IPR011055:IPR016047; KEGG:
FT                   abu:Abu_2038 M24/M37 family peptidase; PFAM: Peptidase M23;
FT                   SPTR: A8EWD2 Peptidase, M23/M37 family; PFAM: Peptidase
FT                   family M23"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92140"
FT                   /db_xref="GOA:D5UZA3"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D5UZA3"
FT                   /protein_id="ADG92140.1"
FT                   /translation="MKNKSSFGKVVLFIFIIGAIVAGCFVYLSPMFEKNPPKVDFKDNI
FT                   YWNLKSKLNLGISDDSGIKFYKVIFKDGNKEIVLDSKVLLEPEKNINLELKSPELDMFF
FT                   KSNDVEIIVEAVDSSKWNFLEGNKVIDTFHLKIDRKKPVASVVANSFAVRRGGSALVIV
FT                   KVEDENLKDAYITFNNEQRFDLIPFYKENYYAAIIAWPIKIEKFNIVNLVAIDKADNKS
FT                   IIKVPLYIRNRKDDKSKIKISDAFIQNVSTKVLEQSGKDVPDNLADVFLKENEVLRNKN
FT                   VQKIEEVSRKFMDRDLVSGFNLIPFKRLENAATAGRFGQERSYYHNGIKIDEAWHLGID
FT                   WASVKKADIFTTNKGRVIFNDYLGIYGNAIIIDHGFGLQSLYAHTSSSNVTVGEEVKEN
FT                   QKIANTGATGAVLGDHLHFGVLVQGIEVDPLEWMDKNWIKTRITDIISDAKKVIDSK"
FT   gene            462752..463660
FT                   /locus_tag="Arnit_0476"
FT   CDS_pept        462752..463660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0476"
FT                   /product="UDP-3-0-acyl N-acetylglucosamine deacetylase"
FT                   /note="COGs: COG0774 UDP-3-O-acyl-N-acetylglucosamine
FT                   deacetylase; InterPro
FT                   IPR004463:IPR020568:IPR015870:IPR011334; KEGG: abu:Abu_2039
FT                   UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase; PFAM: UDP-3-0-acyl N-acetylglucosamine
FT                   deacetylase; SPTR: A8EWD3 UDP-3-O-[3-hydroxymyristoyl]
FT                   N-acetylglucosamine deacetylase; TIGRFAM: UDP-3-0-acyl
FT                   N-acetylglucosamine deacetylase; PFAM: UDP-3-O-acyl
FT                   N-acetylglycosamine deacetylase; TIGRFAM: UDP-3-0-acyl
FT                   N-acetylglucosamine deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92141"
FT                   /db_xref="GOA:D5UZA4"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D5UZA4"
FT                   /protein_id="ADG92141.1"
FT                   /translation="MKQRTIAKAVEIVGIGLHKGVPVKMRLEPLEANQGIIFYRSDEAL
FT                   TIPLKIENVVDTKMATVIGKDGIVISTIEHLLSAVYAYGIDNLRVVLDNDEVPVLDGSS
FT                   SGYCMLIDEVGIKELSESKKVIKIKKEVEVRTEDGKRVSLKPSNHIVYDFSIDFENPVI
FT                   GQQNYHFDYSIDEYKENISKARTFGFLHEVQYLRSIGLAQGGSMENAIVVDDDKILNPE
FT                   GLRYENEFVRHKILDAIGDMSLLGYTLIGEYDAHAGSHHLNHLLTKKVYESEENYEILD
FT                   LDEAQKESYVFQKAYALVDAN"
FT   gene            463669..464121
FT                   /locus_tag="Arnit_0477"
FT   CDS_pept        463669..464121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0477"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: abu:Abu_2040 hypothetical protein; SPTR:
FT                   A8EWD4 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92142"
FT                   /db_xref="UniProtKB/TrEMBL:D5UZA5"
FT                   /protein_id="ADG92142.1"
FT                   /translation="MIDIIVISISIPIKIGIYENKVLINEIEQEGKTSDILPLIFEKLL
FT                   KEYDIKSITYVNTPGSYMAIKVAYVFLKTVCIARDIELNAASGFLFNDNSPIKALGKKY
FT                   FFNKNGEIIIDFLEEKSIISDFKLPKSLDRTKFSSNTLPIYNLPAV"
FT   gene            464132..465013
FT                   /locus_tag="Arnit_0478"
FT   CDS_pept        464132..465013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0478"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /note="COGs: COG0083 Homoserine kinase;
FT                   InterProIPR006203:IPR000870:IPR020568:IPR006204:IPR
FT                   013750:IPR014721; KEGG: abu:Abu_2041 homoserine kinase;
FT                   PFAM: GHMP kinase; GHMP kinase domain protein; PRIAM:
FT                   Homoserine kinase; SPTR: A8EWD5 Homoserine kinase; TIGRFAM:
FT                   homoserine kinase; PFAM: GHMP kinases C terminal; GHMP
FT                   kinases N terminal domain; TIGRFAM: homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92143"
FT                   /db_xref="GOA:D5UZA6"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D5UZA6"
FT                   /protein_id="ADG92143.1"
FT                   /translation="MRISVPATSANLGPGFDTLGLALKIKNQVTIRPAKFHSVSLKGEG
FT                   SNNPILKDNNMFIAIFNDFYNNLSQKKRSFRFEFENQIPLSRGLGSSSAVIVSAIASAY
FT                   AIEEMELPKEKLLNLALAYESHPDNITPAVMGGFTVSSVEDNEVKFINKSIPKSLSAVV
FT                   VVPNRPISTQLSRKTLPYKYSKEDAIFNVSHSSLLTAAFMSENWEMLKIASQDKFHQSY
FT                   RMRQMPELFEVQKCSLNSGALMSTLSGSGSTLFSICYFEDAKKIEKELRAKFPHFKVFI
FT                   SGFDNYGIKVEA"
FT   gene            465048..465314
FT                   /locus_tag="Arnit_0479"
FT   CDS_pept        465048..465314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0479"
FT                   /product="protein of unknown function DUF448"
FT                   /note="InterPro IPR007393; KEGG: abu:Abu_2042 hypothetical
FT                   protein; PFAM: protein of unknown function DUF448; SPTR:
FT                   A8EWD6 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function (DUF448)"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92144"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="InterPro:IPR035931"
FT                   /db_xref="UniProtKB/TrEMBL:D5UZA7"
FT                   /protein_id="ADG92144.1"
FT                   /translation="MPKLEKPIRTCIVCRSKLSKENLIRLQCKDYKLISFDGIGRSFYI
FT                   CKECQSKTLLDEETKKIEKALFKQCKKKDEYLVQLKEIITHVR"
FT   gene            465304..467970
FT                   /locus_tag="Arnit_0480"
FT   CDS_pept        465304..467970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0480"
FT                   /product="translation initiation factor IF-2"
FT                   /note="COGs: COG0532 Translation initiation factor 2 (IF-2;
FT                   GTPase);
FT                   InterProIPR000178:IPR005225:IPR009000:IPR009061:IPR
FT                   006847:IPR000795:IPR004161; KEGG: abu:Abu_2043 translation
FT                   initiation factor IF-2; PFAM: protein synthesis factor
FT                   GTP-binding; translation initiation factor IF-2 domain
FT                   protein; elongation factor Tu domain 2 protein; SPTR:
FT                   A8EWD7 Translation initiation factor IF-2; TIGRFAM:
FT                   translation initiation factor IF-2; small GTP-binding
FT                   protein; PFAM: Elongation factor Tu domain 2;
FT                   Translation-initiation factor 2; Translation initiation
FT                   factor IF-2, N-terminal region; Elongation factor Tu GTP
FT                   binding domain; TIGRFAM: small GTP-binding protein domain;
FT                   translation initiation factor IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92145"
FT                   /db_xref="GOA:D5UZA8"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/TrEMBL:D5UZA8"
FT                   /protein_id="ADG92145.1"
FT                   /translation="MSDNVRVYEIAEEAGASSNHVINKAKDLGIELKSPQSQTTVEDAE
FT                   EIVNYIMTGKSKKLPQKKKVAKKVEPKIVKEEEPVVSEEPKPKEEITIKETKVEEPKEE
FT                   IKPVIEKPKKTEDTSPKKTDDTQEVTDTLSVKKVVPKRRGLKIVKKKKPEEVKVVKKEE
FT                   PTFSSDDSSQVKKPMKSLSEILGGNNNQENQTEAAKAKAKVQKKKAPPRAHEHGKVLEI
FT                   SKQEFKESDDSLLGEEVVLLDMGLTDTSKLFDDPHKPAKNNNDKQTRSSKPAAFGNRPQ
FT                   GLKRGRRKKRIKREVETAEVTEITIPEDVRVYEFAEACGKSASEVITVLFSLGMMVTKN
FT                   DFLKQDELEILGEEFGIEVTVKDALEDVNYVEDFNEEIDKSNFVTRPPVVTIMGHVDHG
FT                   KTSLLDKIRSAKVAKGEAGGITQHISAYTVEQNGKKITFVDTPGHAAFSEMRSRGASVT
FT                   DIIIIVVAADDGVKPQTEEVIAHAKASGCPIIVAMNKMDKETANPDMVKSQMAEKEMLP
FT                   IDWGGDIEFIGVSAHTGDGIDDLLENILIQAEMLELQADPSSKAKATVVEATLEKGRGP
FT                   VATVIVQSGTLRVGDNIVSDTTYGRVKAITNDMGQPVKELGLSETGNVLGLNDIPTSGS
FT                   VMVVQDSEKEARDIATTRAEHARAKELSKSTKVSLEEMSGLIAEGKIKQLPVIIKTDVG
FT                   GSLEAIKGSLEKIQNDEVKVKILHAAVGGITESDVVLAGASEGCIILGFNVRPTGSIKQ
FT                   KAKADGITINTYSIIYDLIDDIKATLSGMMSAVIREENTGQAEVKDTFVVPKIGTVAGC
FT                   LVTDGKVIKGEHARIIRDGIVTYTGKISSLKRFKDDAKEVVNGFECGIMFEKFNDIKVG
FT                   DFIETFIQIEEKINIDL"
FT   gene            467972..468328
FT                   /locus_tag="Arnit_0481"
FT   CDS_pept        467972..468328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0481"
FT                   /product="ribosome-binding factor A"
FT                   /note="COGs: COG0858 Ribosome-binding factor A; InterPro
FT                   IPR020053:IPR000238:IPR015946; KEGG: abu:Abu_2044
FT                   ribosome-binding factor A; SPTR: A8EWD8 Ribosome binding
FT                   factor A; TIGRFAM: ribosome-binding factor A; PFAM:
FT                   Ribosome-binding factor A; TIGRFAM: ribosome-binding factor
FT                   A"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92146"
FT                   /db_xref="GOA:D5UZA9"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/TrEMBL:D5UZA9"
FT                   /protein_id="ADG92146.1"
FT                   /translation="MKSVNLQRTESLLMELIPEALATLNDSRIKSLGITEVNCRNGKYD
FT                   AIVYYDGSDYDKKEHQILNNLLSKANGHIKTYCLNATGWYKCPNFKFQADDKLEKDLKI
FT                   ESLFDKIKKEKKED"
FT   sig_peptide     467972..468037
FT                   /locus_tag="Arnit_0481"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            468328..468756
FT                   /locus_tag="Arnit_0482"
FT   CDS_pept        468328..468756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0482"
FT                   /product="protein of unknown function DUF150"
FT                   /note="InterPro IPR003728; KEGG: abu:Abu_2045 hypothetical
FT                   protein; PFAM: protein of unknown function DUF150; SPTR:
FT                   A8EWD9 Ribosome maturation factor rimP; PFAM:
FT                   Uncharacterised BCR, YhbC family COG0779"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92147"
FT                   /db_xref="GOA:D5UZB0"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/TrEMBL:D5UZB0"
FT                   /protein_id="ADG92147.1"
FT                   /translation="MTLEESIEMTVKGCGVELYDILTTKENDRDIFRIYITSKDGVSLD
FT                   KCAEISRLVSPILDTNEPMYGKYNLEVSSPGIERKLKKTAHYISSIGENVKVKDFDKNV
FT                   LKGELIFADENEIKVKTQEGEETISYDKISSASTYFEW"
FT   gene            468772..469398
FT                   /locus_tag="Arnit_0483"
FT   CDS_pept        468772..469398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0483"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="COGs: COG1280 Putative threonine efflux protein;
FT                   InterPro IPR001123; KEGG: vsp:VS_II0834 putative threonine
FT                   efflux protein; PFAM: Lysine exporter protein (LYSE/YGGA);
FT                   SPTR: Q2BLH5 Putative threonine efflux protein-like; PFAM:
FT                   LysE type translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92148"
FT                   /db_xref="GOA:D5UZB1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:D5UZB1"
FT                   /protein_id="ADG92148.1"
FT                   /translation="MSFESSLTFFLAIFIFSITPGPGVFALLARGMTLGTKHCIPLAFG
FT                   MSISDIIYLVFACLGLATIAQNYALLFEFIRIAGALYLFYLGYKMFTTPIEIETVSKDK
FT                   APKKDFFFGFMQGFLISASNPKVILFYIAFLPTFLDIKSLNGYDIFIASTLALVALMIG
FT                   LMFISILASQAKQVLKSKKSLKRLNYTAGSIMIAAGSFLLFNRQA"
FT   sig_peptide     468772..468849
FT                   /locus_tag="Arnit_0483"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            469398..470405
FT                   /locus_tag="Arnit_0484"
FT   CDS_pept        469398..470405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0484"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /EC_number="3.5.4.26"
FT                   /note="COGs: COG0117 Pyrimidine deaminase; InterPro
FT                   IPR004794:IPR016193:IPR002125:IPR002734; KEGG: abu:Abu_2046
FT                   bifunctional riboflavin biosynthesis protein RibD; PFAM:
FT                   CMP/dCMP deaminase zinc-binding; bifunctional
FT                   deaminase-reductase domain protein; PRIAM:
FT                   Diaminohydroxyphosphoribosylaminopyrimidine deaminase;
FT                   SPTR: A8EWE0 Bifunctional riboflavin biosynthesis protein
FT                   RibD; TIGRFAM: riboflavin biosynthesis protein RibD; PFAM:
FT                   RibD C-terminal domain; Cytidine and deoxycytidylate
FT                   deaminase zinc-binding region; TIGRFAM: riboflavin
FT                   biosynthesis protein RibD"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92149"
FT                   /db_xref="GOA:D5UZB2"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D5UZB2"
FT                   /protein_id="ADG92149.1"
FT                   /translation="MVIDDKFYMKLAIDEAWKYQLLTYPNPAVGCVVVKNGEILAIEAH
FT                   KEAGMSHAEVNALKAAYLKKHANDTLKIKKSSREIHEYLLKNHNNFFNDCEIYVTLEPC
FT                   NHIGKTPSCANLLKELKPKRVIIAHEDTNKQASGGIQTLESVNIDITLDCMKKEAYDLL
FT                   YPFIKWNSGTFVFYKMAQTLNGSIDGKVSSTMAQLYVHTLRDKIDLMLIGGNTVRTDKP
FT                   TLDARYIAGRAPNVMIYSKNKIFDNNIPLFKVPNREVIISDDLFKLLDYKFVMVEGIYN
FT                   LMDALKERIDYIVLLVSPKIRKGVNALNEIDMDFKIVHENYIGEEKILFLKRTK"
FT   gene            470406..470723
FT                   /locus_tag="Arnit_0485"
FT   CDS_pept        470406..470723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0485"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; SPTR: A0DH50 Chromosome
FT                   undetermined scaffold_50, whole genome shotgun sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92150"
FT                   /db_xref="UniProtKB/TrEMBL:D5UZB3"
FT                   /protein_id="ADG92150.1"
FT                   /translation="MKIKKPIYVISLDSREVIKYDSLEYAQDDLEAYDLDEYKAYDSKF
FT                   RKLELYKLDKYNRVGFRLIDHNCSYPDELEVYIRNYLEVIGKSNIVGNLEHLLLFIESE
FT                   N"
FT   gene            complement(470858..471421)
FT                   /locus_tag="Arnit_0486"
FT   CDS_pept        complement(470858..471421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0486"
FT                   /product="translation elongation factor P"
FT                   /note="COGs: COG0231 Translation elongation factor P
FT                   (EF-P)/translation initiation factor 5A (eIF-5A);
FT                   InterProIPR011768:IPR020599:IPR008991:IPR016027:IPR
FT                   013185:IPR001059:IPR015365:IPR014722:IPR012340; KEGG:
FT                   abu:Abu_2047 elongation factor P; PFAM: Elongation factor
FT                   KOW domain protein; Elongation factor P/YeiP protein;
FT                   Elongation factor P; SPTR: A8EWE1 Elongation factor P;
FT                   TIGRFAM: translation elongation factor P; PFAM: Elongation
FT                   factor P, C-terminal; Elongation factor P (EF-P) KOW-like
FT                   domain; Elongation factor P (EF-P) OB domain; TIGRFAM:
FT                   translation elongation factor P"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92151"
FT                   /db_xref="GOA:D5UZB4"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/TrEMBL:D5UZB4"
FT                   /protein_id="ADG92151.1"
FT                   /translation="MANIGMSELKKGMKIQLDGIPYKITEYQHVKPGKGAAFVRCKIKS
FT                   FLNGKVIEKTFHAGDKCETPDLQQKTMQFLYDDGELLQFMDNNTYEQIGLTYDQVGEAF
FT                   DWIIDGMNCDMMFFNGSAITVEPPMTVELKIVDTPPNFKGDSQGGKKPATLESGAVVQI
FT                   PFHLVEGDIIKCDTRIGEYIEKVK"
FT   gene            complement(471434..473017)
FT                   /locus_tag="Arnit_0487"
FT   CDS_pept        complement(471434..473017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0487"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /note="COGs: COG0111 Phosphoglycerate dehydrogenase and
FT                   related dehydrogenase;
FT                   InterProIPR006140:IPR006236:IPR016040:IPR006139:IPR 002912;
FT                   KEGG: abu:Abu_2048 D-3-phosphoglycerate dehydrogenase;
FT                   PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; amino acid-binding ACT domain protein;
FT                   SPTR: A8EWE2 D-3-phosphoglycerate dehydrogenase; TIGRFAM:
FT                   D-3-phosphoglycerate dehydrogenase; PFAM: D-isomer specific
FT                   2-hydroxyacid dehydrogenase, NAD binding domain; ACT
FT                   domain; D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   catalytic domain; TIGRFAM: D-3-phosphoglycerate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92152"
FT                   /db_xref="GOA:D5UZB5"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR006236"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5UZB5"
FT                   /protein_id="ADG92152.1"
FT                   /translation="MSKHTIVVCDHIHENGLNILKAAEDINYVFAADIDKTALLDVIKD
FT                   ADVAITRSSTDVDEKFLNAAVNLKAIIRAGVGYDNVDMEGCSKRGIIAMNVPTANTIAA
FT                   VELTMTHMLSCMRKFPYAHNQLKNERVWKREDWYGNELFGKKLGVIGFGNIGHRVALRA
FT                   KSFEMDVVTYDPYIPSTKATDLGIKYTTNFDDILSCDIITIHTPKNQETIDMIGEDEIA
FT                   KMKDGVILINCARGGLYNEEALFNNLKSGKIAMAGIDVFKKEPAINNPLLDLPNITVTA
FT                   HLGANTRESQKEIAVQAARNAIESARGISYPNALNLPIDESKIPSFVKPYIELTQKIAF
FT                   LSAQTDKTAIRSITVSAQGEIKEYLDSLLTFATVGALKVAGGDEVNYVNAKFWAEEKGI
FT                   KVDTCEIINGSGYSNKVTVKITTEKGVNTISGTVFDEDVQRIVEVNGFVFDIAPKGNMI
FT                   FLRNSDIPGVIGTVGKTLGDNNINIADFRLSRGKDSALAVILVDTFVSHDVLKQLENLE
FT                   AAISVSYVEI"
FT   gene            complement(473035..474687)
FT                   /locus_tag="Arnit_0488"
FT   CDS_pept        complement(473035..474687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0488"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="COGs: COG0539 Ribosomal protein S1; InterPro
FT                   IPR003029:IPR000110:IPR016027:IPR012340; KEGG: abu:Abu_2049
FT                   30S ribosomal protein S1; PFAM: RNA binding S1 domain
FT                   protein; SPTR: A8EWE3 30S ribosomal protein S1; PFAM: S1
FT                   RNA binding domain; TIGRFAM: ribosomal protein S1"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92153"
FT                   /db_xref="GOA:D5UZB6"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D5UZB6"
FT                   /protein_id="ADG92153.1"
FT                   /translation="MGIEDIEIGEDFDFEQMLNESFENAENNSVVDGVIVEISGENVSV
FT                   DVGQKVEGRLHISEITIGGEVKYKVGDTIPVILTGIRGEKPSISHKKVLQKEKFDAFVK
FT                   EHTEDLEDVTIEGKIISIKPRGGFIIEDDNGCEYFMPMAQSYLKAQGALGKKVKAKVLK
FT                   INEAQNSIIVSRKKLIEESKIEKDAKVAQFLENDGLINGTIKKITSYGMFVDLGGIDGL
FT                   VNYNEISYKGPVNPSNYYAEGDEVTVKVLSYDKAKQHLSLSVKAALSNPWEEIRDELDV
FT                   GDTITVTISNFESYGAFVNLGNDIEGLLHISEISWNKNLKNPKDLLTLGDEVNVEVIEL
FT                   DVDKKRLRVSLKNLQEKPFAKFTKEHKVGDIVTGKVATLTEFGAFVTLGDVDGLLHNEE
FT                   ASWEGNAKCKNLYKKGDELEVKIIKIDKEKENISLSIKDITDSPAKKFQATHKIGDIVK
FT                   GTIKDLKDFGLFIKLEDNLDGLVRNEDFAPTTADNIEIGKEIEAVVVNIDTNRNRVRLS
FT                   IKRLEQQQEREILKSVNDDSSMTLGDLLKDQMK"
FT   gene            complement(474771..475604)
FT                   /locus_tag="Arnit_0489"
FT   CDS_pept        complement(474771..475604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0489"
FT                   /product="hydroxymethylbutenyl pyrophosphate reductase"
FT                   /EC_number="1.17.7.4"
FT                   /note="COGs: COG0761 Penicillin tolerance protein; InterPro
FT                   IPR003451; KEGG: abu:Abu_2050 4-hydroxy-3-methylbut-2-enyl
FT                   diphosphate reductase; PFAM: LytB protein; PRIAM:
FT                   4-hydroxy-3-methylbut-2-enyl diphosphate reductase; SPTR:
FT                   A8EWE4 4-hydroxy-3-methylbut-2-enyl diphosphate reductase;
FT                   TIGRFAM: hydroxymethylbutenyl pyrophosphate reductase;
FT                   PFAM: LytB protein; TIGRFAM:
FT                   (E)-4-hydroxy-3-methyl-but-2-enyl pyrophosphate reductase
FT                   (IPP and DMAPP forming)"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92154"
FT                   /db_xref="GOA:D5UZB7"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/TrEMBL:D5UZB7"
FT                   /protein_id="ADG92154.1"
FT                   /translation="MKVKLASSYGFCFGVKRAIKIAEEYKNSATMGPLIHNTNEIDRLK
FT                   NDYNVGLYNSLDEVKDNDTIIIRTHGIPKFDLKNLKAKDAKVINATCPFVTTPQQIVKK
FT                   MSAEEYSIVIFGDKDHPEVLGVQSYAKDQDDVFVILEPEDLNNIKFKYSKIATIAQTTK
FT                   KKEKYLEIVNTLIPKNKEVRVFNTICDATFENQDAARELSKEVDIMIVIGGKNSSNTKQ
FT                   LLNISKENCIDSYLLEDERELDPKWFKNKKLCGITAGASTPDWVIQKVVNQVEAY"
FT   gene            complement(475719..476999)
FT                   /locus_tag="Arnit_0490"
FT   CDS_pept        complement(475719..476999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0490"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /note="COGs: COG0128 5-enolpyruvylshikimate-3-phosphate
FT                   synthase; InterPro IPR001986:IPR006264:IPR016228:IPR013792;
FT                   KEGG: abu:Abu_2051 3-phosphoshikimate
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase); PRIAM:
FT                   3-phosphoshikimate 1-carboxyvinyltransferase; SPTR: A8EWE5
FT                   3-phosphoshikimate 1-carboxyvinyltransferase; TIGRFAM:
FT                   3-phosphoshikimate 1-carboxyvinyltransferase; PFAM: EPSP
FT                   synthase (3-phosphoshikimate 1-carboxyvinyltransferase);
FT                   TIGRFAM: 3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92155"
FT                   /db_xref="GOA:D5UZB8"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:D5UZB8"
FT                   /protein_id="ADG92155.1"
FT                   /translation="MQSFSIGALKKPFNIVIDNIASDKSISHRCAMFSLLSNETSHIKN
FT                   FLTAEDTLNTLSIVEQLGAEIKRDGSTVTITPKGTLTEPSNVLDCGNSGTAMRLFCGFL
FT                   ASIDGAFTLVGDKYLHSRPMKRVANPLRSIGAKIDGREDGNKAPLFIRGVKELKAFTYH
FT                   SPVDSAQVKSAMILAALRANGVSKYKENELTRDHTERMLKGMGAKLENDSEGFIHIYPL
FT                   TKPLKPLNITVPTDPSSAFFFALAAAITPNAKVTIKNVTLNPTRTEAYVVLKRMGANVE
FT                   FIEKENVYEPMGDIVVSANELNGVDVSENISWLIDELPALSIAMSLANGKSKVSNAKEL
FT                   RVKESDRISSVVNNLKLCGVTYKEFEDGYEITGGKLKKATINSHGDHRIAMSFAIAGLN
FT                   SGMQIQDVDCILTSFPNFKEILDTLKS"
FT   gene            complement(477000..479318)
FT                   /locus_tag="Arnit_0491"
FT   CDS_pept        complement(477000..479318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0491"
FT                   /product="phenylalanyl-tRNA synthetase, beta subunit"
FT                   /note="COGs: COG0072 Phenylalanyl-tRNA synthetase beta
FT                   subunit;
FT                   InterProIPR002547:IPR005121:IPR004532:IPR016027:IPR
FT                   009061:IPR005147:IPR012340; KEGG: abu:Abu_2052
FT                   phenylalanyl-tRNA synthetase subunit beta; PFAM:
FT                   ferredoxin-fold anticodon-binding; t-RNA-binding domain
FT                   protein; tRNA synthetase B5; SPTR: A8EWE6 Phenylalanyl-tRNA
FT                   synthetase, beta subunit; TIGRFAM: phenylalanyl-tRNA
FT                   synthetase, beta subunit; PFAM: tRNA synthetase B5 domain;
FT                   Ferredoxin-fold anticodon binding domain; Putative tRNA
FT                   binding domain; TIGRFAM: phenylalanyl-tRNA synthetase, beta
FT                   subunit, non-spirochete bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92156"
FT                   /db_xref="GOA:D5UZB9"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:D5UZB9"
FT                   /protein_id="ADG92156.1"
FT                   /translation="MIVTKRWLEDFIDISKIDINDICKKLNSIGLEVDSLEKIRIPSGV
FT                   VIGYVESKEKHPDADKLSVCQVNIGNEVTQIVCGAKNVAAGQYVPVATVGCVLGTDFKI
FT                   KKAKLRGLESNGMICSSTEIGLPKLNDGILELDDSIGELIIGKELNEYRLINDDIIDIE
FT                   LTANRGDCLSIHGVARELSVCYGVTLCEQEKNLEYNDIGIGQLLEIESDSTISSSLIYK
FT                   AGDFTELKVPILYKLRVATINLYKDCDLENILSYATHATGVTMYAYAKVDCDTLNDLSV
FT                   LHIKKSKDGFDEVYGKEKLSTISIKNEAINKDDTTYILEASYNNPEELSKNVFDKKIKT
FT                   GDVYYKTSRGSEPNIESGMEYFTTLISKFGAKLYRGYEVFTEDKERLSIDVSIKRVSSI
FT                   VGKTFTKVKIEKILSGLGFTVKDGGSGVLSVQVPLFRHDIKNIADITEEIVRIVGIDNI
FT                   ESNPLQIEEVNRLNETSNKITKKNKIRAKAIENGFFETLSYVFTSKETLEKYNLETVNE
FT                   KLDVLNPIVNELNTLRTTMLTNLIEACSNNFKQGFKKVAFFEIGTVFDTQRNESQKISF
FT                   IFSGDSEYESFTNNGKPANIEFFGFAKKVANAIGRFDLEPMNEINNLLIHPYQNANIIV
FT                   DNKKIGFISKLHPNVANDYDLPDTFIAEIDFEKIKNNLIKANEYSKFQASKRDLSLIVP
FT                   KDISYSRIRNVINSIEDATIQQFNLVDTYSDEKLGDKESLTIRFVLQSFDKTLEEDHIN
FT                   ATMNTILEKLNLALGIGIR"
FT   gene            complement(479315..480307)
FT                   /locus_tag="Arnit_0492"
FT   CDS_pept        complement(479315..480307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0492"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="COGs: COG0016 Phenylalanyl-tRNA synthetase alpha
FT                   subunit;
FT                   InterProIPR006195:IPR004529:IPR010978:IPR004188:IPR 002319;
FT                   KEGG: abu:Abu_2053 phenylalanyl-tRNA synthetase subunit
FT                   alpha; PFAM: phenylalanyl-tRNA synthetase class IIc;
FT                   aminoacyl tRNA synthetase class II domain protein; PRIAM:
FT                   Phenylalanine--tRNA ligase; SPTR: A8EWE7 Phenylalanyl-tRNA
FT                   synthetase, alpha subunit; TIGRFAM: phenylalanyl-tRNA
FT                   synthetase, alpha subunit; PFAM: tRNA synthetases class II
FT                   core domain (F); Aminoacyl tRNA synthetase class II,
FT                   N-terminal domain; TIGRFAM: phenylalanyl-tRNA synthetase,
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92157"
FT                   /db_xref="GOA:D5UZC0"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/TrEMBL:D5UZC0"
FT                   /protein_id="ADG92157.1"
FT                   /translation="MKEWIEKIESADSIEALENLRIEILGKKGFLTKEFARLKDIPNEE
FT                   KKAFAQDLNTKKIEITNALESKKEILEKIELNKKLEAERIDVSRFNNKLTCGAVHPVVD
FT                   TMDKIISYFQNLNFAVEEGPLVEDDFHNFEALNLPKYHPARDMQDTFYNKDYSLLRTHT
FT                   SPVQIRTMLAQKPPIRMIAPGTVFRRDYDITHTPMFHQIEGLVVDDSDKISFSNLKHVM
FT                   EEFLKHMFGNVEVRFRPSFFPFTEPSAEVDISCVFCKGDGCRVCSHTGWIEILGCGIVD
FT                   QNVFKAVGYEDMSGYAFGMGIERVAMLIHNIGDLRSLFESDLRLLGQFK"
FT   gene            480410..480754
FT                   /locus_tag="Arnit_0493"
FT   CDS_pept        480410..480754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0493"
FT                   /product="histidine triad (HIT) protein"
FT                   /note="COGs: COG0537 Diadenosine tetraphosphate (Ap4A)
FT                   hydrolase and other HIT family hydrolase; InterPro
FT                   IPR001310:IPR019808:IPR011146:IPR011151; KEGG: abu:Abu_2054
FT                   HIT family protein; PFAM: histidine triad (HIT) protein;
FT                   SPTR: A8EWE8 HIT family protein; PFAM: HIT domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92158"
FT                   /db_xref="GOA:D5UZC1"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:D5UZC1"
FT                   /protein_id="ADG92158.1"
FT                   /translation="MCIFCKIVNGEIPNKTILEDEKFLAFEDINPACKVHALIIPKEHY
FT                   TSFDVVPPKVMAGMTEFIQKVASKLNLRDDGYRLITNIGEQGGQVVHHLHFHVLGGEYV
FT                   GSLVGNKNKE"
FT   gene            complement(480778..481716)
FT                   /locus_tag="Arnit_0494"
FT   CDS_pept        complement(480778..481716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0494"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   alpha subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="COGs: COG0825 Acetyl-CoA carboxylase alpha subunit;
FT                   InterPro IPR011763:IPR001095:IPR020582; KEGG: abu:Abu_2055
FT                   acetyl-CoA carboxylase carboxyltransferase subunit alpha;
FT                   PFAM: Acetyl-CoA carboxylase, alpha subunit, conserved
FT                   region; PRIAM: Acetyl-CoA carboxylase; SPTR: A8EWE9
FT                   Acetyl-coenzyme A carboxylase carboxyl transferase subunit
FT                   alpha; TIGRFAM: acetyl-CoA carboxylase, carboxyl
FT                   transferase, alpha subunit; PFAM: Acetyl co-enzyme A
FT                   carboxylase carboxyltransferase alpha subunit; TIGRFAM:
FT                   acetyl-CoA carboxylase, carboxyl transferase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92159"
FT                   /db_xref="GOA:D5UZC2"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D5UZC2"
FT                   /protein_id="ADG92159.1"
FT                   /translation="MSTYLTFEEKIKAIEEDIIVAKSKSDEHAVEILDKKLEKEVEKTF
FT                   KNLTDYQKLQLARHPDRPYALDYIRGLLTDAYEIHGDRHFTDDNAIVCYLGKIGDEKVV
FT                   VIGEQKGRGTKNKLKRNFGMPSPEGYRKALRAAKLAEKFNLPILMLVDTPGAYPGIGAE
FT                   ERNQSEAIAKNLYEFSDLKTITISVVIGEGGSGGALAISIADKLAMMRYSVYAVISPEG
FT                   CAAILWNDPAQAETAANSLKITAESLKSLNLIDDVINEPLIGAHRSKDEAIKALADYFL
FT                   ESVKELRNMSQEERYEKRYEKLMSLGSFSQK"
FT   gene            complement(481758..483017)
FT                   /locus_tag="Arnit_0495"
FT   CDS_pept        complement(481758..483017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0495"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase 2"
FT                   /note="COGs: COG0304 3-oxoacyl-(acyl-carrier-protein)
FT                   synthase;
FT                   InterProIPR017568:IPR016039:IPR014030:IPR014031:IPR 016038;
FT                   KEGG: abu:Abu_2056 3-oxoacyl-(acyl carrier protein)
FT                   synthase II; PFAM: Beta-ketoacyl synthase; SPTR: A8EWF0
FT                   Beta ketoacyl-(Acyl carrier protein) synthase II; TIGRFAM:
FT                   3-oxoacyl-[acyl-carrier-protein] synthase 2; PFAM:
FT                   Beta-ketoacyl synthase, N-terminal domain; Beta-ketoacyl
FT                   synthase, C-terminal domain; TIGRFAM:
FT                   3-oxoacyl-[acyl-carrier-protein] synthase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92160"
FT                   /db_xref="GOA:D5UZC3"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:D5UZC3"
FT                   /protein_id="ADG92160.1"
FT                   /translation="MKRVVITGLGTINSLGHNVNESFDAVVAGKCGIRDITLFDASEYS
FT                   VKFAGEVKDFDPTTVMDKKEVKKADRFIQLGIKAAKEAMLDSGFTSEENNKVSDELSPR
FT                   FGVISASGIGGLSTIEKNSVVCDTKGPRRISPFFIPSSLVNMLGGFISIEHGLRGPNLS
FT                   HVTACSASTHALSDAVKTIALGGADSVLVVGAEAAICGAGIGGFAAMKALSTRNDDPQT
FT                   ASRPFDKDRDGFVMGEGAGALVVETLDSALARGAKIYAEIIAFGESADANHITAPVMDG
FT                   PLRAMRAAFEMVKSNTGEYPKIDYINTHGTSTPVGDGNETKAIKELFGGKENCPPVTST
FT                   KGQIGHCLGAAGAIEAIFTIKSLNEGIIPPTINMINPDEECDLDYVPNVARKAELTTVM
FT                   SNNFGFGGTNGSIIFKKFIK"
FT   gene            complement(483150..483380)
FT                   /locus_tag="Arnit_0496"
FT   CDS_pept        complement(483150..483380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0496"
FT                   /product="acyl carrier protein"
FT                   /note="InterPro IPR009081:IPR006162:IPR003231:IPR006163;
FT                   KEGG: abu:Abu_2057 acyl carrier protein, putative; PFAM:
FT                   phosphopantetheine-binding; SPTR: A8EWF1 Acyl carrier
FT                   protein; TIGRFAM: acyl carrier protein; PFAM:
FT                   Phosphopantetheine attachment site; TIGRFAM: acyl carrier
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92161"
FT                   /db_xref="GOA:D5UZC4"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:D5UZC4"
FT                   /protein_id="ADG92161.1"
FT                   /translation="MALLDDVKEVVVEQLDCDPAEVKEDSKFIEDLGADSLDVVELVMA
FT                   LEEKFDIEIPDEDAEKILTVSDAIKYIEDNK"
FT   gene            complement(483458..484201)
FT                   /locus_tag="Arnit_0497"
FT   CDS_pept        complement(483458..484201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0497"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="COGs: COG1028 Dehydrogenase with different
FT                   specificities (related to short-chain alcohol
FT                   dehydrogenase); InterPro
FT                   IPR002198:IPR011284:IPR002347:IPR016040; KEGG: abu:Abu_2058
FT                   3-ketoacyl-(acyl-carrier-protein) reductase; PFAM:
FT                   short-chain dehydrogenase/reductase SDR; SPTR: A8EWF2
FT                   3-oxoacyl-(Acyl carrier protein) reductase; TIGRFAM:
FT                   3-oxoacyl-(acyl-carrier-protein) reductase; PFAM: short
FT                   chain dehydrogenase; TIGRFAM:
FT                   3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92162"
FT                   /db_xref="GOA:D5UZC5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5UZC5"
FT                   /protein_id="ADG92162.1"
FT                   /translation="MKFTGSNVLVTGASRGIGAQIAKTLASHGLKVWINYRSGADAASK
FT                   IQEEIEAAGGKAAIIKADVTNEDEFVSAINTIIDSDGELSYLVNNAGITKDKLALRMSV
FT                   QDFNDVISANLTSAFIGCKAALKVMGKKRFGSIVNISSIVGEMGNPGQTNYSASKGGLN
FT                   AMTKSFAKEAASRSIRYNAVTPGFIQTDMTDELKDEVKAEYEKNIPLSRFGKPSEIADA
FT                   VAFLLSDHSSYITGEILKVNGGLYV"
FT   gene            complement(484268..485017)
FT                   /locus_tag="Arnit_0498"
FT   CDS_pept        complement(484268..485017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0498"
FT                   /product="Radical SAM domain protein"
FT                   /note="COGs: COG0602 Organic radical activating protein;
FT                   InterPro IPR007197; KEGG: abu:Abu_2059 radical SAM
FT                   domain-containing protein; PFAM: Radical SAM domain
FT                   protein; SPTR: A8EWF3 Radical SAM domain protein; PFAM:
FT                   Radical SAM superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92163"
FT                   /db_xref="GOA:D5UZC6"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="UniProtKB/TrEMBL:D5UZC6"
FT                   /protein_id="ADG92163.1"
FT                   /translation="MLEVNEIFGPTIQGEGKYVGNPSIFIRFGKCNFRCEGFAVEYETP
FT                   SGVKKCSCDSFYAVDPAFKDQWHKMNKNEIINQVKKLEPSYKVDIVITGGEPLLYWKDE
FT                   EFQEILKYYISNGYKVTIETNGSLNIDFTKEYQKELIFSMSVKLSNSLEPLKKRVNEET
FT                   LKKIITNTKESYLKFVISKEFITKAKEEIELISSIIPNCDIYLMPMGDSAYEINKHSES
FT                   VINMAINSGYKYCDRLHIRVWDNKRGV"
FT   gene            complement(485010..485546)
FT                   /locus_tag="Arnit_0499"
FT   CDS_pept        complement(485010..485546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0499"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: abu:Abu_2060 hypothetical protein; SPTR:
FT                   C1ZZD3 Putative uncharacterized protein; PFAM: 6-pyruvoyl
FT                   tetrahydropterin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92164"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:D5UZC7"
FT                   /protein_id="ADG92164.1"
FT                   /translation="MKWNISKEFDFCYGHRVWSQELNPDFSLDTCLMCRHLHGHQGKVI
FT                   VHLESSSLKNGMVTDFKHLNWFKKFLDDTLDHKFVLDLNDPLFETLLPHFKNKEELFFH
FT                   EEGFYTFDLNSIKDEPIHIRELYEGYVLVDFVPTSENLSAWLLEIIQTKMNELPIEVSH
FT                   VEFLETPKSKSTVYA"
FT   gene            complement(485546..486217)
FT                   /locus_tag="Arnit_0500"
FT   CDS_pept        complement(485546..486217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0500"
FT                   /product="exsB protein"
FT                   /note="COGs: COG0603 PP-loop superfamily ATPase; InterPro
FT                   IPR004479:IPR018317; KEGG: abu:Abu_2061 ExsB family
FT                   transcriptional regulator; PFAM: Queuosine synthesis-like;
FT                   SPTR: A8EWF5 Queuosine biosynthesis protein queC; TIGRFAM:
FT                   exsB protein; PFAM: ExsB; TIGRFAM: exsB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92165"
FT                   /db_xref="GOA:D5UZC8"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/TrEMBL:D5UZC8"
FT                   /protein_id="ADG92165.1"
FT                   /translation="MSKKAICILSGGMDSTLSSYIAKNEGYEIIAIHFNYGQRTEKREL
FT                   KAFRDVCENLNVKNKYEIDIPFFTQIGASALTDANIDVPIDGVKPGVPVTYVPFRNGIF
FT                   LSIAAAVAEKENAEAMFIGVVEEDSSGYPDCTDAFINQIKNAINEGTKEATHISIKTPL
FT                   VKLHKSEIVKKALELNVPLELTWSCYKEEKEACGVCDSCRLRLNGFAQANSKDPIPYKG
FT                   S"
FT   gene            complement(486210..487430)
FT                   /locus_tag="Arnit_0501"
FT   CDS_pept        complement(486210..487430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0501"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="COGs: COG0303 Molybdopterin biosynthesis enzyme;
FT                   InterPro IPR020817:IPR005110:IPR001453:IPR005111; KEGG:
FT                   tdn:Suden_1912 molybdopterin binding domain-containing
FT                   protein; PFAM: MoeA domain protein domain I and II;
FT                   molybdopterin binding domain; MoeA domain protein domain
FT                   IV; SPTR: B6BHS7 Molybdopterin binding domain protein;
FT                   TIGRFAM: molybdenum cofactor synthesis domain protein;
FT                   PFAM: Probable molybdopterin binding domain; MoeA
FT                   N-terminal region (domain I and II); MoeA C-terminal region
FT                   (domain IV); TIGRFAM: molybdenum cofactor synthesis domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92166"
FT                   /db_xref="GOA:D5UZC9"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:D5UZC9"
FT                   /protein_id="ADG92166.1"
FT                   /translation="MSVSIEEALNIIVNSIQINKFEIVPIENATSRISAENLHATISLP
FT                   KFNNSAMDGYAILFEDKDKELTLTNKIFAGDNNQDILETGTTIKIMTGARVPQNCEAVV
FT                   PQENTQTIGSRIKITSDIRKMQHIRFIGEDIQKDEILVKKGEELNFSKITLLASQGISH
FT                   VKVYKKPKVVVFASGEELKLHYQGIKEYQIYNSNTPTFIARTKELGCDVSFIGQAKDSI
FT                   ESIKEHVLNSLGADLIITSGGVSVGEADFTRESFTQVGLETLFDGVNVKPGKPTIFGKI
FT                   KDTFILNLPGNPLASAMVFEMLGQIIIQKMIGSKDFYHNFIMAKLDQTLLNKKGRLTLL
FT                   PGFFDGEKFTPSDKKSPGMVSVLCKCNSFIALDENVSKLNENQEVKVIPINWKFFCDKK
FT                   KDYITYE"
FT   gene            487502..487906
FT                   /locus_tag="Arnit_0502"
FT   CDS_pept        487502..487906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0502"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: abu:Abu_2062 hypothetical protein; SPTR:
FT                   A8EWF6 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92167"
FT                   /db_xref="GOA:D5UZD0"
FT                   /db_xref="UniProtKB/TrEMBL:D5UZD0"
FT                   /protein_id="ADG92167.1"
FT                   /translation="MDFSSSTIDTHVFFVYLFISVMIINFYSVYNINNFIKLAKRLKFF
FT                   TPLYHTLNAIIIYTGTIVAFYQRTFSFTIFIMIAAAIAVMVLEIKRFKKMRVIKSDDTQ
FT                   LQEEFFRFSRKIYLIEIIIIVFTYIISKIF"
FT   gene            487906..488574
FT                   /locus_tag="Arnit_0503"
FT   CDS_pept        487906..488574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0503"
FT                   /product="protein of unknown function DUF558"
FT                   /note="COGs: COG1385 conserved hypothetical protein;
FT                   InterPro IPR006700; KEGG: abu:Abu_2063 16S ribosomal RNA
FT                   methyltransferase RsmE; PFAM: protein of unknown function
FT                   DUF558; SPTR: A8EWF7 Putative uncharacterized protein;
FT                   PFAM: RNA methyltransferase; TIGRFAM: RNA
FT                   methyltransferase, RsmE family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92168"
FT                   /db_xref="GOA:D5UZD1"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D5UZD1"
FT                   /protein_id="ADG92168.1"
FT                   /translation="MQFVYSSEASLETIKVEGDIYKYLFKARREKIGSTVFFRNLKNNF
FT                   IYSYEIFDISKKDANLRLIKKEEKIVEANNKLHIIWAIVDPKTIEKQLPYLNEIGVDKI
FT                   TFFYADYSQKNFKLNIEKFEKILINSSQQCGRSSIIKLEIIASLDEVLTSYKDSFVFNF
FT                   SNNHINDKKDIKSIIVGCEGGFSPKELEKFTEEKTVGINSNLILRSETAVTTIAAKLIV
FT                   "
FT   gene            complement(488681..489352)
FT                   /locus_tag="Arnit_0504"
FT   CDS_pept        complement(488681..489352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0504"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="COGs: COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain; InterPro IPR001789:IPR011006:IPR001867; KEGG:
FT                   abu:Abu_1736 two-component response regulator; PFAM:
FT                   response regulator receiver; transcriptional regulator
FT                   domain protein; SMART: response regulator receiver; SPTR:
FT                   A8EVL0 Two-component response regulator; PFAM: Response
FT                   regulator receiver domain; Transcriptional regulatory
FT                   protein, C terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92169"
FT                   /db_xref="GOA:D5UZD2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D5UZD2"
FT                   /protein_id="ADG92169.1"
FT                   /translation="MLGTKILFLEDDKLYQETIKDLLEEENFIIDTCSNGEKFLNKIYD
FT                   NIYDLYILDINVPQIDGYEIMRILNEYEDETLRLVLTSISNSIIRSFKSGCDGFLNKTG
FT                   NNQELILRIQSLIKRSYRTYHQDIIISENLSYNIFSKELFYNQEPLEMEPQTLLVLNYL
FT                   IKNRGNFVSKESLEKNVYPSNSNSKADVIRYHIWHLRKILGVDIIESQKNRGYRLKPIG
FT                   V"
FT   gene            complement(489414..490607)
FT                   /locus_tag="Arnit_0505"
FT   CDS_pept        complement(489414..490607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0505"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: wsu:WS0750 hypothetical protein; SPTR: C1ZXD2
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92170"
FT                   /db_xref="GOA:D5UZD3"
FT                   /db_xref="UniProtKB/TrEMBL:D5UZD3"
FT                   /protein_id="ADG92170.1"
FT                   /translation="MDASILLALRDPAGVPFYPVVFQVLYVLTWALHAAFVFLALGSMG
FT                   LSLYGTFKQKSDENWKILTPHLIQTGKISISILIVLGVAPLLFTQVIYDPNWYVTNTLS
FT                   GMWVFIFIYTLVLGYILYYWYYFANKKNQGGGKLIGIISFLILIFAGTLMHNFAVTSLM
FT                   PNDWMNMYAPNGIVDNSGWTFNVDTVRLIFMLSLSIPVVGLFLQNYSRFLSTREDFSET
FT                   FVKYTASLGTKIGVVGLIISAVAFVAWMLQVGYLLHPLSIAIVIGVVVLLFMILKNSNS
FT                   YITTIVLVVVALLISAMRELIRFDIMAKLGYSIYEYPVNLEIPTIVMFLLTFLVLGGVG
FT                   VAYLLTLAWKVGKNQGVFDGTKDKAVTKLGNYTLSIMVLWMVVYFGWGMTILFMNIL"
FT   gene            complement(490616..491953)
FT                   /locus_tag="Arnit_0506"
FT   CDS_pept        complement(490616..491953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0506"
FT                   /product="cytochrome c class I"
FT                   /note="InterPro IPR009056:IPR003088; KEGG: wsu:WS0749
FT                   hypothetical protein; PFAM: cytochrome c class I; SPTR:
FT                   C1ZXD1 Cytochrome bd-type quinol oxidase, subunit 1; PFAM:
FT                   Cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92171"
FT                   /db_xref="GOA:D5UZD4"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D5UZD4"
FT                   /protein_id="ADG92171.1"
FT                   /translation="MDIIGQFPLFYFPEYGSAWMMGMTGTIHILASHTSVGAAMLFAYL
FT                   SYKAYKENRTDLYPYMKKYGMFLLIFSYVIGSITGPGIWYTATAASPRGISALIHNFVW
FT                   VWATEWVFFVFEVIGVFVLVYFIDKIDKKTHLKLTFSFAMASVGTLALIIGIISFMMWP
FT                   GTQEYYTTGSASDAFFGINTFPHMFLRIGFMIMLSGVIGLIISSAMKKDNLELSRELTK
FT                   KMGYISMLGGFLVLFFFMWYMGTLPDNAHAVFNITKADVIQSRIILTIVFSIYFLVAIV
FT                   KPQFISTPLAGVMVFVILIAGIWPGEKLRESMRKPYVAGQYIYSNQIISRDVPGKGIKS
FT                   ELPIIAQKGLLQVNPFVPENLKVITEENKHEAGKLLARMACSNCHSLEKTGKYRPLKDR
FT                   LAGMDKEAIKSILYAIGAGGMPYMPTLKLPENETDAIAQYLASMKY"
FT   gene            complement(492112..493140)
FT                   /locus_tag="Arnit_0507"
FT   CDS_pept        complement(492112..493140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0507"
FT                   /product="ubiquinol cytochrome c oxidoreductase, cytochrome
FT                   c1 subunit"
FT                   /note="COGs: COG2857 Cytochrome c1; InterPro
FT                   IPR009056:IPR013838; KEGG: abu:Abu_2064 ubiquinol
FT                   cytochrome c oxidoreductase, cytochrome c1 subunit; SPTR:
FT                   A8EWF8 Ubiquinol cytochrome c oxidoreductase, cytochrome c1
FT                   subunit; PFAM: Cytochrome c; Cytochrome C1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92172"
FT                   /db_xref="GOA:D5UZD5"
FT                   /db_xref="InterPro:IPR002326"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR021195"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D5UZD5"
FT                   /protein_id="ADG92172.1"
FT                   /translation="MRELKILAVVVSLTLLTYYLVEPFAHSKMHPHVDAPNYNFPQADK
FT                   VTDAENVEKAKVALEEAEKAGKEKAIKSAKTDLANAEKFEKDTNAFWASAKAAIADKGN
FT                   VANGEVLVTSNCTACHSIESKGFPPVMDNASAAAAYGVVPPDLGTAGKLYTKDYLVGFI
FT                   MNPARASKVTHKFVDGRVHPMPGFDWMQPQELADIVAYLESIAPKTMTDKEVFHNACQR
FT                   CHSIKYGDMQKGTMQAFTPDANIKTYMGKVPPDLSQYIKSRGAKYIHEFVNDPQKHLEG
FT                   TAMPRVGLTQASEKQVVGYLEKVGDSKKAQREELGPKFLIYLVIFAIFAWLWKSKQWRE
FT                   MH"
FT   gene            complement(493137..494387)
FT                   /locus_tag="Arnit_0508"
FT   CDS_pept        complement(493137..494387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0508"
FT                   /product="Cytochrome b/b6 domain protein"
FT                   /note="COGs: COG1290 Cytochrome b subunit of the bc
FT                   complex; InterPro IPR005797:IPR005798:IPR016174:IPR016175;
FT                   KEGG: abu:Abu_2065 ubiquinol cytochrome c oxidoreductase,
FT                   cytochrome b subunit; PFAM: Cytochrome b/b6 domain; SPTR:
FT                   A8EWF9 Cytochrome b; PFAM: Cytochrome
FT                   b(N-terminal)/b6/petB; Cytochrome b(C-terminal)/b6/petD"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92173"
FT                   /db_xref="GOA:D5UZD6"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:D5UZD6"
FT                   /protein_id="ADG92173.1"
FT                   /translation="MAKFEKANSVGEWLDQRLNLTAFNKVMMTEYWIPKDINFLWAMGV
FT                   LLATTFGILIISGIFLMMYYKPDIHLAFDSVNYTIMQEVKFGWLFRHMHAVAASVVFLI
FT                   IYIHMFTGIYYGSYKQGREMIWISGMLLFMTFSAAGFSGYMLPWGQMSYWAAMVITNLF
FT                   GGIPFIGDALVVWIRGDFNVADATLTRFFMLHVFLLPVVIMGIIALHFYTLRVPHVNNQ
FT                   DSEELDFDAEAEKYLSGNKKESKVIPFWPVFISKDLAVMGIFFIFYFYLVFFHYDFAMD
FT                   PVNFDPADNMVTPTHIYPEWYFLWSYEVLRGSIFNVGSLKAGDIGLMAFGFANVIFLLL
FT                   PFLDRDPKILPAHKRPKFFIWFWILMIDLIALTALGKLPPQGIFTYLGFVAMVSFILLF
FT                   LSLPLITKSDAKKRGDV"
FT   gene            complement(494400..494906)
FT                   /locus_tag="Arnit_0509"
FT   CDS_pept        complement(494400..494906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0509"
FT                   /product="ubiquinol-cytochrome c reductase, iron-sulfur
FT                   subunit"
FT                   /note="COGs: COG0723 Rieske Fe-S protein;
FT                   InterProIPR017941:IPR017909:IPR006311:IPR006317:IPR 005805;
FT                   KEGG: abu:Abu_2066 ubiquinol cytochrome c oxidoreductase,
FT                   2Fe-2S subunit; PFAM: Rieske [2Fe-2S] iron-sulphur domain;
FT                   SPTR: A8EWG0 Ubiquinol-cytochrome c reductase iron-sulfur
FT                   subunit; TIGRFAM: ubiquinol-cytochrome c reductase,
FT                   iron-sulfur subunit; PFAM: Rieske [2Fe-2S] domain;
FT                   Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal;
FT                   TIGRFAM: ubiquinol-cytochrome c reductase, iron-sulfur
FT                   subunit; Tat (twin-arginine translocation) pathway signal
FT                   sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92174"
FT                   /db_xref="GOA:D5UZD7"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR019470"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:D5UZD7"
FT                   /protein_id="ADG92174.1"
FT                   /translation="MSNETNRRDFIGYSFAAVAAVGGAAALVGMKQAWDPLPSVLAGGF
FT                   TTVDLSTIKAGEPETFVWRGKPVFVLKKTSDMDQSKRDLIVGSDRFIIAIGLCTHLGCI
FT                   PAWKKDVWKCACHGGEYNASAKNIFGPPPRPLDVPPFKLEGTKVVLGESSPEYKKIAAF
FT                   VATEA"
FT   sig_peptide     complement(494829..494906)
FT                   /locus_tag="Arnit_0509"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(495085..496563)
FT                   /locus_tag="Arnit_0510"
FT   CDS_pept        complement(495085..496563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0510"
FT                   /product="threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /note="COGs: COG0498 Threonine synthase; InterPro
FT                   IPR000634:IPR004450:IPR001926; KEGG: abu:Abu_2067 threonine
FT                   synthase; PFAM: Pyridoxal-5'-phosphate-dependent protein
FT                   beta subunit; PRIAM: Threonine synthase; SPTR: A8EWG1
FT                   Threonine synthase; TIGRFAM: threonine synthase; PFAM:
FT                   Pyridoxal-phosphate dependent enzyme; TIGRFAM: threonine
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92175"
FT                   /db_xref="GOA:D5UZD8"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:D5UZD8"
FT                   /protein_id="ADG92175.1"
FT                   /translation="MNFIETRGNDGVKAKEVSFSEAILSPSASFGGLYVPKSLPKLEDD
FT                   FLQNHINSSYKELAYDILKAFDIDIDESEIKKALDLYDNFDDASNPCPVVKIENDLFVH
FT                   EQYHGPTRAFKDMALQPFGSILSSIAKSKDEKYLILAATSGDTGPAALNTFKNKDNIQV
FT                   ACLYPSGGTSDVQRLQMVTEDGANLKVIGIKGNFDDAQTALKRLLASNTFKDELEKDGI
FT                   KLSAANSVNFGRIIFQIIYHFWSYIQLLKQNEITFGEKIYLVVPSGNFGNVLGGFYALN
FT                   MGVPIEKLLVASNENNILTQWINTGIYDIRGKELQLTKSPAMDILKSSNIERVIYSLYG
FT                   AKRTKELMESLNENLFFEMTQEETKELQKYFSAVNSDDEYGINIIKKYIDKDYIMDPHT
FT                   ATCLKAYETLKEKELKTVMYSTAEWTKFSPTVLNAISQNNEKYDDKTALENISKTCNVK
FT                   IPDSISELFNSKILHDEVVEKEKIESKIIEFISK"
FT   gene            complement(496578..497477)
FT                   /locus_tag="Arnit_0511"
FT   CDS_pept        complement(496578..497477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0511"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="COGs: COG0548 Acetylglutamate kinase; InterPro
FT                   IPR004662:IPR011148:IPR001048; KEGG: abu:Abu_2068
FT                   acetylglutamate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase; PRIAM: Acetylglutamate kinase; SPTR: A8EWG2
FT                   Acetylglutamate kinase; TIGRFAM: acetylglutamate kinase;
FT                   PFAM: Amino acid kinase family; TIGRFAM: acetylglutamate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92176"
FT                   /db_xref="GOA:D5UZD9"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/TrEMBL:D5UZD9"
FT                   /protein_id="ADG92176.1"
FT                   /translation="MQIKNTTVETLLEAIPYIKKFYGKIIVIKYGGSAQTSPALQEKFA
FT                   QDIALLSLVGIKPVIVHGGGARISELLKKLEIHSEFIDGHRVTCADSMRVVEMVLSGEI
FT                   NKNITSLLNHHGAKAIGISGKDSSIIKAQAKDGGKFGYTGVITEINGKMITNLINEGFV
FT                   PVIAPIADAKEPGHPGFNINADVAASKIAIALGAQKVLFLTDIVGVLDKDKNLLNSLDK
FT                   SDVEAYKEDGTIAGGMIPKVDSCIDAIYNGVNKAHIIDGRVEHSIILELFTSDGIGTQF
FT                   VRKDNPNNGINLEKLLND"
FT   gene            497573..500308
FT                   /locus_tag="Arnit_0512"
FT   CDS_pept        497573..500308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0512"
FT                   /product="UvrD/REP helicase"
FT                   /note="COGs: COG1074 ATP-dependent exoDNAse (exonuclease V)
FT                   beta subunit (contains helicase and exonuclease domains);
FT                   InterPro IPR014016:IPR014017:IPR000212; KEGG: abu:Abu_2069
FT                   putative recombination protein RecB; PFAM: UvrD/REP
FT                   helicase; SPTR: A8EWG3 ATP-dependent DNA helicase, UvrD/REP
FT                   family; PFAM: UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92177"
FT                   /db_xref="GOA:D5UZE0"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:D5UZE0"
FT                   /protein_id="ADG92177.1"
FT                   /translation="MKNYLALKASAGSGKTFALTVRYISLLLKGASPTEILALTFTNKA
FT                   AKEMSERIFKTLKSLGEDKVYLEQISSVSELSVEQILNKKDYLINLYLNSELSIYTIDK
FT                   FVNKILREFSGYIGVDDDFSIKQDNIENLEYKFLQSLNLENFDKLINFSYYEAKKFNSI
FT                   FDIFLNLNEKNEDFKIVPIEENLINLQKNLALEIAFRLKKHIQNCPSASNAALKSVDFE
FT                   NFEELLLKGKTWLTKEVSTDSRDFKKCSNEEFEQNFQELKMQISNYYKLRSSYSLSSLY
FT                   ELYKLFKDFKKSYNKNKNYFTFNDISNYVYELLSSKIDKDFLYFRLDSKYNHILIDEFQ
FT                   DTSLLQYKILEPLIEEALSGNSEKFKSFFYVGDIKQSIYRFRGGKRELFDFVSKKHNQI
FT                   ETEILNTNFRSAKNIVEFVNRAFINLNNYEYYEQLSNIENGYVEVISDDKLKEEEKYQT
FT                   IASTIAKLIRKNIDPNSIAILTYTNDDVLELYSYLSKMFPTLKISTEMTSKLINQENVK
FT                   ACINAIKYLYYKENIYKENLNAIIGNAPNTKLDFDFDLEENKVFELVLKVAKYFNILDD
FT                   NVIKFVEESKNFTDIVDFVYEVDLMETPIENKEQIGLQILTIFKSKGLEFDTVILLDRI
FT                   KNKNADRSSLLFEYSGVYLDNLYYKISNLENFDKNYKRALNKEKALQAEDELNILYVAL
FT                   TRAKSNLFIFKKEEKSVFDLLGLESCKIGELVINEFTKDSNEKIEKIEYKPLSLGRQKN
FT                   KSVKDYDEDFELKARYFGIATHYCLEMMNDFTIEQLEYSLNLTKSRYSVYLKDNDFDEI
FT                   KQRISLLIQNEEFNSFLEDANFLREQSLIYNGEIKIIDLLIEKENKYYIFDYKTTVQEN
FT                   TEHEKQISFYKKAIKEISNSDEVYAYLVYLGNEKAYLKAI"
FT   gene            complement(500305..500865)
FT                   /locus_tag="Arnit_0513"
FT   CDS_pept        complement(500305..500865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0513"
FT                   /product="thiamine monophosphate synthase"
FT                   /note="COGs: COG0352 Thiamine monophosphate synthase;
FT                   InterPro IPR003733:IPR013785; KEGG: abu:Abu_2031 thiamine
FT                   monophosphate synthase; PFAM: thiamine monophosphate
FT                   synthase; SPTR: A8EWC5 Thiamine monophosphate synthase;
FT                   PFAM: Thiamine monophosphate synthase/TENI"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92178"
FT                   /db_xref="GOA:D5UZE1"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:D5UZE1"
FT                   /protein_id="ADG92178.1"
FT                   /translation="MNQTFNYYLITDPQYYTNDKNTFKEKLEDILTNKRVDMACFRDKE
FT                   SANYEELANIFINTCKKFNIKQIILNRNLELAINLNCGIHLTSQQFDKIKIAKEKNIYT
FT                   IISCHNEKDIEKAIKEKADAITYSPIFYTPNKGQEKGIKALEDMQKKYQIKIIALGGII
FT                   ADLQIKQIQDCQVFGFASIRYFI"
FT   gene            complement(501014..501700)
FT                   /locus_tag="Arnit_0514"
FT   CDS_pept        complement(501014..501700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0514"
FT                   /product="ATP synthase F0, A subunit"
FT                   /note="COGs: COG0356 F0F1-type ATP synthase subunit a;
FT                   InterPro IPR000568; KEGG: abu:Abu_2030 F0F1 ATP synthase
FT                   subunit A; PFAM: H+transporting two-sector ATPase A
FT                   subunit; SPTR: A8EWC4 ATP synthase subunit a; TIGRFAM: ATP
FT                   synthase F0, A subunit; PFAM: ATP synthase A chain;
FT                   TIGRFAM: ATP synthase subunit 6 (eukaryotes),also subunit A
FT                   (prokaryotes)"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92179"
FT                   /db_xref="GOA:D5UZE2"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:D5UZE2"
FT                   /protein_id="ADG92179.1"
FT                   /translation="MEGRLFTFLGAIGGHSQEWIILSHYILVIAIIFLVARAATRKMQL
FT                   VPTGAQNVMEAYIGGVVSMGADTMGEENARRYLPLIGSLGLVVLVANLMGVVPGFESTT
FT                   SNINFTLALALIVFVYYNYLGIKKNGFVGYFAHFMGPMPILAPLMFPIEIISHISRIIS
FT                   LSFRLFGSIRGDDMFLMVLLMLVPWLLPLPGFFLLTAFAFLQAFIFMILTYVYIAGSIM
FT                   MEHEDH"
FT   sig_peptide     complement(501587..501700)
FT                   /locus_tag="Arnit_0514"
FT                   /note="Signal predicted by SignalP 3.0 HMM"
FT   gene            complement(501793..502998)
FT                   /locus_tag="Arnit_0515"
FT   CDS_pept        complement(501793..502998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arnit_0515"
FT                   /product="threonine dehydratase"
FT                   /note="COGs: COG1171 Threonine dehydratase; InterPro
FT                   IPR000634:IPR005789:IPR001926; KEGG: abu:Abu_2029 threonine
FT                   deaminase; PFAM: Pyridoxal-5'-phosphate-dependent protein
FT                   beta subunit; SPTR: A8EWC3 Threonine deaminase; TIGRFAM:
FT                   threonine dehydratase; PFAM: Pyridoxal-phosphate dependent
FT                   enzyme; TIGRFAM: threonine dehydratase, medium form"
FT                   /db_xref="EnsemblGenomes-Gn:Arnit_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADG92180"
FT                   /db_xref="GOA:D5UZE3"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005789"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D5UZE3"
FT                   /protein_id="ADG92180.1"
FT                   /translation="MITLKDIKDAKEKLEGIILKTPLTYAPFLSEELNSNVFLKKENLQ
FT                   LTGSFKIRGAFNKVASLDEETRNIGIVAASAGNHAQGIAYAGNYFGCDATIFMPEATPL
FT                   TKVSGVKQYGANVVLTGQNYDEAYAAAIKFCEENNKTFIHAFANDKVIAGQGTIGLEII
FT                   EQIEDLEVLVIPIGGGGLIAGAAVAAKSINPNIKIIGVVASGARGMKDSFEARLPIDST
FT                   SVKTIADGIAVKVVTPKLLEYALEYVDEVVEVEEHEIANAILFLLEKHKLVVEGAGAVS
FT                   VAALMHKRIDIENSKVCAIISGGNIDVTMLSQIIEKGLVKSYRKMNLMVTLIDKPGSLM
FT                   HLTSIFQSSDANIVQIDYDRSSIKLEFGEAYLTVSLETKGEEHQKVIRENLKQNG