(data stored in ACNUC1104 zone)

EMBL: CP002000

ID   CP002000; SV 1; circular; genomic DNA; STD; PRO; 10236715 BP.
XX
AC   CP002000;
XX
PR   Project:PRJNA46889;
XX
DT   30-JUN-2010 (Rel. 105, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 4)
XX
DE   Amycolatopsis mediterranei U32, complete genome.
XX
KW   .
XX
OS   Amycolatopsis mediterranei U32
OC   Bacteria; Actinobacteria; Pseudonocardiales; Pseudonocardiaceae;
OC   Amycolatopsis.
XX
RN   [1]
RP   1-10236715
RX   DOI; 10.1038/cr.2010.87.
RX   PUBMED; 20567260.
RA   Zhao W., Zhong Y., Yuan H., Wang J., Zheng H., Wang Y., Cen X., Xu F.,
RA   Bai J., Han X., Lu G., Zhu Y., Shao Z., Yan H., Li C., Peng N., Zhang Z.,
RA   Zhang Y., Lin W., Fan Y., Qin Z., Hu Y., Zhu B., Wang S., Ding X.,
RA   Zhao G.P.;
RT   "Complete genome sequence of the rifamycin SV-producing Amycolatopsis
RT   mediterranei U32 revealed its genetic characteristics in phylogeny and
RT   metabolism";
RL   Cell Res. 20(10):1096-1108(2010).
XX
RN   [2]
RP   1-10236715
RA   Zhao W., Zhong Y., Yuan H., Wang J., Zheng H., Wang Y., Cen X., Xu F.,
RA   Bai J., Han X., Lu G., Zhu Y., Shao Z., Yan H., Li C., Zhang Z., Peng N.,
RA   Zhang Y., Lin W., Qin Z., Wang S., Ding X., Zhao G.-P.;
RT   ;
RL   Submitted (01-APR-2010) to the INSDC.
RL   Key Laboratory of Synthetic Biology, Institute of Plant Physiology and
RL   Ecology, Shanghai Institutes for Biological Sciences, CAS, 300 Fenglin
RL   Road, Shanghai, Shanghai, China
XX
DR   MD5; c88d1612bca9db31a00aecc62a928332.
DR   BioSample; SAMN02603409.
DR   EnsemblGenomes-Gn; AMED_R01.
DR   EnsemblGenomes-Gn; AMED_R02.
DR   EnsemblGenomes-Gn; AMED_R03.
DR   EnsemblGenomes-Gn; AMED_R04.
DR   EnsemblGenomes-Gn; AMED_R05.
DR   EnsemblGenomes-Gn; AMED_R06.
DR   EnsemblGenomes-Gn; AMED_R07.
DR   EnsemblGenomes-Gn; AMED_R08.
DR   EnsemblGenomes-Gn; AMED_R09.
DR   EnsemblGenomes-Gn; AMED_R10.
DR   EnsemblGenomes-Gn; AMED_R11.
DR   EnsemblGenomes-Gn; AMED_R12.
DR   EnsemblGenomes-Gn; AMED_R13.
DR   EnsemblGenomes-Gn; AMED_R14.
DR   EnsemblGenomes-Gn; AMED_R15.
DR   EnsemblGenomes-Gn; AMED_R16.
DR   EnsemblGenomes-Gn; AMED_R17.
DR   EnsemblGenomes-Gn; AMED_R18.
DR   EnsemblGenomes-Gn; AMED_R19.
DR   EnsemblGenomes-Gn; AMED_R20.
DR   EnsemblGenomes-Gn; AMED_R21.
DR   EnsemblGenomes-Gn; AMED_R22.
DR   EnsemblGenomes-Gn; AMED_R23.
DR   EnsemblGenomes-Gn; AMED_R24.
DR   EnsemblGenomes-Gn; AMED_R25.
DR   EnsemblGenomes-Gn; AMED_R26.
DR   EnsemblGenomes-Gn; AMED_R27.
DR   EnsemblGenomes-Gn; AMED_R28.
DR   EnsemblGenomes-Gn; AMED_R29.
DR   EnsemblGenomes-Gn; AMED_R30.
DR   EnsemblGenomes-Gn; AMED_R31.
DR   EnsemblGenomes-Gn; AMED_R32.
DR   EnsemblGenomes-Gn; AMED_R33.
DR   EnsemblGenomes-Gn; AMED_R34.
DR   EnsemblGenomes-Gn; AMED_R35.
DR   EnsemblGenomes-Gn; AMED_R36.
DR   EnsemblGenomes-Gn; AMED_R37.
DR   EnsemblGenomes-Gn; AMED_R38.
DR   EnsemblGenomes-Gn; AMED_R39.
DR   EnsemblGenomes-Gn; AMED_R40.
DR   EnsemblGenomes-Gn; AMED_R41.
DR   EnsemblGenomes-Gn; AMED_R42.
DR   EnsemblGenomes-Gn; AMED_R43.
DR   EnsemblGenomes-Gn; AMED_R44.
DR   EnsemblGenomes-Gn; AMED_R45.
DR   EnsemblGenomes-Gn; AMED_R46.
DR   EnsemblGenomes-Gn; AMED_R47.
DR   EnsemblGenomes-Gn; AMED_R48.
DR   EnsemblGenomes-Gn; AMED_R49.
DR   EnsemblGenomes-Gn; AMED_R50.
DR   EnsemblGenomes-Gn; AMED_R51.
DR   EnsemblGenomes-Gn; AMED_R52.
DR   EnsemblGenomes-Gn; AMED_R53.
DR   EnsemblGenomes-Gn; AMED_R54.
DR   EnsemblGenomes-Gn; AMED_R55.
DR   EnsemblGenomes-Gn; AMED_R56.
DR   EnsemblGenomes-Gn; AMED_R57.
DR   EnsemblGenomes-Gn; AMED_R58.
DR   EnsemblGenomes-Gn; AMED_R59.
DR   EnsemblGenomes-Gn; AMED_R60.
DR   EnsemblGenomes-Gn; AMED_R61.
DR   EnsemblGenomes-Gn; AMED_R62.
DR   EnsemblGenomes-Gn; AMED_R63.
DR   EnsemblGenomes-Gn; AMED_R64.
DR   EnsemblGenomes-Gn; EBG00001058924.
DR   EnsemblGenomes-Gn; EBG00001058925.
DR   EnsemblGenomes-Gn; EBG00001058926.
DR   EnsemblGenomes-Gn; EBG00001058927.
DR   EnsemblGenomes-Gn; EBG00001058928.
DR   EnsemblGenomes-Gn; EBG00001058929.
DR   EnsemblGenomes-Gn; EBG00001058930.
DR   EnsemblGenomes-Gn; EBG00001058931.
DR   EnsemblGenomes-Gn; EBG00001058932.
DR   EnsemblGenomes-Gn; EBG00001058933.
DR   EnsemblGenomes-Gn; EBG00001058934.
DR   EnsemblGenomes-Gn; EBG00001058935.
DR   EnsemblGenomes-Gn; EBG00001058936.
DR   EnsemblGenomes-Gn; EBG00001058937.
DR   EnsemblGenomes-Gn; EBG00001058938.
DR   EnsemblGenomes-Gn; EBG00001058939.
DR   EnsemblGenomes-Gn; EBG00001058940.
DR   EnsemblGenomes-Gn; EBG00001058941.
DR   EnsemblGenomes-Gn; EBG00001058942.
DR   EnsemblGenomes-Gn; EBG00001058943.
DR   EnsemblGenomes-Gn; EBG00001058944.
DR   EnsemblGenomes-Gn; EBG00001058945.
DR   EnsemblGenomes-Gn; EBG00001058946.
DR   EnsemblGenomes-Gn; EBG00001058947.
DR   EnsemblGenomes-Gn; EBG00001058948.
DR   EnsemblGenomes-Gn; EBG00001058949.
DR   EnsemblGenomes-Gn; EBG00001058950.
DR   EnsemblGenomes-Gn; EBG00001058951.
DR   EnsemblGenomes-Gn; EBG00001058952.
DR   EnsemblGenomes-Gn; EBG00001058953.
DR   EnsemblGenomes-Gn; EBG00001058954.
DR   EnsemblGenomes-Gn; EBG00001058955.
DR   EnsemblGenomes-Gn; EBG00001058956.
DR   EnsemblGenomes-Gn; EBG00001058957.
DR   EnsemblGenomes-Gn; EBG00001058958.
DR   EnsemblGenomes-Gn; EBG00001058959.
DR   EnsemblGenomes-Gn; EBG00001058960.
DR   EnsemblGenomes-Gn; EBG00001058961.
DR   EnsemblGenomes-Gn; EBG00001058962.
DR   EnsemblGenomes-Gn; EBG00001058963.
DR   EnsemblGenomes-Gn; EBG00001058964.
DR   EnsemblGenomes-Gn; EBG00001058965.
DR   EnsemblGenomes-Gn; EBG00001058966.
DR   EnsemblGenomes-Gn; EBG00001058967.
DR   EnsemblGenomes-Gn; EBG00001058968.
DR   EnsemblGenomes-Gn; EBG00001058969.
DR   EnsemblGenomes-Gn; EBG00001058970.
DR   EnsemblGenomes-Gn; EBG00001058971.
DR   EnsemblGenomes-Gn; EBG00001058972.
DR   EnsemblGenomes-Gn; EBG00001058973.
DR   EnsemblGenomes-Gn; EBG00001058974.
DR   EnsemblGenomes-Gn; EBG00001058975.
DR   EnsemblGenomes-Gn; EBG00001058976.
DR   EnsemblGenomes-Gn; EBG00001058977.
DR   EnsemblGenomes-Gn; EBG00001058978.
DR   EnsemblGenomes-Gn; EBG00001058979.
DR   EnsemblGenomes-Gn; EBG00001058980.
DR   EnsemblGenomes-Gn; EBG00001058981.
DR   EnsemblGenomes-Gn; EBG00001058982.
DR   EnsemblGenomes-Gn; EBG00001058983.
DR   EnsemblGenomes-Gn; EBG00001058984.
DR   EnsemblGenomes-Gn; EBG00001058985.
DR   EnsemblGenomes-Gn; EBG00001058986.
DR   EnsemblGenomes-Gn; EBG00001058987.
DR   EnsemblGenomes-Gn; EBG00001058988.
DR   EnsemblGenomes-Gn; EBG00001058989.
DR   EnsemblGenomes-Gn; EBG00001058990.
DR   EnsemblGenomes-Gn; EBG00001058991.
DR   EnsemblGenomes-Gn; EBG00001058992.
DR   EnsemblGenomes-Gn; EBG00001058993.
DR   EnsemblGenomes-Gn; EBG00001058994.
DR   EnsemblGenomes-Gn; EBG00001058995.
DR   EnsemblGenomes-Gn; EBG00001058996.
DR   EnsemblGenomes-Gn; EBG00001058997.
DR   EnsemblGenomes-Gn; EBG00001058998.
DR   EnsemblGenomes-Gn; EBG00001058999.
DR   EnsemblGenomes-Gn; EBG00001059000.
DR   EnsemblGenomes-Gn; EBG00001059001.
DR   EnsemblGenomes-Gn; EBG00001059002.
DR   EnsemblGenomes-Gn; EBG00001059003.
DR   EnsemblGenomes-Gn; EBG00001059004.
DR   EnsemblGenomes-Gn; EBG00001059005.
DR   EnsemblGenomes-Gn; EBG00001059006.
DR   EnsemblGenomes-Gn; EBG00001059007.
DR   EnsemblGenomes-Gn; EBG00001059008.
DR   EnsemblGenomes-Gn; EBG00001059009.
DR   EnsemblGenomes-Gn; EBG00001059010.
DR   EnsemblGenomes-Gn; EBG00001059011.
DR   EnsemblGenomes-Gn; EBG00001059012.
DR   EnsemblGenomes-Gn; EBG00001059013.
DR   EnsemblGenomes-Gn; EBG00001059014.
DR   EnsemblGenomes-Gn; EBG00001059015.
DR   EnsemblGenomes-Gn; EBG00001059016.
DR   EnsemblGenomes-Tr; AMED_R01-1.
DR   EnsemblGenomes-Tr; AMED_R02-1.
DR   EnsemblGenomes-Tr; AMED_R03-1.
DR   EnsemblGenomes-Tr; AMED_R04-1.
DR   EnsemblGenomes-Tr; AMED_R05-1.
DR   EnsemblGenomes-Tr; AMED_R06-1.
DR   EnsemblGenomes-Tr; AMED_R07-1.
DR   EnsemblGenomes-Tr; AMED_R08-1.
DR   EnsemblGenomes-Tr; AMED_R09-1.
DR   EnsemblGenomes-Tr; AMED_R10-1.
DR   EnsemblGenomes-Tr; AMED_R11-1.
DR   EnsemblGenomes-Tr; AMED_R12-1.
DR   EnsemblGenomes-Tr; AMED_R13-1.
DR   EnsemblGenomes-Tr; AMED_R14-1.
DR   EnsemblGenomes-Tr; AMED_R15-1.
DR   EnsemblGenomes-Tr; AMED_R16-1.
DR   EnsemblGenomes-Tr; AMED_R17-1.
DR   EnsemblGenomes-Tr; AMED_R18-1.
DR   EnsemblGenomes-Tr; AMED_R19-1.
DR   EnsemblGenomes-Tr; AMED_R20-1.
DR   EnsemblGenomes-Tr; AMED_R21-1.
DR   EnsemblGenomes-Tr; AMED_R22-1.
DR   EnsemblGenomes-Tr; AMED_R23-1.
DR   EnsemblGenomes-Tr; AMED_R24-1.
DR   EnsemblGenomes-Tr; AMED_R25-1.
DR   EnsemblGenomes-Tr; AMED_R26-1.
DR   EnsemblGenomes-Tr; AMED_R27-1.
DR   EnsemblGenomes-Tr; AMED_R28-1.
DR   EnsemblGenomes-Tr; AMED_R29-1.
DR   EnsemblGenomes-Tr; AMED_R30-1.
DR   EnsemblGenomes-Tr; AMED_R31-1.
DR   EnsemblGenomes-Tr; AMED_R32-1.
DR   EnsemblGenomes-Tr; AMED_R33-1.
DR   EnsemblGenomes-Tr; AMED_R34-1.
DR   EnsemblGenomes-Tr; AMED_R35-1.
DR   EnsemblGenomes-Tr; AMED_R36-1.
DR   EnsemblGenomes-Tr; AMED_R37-1.
DR   EnsemblGenomes-Tr; AMED_R38-1.
DR   EnsemblGenomes-Tr; AMED_R39-1.
DR   EnsemblGenomes-Tr; AMED_R40-1.
DR   EnsemblGenomes-Tr; AMED_R41-1.
DR   EnsemblGenomes-Tr; AMED_R42-1.
DR   EnsemblGenomes-Tr; AMED_R43-1.
DR   EnsemblGenomes-Tr; AMED_R44-1.
DR   EnsemblGenomes-Tr; AMED_R45-1.
DR   EnsemblGenomes-Tr; AMED_R46-1.
DR   EnsemblGenomes-Tr; AMED_R47-1.
DR   EnsemblGenomes-Tr; AMED_R48-1.
DR   EnsemblGenomes-Tr; AMED_R49-1.
DR   EnsemblGenomes-Tr; AMED_R50-1.
DR   EnsemblGenomes-Tr; AMED_R51-1.
DR   EnsemblGenomes-Tr; AMED_R52-1.
DR   EnsemblGenomes-Tr; AMED_R53-1.
DR   EnsemblGenomes-Tr; AMED_R54-1.
DR   EnsemblGenomes-Tr; AMED_R55-1.
DR   EnsemblGenomes-Tr; AMED_R56-1.
DR   EnsemblGenomes-Tr; AMED_R57-1.
DR   EnsemblGenomes-Tr; AMED_R58-1.
DR   EnsemblGenomes-Tr; AMED_R59-1.
DR   EnsemblGenomes-Tr; AMED_R60-1.
DR   EnsemblGenomes-Tr; AMED_R61-1.
DR   EnsemblGenomes-Tr; AMED_R62-1.
DR   EnsemblGenomes-Tr; AMED_R63-1.
DR   EnsemblGenomes-Tr; AMED_R64-1.
DR   EnsemblGenomes-Tr; EBT00001661376.
DR   EnsemblGenomes-Tr; EBT00001661377.
DR   EnsemblGenomes-Tr; EBT00001661378.
DR   EnsemblGenomes-Tr; EBT00001661379.
DR   EnsemblGenomes-Tr; EBT00001661380.
DR   EnsemblGenomes-Tr; EBT00001661381.
DR   EnsemblGenomes-Tr; EBT00001661382.
DR   EnsemblGenomes-Tr; EBT00001661383.
DR   EnsemblGenomes-Tr; EBT00001661384.
DR   EnsemblGenomes-Tr; EBT00001661385.
DR   EnsemblGenomes-Tr; EBT00001661386.
DR   EnsemblGenomes-Tr; EBT00001661387.
DR   EnsemblGenomes-Tr; EBT00001661388.
DR   EnsemblGenomes-Tr; EBT00001661389.
DR   EnsemblGenomes-Tr; EBT00001661390.
DR   EnsemblGenomes-Tr; EBT00001661391.
DR   EnsemblGenomes-Tr; EBT00001661392.
DR   EnsemblGenomes-Tr; EBT00001661393.
DR   EnsemblGenomes-Tr; EBT00001661394.
DR   EnsemblGenomes-Tr; EBT00001661395.
DR   EnsemblGenomes-Tr; EBT00001661396.
DR   EnsemblGenomes-Tr; EBT00001661397.
DR   EnsemblGenomes-Tr; EBT00001661398.
DR   EnsemblGenomes-Tr; EBT00001661399.
DR   EnsemblGenomes-Tr; EBT00001661400.
DR   EnsemblGenomes-Tr; EBT00001661401.
DR   EnsemblGenomes-Tr; EBT00001661402.
DR   EnsemblGenomes-Tr; EBT00001661403.
DR   EnsemblGenomes-Tr; EBT00001661404.
DR   EnsemblGenomes-Tr; EBT00001661405.
DR   EnsemblGenomes-Tr; EBT00001661406.
DR   EnsemblGenomes-Tr; EBT00001661407.
DR   EnsemblGenomes-Tr; EBT00001661408.
DR   EnsemblGenomes-Tr; EBT00001661409.
DR   EnsemblGenomes-Tr; EBT00001661410.
DR   EnsemblGenomes-Tr; EBT00001661411.
DR   EnsemblGenomes-Tr; EBT00001661412.
DR   EnsemblGenomes-Tr; EBT00001661413.
DR   EnsemblGenomes-Tr; EBT00001661414.
DR   EnsemblGenomes-Tr; EBT00001661415.
DR   EnsemblGenomes-Tr; EBT00001661416.
DR   EnsemblGenomes-Tr; EBT00001661417.
DR   EnsemblGenomes-Tr; EBT00001661418.
DR   EnsemblGenomes-Tr; EBT00001661419.
DR   EnsemblGenomes-Tr; EBT00001661420.
DR   EnsemblGenomes-Tr; EBT00001661421.
DR   EnsemblGenomes-Tr; EBT00001661422.
DR   EnsemblGenomes-Tr; EBT00001661423.
DR   EnsemblGenomes-Tr; EBT00001661424.
DR   EnsemblGenomes-Tr; EBT00001661425.
DR   EnsemblGenomes-Tr; EBT00001661426.
DR   EnsemblGenomes-Tr; EBT00001661427.
DR   EnsemblGenomes-Tr; EBT00001661428.
DR   EnsemblGenomes-Tr; EBT00001661429.
DR   EnsemblGenomes-Tr; EBT00001661430.
DR   EnsemblGenomes-Tr; EBT00001661431.
DR   EnsemblGenomes-Tr; EBT00001661432.
DR   EnsemblGenomes-Tr; EBT00001661433.
DR   EnsemblGenomes-Tr; EBT00001661434.
DR   EnsemblGenomes-Tr; EBT00001661435.
DR   EnsemblGenomes-Tr; EBT00001661436.
DR   EnsemblGenomes-Tr; EBT00001661437.
DR   EnsemblGenomes-Tr; EBT00001661438.
DR   EnsemblGenomes-Tr; EBT00001661439.
DR   EnsemblGenomes-Tr; EBT00001661440.
DR   EnsemblGenomes-Tr; EBT00001661441.
DR   EnsemblGenomes-Tr; EBT00001661442.
DR   EnsemblGenomes-Tr; EBT00001661443.
DR   EnsemblGenomes-Tr; EBT00001661444.
DR   EnsemblGenomes-Tr; EBT00001661445.
DR   EnsemblGenomes-Tr; EBT00001661446.
DR   EnsemblGenomes-Tr; EBT00001661447.
DR   EnsemblGenomes-Tr; EBT00001661448.
DR   EnsemblGenomes-Tr; EBT00001661449.
DR   EnsemblGenomes-Tr; EBT00001661450.
DR   EnsemblGenomes-Tr; EBT00001661451.
DR   EnsemblGenomes-Tr; EBT00001661452.
DR   EnsemblGenomes-Tr; EBT00001661453.
DR   EnsemblGenomes-Tr; EBT00001661454.
DR   EnsemblGenomes-Tr; EBT00001661455.
DR   EnsemblGenomes-Tr; EBT00001661456.
DR   EnsemblGenomes-Tr; EBT00001661457.
DR   EnsemblGenomes-Tr; EBT00001661458.
DR   EnsemblGenomes-Tr; EBT00001661459.
DR   EnsemblGenomes-Tr; EBT00001661460.
DR   EnsemblGenomes-Tr; EBT00001661461.
DR   EnsemblGenomes-Tr; EBT00001661462.
DR   EnsemblGenomes-Tr; EBT00001661463.
DR   EnsemblGenomes-Tr; EBT00001661464.
DR   EnsemblGenomes-Tr; EBT00001661465.
DR   EnsemblGenomes-Tr; EBT00001661466.
DR   EnsemblGenomes-Tr; EBT00001661467.
DR   EnsemblGenomes-Tr; EBT00001661468.
DR   EuropePMC; PMC3072421; 21490938.
DR   EuropePMC; PMC3187414; 21914879.
DR   EuropePMC; PMC3458657; 23012281.
DR   EuropePMC; PMC4920768; 27407288.
DR   EuropePMC; PMC5639847; 28045587.
DR   EuropePMC; PMC5640789; 29062941.
DR   EuropePMC; PMC6134474; 30203150.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01066; 6C.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01746; mraW.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01781; ASdes.
DR   RFAM; RF01782; ASpks.
DR   RFAM; RF01791; F6.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP002000.
DR   SILVA-SSU; CP002000.
XX
CC   Bacteria available from the Institute of Microbiology, Chinese
CC   Academy of Sciences designated CGMCC 4.5720, or from our
CC   laboratory: Key Laboratory of Synthetic Biology, Institute of Plant
CC   Physiology and Ecology, Shanghai Institutes for Biological
CC   Sciences, Chinese Academy of Sciences, Shanghai 200032, China.
CC   gpzhao@sibs.ac.cn.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..10236715
FT                   /organism="Amycolatopsis mediterranei U32"
FT                   /strain="U32"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:749927"
FT                   /culture_collection="CGMCC:4.5720"
FT   gene            1..1644
FT                   /gene="dnaA"
FT                   /locus_tag="AMED_0001"
FT   CDS_pept        1..1644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="AMED_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41827"
FT                   /db_xref="GOA:A0A0H3CT75"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CT75"
FT                   /protein_id="ADJ41827.1"
FT                   /translation="MSDHQHNLGVIWEQVVRELSDGTLSPQQRAWMRVTRPIGLLDGTA
FT                   LLAAPSDFAKEAIERGLRGAITDALSRRLGRAISLAVKVDSAEAVAPAPAPHYAPSPGR
FT                   VENGTSPEPAPPMPANGAPMMPPPRPAEPAQQRPPMPRPPMSMPAHQSVAPKPDDGDDT
FT                   DEEVDEEGEALAAVHEIWPTFSGQPIAGQPYTAPAQPQTSKTKLNEKYTFDTFVIGASN
FT                   RFAHAAAVAVAEAPARAYNPLFIWGESGLGKTHLLHAVGHYAQRLFPGMRVRYVSTEEF
FT                   TNDFINSLRDDRKVAFQRRYRDIDILLVDDIQFLEGKEGTQEEFFHTFNTLHNANKQIV
FT                   VSSDRPPKRLETLEDRLRTRFEWGLITDIQPPELETRIAILRKKAAQDRLAVPGEVLEF
FT                   IASRVEANIRELEGALIRVTAFASLNQQPVDSALAEIVLRDLIPDSHAPEITAPTIMGV
FT                   TSEFFDVTLDDLCGPGKTKALATARQIAMYLCRELTDMSLPKIGQTFGGRDHTTVMHAD
FT                   KKIRKEMAERRRIYDQVQELTSRIKQRARQ"
FT   gene            2524..3657
FT                   /gene="dnaN"
FT                   /locus_tag="AMED_0002"
FT   CDS_pept        2524..3657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="AMED_0002"
FT                   /product="DNA polymerase III subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41828"
FT                   /db_xref="GOA:A0A0H3CU86"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CU86"
FT                   /protein_id="ADJ41828.1"
FT                   /translation="MKIRVERDGLADAVAWVARSLPSRPPVPVLGGVLLDAGSDGETDA
FT                   LTVSGFDYEVSATVGVPATIADGGRLLVSGRLLADITKALPAQPVEISVDGARATITCG
FT                   TARFSLPTMPVEDYPQLPSQPAFAGELAGDAFGQAVTQVVVAAGKDDTLPMLTGMRLEI
FT                   SGSSLTLVATDRFRLAMREFTWQPAEGLADAAVLVPARTLAEAAKTLGASGATIRLALA
FT                   SGEGLLGLSGSGRYTTTRLLDAEFPPYRQLLPASHSSRAVIDVSALTESIKRVSLVAER
FT                   GTQVRLEFGDNTLRLSAGGDDEGSAEEELQVEYEGEPVTIAFNPGYLVDGLGALHSDRA
FT                   ELTFTTPNRPALIKPADAEGNVVPGYLYLLMPVRLPG"
FT   gene            3691..4581
FT                   /gene="gnd"
FT                   /locus_tag="AMED_0003"
FT   CDS_pept        3691..4581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gnd"
FT                   /locus_tag="AMED_0003"
FT                   /product="6-phosphogluconate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41829"
FT                   /db_xref="GOA:A0A0H3CV94"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV94"
FT                   /protein_id="ADJ41829.1"
FT                   /translation="MVQLGLIGLGKMGFNMRERLRAAGHEVVGYDRNPDVTDTTSLEDL
FT                   VSKLEGPRIVWIMVPAGDPTRQTVTELSNLLAEGDMVIDGGNSKYTDDKLNADLLAAKN
FT                   IGYVDCGVSGGVWGKDNGYGLMVGGTAADVEKAMPIFDALRPEGPREEGFSHAGDVGAG
FT                   HYAKMIHNGIEYGMMQAFAEGFELLEAAKVVKDVPAVIKGWQRGTVVRSWLLDLLVRAL
FT                   DEDPELDDLEGYVEDSGEGRWTLEEAINNAVPAPVISAALFARFASRQEHSAAMRAVAA
FT                   LRNQFGGHAVKKVGG"
FT   gene            4592..5746
FT                   /gene="recF"
FT                   /locus_tag="AMED_0004"
FT   CDS_pept        4592..5746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="AMED_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41830"
FT                   /db_xref="GOA:A0A0H3CUZ2"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUZ2"
FT                   /protein_id="ADJ41830.1"
FT                   /translation="MYLRHLQVTDFRSWPQADLALEPGPTVLVGQNGRGKTNLLEAIGY
FT                   VATLGSHRVATDAPLIRHGCERALVRVAVVNDDRELTVELEITAGRANRARVNRGAVGR
FT                   PRDVLGILRTVLFSPEDLALVRGDPGERRRFLDELLVLRAPRYAGVRADYEKVLKQRNA
FT                   LLKTAGKRRTGREDPYALSTLEVWDDHLAEAGAELLAARLNLVADLAPHAASAYMGVAP
FT                   DSRPAKITYRSSLGAAMPETYGVPDGERAQPEVLKDVLLKALGEARKAELERGISLVGP
FT                   HRDELELILGEAPAKGYASHGESWSFALALRLGSYELLRAEAGEPVLLLDDVFAELDRK
FT                   RRARLAEVAASAEQVLVTAAVDEDVPGELAGTRFVVADGEITRG"
FT   gene            5967..6470
FT                   /locus_tag="AMED_0005"
FT   CDS_pept        5967..6470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0005"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41831"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWX5"
FT                   /protein_id="ADJ41831.1"
FT                   /translation="MTGRDLAHAALEAAKAKAKERGTSPGRRRPATGGGQSPRRRRWSG
FT                   PGADARDPQPLGRLVSRLMSDRGWNESVTSARVFAQWARLVGEDVAEHAQPIALKDGEL
FT                   TVRASSTAWATQLRLLQGKLLHKIAAGVGNGVVKRMRIQGPTAPSWRKGPRHVPGRGPR
FT                   DTYG"
FT   gene            6668..8635
FT                   /gene="gyrB"
FT                   /locus_tag="AMED_0006"
FT   CDS_pept        6668..8635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="AMED_0006"
FT                   /product="DNA gyrase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41832"
FT                   /db_xref="GOA:A0A0H3CT81"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CT81"
FT                   /protein_id="ADJ41832.1"
FT                   /translation="MTENKHEYNASSITVLEGLEAVRKRPGMYIGSTGERGLHHLVQEV
FT                   VDNSVDEAMAGHATKVEVTLLADGGVRVVDDGRGIPVDMHPKEQKPTLEVVLTVLHAGG
FT                   KFDSDSYAVSGGLHGVGVSVVNALSKKLLAEVKYGGRSWRQEYTDQIPGPLEDLGPASE
FT                   TGTTITFWADGDIFETTTYNFETISRRLQEMAFLNKGLTLSLRDERVADEEAEADAEGK
FT                   VARVKEKTYCYPGGLEDFVKHINGSKDPIHSSVISFEAKGTGLEVEVAMQWNNGFTPSV
FT                   YTFANTINTHEGGTHEEGFRAALTRVVNTYARDKKLLKEKDTNLTGDDVREGLAAIVSI
FT                   KLSEPQFEGQTKTKLGNSEAKTFVQQTSNEWLADWFERNPTEAKTIINKSISSAQARMA
FT                   ARKARDLVRRKGALDIGGLPGKLKDCRSTKPEECELYIVEGDSAGGSAKEGRDSMYQAI
FT                   LPIRGKIINVEKARIDRVLKNTEVQSLITALGTGIHDEFDLEKLRYHKIVLMADADVDG
FT                   QHITTLLLTLLFRFMTPLIEHGHVFLSRPPLYKIKWPRAEPEYAYSDRERDAVIQAGVE
FT                   AGKRLPKDDAIQRYKGLGEMNAEELWETTMDPANRLLGQVTLDDAAQADELFSVLMGED
FT                   VEARRSFITRNAKDVRFLDV"
FT   gene            8688..11225
FT                   /gene="gyrA"
FT                   /locus_tag="AMED_0007"
FT   CDS_pept        8688..11225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="AMED_0007"
FT                   /product="DNA gyrase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41833"
FT                   /db_xref="GOA:A0A0H3CU92"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CU92"
FT                   /protein_id="ADJ41833.1"
FT                   /translation="MTETLPPAPDHDRIEPVDIQQEMQRSYIDYAMSVIVSRALPDVRD
FT                   GLKPVHRRVLYSMFDSGFRPDRGYNKCSRVVGDVMGNYHPHGDSAIYDALVRLAQPWSM
FT                   RYPLIDGQGNFGSPGNDPAAAMRYTESRLAPLAMQMLADIEEDTVDFSDNYDGRTQEPD
FT                   VLPSRFPNLLVNGGSGIAVGMATNIPPHNLREVSEGVVWALENPEATDDELLAALLVRI
FT                   KGPDFPTKAMILGTSGIEDAYRTGRGSVRMRAVVEVEEDAKGRTILVVSELPYQVNPDN
FT                   LVENIANLVRDGKLTGISDIADESNSRSGMRIVVTIKRDAVAKVVLNNLFKHTQLQQNF
FT                   GVNMLALVDGVPRTLRLDQIIRHYVKHQMDVIVRRTRYRLRKKEERAHILRGLVKALDA
FT                   LDEVIALIRRSPSADEARPALMTLLDIDEIQAVAILDMQLRRLAALERQRIIDELAEIE
FT                   IEIADLKDILEKPERQRAIIRDELMAIVDKYGDDRRTKIIGFSGDVTDEELIAVEDVVV
FT                   TITRTGYAKRTKTDLYRSQKRGGKGVQGATLKQDDIVQHFFVCSTHDWILFFTNKGRVY
FT                   RTKAYELPEANRNARGQHVANLMAFQPDEQIAQVIQIKNYEVAPYLVLATKRGLVKKTK
FT                   LTDFDSNRSGGLIAINLREGDELVGAVLAAAEDDLLLVSAEGQSIRFHATDEALRPMGR
FT                   PTSGVMGMRFNDGDELLGISVVKEGKFLLVATDGGYSKRTAIEDYPVQGRGGKGVLTIQ
FT                   HDRKRGRLVGALIVDAEDELYAITSSGGVIRTPAGDVRKAGRQTKGVRLMNLGEGTTLL
FT                   AVARNADEPSDVANGEAPEAPEAGEETTAPSEQ"
FT   gene            11278..11943
FT                   /locus_tag="AMED_0008"
FT   CDS_pept        11278..11943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0008"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41834"
FT                   /db_xref="GOA:A0A0H3CV99"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV99"
FT                   /protein_id="ADJ41834.1"
FT                   /translation="MTPTENPEAAGSNGTPASPPWQRVDKEGDAEATVKLATDEAQPPA
FT                   AATQPVTPERSVVTGSAAPRLFGGGSGDTPPVGGEVPPASTQRARPSALRRPGRGPRRA
FT                   SLQVKRFDPWSVLKLSLVLGVAMFFVWLVAVGVLYTVLDGMGVWDKLNGTYSSLVGGEG
FT                   ANASAEPLISAGRVFGIAAILGAINIVLVSALATVSAFIYNVSADLAGGLEVTLSERE"
FT   gene            11993..12066
FT                   /locus_tag="AMED_R01"
FT                   /note="tRNA-Ile-GAT"
FT   tRNA            11993..12066
FT                   /locus_tag="AMED_R01"
FT                   /product="tRNA-Ile"
FT   gene            complement(14731..15918)
FT                   /locus_tag="AMED_0010"
FT   CDS_pept        complement(14731..15918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0010"
FT                   /product="putative phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41835"
FT                   /db_xref="GOA:A0A0H3CUZ6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUZ6"
FT                   /protein_id="ADJ41835.1"
FT                   /translation="MASRRSRGDGGLYWSEDRQRWIAELTIGYRPNGKRITRKASGKTK
FT                   TEAKAALDRLVERKKEGTATAVRGLTVEKAVRDWLRHGLNGRTAATVEKLTILAETHIV
FT                   PSLGARLLLDPKQSKELTADDVDAWLEEKAEVLATRTLQDLRSILRRAINRAAKRTKGI
FT                   RNAVLLGDELPVGRDGRPSKSLTFAQAVAVLAAAEAEDSTYGDYTVVSLLTGARTEEAR
FT                   PLAWPEVDLVGKLEAAPPIPPHVNVWRSVRAGGDTKTKKSRRSLALPGRAVEALERQKL
FT                   RQKHQRESAGDRWQELGIVFASDVGTQLDAANVRRGFRRILKLAGLEPKNWTPRELRHS
FT                   FVSLLSDSGLTIEEISRLVGQSDTKVTELVYRHQLRPVIQNGSKAMDAIFSSPLP"
FT   gene            complement(15902..16117)
FT                   /locus_tag="AMED_0011"
FT   CDS_pept        complement(15902..16117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0011"
FT                   /product="excisionase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41836"
FT                   /db_xref="GOA:A0A0H3CWY0"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWY0"
FT                   /protein_id="ADJ41836.1"
FT                   /translation="MPVAVPERHLYRITEAMRLLSMSRSVIYEQLRSGRLRSVKQGRAR
FT                   LVPAVAIQEYVELLMREAEVSYGESA"
FT   gene            complement(16129..17685)
FT                   /locus_tag="AMED_0012"
FT   CDS_pept        complement(16129..17685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0012"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41837"
FT                   /db_xref="InterPro:IPR022081"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CT85"
FT                   /protein_id="ADJ41837.1"
FT                   /translation="MSGFDDTLSVIDFVISDEPAPHCQQCGRPRSDSPSGDFCSENCQR
FT                   VWRGRHTAAKPAEDGGAQPSELPEAAPVNPLTWLGPAPVGAFAKPGHEVLDAVVTFVSR
FT                   FSAFANEHAAPTLALWYAHTHVAERLYVTPRLILDSAEPGSGETRVLEVAQYLVAKPEM
FT                   TISITPAAIFRMLADGPMTLLFDEIDAVFNPKTGGNNEDLRALLNAGYKRSATVTRCVG
FT                   DAKSMNVTRFPVYAPVALAGIAGGMPDTITTRAITVHMRKRRFDEAVEEFIEEDVERES
FT                   APVRAELAEWVGRVGDEVSRARPDRPDGVRDRAAEIWRPLLAIADAAGGHWPETARKAC
FT                   RHFVLEATAQPASIGVRLLADVRQIFTAEHTDRMVTAELIRELHAIEDEPWTDLQGKPL
FT                   DSRRLAEELDRYLVRPKDLKVSDKTLKGYRIDGDGGLADAWSRYLPPPETGATSATNAT
FT                   PQVTATSGVAEAPSSAATSATRVADGRGTQQPLAPALTSPVAEVADVAPAKPDHDTEWD
FT                   R"
FT   gene            complement(17685..18125)
FT                   /locus_tag="AMED_0013"
FT   CDS_pept        complement(17685..18125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41838"
FT                   /db_xref="GOA:A0A0H3CU97"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CU97"
FT                   /protein_id="ADJ41838.1"
FT                   /translation="MRANDFDSPIAARVLQLVIELTGAGHAPTPMAVMDHARERTATEP
FT                   RSGGAHRLHSLGLWIVETYTDGPILPPPYYGAWLKAVVLKNAYRRAVREHAARLVQAVE
FT                   DDSPTDVLRHQLDDTERLDDLWRRYREAGGDDEPTARLEVAA"
FT   gene            18275..18487
FT                   /locus_tag="AMED_0014"
FT   CDS_pept        18275..18487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41839"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVA4"
FT                   /protein_id="ADJ41839.1"
FT                   /translation="MFSSFDYKYGGGRPKSLVASFLDQEILPTSKTACVRSVVKAFVDV
FT                   IRLLYRGASARLELRQERVLGESRP"
FT   gene            complement(18539..19336)
FT                   /locus_tag="AMED_0015"
FT   CDS_pept        complement(18539..19336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0015"
FT                   /product="XRE family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41840"
FT                   /db_xref="GOA:A0A0H3CUZ9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUZ9"
FT                   /protein_id="ADJ41840.1"
FT                   /translation="MTEAALRPAVIALAGGLREARNERGIGLRRLAAMVDLHHAVLSSF
FT                   ELGQRAPQDTIVAHILGVLRTPQDVRDHLIDLARRSHDRDLIDRTGRAENYLRTAFEQR
FT                   SSRVTEWSPSLIPDVLQTAEYAGALRDTGLLAPEVTDVGCLLRTACQLALSDKPGPLYT
FT                   FLIGEAATRPDACTPDVLRDQLDQLRTWTRRPRVAVRLVPAADCPPGLVGPFTFYEHRA
FT                   GALAVALRHHHGGAAYSTDQAVLTTYKETVRALQRRATENAWP"
FT   gene            complement(19333..19599)
FT                   /locus_tag="AMED_0016"
FT   CDS_pept        complement(19333..19599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41841"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWY4"
FT                   /protein_id="ADJ41841.1"
FT                   /translation="MHARDRELLAALSKVNSKIGSVTVELLTLQPDDAAYASGLRTLGR
FT                   QLVHIGVALTRRAGELDGTELDPVALLNAPDTEAHDRTERSEP"
FT   gene            complement(19586..19882)
FT                   /locus_tag="AMED_0017"
FT   CDS_pept        complement(19586..19882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41842"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CT90"
FT                   /protein_id="ADJ41842.1"
FT                   /translation="MTAVDDGPMTGTDSHQDFWEWHEFTGGDGWAHLYLHSEMTNPRLV
FT                   MLLPWCLTDVRFPLEHDRPSISRRRVIPRPGRMCPVCTAQNERRRIEVPRACS"
FT   gene            complement(19879..20076)
FT                   /locus_tag="AMED_0018"
FT   CDS_pept        complement(19879..20076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41843"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUA2"
FT                   /protein_id="ADJ41843.1"
FT                   /translation="MTAEHFDDRPTFWCGGSLFNTGGQRLNEIDLDAYQHPKKHADMTD
FT                   ADWEQAAAAVRVFDIERGLR"
FT   gene            20386..21537
FT                   /locus_tag="AMED_0019"
FT   CDS_pept        20386..21537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0019"
FT                   /product="XRE family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41844"
FT                   /db_xref="GOA:A0A0H3CVA8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVA8"
FT                   /protein_id="ADJ41844.1"
FT                   /translation="MDSIGITIRRLRRWRGLSLEQLAGLSGLSKGYLSKIENERTAIDK
FT                   RSTLVAIAGALRVSLSDITGDGLEIRDPQADSAIPAIRDALLSTDLDGTEPPIGDLARL
FT                   LSETQLVAALRQANQDAEVGARLPELLLALHTHVDKPDALRSLVTATHTTALLTKGLGA
FT                   FELAWIAADRGHEAAQRLGEPGWIALAEFARTQALSGLGAHKRASKLAERALDYVPTDA
FT                   YDVRGALTLTTGYTESVLGGDATAALDEAAGLAEHVEYGNRNFLLFSPANVVLWRISSA
FT                   LERGDHAEAARLAATVDPVELTIDSRRTTFLIEHARALYGIRRPDEEVLALLVKAEKLG
FT                   HIRTRTNPFVREIISTMLARARREGVAREVRGMADRMGLIKTA"
FT   gene            complement(21938..25339)
FT                   /locus_tag="AMED_0020"
FT   CDS_pept        complement(21938..25339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0020"
FT                   /product="NTPase-like protein probably invoved in signal
FT                   transduction"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41845"
FT                   /db_xref="InterPro:IPR007111"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV02"
FT                   /protein_id="ADJ41845.1"
FT                   /translation="MSVTVAPLAKAILSRVGKEIGGVAAKGTRKWVLGDPEKKALERAL
FT                   GRAFAEVERLYGRQLADFDINAGFWEHEGADELSKVLVAGLTPSAAKFAERAVDSLGPS
FT                   RSDDERLDRILALRPPFKAMLTALEREVRTESALHALLERADAARTADAASSIVEAMGA
FT                   RASSEDDQVRYLGWLIDQHRYVRTAGVVRNTTVQLPLERVFVGLRARHDRHPGDRARLW
FT                   FEQERQKAAALLEAGQLDHVGYEAVLDRLQTQYGRKFAVDVGSEFDQPVLVLDAVRDAS
FT                   QVLVLGDPGTGKTTLLRYLALRHARAVLKGESVQGRPARLPIYVRIGDYARQGYPRVGI
FT                   SDFLPDYLNRSECRLPGLANMLGQQLEAGRCLVLLDGLDEVASAELRREVVAAVVNFVA
FT                   AHSRSGNRFVVTSRVAGYQAAPLPQPFTAMRLDDMDDDTISQFLQVYCRQVERAETPDK
FT                   SQAAIIEAGARETAAIEQALRSNAGVRRLAANPLLLTALVLVHRASGRLPHRRVEAYVE
FT                   VCTALGRTWRSAQGVADADLPDERILTRWLIELGAWMHQYRPEGAATRAELLEVLGPLW
FT                   SAHQGSAWDPDALLTADPLDTEAGQGVLEFIEKADKHTGLLVERAPGRYGFAHLTFEEY
FT                   YAGRALAFRGTATERVLALRGHLHDPRYEEPILLALGLIGTDYADQIDDVVAQAIYPGT
FT                   VPSLYEDLLGRDFLFMLRVLADDTPVQTATIDHVITLAITERLAPDRSRCRFASYSQAL
FT                   EQHLAALTGTKAAGRYITAVDKRADLLTPETVGPWVTLAGIAAQLDVLLAATVAALVQV
FT                   ATDPGIDPSMRVQAGLVLAGRGELREPVITALLQLATDSNPDIDPYVRLQGASVLADAG
FT                   ELREPVITALLQLATDSNPDIDPYVRVEAGSVLADAGELREPVITALLQLATDPFVEVE
FT                   ARSVLANGGELSEPVITALLQVATNPDIDPSAGVQAGSVLADAGELSEPVITALLQLAT
FT                   DSNPDIDPSARVQAGSVLADAGELSEPVITALLQLATEDEDYSVREQAVKALQHALPTR
FT                   SLRKAVAELFRDDDNDVRRATAATFVEWSRRHQQYFNEIGSDLTRACTDPALEVMDKYE
FT                   HRTGWDYAHRGLAAHVETLNNPTIDR"
FT   gene            26046..26423
FT                   /locus_tag="AMED_0021"
FT   CDS_pept        26046..26423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0021"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41846"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWY9"
FT                   /protein_id="ADJ41846.1"
FT                   /translation="MADELTIPLLPCPSIDEIASFYEMLGFEITYRQTRPNPHVAVRRD
FT                   AINLHFFGMDDYDPAQSYSTCLVIVADTNELYEAFAAGMRSVHGKRLIAGIPRMTRPRL
FT                   RNDRYTGFTVVDPGGNWIRIH"
FT   gene            complement(26639..27820)
FT                   /locus_tag="AMED_0023"
FT   CDS_pept        complement(26639..27820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0023"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41847"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="InterPro:IPR037473"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CT94"
FT                   /protein_id="ADJ41847.1"
FT                   /translation="MSETQNTKATALTAVEALKYQGDPLADAVIADLVAGGTTSAVNEV
FT                   LARFRDNDQPVPEDLPEPVRRYLVATDAPPDWADPDRIAGAYEFFVDDGVHVASVLSFG
FT                   AMVNCYAQPRPSRVLSLTHRLNQPHRRLSETSQFVLNLMGRNPFGSGGSFVPTIQKTRL
FT                   IHAAVRHFITRSGEWDVEADGVPLCQQDMLGALLIFSVQVIDGMRRIGISVTDREAEDY
FT                   YYVWRVTGALLGIPADAMPETLAEAQALNARLVEASYGPSAEGIELTRNLLRLYENLVP
FT                   GRAFDGVVAAMVRQVVTPQVADWLEVPHSRAWVRTVAAGARVMRLLERSEDRSRVATTV
FT                   LDKAGSLLLGGSVRTLTDGQPTTLTIPSDLREKWLAAGVCPVAPPPGGARDGR"
FT   gene            28241..28408
FT                   /locus_tag="AMED_0024"
FT   CDS_pept        28241..28408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0024"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41848"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUA6"
FT                   /protein_id="ADJ41848.1"
FT                   /translation="MKKLLALAVIAGGVLFVVKRNKAAKAEADLWREATAPVPSTNGTT
FT                   PAKPAGASRN"
FT   gene            28444..28516
FT                   /locus_tag="AMED_R02"
FT                   /note="tRNA-Ala-TGC"
FT   tRNA            28444..28516
FT                   /locus_tag="AMED_R02"
FT                   /product="tRNA-Ala"
FT   gene            28659..29594
FT                   /locus_tag="AMED_0025"
FT   CDS_pept        28659..29594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0025"
FT                   /product="ATPase component of ABC-type multidrug transport
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41849"
FT                   /db_xref="GOA:A0A0H3CVB2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVB2"
FT                   /protein_id="ADJ41849.1"
FT                   /translation="MTDLAITASGLRKAYQDKTVLDGVDLEVEAGTIFSLLGPNGAGKT
FT                   TTVNVLTTLTKADGGTVRVAGHDVATEAKAVRAAIGVTGQFAAVDELLTGQENLQLMVD
FT                   LNRGSTSKKTVAELLERFDLTEAARKPASTYSGGMRRKLDLAMTLVGRPRIIFLDEPTT
FT                   GLDPRSRRTMWAIIRDLVADGVTVFLTTQYLEEADQLADRIAVLDQGRLVAQGTADELK
FT                   RRIPGTHVRLRFTTAGELDAAARILPEAGRDDEAMALRVPSDGGTKSLRSLLDRLDEYA
FT                   LSAEELSVHTPDLDDVFLALTGRATEVPAK"
FT   gene            29591..30334
FT                   /locus_tag="AMED_0026"
FT   CDS_pept        29591..30334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0026"
FT                   /product="ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41850"
FT                   /db_xref="GOA:A0A0H3CV06"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV06"
FT                   /protein_id="ADJ41850.1"
FT                   /translation="MKSHSIVMLRRNFKHIARNPVSVFNAVLMPIVIMLMFVYMFGDAF
FT                   SVGVDYVDYATPGLMLLAVCYGLGATATAVNSDMTKGIINRFKVMDVSRGAVLTGHVVA
FT                   SVLTNLVAIAALLGVAFLLGFEPAANLLDWLGALGVVMLLGFATGWLTIALGLAAKTPE
FT                   TAGLASVPLVMLPFFSSAIVPADKMGPGLKQFAEYQPFTPIIETLRGLLNGSPATGTLL
FT                   VALGWCVGIAVVGYLWASSTFKKRA"
FT   gene            complement(30318..33431)
FT                   /locus_tag="AMED_0027"
FT   CDS_pept        complement(30318..33431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0027"
FT                   /product="SARP family transcriptional regulator fused with
FT                   ATPase domain"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41851"
FT                   /db_xref="GOA:A0A0H3CWZ5"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWZ5"
FT                   /protein_id="ADJ41851.1"
FT                   /translation="MQIGILGPFEVRTADGVLADVPGARLRGLLVALALEPGQVVPKGT
FT                   LVDWIWGEHPPAEAPNALQRLVSRLRKALPEGAVDGRPTGYRLVVAPEDVDAVRFERLV
FT                   GQARQEDDPRRLREALALWRGPAMQDVELPESAAFEAAVTRLEGLRLAALEDRFDAETR
FT                   LGHGAELVTELTDLVAAHPMRERLVAALMRALVATGRDTEALLVYERTRETLADSLGVD
FT                   PSPELSEVHVALLRGELGRREESRKTNLRAELTSYVGKDAEVTAVRELIAEHRLTTLIG
FT                   PGGSGKTRQATETARTLLGDLPDGAWLVELAGIGASDDVAQATLGALKLRDSLVGEAPD
FT                   AEPTDRVIAALRERSILLILDNCEHVIEAAAAFAHRVLGECRRLRILATSREPLGITGE
FT                   ALWQVAPLVVPAENADPAEIESAPAVRLLRDRAGAVRKDLAVDARTLARVCRALDGMPL
FT                   AIELAAARLRTMSLDQLAHRLDDRFRLLTGGSRTALPRHRTLRAVIDWSWELLSDAERV
FT                   VLRRLSVFSGGASLEAAERVCGDDSAEVLDLLTALTEKSLVVIVGDEAPRYRMLGTIKE
FT                   YARQRLAEAGETDLARRAHLAYFTELAETAEPHLRRAEQLRWLATLEAEHDNLTAAMRG
FT                   ALAAGEAAEAMRLAATAGWYWWLAGHRAEGNELVMAATAVPGEVPDEIRGVVYTFVVQF
FT                   VTAGQQSDEYRAEEWIRKAHEISLRVENPRLALRFAGSLERLLHGPDAALSAFEPLLAD
FT                   EDPWVRAVARLQLGKMRIQFGHGDQAADALLETAVAEFCSLGERWGTSFALTELADRIA
FT                   VRGEFGEACKYYEQAVEVVTEVGALEDVVRMRSRQAQLYWLLDDEKASAAALAEAQLAA
FT                   ERVAWPNALAELALAKAELARWSGDTAQARHQLEVATTEMGDDAQRANVQAVVRDLLGY
FT                   LAEDVGEAREHRAAAFDAATETGHPLTISQVLVGLADLALRTGQDEQAARLLGASAGVR
FT                   GLPDRSHPDVARIEETTRSRLGDVGFTEATRAGSEASWPELAAVTLAS"
FT   gene            33529..34749
FT                   /locus_tag="AMED_0028"
FT   CDS_pept        33529..34749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0028"
FT                   /product="cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41852"
FT                   /db_xref="GOA:A0A0H3CTA0"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTA0"
FT                   /protein_id="ADJ41852.1"
FT                   /translation="MSQTVDVPHGLPMDRDAGPFDPPSALTRLRDTRPVSPLVFPDGHE
FT                   GWLVTGYEEVRQLMADTRFSSRLDLDVIHVPYETGMPAATEPSPQLPGMFIAMDPPDHS
FT                   RLRRKLTGAFTVKRMKQLEEHIADVVERQLDHLARLAPPVDLVREFALPVPSLVICELL
FT                   GVPYADRDSFQANSAQFMVREQPLEQKMGAYIALNTYLTELVTNKRADPGEDILSDLAR
FT                   HDDLTIEELTGAAFLLLLAGHETTANMLSLGTFALLQHPGQCAELRADAELLPGAVEEL
FT                   LRYLSVADIFFRYATEDLELGGETITKGSTVVVSLLAANHDPRRFENPGTLDIHRNARG
FT                   LLSFGHGVHQCLGQQLARIEMRAGFEGLLRRFPTLALAVPAEEVKLRTDMNIYGVHALP
FT                   VTWTAGS"
FT   gene            complement(34727..36124)
FT                   /locus_tag="AMED_0029"
FT   CDS_pept        complement(34727..36124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0029"
FT                   /product="esterase/lipase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41853"
FT                   /db_xref="GOA:A0A0H3CUB0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR013595"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUB0"
FT                   /protein_id="ADJ41853.1"
FT                   /translation="MRSKMLTAGLVLALTAALGGVATADARPGGRPALADPHPCPGQPG
FT                   FTCSTLTVPLDHTGRVPGTLALPVATADNATAPKGVLLFLTGGPGQGGVGTITRIAKQR
FT                   LPEVAQDYRIVMLDQRGTGPSGALRCPGLQAEMGSSDIATPSAGAVQECARILGNTAPL
FT                   YSTDQSVADFDQLRQALGVPKLVVDGVSYGSFTAARYAIAHPDHVGKVILDSVLPHHAT
FT                   ASASLYLTGLTAEARVLRAACAVAPACGFDPAEDMAWVVRHRGTADGVRIFDTVVSYEF
FT                   ADSTYRNPAAGDIIGALHEARNGTPAHLDDLLEAYKSGGDDPAAFSAGLHAATLCADQR
FT                   FPWGSAATPLPLRQPLLSLAARTLPASATWPYTTGVATQQGFIQSCLPWPAERPASNPA
FT                   SRLPDVPVLLLNGDRDLSTPMEWAREEAARAPRGRLVIVPGESHSIQNRERGHAGRDAV
FT                   LSFLRST"
FT   gene            complement(36180..36818)
FT                   /gene="pdxH"
FT                   /locus_tag="AMED_0030"
FT   CDS_pept        complement(36180..36818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxH"
FT                   /locus_tag="AMED_0030"
FT                   /product="pyridoxamine 5'-phosphate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41854"
FT                   /db_xref="GOA:A0A0H3CVB5"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVB5"
FT                   /protein_id="ADJ41854.1"
FT                   /translation="MVQVRGWPSFPEELPVFKPETAPPDPQALFLEWLTEAGEHVLAPH
FT                   AVTLSTVDADGAPDARVVVLKDVGAGGWAVATSSESPKGLQLRKDPRAALTFFWPGRGR
FT                   QVRLRGPVSPAAPEVSAADFLARPPASRVEAFIGHQSQVLHDPADLDAAAAEAERWVEE
FT                   NPDVAPETWTRYLVDPDEAEFWQASHDRRHVRLRYRKAGDGWVRERLWP"
FT   gene            complement(36820..37470)
FT                   /locus_tag="AMED_0031"
FT   CDS_pept        complement(36820..37470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0031"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41855"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV09"
FT                   /protein_id="ADJ41855.1"
FT                   /translation="MLTPEQYLGAMAERIQRAGGRLNSVQIGPATAVVGLFTEQVLLTT
FT                   MNYCVIAAAVPEVSAAALYDFTGRATQHARANLTGTMGWTAGSVVIAGLVGGRVYPDAA
FT                   QAASAKSGNQFGGETRMVAVDLSAGQLYAFVGGKLWGAAMQGSVNAKLTYCFPQPAEVY
FT                   QQVQWQQAQQQPQHPMPAPAPQVPPPPYAGPAGPQPPVYPPPGHAPQQGPYGY"
FT   gene            37737..38084
FT                   /locus_tag="AMED_0032"
FT   CDS_pept        37737..38084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0032"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41856"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="InterPro:IPR018567"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CX01"
FT                   /protein_id="ADJ41856.1"
FT                   /translation="MAEANGQHVSKVRVSADQPHPACFFYRPDGKIQLTVRVYVGDAKT
FT                   ATALVNKAAPVDSSNPASDPSGWKGGYLSTDDGAVYAVAKGATAVIASTNQKQSVKART
FT                   VVKKAIAALKL"
FT   gene            38231..38683
FT                   /locus_tag="AMED_0033"
FT   CDS_pept        38231..38683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0033"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41857"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTA5"
FT                   /protein_id="ADJ41857.1"
FT                   /translation="MADTLKEILLDSSRRPAVVSDFETLVDAEVSDKGGVSGAVVKTSF
FT                   AAVKKIKPGIIPSAVDTLLPDFASALEPFYGDYRAKGGNDFGAYLSSRSDEASDALLSV
FT                   TDSRAEKSSRDSIKKVYGKLRPNGKKNVEEALPRLGQLIDKHAAAV"
FT   gene            complement(38752..39288)
FT                   /locus_tag="AMED_0034"
FT   CDS_pept        complement(38752..39288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41858"
FT                   /db_xref="GOA:A0A0H3CUB5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUB5"
FT                   /protein_id="ADJ41858.1"
FT                   /translation="MSRATAQAVETADKLVTEGVKQGRRAQKKLAKKTELTRKELKKSS
FT                   KAARQEALARLSELRKPGRKAKKAAIKAAKAAGESKRRGKKDFKAAKKDFYAALSEAKS
FT                   AAKGTRSRRKWPWLLGLVVVGAGAAYALRSKQEPPVAPAPPKATPPAPKPAEPAKPTAQ
FT                   ANGKAPSAAPAEKKN"
FT   gene            39387..39902
FT                   /locus_tag="AMED_0035"
FT   CDS_pept        39387..39902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0035"
FT                   /product="peptidyl-prolyl cis-trans isomerase A
FT                   (cyclophilin A)"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41859"
FT                   /db_xref="GOA:A0A0H3CVB9"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVB9"
FT                   /protein_id="ADJ41859.1"
FT                   /translation="MKATLHTNQGDIHLTLLPDHAPKTVANFVGLAEGTKEYTQPNAAG
FT                   TNSGPFYDGSIFHRVIDGFMLQGGDPTGTGRGGPGYKFGDEFHPELQFSKPYLLAMANA
FT                   GPGTNGSQFFITVAPTTHLNFRHTIFGEVADQESRNVVDAIARTSTGPADRPLTDIVIE
FT                   KVTIDHEG"
FT   gene            40093..40893
FT                   /locus_tag="AMED_0036"
FT   CDS_pept        40093..40893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0036"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41860"
FT                   /db_xref="GOA:A0A0H3CV12"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV12"
FT                   /protein_id="ADJ41860.1"
FT                   /translation="MHAGGQEQRRQHRGYQEAGFGQRTVFGARLSRSVLVTQAILAVNV
FT                   LVFLLTVAQAGSLNDNDLSSAFQHGALYGDATLGHGEWWRILTNGFLHYGPIHIAVNMF
FT                   SLWMMGRSLEQVCGRGRFLALYFVSMLGASASVLLFGNPGGYPGTVGASGALFGLMGAY
FT                   AVTVLKLRLNPTGLIITLALNAFITFGIPGISIFGHIGGLVTGALVTVALLYAPEVGQV
FT                   RWQAIGITIITVAIIGLIVYRGSQFSPETCQFVQFPFGRYYVCA"
FT   gene            complement(40890..41261)
FT                   /locus_tag="AMED_0037"
FT   CDS_pept        complement(40890..41261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0037"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41861"
FT                   /db_xref="GOA:A0A0H3CX07"
FT                   /db_xref="InterPro:IPR019692"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CX07"
FT                   /protein_id="ADJ41861.1"
FT                   /translation="MVSAWAVTALLLAGVVTDALTGDRGGLVLFALAAVAAGAFAAHAT
FT                   IVRPRLAADTEGLVARTLGGTHRLPWAQTRTRLRTTRRLGRDGVTLEIEHEDELYVFGW
FT                   LDLGEDPRDVLDVLSTLRS"
FT   gene            complement(41374..41640)
FT                   /locus_tag="AMED_0038"
FT   CDS_pept        complement(41374..41640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0038"
FT                   /product="putative septation inhibitor protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41862"
FT                   /db_xref="GOA:A0A0H3CTB0"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTB0"
FT                   /protein_id="ADJ41862.1"
FT                   /translation="MPKSKVRKKTAYTPPADRRTPVKVRAAGPTGLAWKIPMFGLMLIG
FT                   LVWLLVNYIAGDKISWMADLGNWNFAGGFALMIAGLLMTMRWR"
FT   gene            41881..42939
FT                   /gene="srtA"
FT                   /locus_tag="AMED_0039"
FT   CDS_pept        41881..42939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="srtA"
FT                   /locus_tag="AMED_0039"
FT                   /product="sortase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41863"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042003"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUB8"
FT                   /protein_id="ADJ41863.1"
FT                   /translation="MPPREPMPPRRPPSPGRSATPPRGQVPPRRPQRGPQDQPPPRPQG
FT                   RPPRRYTGPTPPPGANEETVIFAPVGKGGTATEEKSAPAPLGKGGVAIRTAGEILITLG
FT                   LVVLLFMVYELYVTDLFSAGKQSEASDQLDGEWAHDRTLHPELVDGKAFARIHIPSFGV
FT                   DYNFTIQEGTDDAALEVGPGHYKGTALPGEPGNFAVAGHRVGKGAPFNDLDNLSSCDQI
FT                   VIETSADFYIYKVLPYDDEMKDWAAGKGADPKCKGVSTLRDQNAEDGGAYSETFGRKVV
FT                   LPSQGTAVNPVPYKGAEALPKAQQAALLTLTTCHPQFSAKERLIITSVLTQQVPKNQVK
FT                   DYGDLLSKIGEA"
FT   gene            42939..43094
FT                   /locus_tag="AMED_0040"
FT   CDS_pept        42939..43094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41864"
FT                   /db_xref="GOA:A0A0H3CVC3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVC3"
FT                   /protein_id="ADJ41864.1"
FT                   /translation="MYAWIWRKLPGPFAAKLTMAVVLVLGVVALLMFVVFPWLEPRLWF
FT                   NEVAVH"
FT   gene            complement(43199..43591)
FT                   /locus_tag="AMED_0041"
FT   CDS_pept        complement(43199..43591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0041"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41865"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV15"
FT                   /protein_id="ADJ41865.1"
FT                   /translation="MSLDVSPALLEKAERGEVTDAEFVTCVKESLPYAWEVITGVIADA
FT                   EGAADGFADNETPPPSEAARGQLLRALASDAIRGGLERHFGVKLAFQNCHRVAVFKQSE
FT                   VAGDRYRAFVSPRGQLLNQSPELRDC"
FT   gene            complement(43692..44426)
FT                   /locus_tag="AMED_0042"
FT   CDS_pept        complement(43692..44426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0042"
FT                   /product="ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41866"
FT                   /db_xref="GOA:A0A0H3CX12"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CX12"
FT                   /protein_id="ADJ41866.1"
FT                   /translation="MNTFAKITATETKLFLRSPLMAAAGILLPSILLLAIGAIPGMSEP
FT                   SAAAGGYRFIDAWVPSLIVVSLAMLALQSIPAAVATYREQGVLRRLATTPVHPANLLGA
FT                   QLLIHVAVSLAGIVLVLGLGHAVYDVPLPKHPLSFALTLLLGIVSMFALGLIAAAVART
FT                   SKAASGVAMIAFLPTMFFGGVYLPRPFLPETLRRIGDYVPPGSQPLQDAWVGTGVQPLQ
FT                   LAALAAFAVLGTALAAKLFRWE"
FT   gene            complement(44423..45136)
FT                   /locus_tag="AMED_0043"
FT   CDS_pept        complement(44423..45136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0043"
FT                   /product="ATPase component of ABC-type multidrug transport
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41867"
FT                   /db_xref="GOA:A0A0H3CTB5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTB5"
FT                   /protein_id="ADJ41867.1"
FT                   /translation="MPLIEVTDLRKRYGTRVAVDGVSFTVERGEIFGILGTNGAGKTTT
FT                   VECLQGLRRADGGTISVLGLDPATDRTALTRRVGVQLQESQLPAKLRVREALELFASFY
FT                   PEHADIDVLLDQLDLSDHARSYFGKLSGGQKQRVSIALALVGQPELAILDELTTGLDPH
FT                   ARRETWRLVEGVRATGVTVLLVTHFMDEAERLCDRVAIFDAGRVVATGTPTELRAAAGA
FT                   STLDDAFVSLTRSAR"
FT   gene            45307..47130
FT                   /locus_tag="AMED_0044"
FT   CDS_pept        45307..47130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0044"
FT                   /product="two-component system histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41868"
FT                   /db_xref="GOA:A0A0H3CUC2"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUC2"
FT                   /protein_id="ADJ41868.1"
FT                   /translation="MVYLRAIGRAFALAAFSLLSWLDVLVELVTFALLCGGLVFFFGPA
FT                   VEWARGRSAAARTLAARWCGVEIAAPYRPEPPEPVRERDGWYRDGNQLYKRAFWISWQH
FT                   RLTWVMEDPATGREFTWQLVNPLLTLLLPVAVLLGGPAALRGHGRWTRWMLGPRPPVEP
FT                   TRKNWLHRHLESLGHQFGILALSLVQLIFSVFQLAVFGVATPLAAPVVLWSRSITDTLR
FT                   REAENWTGVRIPRPYLPPPALPVPRADGLYQVGRQLHEEPFWPVQLARRRWILRDRATW
FT                   RDIAGGGLSSLVSLACSLPALVAFGWAVTGLSVLWVWRPFVSPRVEWFPLPPVSTHLGA
FT                   LAQTPLILLAVVIAVAPAPWLARQQARFARLWFGPTESSRLAQRVERLKQTRSDVTVTQ
FT                   AAELRRIERDLHDGIQSRLVAMGMKLGAVEALVDTDPAAAKRLAAELRAASSEALTELR
FT                   VLIRGIHPPVLSERGLLDAVRALAMDSPLKSEVTGSLPGRVEEPVEACVYFAVSELLGN
FT                   AAKHGAKRVSIEVEFADGLLTVVVTDEGPGGANPARGSGLRGIERRLGAFDGRLTLTSP
FT                   IGGPTKATLEIPCQLDLEPSSPRTSTSSETA"
FT   gene            47070..47729
FT                   /locus_tag="AMED_0045"
FT   CDS_pept        47070..47729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0045"
FT                   /product="two-component system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41869"
FT                   /db_xref="GOA:A0A0H3CVC7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVC7"
FT                   /protein_id="ADJ41869.1"
FT                   /translation="MSARPRTLVAEDQYLLRDGLTHLLTAHGFDVVAAVASGPELVAAL
FT                   RAERPDVSIVDVRMPPTNTDEGLQAALAARREIPGLPILVLSQHVEQLYARELLADGTG
FT                   AIGYLLKDRVFNAEQFIDAVRRVAAGGTVMDPEVIAKLVAGNASDPLAALTQREREVLS
FT                   LMAEGCSNAAIAAKLHFSEGAVGKHTANIFAKLDITASDDTNRRVMAVLAYLGAGT"
FT   gene            complement(47726..49045)
FT                   /gene="fpr"
FT                   /locus_tag="AMED_0046"
FT   CDS_pept        complement(47726..49045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fpr"
FT                   /locus_tag="AMED_0046"
FT                   /product="ferredoxin--NADP+ reductase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41870"
FT                   /db_xref="GOA:A0A0H3CV18"
FT                   /db_xref="InterPro:IPR021163"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV18"
FT                   /protein_id="ADJ41870.1"
FT                   /translation="MGAGPAGIYAADILDKSDADVTIDLFERMPAPFGLIRYGVAPDHP
FT                   RIKGIVTALEKVLAKPNIRLLGNIDYGTDIKLDELREFYDAVIFSTGASADRALGIPGI
FT                   DLDGSFGAADFVSWYDGHPDVPRTWPLTASSVAVLGVGNVALDVARVLAKTADELLTTD
FT                   IPENVYQGLKASPVTDVHVFGRRGPAQAKFTPLELRELDHSPNVEVIVYPEDIEFDDGS
FT                   IAALRASKQIDMVVKTLQEWAIREPGSRPRRLHLHFFHSPAEVLGEDGRVTGLRTERTE
FT                   LTGDGNVRGTGEFHEWDVQAVYRAVGYLSSHLPELPFDHVAGVVPNQAGRVLDLDENQL
FT                   SGVYVTGWIKRGPIGLIGHTKGDAAETIASLLTDADTLAAPKFASPDAILDFLEARGIP
FT                   FTNWDGWGRLDAHEKALGSAAGRDRVKVVEREEMTRISRG"
FT   gene            49158..49802
FT                   /gene="pabA"
FT                   /locus_tag="AMED_0047"
FT   CDS_pept        49158..49802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabA"
FT                   /locus_tag="AMED_0047"
FT                   /product="para-aminobenzoate synthetase component II"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41871"
FT                   /db_xref="GOA:A0A0H3CX15"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CX15"
FT                   /protein_id="ADJ41871.1"
FT                   /translation="MRVLVVDNYDSFVYNLVQYLAQLGADCTVWRNDVVDLDRVPEFDA
FT                   VLVSPGPGTPERAGQSMDVIRKCAETRTPMLGVCLGHQALGVVYGATVDRAPELLHGKT
FT                   SQVRHTGAGILKDLPEEFTATRYHSLTVVPDTIPDAVFEITGRTESGIVMGMRHRELPL
FT                   EGVQFHPESVLTEGGHRMLANWLAAAGHPVDPVRVNELERATKALQKAAVA"
FT   gene            49799..50590
FT                   /locus_tag="AMED_0048"
FT   CDS_pept        49799..50590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0048"
FT                   /product="ABC transport system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41872"
FT                   /db_xref="GOA:A0A0H3CTB7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTB7"
FT                   /protein_id="ADJ41872.1"
FT                   /translation="MIRLEGVGKRYGRGDFVLRDVDLTVEPGHVVGILGSNGSGKSTLL
FT                   RIMAGVSHATTGSLTGSPRIGYLPDRFPAGQRMGARAYLRHMARIRGLADLSVIDPLLE
FT                   RLALVGGPTAPLRTLSKGNAQKVGLAQAVMVRPDLLILDEPWSGLDVGTHAILGELVAE
FT                   TRARGASVVFTDHRPQVVHDHADVVHLMNDGKLTAESAEPTTRIVLRGGGTGWVDEPGV
FT                   RHAVTEGPHVVLTVEVARVDAVLLRALEDGWSVREVAPCSP"
FT   gene            50578..51219
FT                   /locus_tag="AMED_0049"
FT   CDS_pept        50578..51219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0049"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41873"
FT                   /db_xref="GOA:A0A0H3CUC7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUC7"
FT                   /protein_id="ADJ41873.1"
FT                   /translation="MLALTRYYLALLGHSQRYLPALLAYLALCVILYADPHSPPLPLYG
FT                   VSAGGLLVVSCWLTIALLDIEDPVQRLVTLSHARQWRRMITGAILTVLACSLVLTAITE
FT                   VWSALKSFRIQPSALGIGLLAHLACAVLGIAIALPCSRLLVHRIGWTVLAAVITLVVVL
FT                   LAKIPLVHPLLHALTDDEPIGGPLVLALVTAAAMVAVSYFAVSELVRRRS"
FT   gene            51320..51637
FT                   /locus_tag="AMED_0050"
FT   CDS_pept        51320..51637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41874"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVD1"
FT                   /protein_id="ADJ41874.1"
FT                   /translation="MTAGIVAITVPNSGSELPELADWLRGEDQLRGRVQLFDAVVVGVS
FT                   STSADVFCRSLFAWLTRCRETRVSLKVKRSGAAEELELDFGAASDADQVLVAVQGFLDQ
FT                   S"
FT   gene            complement(51698..53674)
FT                   /locus_tag="AMED_0051"
FT   CDS_pept        complement(51698..53674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0051"
FT                   /product="serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41875"
FT                   /db_xref="GOA:A0A0H3CV21"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV21"
FT                   /protein_id="ADJ41875.1"
FT                   /translation="MSTPRLLSNRYELGETLGYGGMSEVHHGHDVRLGREVAIKILRAD
FT                   LARDPQFLERFRREAQNAAALNHPAIVAVYDTGEANAEFGPLPYIVMEYVEGRTLRDIV
FT                   KTEGPMSQKRAMEVMADVCAALDFSHRHGIVHRDVKPANVMITKNGAVKVMDFGIARAM
FT                   HDGQSAMTQTAAVIGTAQYLSPEQARGESVDARSDVYAAGCVLYELITGEPPFTGDSPV
FT                   AVAYQHVREDPSAPSSVNPAVAPELDAVVLKALAKGPANRYQSAAEMRSDLVRTLSGQR
FT                   PVAPMVMSEDERTQVMNADRRQPQRYDEYSEPDDEDPKAKRRRRAILAAVAAVFVLGAV
FT                   LLIMWLSNAFKSNDPTTVAVPDVLHQTVPQARETLISKGFTGTVEQKQVTCGVQPTDGN
FT                   PQCGQDDVNRVIKIDPGVGTQVASTQKMTLYVGVAPGKSSVPDLKGKTRDQAEQALTDA
FT                   KLTLDGSVQETEVSDPNQAGLVLAQNPPSGSQVDQGTSVKITIGKSKQLKTVTDFTNQA
FT                   YSKAKSSLESQGFTTKRVDQASETVPKDTVITQNPNGGQLAVGSQIVLTVSTGPDSSSQ
FT                   IQMPLLAGMTLDQAQDKLSSMGWTGKFNQKSDKNSNAPEGTITGQNPSAGTMINRDQNV
FT                   TVNVSEGNGFPSITFPTTTRTSN"
FT   gene            complement(53671..55017)
FT                   /locus_tag="AMED_0052"
FT   CDS_pept        complement(53671..55017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0052"
FT                   /product="serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41876"
FT                   /db_xref="GOA:A0A0H3CX20"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CX20"
FT                   /protein_id="ADJ41876.1"
FT                   /translation="MLSSGQLLADRYKLTSRIAVGGMGEVWQASDTRLDRTVAVKILKA
FT                   ELSGDAEFLHRFRTEARMTASLNHPGIAAVHDYGETIFDGDLPIAYLVMELVDGDPLAG
FT                   LLAKHGRLSAEFTLDMLEQAGNALQAAHSHGLVHRDVKPGNILVTSAGQVKITDFGVAK
FT                   AADAAPVTRSGMVMGTAHYIAPEQALGQPAEPASDVYSLAVCGYECLAGHRPFLSENAV
FT                   TVAMMHIRDIAPPLPPDVPPAARAVIEATLIKDPRQRYNNGGEFAAAVAAVRAGLPLPT
FT                   PSGLVNATYATGQQPQQPPPQQLQPPPSMPVPIPQQQLPPQQQMPGGPPSPAMNPMLAI
FT                   GPPSRPAPRQVMLPAARKKTQWGWWALLAAILLVVLVAGIVLVAKMLGAGNGSPPHNGQ
FT                   TQSQVFPGRQVPAEQSSGGYPADTPGTTTDDGRQGIMTTPWTEWNGIQR"
FT   gene            complement(55021..56490)
FT                   /locus_tag="AMED_0053"
FT   CDS_pept        complement(55021..56490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0053"
FT                   /product="peptidoglycan glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41877"
FT                   /db_xref="GOA:A0A0H3CTC0"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTC0"
FT                   /protein_id="ADJ41877.1"
FT                   /translation="MNTPLRKVGMAMLVMVVLLLANATYIQVVKADDYRTDSRNARVLY
FT                   DEFARQRGKIVSQANGEVLAGINPSNDKYKYIRTYADGPMYAPVTGYYSINYGAGGLER
FT                   AEDDVLNGSDPRLFVRRLSDMVTGRDPSGGNVRLTIDPAVQKAAYDLMTQKGYTGAVVA
FT                   MEPSTGRILAMVSTPSYDPNQLASHTSKAQADAWNANNKDPKKPMLNRAISETYPPGST
FT                   MKLVTAAAVLEDGKGPDTQVSQEPNTKLPGTNTTLENYGGETCPGNTFKDALAHSCNVP
FT                   FAEFAGQLGPDKMKKTAANFGIGQTDLTVPMKVAPSTVGPLDSQGALYQSGIGQRDVRL
FT                   TPLQDCLLAATVANGGMAMKPQLVQSVLAPDLSTIEDYSPTELTGTAALSSSNAAILKD
FT                   MMIASEGFTKGGGKRADVKIASKTGTAEHGTDSKNTAPHAWYTAFAPADSPQIAVAVIV
FT                   EDGGNRGLAATGGTVAAEIGRAAINAKLGGG"
FT   gene            complement(56487..57974)
FT                   /gene="ftsW"
FT                   /locus_tag="AMED_0054"
FT   CDS_pept        complement(56487..57974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="AMED_0054"
FT                   /product="cell division protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41878"
FT                   /db_xref="GOA:A0A0H3CUC9"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUC9"
FT                   /protein_id="ADJ41878.1"
FT                   /translation="MSQPAARAAEPLAAQFQTNPPREVPTRRNTELVLLGFATFIVTVA
FT                   LVLVEANQEQELTASIIWLGLAYLGVLTGAHLAVRKWAPYADPVLLPCVALLNGIGLVM
FT                   IHRIDLALAERATQQGKDYTPAVTAQVLFTVISLVFFVVVLVVVNDHRTLTRYGYTAGL
FT                   IGIVALALPALLPSSLSEVNGAKVWLKLPGFSIQPGEFAKILLMIFFASFLVSKRDLFM
FT                   VAGKKLVGVELPRARDLGPILIAAFVCIGVLVFEKDLGTSLLFFSVILVMLYVATERAI
FT                   WVVLGLSFFAVGCVIAYNLFGHVQQRVANWLDPLATYDQAGGGYQLAQGLFGLGTGGVG
FT                   GTGLGAGRPDMVPEANTDFITASIGEELGFIGLAAVLMLYLLVAMRGMRSALAVRDTFG
FT                   KLLGGGLAFTMVMQIFVVVGGVTKLIPETGITAPFLSKGGSSLLANYILVALLLRISDA
FT                   ARKPASRPKPQQQPQAPIAEAHTVLVQRPPAEGGAQA"
FT   gene            complement(57974..59371)
FT                   /locus_tag="AMED_0055"
FT   CDS_pept        complement(57974..59371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0055"
FT                   /product="protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41879"
FT                   /db_xref="GOA:A0A0H3CVD5"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVD5"
FT                   /protein_id="ADJ41879.1"
FT                   /translation="MTLVLRYAARSDRGLVRSSNQDSVYAGPRLLALADGMGGHAAGEV
FT                   ASKVVIASLAPLDDDEPRDDLLAQLREAVANGNAAIAELVSQDPDLDGMGTTLTAVLFA
FT                   GTRLGLVHVGDSRAYLLRGGQFAQITRDDSFVNELLEQGRITPEEAAVHPQRSLLLKAL
FT                   TGHEVEPSLTVREARSGDRYLICSDGLSGMVSDETLAEAVQIPDPQQCADRMIELALKG
FT                   GGTDNVTVIIADVVDVDFGEDAPIVGGAAGDGSDELHQGDSPAARARALTQPPPQQRPD
FT                   LPQPREDPKAKRRKRFRWLAGALVVLVVLAAAAIATRYFVLSQYYVGEGADGEVVIYRG
FT                   VPGSILGIDLHAYEQGSCPPSQVCTDKLRVTQLQEDARLAVQNGVKKDNLDEARKYIDD
FT                   FLQLRKRLNNCAPAGGQPSTTPTPSVTPTTTPSAPAGSTAPSSANQPAGRDCSTPSSTA
FT                   PTTGGGN"
FT   gene            complement(59368..59829)
FT                   /locus_tag="AMED_0056"
FT   CDS_pept        complement(59368..59829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0056"
FT                   /product="FHA domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41880"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV25"
FT                   /protein_id="ADJ41880.1"
FT                   /translation="MPELVVQLTRVGFLVLLWLFVFAALRVVRSDLYAASGMRVQVPTF
FT                   GRKKEKKPRNSKSPQQLLVTHGALAGTRIALDGRPILIGRADDSTLVLDDDYASTRHAR
FT                   IAQRGEDWYVEDLGSTNGTYLDRAKVTAPLRVPLGVPIRIGKTVIELRP"
FT   gene            complement(59930..61165)
FT                   /locus_tag="AMED_0057"
FT   CDS_pept        complement(59930..61165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0057"
FT                   /product="FHA domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41881"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CX23"
FT                   /protein_id="ADJ41881.1"
FT                   /translation="MGRAERFDRRLENLVGNTFARMFGGNVVTQEVAIALERESEENVR
FT                   ELAGGRQLAPNHYIVSLGAADHERMAGDEQRVTQVLAKAVAEHLAAAGLDTYGDVVVSL
FT                   ERNEALHTGQFKTRSSVDPDARPSGAGSPRSARPSNAGDPAMSQPPGYGQYDQGDPYGQ
FT                   QGQYGYGQQGGQQPGYDQGYGQQGGYDQYGGQQPQGGGYDQYGQPQQGGGYDQYGQQPQ
FT                   AGYDQGYAQPQGGGYDQGGYQQPQGGGYDQGYGQPQGGGYDQGGYQQGGYDQYGQQQPQ
FT                   GGYDQYGQQQAYGQPAADPYAQQQGGYGQPAPGRQLAASLQLDDGSNRTYSLKQGGNVV
FT                   GRGQDADFRLPDTGVSRRHLEITWDGQSATLADIGSTNGTTVNGTPVQTWQLADGDVIR
FT                   VGHSSLVFRTQG"
FT   gene            61296..61378
FT                   /locus_tag="AMED_R03"
FT                   /note="tRNA-Leu-CAG"
FT   tRNA            61296..61378
FT                   /locus_tag="AMED_R03"
FT                   /product="tRNA-Leu"
FT   gene            complement(61553..62284)
FT                   /locus_tag="AMED_0058"
FT   CDS_pept        complement(61553..62284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0058"
FT                   /product="secreted esterase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41882"
FT                   /db_xref="GOA:A0A0H3CTC3"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTC3"
FT                   /protein_id="ADJ41882.1"
FT                   /translation="MRLRALLAAAVLTVSTAPAAWAVAHGSDVPPGQYGFVAKLAMTKI
FT                   PRPDGSTYSSFCTGALVAPDWVLTTGHCFHDAHRDRVSGKTPYPTTVTLGLTDEATESG
FT                   IARKATEVLQAKENDVALVRLDSPVTTVTPLTVTRAAPKVGQQLTLAGWGSLTSSDPKP
FT                   ATRLQEGTVAVAKVDPTTLGVRGAAPEITTSACTYDSGAPYFSGNELVAVEATGPDCPH
FT                   AGIETTSRADVIADWTATHTA"
FT   gene            complement(62400..63152)
FT                   /locus_tag="AMED_0059"
FT   CDS_pept        complement(62400..63152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0059"
FT                   /product="secreted esterase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41883"
FT                   /db_xref="GOA:A0A0H3CUD3"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUD3"
FT                   /protein_id="ADJ41883.1"
FT                   /translation="MRVRAVLSAALLTLAAGLATAPAASAVANGADVPAGQFGFAAKLT
FT                   MTDIPKPNGTKYTSACSGALIAAQWIITAGHCFHDANRNRVSGPVPYPTSVLLGTVDQN
FT                   APGVTRNVVTVYQSSANDIAIATLDADVTGITPLTVNRVTPSAGQLLTLAGWGSLTSVN
FT                   PAPSTKLQQGTVQVGQVGTATLGVLGVAPTSTTSACVYDSGAPYFVAGGDGGQLVSVES
FT                   TGPDCPHHQLETTSRVDVVADWIASHTG"
FT   gene            complement(63304..63678)
FT                   /locus_tag="AMED_0060"
FT   CDS_pept        complement(63304..63678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0060"
FT                   /product="peptidylprolyl isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41884"
FT                   /db_xref="GOA:A0A0H3CVD8"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR023566"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVD8"
FT                   /protein_id="ADJ41884.1"
FT                   /translation="MTLEKPLIDRPDGPPPAELEITDITVGDGAEATAGKSVTVHYVGV
FT                   SHSTGEEFDASWNRGEPLRFGLGAGQVISGWDQGVAGMKIGGRRKLVIPPHLAYGDRGA
FT                   GGVIKPGETLVFVVDLVGVN"
FT   gene            63868..67038
FT                   /locus_tag="AMED_0061"
FT   CDS_pept        63868..67038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0061"
FT                   /product="penicillin acylase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41885"
FT                   /db_xref="GOA:A0A0H3CV30"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR002692"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR023343"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV30"
FT                   /protein_id="ADJ41885.1"
FT                   /translation="MAGLTQVAVTAPAAQAAVSPDDYCGGQCSDILPPGEQGSATLAEI
FT                   LAHKLLGTRPAHSADQLGKYSSLAGGYKTLTTSAINQYFNDSSFGVPADQVASTTKPRA
FT                   DVTIVRDKALGVPHITGTTRAGTEFGAGYAAGQDRLWLMDVLRHAARGQLSPFAGGAAS
FT                   NRELEQQFFSNAPYTEAELQAQIDRTAASGPRGAQGLADAQAYVDGINKYISDAYNGRY
FT                   FPGEYVLTGHVDSITNAGSIDPFKLTDLVALASLVGAEFGAGGGGEVQNAIAKLAMQEK
FT                   YGVVQGEKVWRSLRAEDDPEAVKTLHDGQTFPYGKTPANAAGQAMPDKNSVTPQPVVFD
FT                   KTGSASTATPSTVDVAAPAEQEPARGIFENGVLPGNMLSEKHGMSNALLVSGAKTASGH
FT                   PVAVFGPQTGYFAPQLLMLQELQGPGISARGAAFAGLSLYVLLGRGQDYSWSATTSAQD
FT                   IIDTYALQLCDPSGNAPTKDSNYYTYQGKCVPMDTVEVKNAWKPTVADGTAAGSYTLRS
FT                   YRTRYGPVQSRATVGGKPVAYTALRSSYFHEVDSLIGFQELNDPTFVKSAADFQRAAQD
FT                   INFTFNWFYADSKDIAYFNSGANPVRPSDVDPNMPVWGDQGHDWVGWNPAGNVANYTPA
FT                   SQHPQSINQDYYVSWNNAQANGYAAAGADKSAVHRVDLLDSRVKKLIASGTKVTRVNLT
FT                   QAMSEAALADLRAERVLPLLLQVLDKTPATGAAADAEAKLKTWLSHGQLRTETSPGSKA
FT                   YADADAIRIFDAWWPLLVQAEFKPGMGDDAYNAMTGVLGINESPSGWQNGNGQHTGQPH
FT                   KGSSFQFGWWGYVSKDIRQVLGQPVAGPLAQTFCGGGDVTACRQGLVDSLTTAAGQAAN
FT                   TVYPGDANCSAGDQWCADSIIQNPLGGITQDKISWQNRPTFQQVVEYAAHRGDNVANLA
FT                   AAKTVSATSAETGFYDSPASNAIDGNASTRWASDWSDDQAITVDLGSVQQVSRVMLNWE
FT                   SAYGKSYRIQLSPDAVNWTDAAVVTDGDGGQDNLAFDATPARFVKLQGVQRGTKYGYSL
FT                   YEFEVYAH"
FT   gene            67097..68137
FT                   /gene="metB"
FT                   /locus_tag="AMED_0062"
FT   CDS_pept        67097..68137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metB"
FT                   /locus_tag="AMED_0062"
FT                   /product="cystathionine gamma-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41886"
FT                   /db_xref="GOA:A0A0H3CX27"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CX27"
FT                   /protein_id="ADJ41886.1"
FT                   /translation="MDDWTPRTKAIAAGRPHGPGEPLNTPLVATSTYQAGGDFAYARGD
FT                   GTPTWHALEEAVGALEGGHATAFASGVATLSAVLDLLPVGSRVAVPTFSYAVTRGVLAH
FT                   AQKLGKLAVTELEPTDTEAWVAEAATSDLVWLESPTNPTLDVMAIEPIAAAARGRVVVD
FT                   NTFATPLQQRPLELGADVVVHSATKLIGGHSDLLLGITVAKDPAVAAELRGARTRVGAT
FT                   PGALEAWLALRGLRTMPVRLAEQSRTAALLAERLAGHPAVRRVRYPGFGMMVSFDLADA
FT                   ETADRFCASVRLIRSATSLGGVESLVERRAWLAGEERVPAGLIRFSVGLEDPEDLWDDL
FT                   AFALPE"
FT   gene            68211..68996
FT                   /locus_tag="AMED_0063"
FT   CDS_pept        68211..68996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41887"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTC6"
FT                   /protein_id="ADJ41887.1"
FT                   /translation="MSRFAGIVSAGALITFAAAPAALAQTTSETPTTPATTETTSETTT
FT                   TAPPTSATTTPSTSVTTTGTTAPNPTREVTKTTTPGTTTSTSAESEPPKDDYQDNTGHG
FT                   FVGLGGEGVLVIACAAGRPGEVATQYLSVTGGPDQDEADGRLWNYSVRVVDAPAGTTTA
FT                   KFSWTCGGVEGNGTVEFEQEQPPTSTVTATSTPTSTSTSTTSSSAPASSTAPITTASIT
FT                   AVPSTTATSTTPAGNAAPKAQVKVAPKGGVETGFGGTAW"
FT   gene            68993..69577
FT                   /locus_tag="AMED_0064"
FT   CDS_pept        68993..69577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0064"
FT                   /product="peptidase C60, sortase A and B"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41888"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042001"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUD7"
FT                   /protein_id="ADJ41888.1"
FT                   /translation="MTVRRAGAALALVLALAGCGTAEPPKAAAPAPAPASVPVTVPFKG
FT                   LRPTSVKIPKIGAESSLLAVAVKPDGSISVPSVRTPMQAAWYKLSPVPGDVGPAIVLGH
FT                   VDGDKKPGIFFKLKDLAPGDEVDIDRSDGRKLKFVVDRVTQVPKDTFPRDAVYGNSAKP
FT                   ELRLITCGGAFDHAEHSYKDNIVVYANLADA"
FT   gene            complement(69563..70543)
FT                   /locus_tag="AMED_0065"
FT   CDS_pept        complement(69563..70543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0065"
FT                   /product="patatin-like phospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41889"
FT                   /db_xref="GOA:A0A0H3CVE4"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVE4"
FT                   /protein_id="ADJ41889.1"
FT                   /translation="MLFHAGALWRLNELGWLPKLTTVSSVSGGSIAAGVLAHAWTKLWF
FT                   GEDGVAENFGKEVVQPIRKLARTNLDVPVTLKAMMMPWRSAGEELARRYAKHLFGDCCL
FT                   ADLDPAGPHFVFTATSLQDGSLWWFFRQPGPHGQIPLATAVAASSAFPPMLSPVVIPDP
FT                   HRAGHKIVLSDAGVYDNLGLDPIENQRATVLVSDAGKKMKHEDRPRHNWPMQLLRVLTV
FT                   MDNQVRELRTGSLLKSYEDKTYAGTYWATYSDIEHFELPDALPAPVEQTRKLAETKTRL
FT                   TRMSESTQDQLINWGYAVCDAGMRRWVCPGTGLKPEFPYPGSGVG"
FT   gene            complement(70724..71467)
FT                   /gene="pdhR"
FT                   /locus_tag="AMED_0066"
FT   CDS_pept        complement(70724..71467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhR"
FT                   /locus_tag="AMED_0066"
FT                   /product="GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41890"
FT                   /db_xref="GOA:A0A0H3CV35"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV35"
FT                   /protein_id="ADJ41890.1"
FT                   /translation="MRFEPVAPVRAYERVVEQIEQAVVSGALKPGERLPSERELMTQFG
FT                   VGRSTVREALRVLQAAEMIRSRPGDPRGPEVLAASPAALHRSMHRLARADHVGLAELLQ
FT                   FRMILDGSAHLLAAGLRTEEDLTGLDAALESMREGVSRGYAEFSRADVAFHEVIARISR
FT                   NPLLVVSEEVVRGVVLELIEDKLEHASNRTSLMRTWLAHHAEVLDAIRAADGAGAAQLA
FT                   KQALYDNYAEYVPAGQRPLLTPLLQ"
FT   gene            71616..73085
FT                   /locus_tag="AMED_0067"
FT   CDS_pept        71616..73085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0067"
FT                   /product="periplasmic substrate-binding component of
FT                   ABC-type dipeptide/oligopeptide transport system"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41891"
FT                   /db_xref="GOA:A0A0H3CX33"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CX33"
FT                   /protein_id="ADJ41891.1"
FT                   /translation="MAAVLLLAVSGCSAGSSASVSAGPNTLSVGFTAEPANFDFTRTDG
FT                   AAIPQALLYNVYEGLVRLDAQGRVVPLLAKSWTISPDRKTYDFQLQQGVKFSNGAPFTA
FT                   EDVKFSLLRVKTDWTISIKANMDVIDHVDVEAPDHARVVLSKPSNGWLFSLTSRLGAMF
FT                   SPTGIADLANKPVGTGPYVVAARKRGDSVVLKANPAYWGRKPAYGTVVLKYIKDPTALN
FT                   NALFSNGIDVISAITAPDSIPQFQADDRFQVVQGTSNSEVTLAMNNARPPLNDVRVRQA
FT                   LTYAIDRKALLDTAWAGRGTLIGSMVPPTDPWYEDLANVHPFDPAKAKALLTEAHATNL
FT                   NLRLRIPNLPYAVSAAQVVQSQLADVGVRTTIEPLDFPAVWLKQVFTDHDYDLSIIQHV
FT                   EARDITTFGKPKYYWGYDSKRVQQLLAEADSGTPEQQVADMKQVARQLNTDAAADWLFL
FT                   FPNVIVAKAKVGGFVQNQVSESFDLTGLAPR"
FT   gene            73094..74026
FT                   /locus_tag="AMED_0068"
FT   CDS_pept        73094..74026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0068"
FT                   /product="permease component of ABC-type
FT                   dipeptide/oligopeptide/nickel transport system"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41892"
FT                   /db_xref="GOA:A0A0H3CTC9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTC9"
FT                   /protein_id="ADJ41892.1"
FT                   /translation="MLRRVAIFVVSVLVASIVVFLFMAVLPGDPAQVALGVNATPELLA
FT                   KTRAEFGIDRPLVTQYFDWIGGVLHGDFGRSYVTRDAIGPQLLDRLGVTLWLVGAGMLV
FT                   ALVIAIPAGTFAAVKHRKAAGASVSGLSQIGVAIPAFLAGIILVQIFAVQLRWLPSGGW
FT                   TPPDQDAGEFLRGLILPALSLGLVQGAVLTRYVRSAVLDTLGQDYLRTARSKGLRPGQA
FT                   LVRHGLRNASVPVVTVLGLQLATLLIGAVVVERVFVLPGLGSMLLDAVSARDLLTVQGI
FT                   VLVLVAGVLLVNFVVDLLYTVLDPRLRGS"
FT   gene            74023..74832
FT                   /locus_tag="AMED_0069"
FT   CDS_pept        74023..74832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0069"
FT                   /product="permease component of ABC-type
FT                   dipeptide/oligopeptide/nickel transport system"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41893"
FT                   /db_xref="GOA:A0A0H3CUE1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUE1"
FT                   /protein_id="ADJ41893.1"
FT                   /translation="MMRNLVIGGILVGLVVLAALLSFAWTPFDPVKVDAAHRLLGFTGS
FT                   HWFGTDKFGRDLLSQLMVGARTTVYVGVVAVGIAAVIGTPLGILAGMSPRWLGEFVMRV
FT                   NDLVLAFPALLLAIMFGAVFGADTLTAMVAIGIATIPSFARIARSGTLQVMSTEFVLAA
FT                   RAGGRSRLNIALRHVLPNISGLLIVQASVSFAIAVLAEAALSFLGFGTRPPTPSWGRML
FT                   QESQELLTVQPRLALVPGIAIAVAVLGFNLLGDGLRDRLDPRLAARL"
FT   gene            74829..75560
FT                   /locus_tag="AMED_0070"
FT   CDS_pept        74829..75560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0070"
FT                   /product="ATPase component of ABC-type
FT                   dipeptide/oligopeptide/nickel transport system"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41894"
FT                   /db_xref="GOA:A0A0H3CVE9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVE9"
FT                   /protein_id="ADJ41894.1"
FT                   /translation="MTLSVRGLSVSTLVRDVSFEIGAGERVGLIGESGSGKSLTALAIM
FT                   GLLPEELPASGSVVLHDHELLEMSEKDLSRLRGDELAMVFQEPMTALNPAMRVGRQVTE
FT                   PGRLRGRRHRAEDLLSAVGLPGTARAYPHQLSGGQRQRVVLAMALANEPSLLICDEPTT
FT                   ALDVTVQAQILSLIKTSLPAESALLFITHDLAVVASVCERVLVMLDGEIVEAGSTREVL
FT                   TSPKHEYTRKLLDASDLEARR"
FT   gene            75557..76330
FT                   /locus_tag="AMED_0071"
FT   CDS_pept        75557..76330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0071"
FT                   /product="ATPase component of ABC-type
FT                   dipeptide/oligopeptide/nickel transport system"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41895"
FT                   /db_xref="GOA:A0A0H3CV40"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV40"
FT                   /protein_id="ADJ41895.1"
FT                   /translation="MTVIEVRDLERRYARRDVHALRGVSFDVEAGQRFGIVGESGSGKS
FT                   TLVRLLAALDKPTAGTVSFQGRRIDNLPERRLGFLRSELQIVFQDPMGSLDPRMRVRDI
FT                   VSEPLGRREPDRVAELLAAVGLPADAAQRYPHQFSGGQRQRISIARALAPNPSVLIADE
FT                   PVSALDVSVRGQILDLLGSLVEQFALTLVFVSHDLGVVRHVCDRVAVMRRGEIVELGDV
FT                   PQVYDAPRHEYTRELLEAAPNLRAELARLRGGEDA"
FT   gene            76491..77735
FT                   /locus_tag="AMED_0072"
FT   CDS_pept        76491..77735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0072"
FT                   /product="aldehyde dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41896"
FT                   /db_xref="GOA:A0A0H3CX39"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CX39"
FT                   /protein_id="ADJ41896.1"
FT                   /translation="MASLPSRVRRSLLNDVAAAIRSRREEFENLLVLETGKPLVDCRVE
FT                   VARTIVTWEAAAEEVSRLHGETVPLDLLPSGDGLVGFWKRKPIGVVVGIAGFNYPLLLA
FT                   SHKIAPAIAAGCPVIVKPAPQTPLATLWLVHLVRSVAPIAAMVQLVTGDAAVGAALTTD
FT                   RRIGAVSFTGSAAVGHRIARDAAPTKTLLELGSNAALVVAPDADLDAAVDAVLRGGFYA
FT                   SGQACISVQRVLVVASVAEEFTERLVGRLDEVVVGDPRDEKTRVSALIDPASTARVAAW
FT                   IEQAGARRVGGGVDGTVLRPTVLLDVPDGVEAWDEEIFGPVVCVRTVSDVDEAFAAVNA
FT                   SRYGLHASVYSRSLHTAFRALDELEVGGVVVNEVPGFRSDTMPYGGVKDSGIGREGPRF
FT                   AVEELTVTRMAVLRP"
FT   gene            77732..78487
FT                   /locus_tag="AMED_0073"
FT   CDS_pept        77732..78487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0073"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41897"
FT                   /db_xref="GOA:A0A0H3CTD2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTD2"
FT                   /protein_id="ADJ41897.1"
FT                   /translation="MNYSTLFRLDGRRAVVLGAGGIGREAARALAAHGADVVCADRDLE
FT                   AAREAGVGEPYEIDLLAPGAVDKAASDLGPLDVVVLTAATNVRKRLLDYTREEFDRVIA
FT                   LNLGVTFEVVRVFGADMVARGRGSIIGFSSIRGTTVEPGQGPYAATKAGLVQLFRTAAA
FT                   EFGPAGVRVNAIAPGVVETPLTAQIKANPEWYAAYAAKGALGRWARPEELAGAVVYLAS
FT                   DASSFVTGSVLAVDGGWTAVDGRFDPPAS"
FT   gene            78497..79882
FT                   /gene="gatA"
FT                   /locus_tag="AMED_0074"
FT   CDS_pept        78497..79882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="AMED_0074"
FT                   /product="aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln)
FT                   amidotransferase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41898"
FT                   /db_xref="GOA:A0A0H3CUE4"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUE4"
FT                   /protein_id="ADJ41898.1"
FT                   /translation="MTELPDLTAVELVAQYRAKTLSPVEVTEAVLTRIEEREPELHALY
FT                   AYDPSGARDDAKASEARWASNEPLGPIDGVPLTLKENIATRGTPVPLGTAATALVPAAE
FT                   DAPAAARVRESGAVLLAKTTMPDYGMLTSGLSSFHTTARNPWQLSATPGGSSAGAGAAA
FT                   AAGYGPLHVGTDIGGSIRLPAGWCGLTGLKPSFGRVPVDPPFLGRVAGPMTRTVADTTL
FT                   LMSVLSRPDPRDHLCLPPSELDWSSTALPVGGLRVGLQLESGPGLPVDPAIRDAVTAAA
FT                   RAFEAAGAVVEPVEPFLTREMLDGLDVFWRTRAWSDLAALPRDRRAKVLPYIADWAAGG
FT                   ADASGVDVYRGFAQIDVMSVAALRATSAFDVVLSPVCPVAAPPAEWASPTNDPARPFEH
FT                   IAFTVPYNMSGQPAVSLNCGYTDDGRPIGLQIAGRRFDDLGVLRVAAAYEGLRPPQRPW
FT                   PIG"
FT   gene            complement(79955..81166)
FT                   /locus_tag="AMED_0075"
FT   CDS_pept        complement(79955..81166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0075"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41899"
FT                   /db_xref="GOA:A0A0H3CVF3"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVF3"
FT                   /protein_id="ADJ41899.1"
FT                   /translation="MKVRPLVWVGIDVGKAHHHACVMDPAGTVVFSQKVANDQAAIEQL
FT                   VARAGQAAGEVRWAIDLTSNAAALLIAVLIASGQQVVYVPGRVVNRMTGVFRGEAKSDA
FT                   KDARVIAETARMRTDLTPVTATDDLVIELTRLSAHREDLMADWVRGVNRLRDLLTGIFP
FT                   ALERAFDYSTRSALILITGFQTPQAIREAGETGVAGYLREHGAWAKGIPGMTADALAAA
FT                   HAQTVQLPGEATTATLIAGLARQLLALDRQIKNTDKLLTSQFRQHPQAEIIESLPGLGP
FT                   ILGAEFLVVTGGNLTAFATPGRLASYAGLVPVPQDSGRVTGNLRRPKRYNRRLRRVFYM
FT                   AALSSLKAGGPSRAFYDRKRSERLIHTQALLALARRLVDVLWALLRDSRTYTPTAPQPA
FT                   TAAA"
FT   gene            81407..81928
FT                   /gene="rpoE"
FT                   /locus_tag="AMED_0076"
FT   CDS_pept        81407..81928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoE"
FT                   /locus_tag="AMED_0076"
FT                   /product="RNA polymerase sigma-70 factor, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41900"
FT                   /db_xref="GOA:A0A0H3CV45"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV45"
FT                   /protein_id="ADJ41900.1"
FT                   /translation="MTAAPVLDSEHFTEVHDRHFADIYRYVAGRLGAQAAEDVAAETFL
FT                   VAFDRRKTFDASRGDMRAWLFGIATNLVSRHRRKEARHYRALSRLDPRETTEGHENRVV
FT                   DAVVAARVGKALSRLSTGERDVLLLVALGELGYAEVAEALGISPGTVGSRLNRARKKLN
FT                   PVLSQEASDE"
FT   gene            81921..82814
FT                   /locus_tag="AMED_0077"
FT   CDS_pept        81921..82814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41901"
FT                   /db_xref="GOA:A0A0H3CX43"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CX43"
FT                   /protein_id="ADJ41901.1"
FT                   /translation="MNDLQTLRAALVPGDPAQDVVDRSRHRLQNRMLTGPRRRVRPLAL
FT                   GAGLVTTAAAAAVVVATLPGAPAPTPVPAPQPQAVAPVVTGTQVLLAAATVAEHAPADT
FT                   GKYWHVRTASDKQVYEYWFSADGHLWFRGAKSSGRLMALGSSPLRLAGTTVTFEQLRTL
FT                   PIDPAALRDWLVNAIAHSGARTSAGPLTADDRERELLLSMVSLVSTLPAPPAVRAAAFR
FT                   AIAAYPGVQDLGAVPGGRGFMLPGNYRLVVDPSTGRINRTSMYVTADGAVYVVSGAQGA
FT                   EAGAQVSAEWTDDLPK"
FT   gene            complement(82855..83718)
FT                   /gene="citE"
FT                   /locus_tag="AMED_0078"
FT   CDS_pept        complement(82855..83718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citE"
FT                   /locus_tag="AMED_0078"
FT                   /product="citrate lyase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41902"
FT                   /db_xref="GOA:A0A0H3CTD8"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTD8"
FT                   /protein_id="ADJ41902.1"
FT                   /translation="MTELKPRRSVLYLPGANERALEKAKTIPADALILDLEDAVSPDAK
FT                   EAARERVCAAASSGDYGEREVTIRVNGLDTEWHDADLRAAASAGPAAVVVPKVNSAAEV
FT                   HNIERALELGGAPEHTKIWAMVETPVAMLHAEEIAAASERLTVLVMGTNDLAKELHAEF
FT                   VPGRGPLLGGLSLCLLAARATGKVILDGVYNDVKDLEGFEAECEQGRQYGFDGKTLIHP
FT                   AQVEPCNRIFAPSEEEVDRSRRIIEAFEEAQKEGRGVVTVDGRMIENLHVDTARRVLAL
FT                   AEAVKS"
FT   gene            complement(83715..84785)
FT                   /gene="citE"
FT                   /locus_tag="AMED_0079"
FT   CDS_pept        complement(83715..84785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citE"
FT                   /locus_tag="AMED_0079"
FT                   /product="citrate lyase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41903"
FT                   /db_xref="GOA:A0A0H3CUE8"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUE8"
FT                   /protein_id="ADJ41903.1"
FT                   /translation="MRSPKDFFAPLALGAPAPVREIPVTPSRMIHFFDPGNEKMAAKVP
FT                   DIAKKVDVLLGNLEDAVRADRKEAARAGLVAIAKANDFGKTQLWTRVNSLDSPWVLDDL
FT                   ITLVTEIGDKLDVIMVPKVEGAQDIHYVDRLLAQLEARAGLTKPLLVHAILETASGVAN
FT                   VEEIAGASPRMQGISLGPADLAASRRMKTTRVGGGHPGYLVRTDPTGDDLNEGRTTYQQ
FT                   DLWHYTVARMVDACAMHGILPYYGPFGDIRDVVACEDQFRNAFLLGCVGAWSLHPVQID
FT                   IAKKVFSPSPSDVAWARRVIAEMGDGTGAVMIDGKMQDDASVKQCRVVAELADALAADD
FT                   PELAAAYEAATKEALG"
FT   gene            85209..85862
FT                   /locus_tag="AMED_0080"
FT   CDS_pept        85209..85862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41904"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVF8"
FT                   /protein_id="ADJ41904.1"
FT                   /translation="MAATPQNTERSTVAGGAKRSRSMPSRVVPPIELPASVDELARAAA
FT                   AQLGWNGVVLPETTILGRKVCVVAKLRTDVHAERIAMGAGPVADRATVDTWTWPELAGT
FT                   APAPAAEIVGVLAVARHWRTAMASAVPFARYGEAAMVLPSPVVLTEDYVGNCLPRARAY
FT                   GLAIVTADPNAVVDLDLEGRTERVVLAEDPVSRLVNELVYDHLLRTAEVPASLD"
FT   gene            85895..86545
FT                   /locus_tag="AMED_0081"
FT   CDS_pept        85895..86545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0081"
FT                   /product="putative NADH-flavin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41905"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV50"
FT                   /protein_id="ADJ41905.1"
FT                   /translation="MRVVIAGGHGQIALRLERLLAARGDEAIGIIRNPAHAADLEAAGA
FT                   QAVVLDLENSDVDAVAEVLKGADAAVFAAGAGPGSGTARKDTVDRGAAALFAEAAERAG
FT                   VRRHVQVGSIGADNPENPDVSEEFRHYLRAKRAAEDDLKARDLDWTILRPGQLTDDPGT
FT                   GLVLLAENTGRGPIPRDDVAAVLVALLEAPASVHRTLTLISGEAAIGEAISAL"
FT   gene            86542..87492
FT                   /gene="prsA"
FT                   /locus_tag="AMED_0082"
FT   CDS_pept        86542..87492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prsA"
FT                   /locus_tag="AMED_0082"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41906"
FT                   /db_xref="GOA:A0A0H3CX47"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CX47"
FT                   /protein_id="ADJ41906.1"
FT                   /translation="MITQASREIAVFSGSAHPELAEEICEHLGVPLRPVEIQRFANDCL
FT                   EVQLQANCRERDVFIIQPLVKPVQEHLVELLLMLDAARGASASRITAVMPHYSYARSDK
FT                   KDAPRISIGGRLVADLLVTAGASRVLAMTLHSPQVHGFFSVPVDHLHALQELAKHFRQY
FT                   DLSRTTVVSPDLGNAKEASHFARLLGVQVAAGAKERFPDDRVQITSVIGEVTGRDVIVL
FT                   DDEIAKGSTVLELLDRLAELEPRSIRVACTHGLFAAKAIERIGSRPEVLEIVCTNTVPV
FT                   PEEERTEKLKILSIAPAMAEAIRRIHNGESVSALF"
FT   gene            complement(87489..88784)
FT                   /locus_tag="AMED_0083"
FT   CDS_pept        complement(87489..88784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0083"
FT                   /product="L-gulonolactone oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41907"
FT                   /db_xref="GOA:A0A0H3CTE3"
FT                   /db_xref="InterPro:IPR006093"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="InterPro:IPR010031"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTE3"
FT                   /protein_id="ADJ41907.1"
FT                   /translation="MTRWTNWAGTVSASPQHVHQPRDTAEIAATVASIAAAGRTVRPWG
FT                   SGHSFTAIAAADSDALDLRQWTGVERVDLATGHVTVRSGTTLRDLNAALDALGLAMTNL
FT                   GDIDAQTVAGAISTGTHGTGAKLGGLATQVVALELVLADGSVVTCSAEEKPDLFAAARV
FT                   GLGALGVLTTVTLACEPSFVLRAQERPEPLEQVLEGFHDFADENEHFEFYWFPYGKNAL
FT                   VKRNNRTETPQPLSKVREFVDYRIMENVAFGGLCRAGRLMPKLVPSLGSFASNVLSARD
FT                   YSDLSHRVFVTARDVRFTETEYAVPRESVLDVLAELRAVVPTLKDPVMFPVEVRVAAAD
FT                   DIWLSTAQGRDSAYIAIHQFIGMPYREYFSAFEKIAGAVGGRPHWGKMHDLDAGVLRTR
FT                   YPHFDDFLRVRKETDPSGVFTNTYLDRVLGPA"
FT   gene            88871..90055
FT                   /locus_tag="AMED_0084"
FT   CDS_pept        88871..90055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0084"
FT                   /product="amino acid aldolase or racemase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41908"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUF2"
FT                   /protein_id="ADJ41908.1"
FT                   /translation="MTGATEYDLATKDLDPPLAVVDLAAFDANAADLRRRAAGKPIRVV
FT                   SKSVRCRALLERALTMPGFEGLMCYSLAEAVWHIEQGTTDDIVVAYPTADHEALRRLAT
FT                   SDRARAAIAIMVDSPEHLDLVDAALGHGHPEIRVCLELDASWRPFPGIHVGTRRSPVFT
FT                   PKQASTFARQIVARPGFRLVGVMAYEGQIAGLGDAAGHRLNRALVGWMQRRSAAELARR
FT                   RGEAVRAVQAVTPLEFVNGGGTGSLETTGADAVVTEIAAGSGLIGPTLFDGYTRFKPRP
FT                   AALFALPVVRRPTRNIATLFSGGYIASGPTGPSRQPKPYLPRGLKFLGFEGAGEVQTPV
FT                   TGRAARSLKLGDRVWLRHAKAGELAERFTHYHLVLGDRVERTVPTYRGENQNFG"
FT   gene            complement(90267..90914)
FT                   /locus_tag="AMED_0085"
FT   CDS_pept        complement(90267..90914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0085"
FT                   /product="TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41909"
FT                   /db_xref="GOA:A0A0H3CVG2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR041674"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVG2"
FT                   /protein_id="ADJ41909.1"
FT                   /translation="MSDIQAAKVPAEATPLRRQPVQQRSAKRVEQMLDASAALIDELGY
FT                   DALTTTLIAKRAGVAVGSLYQFFPDKRAVVQALTARNLERFVGAVNERLKQLGPEHWWD
FT                   VVDSILDIYLEMHRTVPGFSKVHFGDIIDRQLLDETRDNNAVIVDSLTDLVATQVDRPV
FT                   EDLRFAIGIANEVADALLKLAFRKEPSGDEKIVAEAKYVVKGYLAARFGERS"
FT   gene            91045..92361
FT                   /gene="bglB"
FT                   /locus_tag="AMED_0086"
FT   CDS_pept        91045..92361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bglB"
FT                   /locus_tag="AMED_0086"
FT                   /product="beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41910"
FT                   /db_xref="GOA:A0A0H3CV54"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017736"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV54"
FT                   /protein_id="ADJ41910.1"
FT                   /translation="MQNPIFPPDFLWGVSTSAFQIEGATSEGGRGPSIWDTFTATEGKI
FT                   ARGEQANVAADHYHRYPEDIALMAELGVGAYRMSIAWPRIQPDGKGAPNPEGLGFYDKL
FT                   IDAVCEAGIVPAVTLYHWDTPQAIEDEGGWLSRATAERFAEYAQVIGDRFADRVKLWIP
FT                   LNEPMVMSIFGYGIGEYAPGQVLLLDAIPTAHHQNLAHGLAVQALRAAGATNIGTANNH
FT                   SPIWPADDDARDAAEYLDALLNRLYADPMLLGSYPEQLHQHLPAGFADDLPTIAQPLDF
FT                   YGVNYYEPQGVAMPGPGNPLPFELRDIEGYPMTTNDSPIVPHALRELLLDFHHRYQDKL
FT                   PPIQITENGCSFADEVAEDGGVHDPERIDFLHSHLVALREAMDAGVDVRGYFCWSLMDN
FT                   FEWSKGYAPRFGLVHVDYETLRRTPKDSFHWYRKLVRNE"
FT   gene            92354..93613
FT                   /locus_tag="AMED_0087"
FT   CDS_pept        92354..93613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0087"
FT                   /product="major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41911"
FT                   /db_xref="GOA:A0A0H3CX53"
FT                   /db_xref="InterPro:IPR010645"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CX53"
FT                   /protein_id="ADJ41911.1"
FT                   /translation="MSETTQVVPEALAEPVVRVRPGWMSLLFFANIALWLGVYAPIQVL
FT                   LPQQAELLDKVNKEFVLGLVMGVGAVVALVVNPAVGLLSDRTCSRFGRRHPWTVVGAAV
FT                   AAVGLLVLAFAPNVALLITGWCLVQAGLNGMLATLMSAIADRVPIGQRAQVGGLVGIAQ
FT                   MLGTVLGAIVVVLVAGFAGLAPAYAVCAGIVVAGAAFFVLRTPDAHLPVEFRPSAKAGE
FT                   VLRNLWVSPRRFPDFAWAWSCHFMINLGNAFGTLYLLFFLQDAVHYPDPDTGLIIMMVL
FT                   YGVALVAGAVLAGHFSDRSGRRKPYVLAASGVMALAALLLVVWQSWPVALVASPLLGVG
FT                   FGAYMAVALAMLTQVLPTAQDRAKDLGVINIANSLPQVLAPLVTPLVLAYLGGYSGLFA
FT                   ASAVATLLAAVLVLRVKAVR"
FT   gene            complement(93997..94410)
FT                   /locus_tag="AMED_0088"
FT   CDS_pept        complement(93997..94410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0088"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41912"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTE6"
FT                   /protein_id="ADJ41912.1"
FT                   /translation="MDQVLGQVLRNAVWERLDMLTDLANRADAQSLVSVARSELPRLTE
FT                   AWRAMLKMHEPDERGDCPTCSTRWHRCKAPCSVWQVAHEHLVAGGLAPQQQSADSRLQG
FT                   RRKSPVPAHPAPPTAAETTGRHALVNPRRAVTA"
FT   gene            complement(94423..94761)
FT                   /locus_tag="AMED_0089"
FT   CDS_pept        complement(94423..94761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0089"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41913"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUF5"
FT                   /protein_id="ADJ41913.1"
FT                   /translation="MEFVDSFAGGHAGTATRAVRPATVPPVSTVRPVTPAAAVDPRTAS
FT                   VRHYEGGQLVWRVQCGDLISRERAVTVFVEDNQVVLVSPPGETARLTSGQLGQLRAALN
FT                   EAAKMAER"
FT   gene            95080..96465
FT                   /locus_tag="AMED_0090"
FT   CDS_pept        95080..96465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0090"
FT                   /product="XRE family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41914"
FT                   /db_xref="GOA:A0A0H3CVG7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVG7"
FT                   /protein_id="ADJ41914.1"
FT                   /translation="MDASNGGSADTRQSHAVPADAWEQPEMRTALASREISAVYRLLRK
FT                   HGVSQRQIAAMTGQSQSEVSEILKGRQVMAYDVLTRIADGLGVPRGYMGLAYDEATAIR
FT                   VVGSADGQQAEEDESVKRRRFLAHAAQVTMGAAVFGPESGTWAAGPARTPAPGRIGMTD
FT                   VRQVEAATRALRALDYQYGGGFCRDAVVAQLSWGQQMLEAHGTELVKNRLYVALADLHS
FT                   LAGWTSFDTGLMDSARGHFANALDLAKQGENHPLVANVLYRMGRVYLHQDAPNDALKLF
FT                   QLGQIAAQESGSELAVSVLCANEAWAYAMMGNEEQAVKLLGRSKDEFERANLAEAESWV
FT                   KFFTETDVYAMVGTVHTVLAQKNAEHTKYAIPALTKAVETYDDEMARSKTFMLSALATN
FT                   HLLDGDLDHGAKVGGKAIDCAEGIKSERVKDRMRPLQEEAERRRNNADARDLADRLHAF
FT                   YAA"
FT   gene            96488..97375
FT                   /locus_tag="AMED_0091"
FT   CDS_pept        96488..97375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0091"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41915"
FT                   /db_xref="GOA:A0A0H3CV57"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV57"
FT                   /protein_id="ADJ41915.1"
FT                   /translation="MDGRFTSGKLRGVLAETCALLGLDPAGARLLRFTNNAVYALVTAP
FT                   FVVRIVGSTQLRHRVGTVVRVARHFEHHGVPAIRLLGDVEQPLEVGGHLVTVWHQVPSI
FT                   GRAATSVDLARLLRQVHALPPPPGLAEWAPFAAVRARVSDAEEISDTDRKFLLDRCAEL
FT                   EAELAELEFPLPRGLVHGDAYPGNVIPGPDGPVLCDFDSSCVGPPEWDLTPLAVGRERF
FT                   GDPPVGYRTFAAAYGFDVTSWPGFAVLRGIRELKLTTSVLPILRSRPQVRPELYRRLDD
FT                   LRNARTDTRWTRYR"
FT   gene            complement(97586..98614)
FT                   /locus_tag="AMED_0092"
FT   CDS_pept        complement(97586..98614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0092"
FT                   /product="copper resistance transporter"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41916"
FT                   /db_xref="GOA:A0A0H3CX57"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CX57"
FT                   /protein_id="ADJ41916.1"
FT                   /translation="MTQAEATTKVRYSTLLCVVTAALLGALIGVALMSTAPVPGVVEPS
FT                   AVVSAGIPVVRVLLDLAAVTTIGLALLSVLVGYDRPKLTEPIMRLARPAGVAAALVWAT
FT                   AAVVALILQTAEYKPGSSTLAPSDIGRYIADVGAGKALVIVAALALVHAGISALALRFG
FT                   EKVPAEVRVGLGLFALLPLPVTGHASNWNYHDYTMISMELHVMSAVAWTGGLGAMTVLL
FT                   VANRTLLAHALPRFSKLATLCLAISAATGLFNGLVEISLNPTIGFWTAIFTTPYGQLLV
FT                   LKLGCTGVIAVLGAHVRWRLIPRIVRHDRTALASWATLELTVMGLAFGFAVVLTRAPVV
FT                   AS"
FT   gene            complement(98614..99135)
FT                   /gene="pcoC"
FT                   /locus_tag="AMED_0093"
FT   CDS_pept        complement(98614..99135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcoC"
FT                   /locus_tag="AMED_0093"
FT                   /product="copper resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41917"
FT                   /db_xref="GOA:A0A0H3CTF2"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTF2"
FT                   /protein_id="ADJ41917.1"
FT                   /translation="MTVVAVLGTATPALAHNVLISSDPANGSSVAAGPPKISLTFDQYV
FT                   QGADVNQVAVTGPGGGQWAEGPIGVVNNVITAPLRPLGPAGKYTVGYRVLSADGHPVTG
FT                   ELSFTLTTAGTGTPATVDAARSPGGSSSAAPQPSSTGVPIWVWIAGAVVLLAIGLTVAL
FT                   RSGRSVEEKN"
FT   gene            complement(99265..100032)
FT                   /locus_tag="AMED_0094"
FT   CDS_pept        complement(99265..100032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0094"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41918"
FT                   /db_xref="GOA:A0A0H3CUF8"
FT                   /db_xref="InterPro:IPR012533"
FT                   /db_xref="InterPro:IPR038507"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUF8"
FT                   /protein_id="ADJ41918.1"
FT                   /translation="MSQHVFKRAGFLAATVGVAGLLGAGIASAHVTANVYGSQPTKGGY
FT                   AAIVFRVPSEEPNTMTTKVAVDFKADYGIGSVRTKPLPGWTAEVTKSKLPTPITKDNGT
FT                   QITEAVTAVTWTAQPGNELKATDYQEFSVSFGPLPTNVDEVEFPAHQTYSDGKVVDWNQ
FT                   PTPPGGEEPEHPAPAVKLAAKAAGDGDDDHAGMAAGTASTTGEHTEAAAATSDSTARWL
FT                   GGAGLLVGAIGLGVGAGATIRARKATAKSGGNS"
FT   gene            complement(100103..100603)
FT                   /locus_tag="AMED_0095"
FT   CDS_pept        complement(100103..100603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0095"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41919"
FT                   /db_xref="GOA:A0A0H3CVH1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVH1"
FT                   /protein_id="ADJ41919.1"
FT                   /translation="MLAVSAGALSVTAHRLADGGLPDPAMTVLLTGLFGWTAAALARKA
FT                   RGPVATVVLLGAAQLVMHLLLTTLAEHHAHDADAMPGTSGPGMVAAHAIATVLTALLLA
FT                   RADTMLLTVLAVLRAILPRLLTPLPVPSAPPALVPARTGGPAHLVGVDLRRIRGRRGPP
FT                   VHS"
FT   gene            100896..101543
FT                   /locus_tag="AMED_0096"
FT   CDS_pept        100896..101543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0096"
FT                   /product="permease component of ABC-type proline/glycine
FT                   betaine transport system"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41920"
FT                   /db_xref="GOA:A0A0H3CV63"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV63"
FT                   /protein_id="ADJ41920.1"
FT                   /translation="MNLFDYISDRASKLWLEAYLHTSMVVQCTILAAVLGVLIGVAVYR
FT                   SPIGSAVATALASTILTVPSFALLGLLIPISGLGPTTAVIALVLYGLLPIVRNTIVGLD
FT                   GVDPAVTDAARGIGMSRFGVLTRVELRLAWPAILTGMRVATQMLMGIAVIAAYAKGPGF
FT                   GAEVFSGLTNAGSTNSLNQAVTGTVGVVILALLLDGVYVLIKRLTVSRGVRG"
FT   gene            101536..102702
FT                   /locus_tag="AMED_0097"
FT   CDS_pept        101536..102702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0097"
FT                   /product="ATPase component of ABC-type proline/glycine
FT                   betaine transport system"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41921"
FT                   /db_xref="GOA:A0A0H3CX62"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CX62"
FT                   /protein_id="ADJ41921.1"
FT                   /translation="MAENEEVSGVEIELEHVTKRYPGTRTPAVDDFSMVVPAGKIVVFV
FT                   GPSGCGKTTTMRMINRLIEPTSGRITIGGEDALKLDVDTLRRRIGYAIQQAGLFPHFTV
FT                   AQNIAVVPGLLGWDKKKVNDRVEEMMDLVGLDPADFRDRFPRQLSGGQQQRVGVARALA
FT                   ADPPVLLMDEPFGAVDPITRGNLQDELLRLQSELKKTIVFVTHDFDEAVKLGDKIAVLG
FT                   NQSTILQYDTPEAILANPADDTVAGFVGAGASLKQLTLLRVRDVELRQDALTVTVDESP
FT                   ASVREKLDKSRMHFALVLDARRRPTRWVHARELTSATSLANLGKPLRDVVSLQSTLQDA
FT                   LEAMLAEGGSVPVTGARGEYAGTIQLDTVIATIQQLREEHTNGEEVPA"
FT   gene            102699..103478
FT                   /locus_tag="AMED_0098"
FT   CDS_pept        102699..103478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0098"
FT                   /product="permease component of ABC-type proline/glycine
FT                   betaine transport system"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41922"
FT                   /db_xref="GOA:A0A0H3CTF7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTF7"
FT                   /protein_id="ADJ41922.1"
FT                   /translation="MTAVVDTGFSTESGSKRAERVRLFAQPIVVLVIVAVTLVAVFSSG
FT                   LNATEKETLNASSLFTALWDHLLMTLVVTAIVVLVAVPLGVIVTRPWARFLAPVFLAIA
FT                   NIGQAAPALGVLVLWFIVTGATGGIWVAALPLAFYSLLPVLRNTMVGIQQVDPALIDAG
FT                   RGIGMSATAVLWRVELPLAVPLILAGLRTSLVLAVGTATFGMFVNAGGFGLLIDTGYKL
FT                   NLTSVLVTGSVLAVALALLVDWLGAVAEQFFGPKGLR"
FT   gene            103475..104434
FT                   /locus_tag="AMED_0099"
FT   CDS_pept        103475..104434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0099"
FT                   /product="periplasmic substrate-binding component of
FT                   ABC-type glycine betaine transport system"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41923"
FT                   /db_xref="GOA:A0A0H3CUG3"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUG3"
FT                   /protein_id="ADJ41923.1"
FT                   /translation="MKLRRLFAVALLGVTLSSCGLTVNQAVPYDIKPGSIQPIPALQGV
FT                   KVTVGSKDFTENIILAYMTEMALTAAGAEVVDLSDIKGSNSSRQALLSGQTDVTWEYTG
FT                   TGWINYQGNELPVPGGEKAQYEATAKADEEKFGVTWLNYSPLNDQYAFAVTEAYGAANN
FT                   LKTTSDLAAFIKQKPDQAVFCLETEFTSRQDGFPAAVKAYGFQNPTVKNFGIGTIYSAV
FT                   ASGTCPVGEVFTTDGRISGLNLRVLEDDKKAFPQYNAVATLRTEWLNQHPEVRGPLEKI
FT                   SAAIDNEQMVELCKQVDVDGQDAGKVAHDWMVKKGFVK"
FT   gene            complement(104643..105104)
FT                   /locus_tag="AMED_0100"
FT   CDS_pept        complement(104643..105104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0100"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41924"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVH6"
FT                   /protein_id="ADJ41924.1"
FT                   /translation="MARKAKVEGEARFTPKRAKNAVAVAKVLGPAVIPVVAPLAVRAAG
FT                   AAREAYDRYQARKLGVSVDRLGEYTGRGAALHARIAGIAEGCADLQKSEKASKADQEFA
FT                   QGALGTLEQLSASVRAAERMPTARRKSVHRAVAGELERLEGQLLHRLGI"
FT   gene            105186..106835
FT                   /locus_tag="AMED_0101"
FT   CDS_pept        105186..106835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0101"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41925"
FT                   /db_xref="InterPro:IPR019993"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV68"
FT                   /protein_id="ADJ41925.1"
FT                   /translation="MISMNTEVVLDAGAVSRCRRRVHLEHDPAMREVPLSPPDPTAQQR
FT                   IDDATAHRENIVARLMAANDDHWVKVGRDLPAHERVEQTLQAFADGARFIWGALLPVDA
FT                   AGHRRGGIDLLVRTGRGYVPVLVVRHRITDRGAGAIVTGMTDLDPAHRAADEGRKVRSQ
FT                   PRDQLRLVHIRRMLQTLGQADESLALGGVIGLDADVVVWHDLTAGTWPGGRTALTEYQA
FT                   RFADRLAIATAAANGEEPLAEPSRVLECRRCPWWPTCEVVLTDTRDVSLVVRGEDAVEL
FT                   RRAGVSTVDQLAALDPAGEPPAVNWTGVTFPDAVVLARAWLADLTLVRRVGRVEVPRAD
FT                   VEVDVDMESFGDAGAYLWGCLLSGADIGVEQGYRAFATWDPLPTDDEARSFAEFWAWLA
FT                   DVRERTEAAGLTFRAYCYNALAENRWLFGSVERFGEHPGVPAKKDIQSFVDSEQWVDLF
FT                   RSVTDQFLCSHGKGLKVIAPVAGFSWRDPEAGGEASMRWYRDAVGMDGEKPDDDQRARL
FT                   LRYNEDDVLATRALREWIDARAQAEVPYMFDL"
FT   gene            106918..107553
FT                   /locus_tag="AMED_0102"
FT   CDS_pept        106918..107553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0102"
FT                   /product="PadR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41926"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CX67"
FT                   /protein_id="ADJ41926.1"
FT                   /translation="MMKRRKVGNLLGLAVLSVVLERPMHPYEMATVLKERGKDADMPIK
FT                   WGSLYTVVANLEKYGFIEAVESVKDGGRPERTVYRITPAGREEYEDWVRELVGTVETEP
FT                   PRFRSGLSMLGILGPDQAISLLRQRVAQLDERAAKQQTGLDQLRPLMPRMFLVEVEYDI
FT                   AMTEAEARWVRGFLEELTSGALPGIEAWRRWYETGELPDDFGEFVEER"
FT   gene            107687..108340
FT                   /locus_tag="AMED_0103"
FT   CDS_pept        107687..108340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0103"
FT                   /product="methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41927"
FT                   /db_xref="GOA:A0A0H3CTF9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTF9"
FT                   /protein_id="ADJ41927.1"
FT                   /translation="METTRKHKVPEMEGFQARWYAKNRGTEAQLAQYRRQAAEVTAGLA
FT                   DGAEILEVAPGPGFFAVELAKRGYRVTGLDISHTMVEIARENRAGLDIDFRQGDVTQAP
FT                   FADESFDFVVCQAAFKNFRQPVTALNEIHRVLRPGGFAVIQDLNHEATAADIDREVAGM
FT                   HVGVVSGFTVRQTLGWLRRRAFTSAQFEVLAAESAFGGCSATADGLGLEVRLTR"
FT   gene            complement(108382..109140)
FT                   /locus_tag="AMED_0104"
FT   CDS_pept        complement(108382..109140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0104"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41928"
FT                   /db_xref="GOA:A0A0H3CUH1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUH1"
FT                   /protein_id="ADJ41928.1"
FT                   /translation="MQITDTAALVTGGASGLGGATAKALAAKGARVFALDLAASIEKAA
FT                   QVDGITYVEADVTDVEQVEAAVATAAGSGVPLRTVVNCAGIGPSARILSKKGRHDLALY
FT                   AKVIQINLVGTFNVLTIASEAIAKTEPLEDDARGVIINTASIAAFDGQIGQVAYASSKG
FT                   GVVGMTLPAARDLASHGIRVLTIAPGIVDTPMLATVSDEFRASLAAGIPFPKRLARPDE
FT                   YAQLTLSLIDHDYLNGEVVRMDGSLRMAPR"
FT   gene            109387..110646
FT                   /gene="ugd"
FT                   /locus_tag="AMED_0105"
FT   CDS_pept        109387..110646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugd"
FT                   /locus_tag="AMED_0105"
FT                   /product="UDP glucose 6-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41929"
FT                   /db_xref="GOA:A0A0H3CVI1"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVI1"
FT                   /protein_id="ADJ41929.1"
FT                   /translation="MTTGACLASLGHFVTCVDVDRAKVSRLAAGRVDILEPGLDDLVHR
FT                   GIAAGRLQFVVGARDAVRHAQAVFLCVPTPMEAGGSADLRAVEAVTAEIGDVLPAGCAL
FT                   VTKSTVPVGTSKRIQDLVGRTDVPVVSNPEFLREGTAVADFLGPDRIVVGSDDLAAARW
FT                   VGELYAELDAPVVVADAASAELVKYAANCYLALKLSYVNSIAELCERLGADIDLVTEGM
FT                   GYDRRIGRTFLKPGPGWGGSCLPKDTSALVKVAESVNYDFTMLTSAIDENLAQRDRIVA
FT                   KIAGAVGGTLAGARIGVLGLAFKAGTNDLRDSPALAVSSVLCALGAELIAYDPAIDGEI
FT                   AGMTVVDDAYQVAKDADVVVVLTEWAEFKHLDWAAMAELMEGIDVVDTRNLLDPRVIVD
FT                   AGLSWQGVGRPRAAARIKVS"
FT   gene            110779..112959
FT                   /gene="ggt"
FT                   /locus_tag="AMED_0106"
FT   CDS_pept        110779..112959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ggt"
FT                   /locus_tag="AMED_0106"
FT                   /product="gamma-glutamyltranspeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41930"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV72"
FT                   /protein_id="ADJ41930.1"
FT                   /translation="MIVPSRNNRESAEFLANLLGLEVGEEWGPFIPVEMRNGVRLDFAT
FT                   IPEEDLRLQHYCFLIPEDGFDAVFARLVETGVTYHADPMGKQIGEINHNHGGRGVYFLD
FT                   PGGNGMEIITQPYEPERKRPSSWQKFLSNAYYRGMFTTRPELTGTFGMVASTHWLASAT
FT                   GMAVLEDGGNAFDAAVAAGFVLQVAEPHLCGPAGQVPGLFVTADDPTPRALASQGPSPA
FT                   GATPEHFAALGLDLIPGSGLLPATVPGAWDGWLLLLRDYGTKPLREVLKYAIGYARNGV
FT                   PLVSRVGDTISAVSRLFVEHWPTSAALWMPDGKPASGLHRNPALADTWERLLRETESVS
FT                   GREAQLDAGRRAWSQGFVAEAIDSFSRTAFRDDSGRDHAGLLTGEDLASWSASYEDPAF
FT                   VDVGDWRLVKLGGWTQGPALLQQALLLHGFGDELSYVDGVPSERTVHLATEAAKLAFAD
FT                   REAWYGDTDVPLDVLLSPSYTDARRALITDTASPSLRPGDARGPARLPAILDSLQGIEA
FT                   GDGATGEPTVGPRGQTRGDTVHLDVVDAAGNLVSLTPSGGWLQSSPTIPSLGFCLDSRG
FT                   QMFWLEQGLPNSLAPRKRPRITLSPSLALRDGVPTLAFGTPGGDQQDQWQLCFWLAHVY
FT                   GGLNLQESIDSPAWHTTAFPSSFYPRSWNPRELVVESRLGSSTLDALRERGHAVVDAGD
FT                   WALGRLSAVSRTGGIMRAAANARGMQGYATGR"
FT   gene            complement(112956..113351)
FT                   /locus_tag="AMED_0107"
FT   CDS_pept        complement(112956..113351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0107"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41931"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CX71"
FT                   /protein_id="ADJ41931.1"
FT                   /translation="MAGQWAPRDHEELTAGWRLWLELDSSGWPRPDWDGSPDEAVRGLQ
FT                   ELVHAADEILAQYLAGGGPAEAEVPGLIRSLQLSASWIRELWAGDTTPLDGERMALLHS
FT                   DLAGFAGHARGVRTLLAEGGGWASLTL"
FT   gene            113765..114847
FT                   /locus_tag="AMED_0108"
FT   CDS_pept        113765..114847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0108"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41932"
FT                   /db_xref="GOA:A0A0H3CTG4"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTG4"
FT                   /protein_id="ADJ41932.1"
FT                   /translation="MRHSIGSILALAAAAVVAGAQSFTAIGEWAADAPQSVLAALGARF
FT                   DPRHARYAAPDEATVRRVAGRVDGDILDDVISSWLAHRDTSTTDPAETPPAAIAVDGKS
FT                   LRGTFARTGGAGVHLLAAITHNTATVLGQRQVPAGSSEITWFQPLLDTIDLTGRVVTAD
FT                   ALHTTVEHARYLHQRGAYYVFTVKENQHRLHGLLDTLPWHEIPAHITSGSGHGRSERRT
FT                   VQLAPLGDFLGYPAIDFPHATHAFLIERYTTHHTSQKRSAHAALGLTSLTGRYAHPAHI
FT                   GGYVRSHWHIENKLHWVRDVTDKEDQSRTRTGTAPRVMASLRNLATSTHRQAGHTNIAQ
FT                   ALRHTARNTTRALTLLGIPT"
FT   gene            complement(114938..115822)
FT                   /locus_tag="AMED_0109"
FT   CDS_pept        complement(114938..115822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0109"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41933"
FT                   /db_xref="GOA:A0A0H3CUH6"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUH6"
FT                   /protein_id="ADJ41933.1"
FT                   /translation="MPEPFDALRRPSERVAPDPDFAAELRDDLRRAILNGADMTTTAVP
FT                   ATAASLRSLTPYLAVSDARAALDFYVEVFGAVRRGDPILMDDGRVGHAELAIGDAVLML
FT                   AEEYPEIGHVAPREGGASVRVEVPDVDGSVARALELGATLIRAVSDSPYGRGGSFRDPF
FT                   GQRWLVSQAATAAAGPRPARHGEAMYFTFQVPEASPAKAFYGAVLGWQFTPGSTTDSWG
FT                   FSGPGLEGGLWAGDRQVGWKLMYAVDDLESAMARVREQGGRAGEVEHHPYGNTADCTDN
FT                   QGIEFWLWEKPGQ"
FT   gene            complement(115815..116339)
FT                   /gene="rpoE"
FT                   /locus_tag="AMED_0110"
FT   CDS_pept        complement(115815..116339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoE"
FT                   /locus_tag="AMED_0110"
FT                   /product="ECF subfamily RNA polymerase sigma-24 factor"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41934"
FT                   /db_xref="GOA:A0A0H3CVI6"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVI6"
FT                   /protein_id="ADJ41934.1"
FT                   /translation="MTEPRVRPDPAFALLGLYETALPEVYGYLLSRCGDRTLAEELTSE
FT                   TFLGAVAACRKEYAPPVSTGWLIGVARHKLADHWRRKEREERGLRLVHHSEPDIEDPWD
FT                   EQLDALRARQVLESLGPHHRAALTLRYVDGLGVPEVAGHLGRSVHATEALLVRARAAFR
FT                   RAYEEKEGRDA"
FT   gene            complement(116392..117816)
FT                   /locus_tag="AMED_0111"
FT   CDS_pept        complement(116392..117816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0111"
FT                   /product="MFS transporter, multidrug efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41935"
FT                   /db_xref="GOA:A0A0H3CV78"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV78"
FT                   /protein_id="ADJ41935.1"
FT                   /translation="MSTTELAPSTPGAEFRPGLTPAGLVTVLLGAALPIIDFFIVNVAL
FT                   PTIDADLHASTATLELVVAAYGIAYAVLLVVGGRLGDSFGRRRLFFAGLWLFTLTSLAC
FT                   GIAPTAGTLVVARAAQGAASALLLPQVLSIIQATTSGEERSRALGLFGATGGLSTVVGQ
FT                   LLGGGLVAADLFGTGWRPIFLVNVPIGLVVLLLARRLPESRAHNPLGVDRLGTLLLAVT
FT                   LLSLLVPLMEGRALGWPAWTIALLALFPVSAAALVHVERRLERTGGTPLLPPSVLRLPS
FT                   VRRGLMVAVPFFGAFGSFMFVFAMTLQEGLHFGPLGAGGALTPLAVAYFTVSMLSSRLV
FT                   TRYGQKVVPLGGAITAVGMVALLCTTLSTWPHVTILDLAPSMVAIGVGNALAMTTLFRI
FT                   VLSHVPTDLAGVGSGVMTTNQQTSLALGVATLGSLYAALSGSLGSRDAFALVIGLVAVL
FT                   AAIVAITGRRLPDPRA"
FT   gene            117918..118751
FT                   /locus_tag="AMED_0112"
FT   CDS_pept        117918..118751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0112"
FT                   /product="XRE family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41936"
FT                   /db_xref="GOA:A0A0H3CX75"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CX75"
FT                   /protein_id="ADJ41936.1"
FT                   /translation="MTTVVESGLRRQELARFLRSRRERITPEQVGLPIVGRRRTPGLRR
FT                   EEVAQLAGVGVTWYTWLEQGRDINASEQVLQAIARTLRLDPHEHTHLFRLAGAPDPENE
FT                   KDNQVITPAMELMLKKLEPYPVAVRNARCDLLAYNRGYTWLMGDVDAIPFGDRNTLVQC
FT                   LLNPEWRKRMLDWEANIPRVIASFRAAMADHVAEPAWKQLVKRLKAESPLFAELWPHHD
FT                   VNSEPIRTKRYLHPDVGLLQFNFTYLYYGRRSEITVSTYTPADEETAAKLPLVFD"
FT   gene            118845..119924
FT                   /locus_tag="AMED_0113"
FT   CDS_pept        118845..119924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0113"
FT                   /product="two-component system histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41937"
FT                   /db_xref="GOA:A0A0H3CTG9"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTG9"
FT                   /protein_id="ADJ41937.1"
FT                   /translation="MARAVVVGVFVIGATSASSRWQPGASPLTPIGFAWLAATVLTLLL
FT                   VHRFPLTLFLVAAASAFGYYTSGLPGGPVIVVPTIALFVLTRQRGPLTAGITGASALAA
FT                   AYVVHVITTRSFALETGAAFLVVWLTAVIGVGTAVRYQLDALAARRGQADEHRHRLAEQ
FT                   ERLRIAREVHDVVAHSLAMINVQAGVAAHVADRRPEQAKEALLNIKAASASALKDLRAT
FT                   LAVLRSGEDKAPAPSLAQAGELLDHARDAGLTVEVHGEPGDLPAPVDAAAYRILQESLT
FT                   NVVRHADQPHRVDVRFERRPGAVTLRVRDDGRGTAQPTPGHGLRGMGERAAALGGRCTA
FT                   GPVDGGFEVCVELPIEGEA"
FT   gene            119921..120589
FT                   /locus_tag="AMED_0114"
FT   CDS_pept        119921..120589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0114"
FT                   /product="two-component system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41938"
FT                   /db_xref="GOA:A0A0H3CUI2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUI2"
FT                   /protein_id="ADJ41938.1"
FT                   /translation="MIRVLLADDQVLVRAGFRVLLETEDGFEVVGEAGDGEQAVAGAIE
FT                   HHPDIVVMDVRMPGVDGLEATRRITANPDLAGTKVLVLTTFDVDEYVYEALRAGASGFL
FT                   LKDTEPVELLRALRVVANGEALLAPTVTRRLIQEFVGRPENRRIDTSAVREITDREREV
FT                   LGLVAGGMSNDEIAAHLVISTATARTHVSRIMTKIGARDRAQLVVLAYESGLVTPRRPA
FT                   "
FT   gene            120806..121789
FT                   /gene="gmd"
FT                   /locus_tag="AMED_0115"
FT   CDS_pept        120806..121789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmd"
FT                   /locus_tag="AMED_0115"
FT                   /product="GDPmannose 4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41939"
FT                   /db_xref="GOA:A0A0H3CVJ1"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVJ1"
FT                   /protein_id="ADJ41939.1"
FT                   /translation="MITGITGQDGQYLAELLHEKQYEVFGLVKGQNNPRIDMIRAGYPF
FT                   VEIVEGDLQDLSSLVGVLEQVQPDEVYNLGAISFVALSFKQAELTANVTGLGVLRILEA
FT                   IRMVGGSQNNPIRFYQASSSEMFGKVRESPQTEATPFYPRSPYGVAKVFGHDITVNYRD
FT                   SYGLYACSGILFNHESPRRGIEFVTRKVTNAVARIKLGLQEKLVLGNLDPRRDWGFAGD
FT                   YVRAMWQMLQQDEPQDYVVATGRTHSVRNFVDLAFKHAGLDDWERFVEQDPRFFRPAEV
FT                   DLLVGDATKAHTELGWKPEVGFEDLVAMMVDHDVRFEAGKAGIPLP"
FT   gene            121786..122700
FT                   /locus_tag="AMED_0116"
FT   CDS_pept        121786..122700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0116"
FT                   /product="Rossmann-fold NAD(P)(+)-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41940"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV83"
FT                   /protein_id="ADJ41940.1"
FT                   /translation="MISYAQNGEDVVLARVFAGQSTGRYVDLGAGYPTLDSVTKHFYDL
FT                   GWRGINVEPEPTLAAELDRDRPEDVNLRVAVGAKPGTTVLHAVDGQWGRSTIEGSLAAQ
FT                   YREDWAIRDIEVEVTTLAALLDEHPGELDFLKIDVEGAECAVIEGADWRRHRPRVLVIE
FT                   ATAPGSPTPTHHEWEPMLLDAGYRCGLFDGLNRFYAQADDAEGLKLLSAPANVFDDFEP
FT                   YALAKLRAQFTASEAARPGEVGYIRRLEETVAQVQQSRVELGEQLEEARRELERARRTT
FT                   EETRRWAAALEHRVTELEARQRQ"
FT   gene            complement(122694..125048)
FT                   /locus_tag="AMED_0117"
FT   CDS_pept        complement(122694..125048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0117"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41941"
FT                   /db_xref="GOA:A0A0H3CX82"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CX82"
FT                   /protein_id="ADJ41941.1"
FT                   /translation="MTGSRAHVAMWTPLPPQTSGIADYSYRLLAALAELTDVVAVTDGP
FT                   GARSPRGVSIVSRDEVQADLHIYHMGNHAGVHEWIYRRALAVPGLVVLHDPSLLDFHDG
FT                   IFGGFHTPGFEAEVRYAHGPIHGRKDDPTLLHGMPVLEVDGVPTLDRATLTMERRLVTA
FT                   SRGVLVHDPHTAEFLNARYPGVPVFAVPLGATLLDTSRRDEIRTGLGWTDDQVVFGVFG
FT                   GLGGHKRVPAAVLAFGELRRRWPNARMIIAGHAATPALLADLRRTIQETGAAGSVHLEL
FT                   SPDEDRFDELILASDAVISLRWPTAGETSATMMQALGAGRAVITSDLPQHRHFDPAFCF
FT                   TVPTDPIGEAKGLYRILERGMCWPEELRAAGELARKWAADHADWPIAARGYAAAVEGTL
FT                   AAPTPSSPPERHGVNVFADVRATTGLAESARRLTKVLAASGTGLTLTEVDSHAPYRTVP
FT                   VPPELAGLRRGKEFDVDLWLLNVNEWQLIPEHALDRYTIGLWAWELPSPPAQARPHLPG
FT                   IDELWVVSSFVADAFRTITDKPITVVPNVVPPAPDAAGDRARFGLPEDGLIVLFTFSAS
FT                   SSDARKNPWAVLEAFRRAFPPGDRGPRAHLVLKANNLELFPELDAALSEAVAGVGGTLI
FT                   RREMSRADMDTLLATCDVYASLHRSEGFGLGMAEAMAMGKAVVATGFGGNTDFMPPGSA
FT                   AVVGYDVRPITATDHRYGGAGFGDWYPVGGLWAEPDVDQAARWLRTLAGSPRLRAEMGR
FT                   RAVRAIEEWSGPEAVGRIVTARLAQLARERH"
FT   gene            complement(125045..126178)
FT                   /locus_tag="AMED_0118"
FT   CDS_pept        complement(125045..126178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0118"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41942"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTH3"
FT                   /protein_id="ADJ41942.1"
FT                   /translation="MAPDRLAAALARLDEHRELHLPLRRTDLLGRLALRFLWKRQVKWQ
FT                   VEANLAVRDALVAVHELVRAHHEQLGEAGGHGVVRVDHLARELDQLRQQDQTMTAGLNQ
FT                   RLYSGLGRLETQLSDLRLQQAQTAEAETDAEQRLKSLEAQVAALSSTAADVRLRHAQLD
FT                   VALDRIRAGQPVPEVAPAVADRESFLELALSELLDGPADHVRTARRAHLPLVSAAREAG
FT                   ATGPVFDAAPARGEWLEVLRSAGLPYRAASGNSLVRQHCAGLGLDVEPAEPLAALAAVP
FT                   QRSLGAVTAFRFAERLTPGAFARFADLAATALQPGGVLLVELPGDGEAGLDPFAVTPPH
FT                   PIYLRFVAESAGFGDVEVRASEPVGGLGERRCLIARR"
FT   gene            complement(126203..127486)
FT                   /locus_tag="AMED_0119"
FT   CDS_pept        complement(126203..127486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0119"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41943"
FT                   /db_xref="GOA:A0A0H3CUI7"
FT                   /db_xref="InterPro:IPR031811"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUI7"
FT                   /protein_id="ADJ41943.1"
FT                   /translation="MTTTGRGPRPALPPVYEAFLPREHALYRPRHGRSQLVALICAIVF
FT                   LATPGLSAVAGARPSQFENRALTPFPSFGQGWSFFPQFTRWATDHLVFREQAVHAADGI
FT                   SRGVFGEPPPLNQENQQNPLQVPVPAPDSPKYDRRQFPNVIEGKSGWLYLGDEVTSHCV
FT                   QASNLDTTFAQLRSFRDGIEASGRQLVVVVAPDKVGMVPQYLPDNYVGKDCHDAIEGDF
FT                   WRRVDAENFMIDPRRPIQDWANRKGAPVYGPQDAHWSDEGAISAVRAVVEKLRPGISAG
FT                   WRIQPKEDWQVPADLPPLIGRTGQTEGTHYALMPDGTTDRTRPMPADYIPPVHTDTATG
FT                   EGTYGLRTAWLGDSFTIRTLPYLAATFRDLTALHTSTADHDGGAAAADLLQRSDVVVIE
FT                   LAERGLVVGSVSMLSPAVQQNIFTKLAR"
FT   gene            complement(127483..129894)
FT                   /locus_tag="AMED_0120"
FT   CDS_pept        complement(127483..129894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0120"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41944"
FT                   /db_xref="GOA:A0A0H3CVJ5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVJ5"
FT                   /protein_id="ADJ41944.1"
FT                   /translation="MPGRRPGRPGPRSAACTVVTRDRLAAAEVLAASYRAHHPGHDFVL
FT                   LVADGDTAAGDLGLDPDEYFRLVTCHAGADLADVLRPLLLAKLLDRFDVVVLLDPDIEV
FT                   HAPFEDVSLLAGDHGLVAAAALLAPLPQDGLEPEDVPGVFDGFLAAGQAARPFLEHWAG
FT                   HARRRPPHRTGPDRRWPELAGGLFDLFVVRDPGLAVGYWNLHERRLAGDPPAVSGQPLR
FT                   FFAFRGFDPGRPWLLTGDYPERPRVRLSAEPVLRRLCEAYRERLGSAKPVENRFAALPD
FT                   GSPLTVPMRQLYHEAWLRTERAQHTPGSLDVVADKVPPHPFGDDDGRAFRQWLAEPASP
FT                   LDAAAGLTRLAAAVWLSRVDLQAVFPHPRGENAAGFREWCSTHGVQEGLLPAWALPAAP
FT                   PPPVPPVRDFGVNVVGYLTAGLGLGEMARVVRRAIAAAGVPMVSVVEEHSLAGSAPTGL
FT                   ATPDDVGAPRFGVSLLTVNSDFTRLILDSHPDAGAGRYRIGLWAWELEDFPVAMHDGFA
FT                   LVDEVWTPSEFATRAIAAHSPVPVRTIPVPVPDPGPVAREPGATTQFLFIFDFNSTGGR
FT                   KNPWGVVDAFHRAFPDRDDVRLVLKATGGHRNVPAVERLRRVIGDDPRIELLERYLTVA
FT                   ELDDLYARTDAYVSLHRSEGFGLTVAEAMARGLPVIATDYSSTTEFFGPGHGWPIPCTM
FT                   TDVGPDWPPYHPGGRWAEPDLDAAAAAMRAVADDPAEARRRGQAAREHVLRTRSTEVAA
FT                   SWMRDRLASAHRTWLASQSAGPPPRHPLVARARRLLRPVRAAARKFRGAT"
FT   gene            complement(129896..131071)
FT                   /locus_tag="AMED_0121"
FT   CDS_pept        complement(129896..131071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41945"
FT                   /db_xref="GOA:A0A0H3CV86"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV86"
FT                   /protein_id="ADJ41945.1"
FT                   /translation="MDEELAAGQISADDYRVRRDSVLSAAVNAEPQAAPPADNPAESTQ
FT                   IIAPVTPPPGQPQAGGTPSAEQTQIVNASFGDAERTQAVNQGGAPQGWAPAGQGDAERT
FT                   QVVPGVPPQSVSGAYRRQGQGSGGFPAQQPQYQHPQGQQMPWAVPSQDTSTPWGGSEFP
FT                   ADTNWVGQGPEPSFETTSRKGGGGKKIVAIVVAVVVLAGLGVGGYFLFSGNDSGNPTPP
FT                   AASSGPAPTPQKPKDDREIAKLPGTVQWNTDFPTFDDLKAAKVLTDEEYDALAGANPTV
FT                   SRGSASTLPSGATIVVMTVKTAGSSAASEAVDKLVNLQAKYKLTKYTGTTPPGVEVMQL
FT                   VREDGKALVRAHYVHKQTVVRVHVDGGDMASVSQVFDEILAKQLAELPANG"
FT   gene            complement(131204..132397)
FT                   /locus_tag="AMED_0122"
FT   CDS_pept        complement(131204..132397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41946"
FT                   /db_xref="GOA:A0A0H3CX86"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CX86"
FT                   /protein_id="ADJ41946.1"
FT                   /translation="MSWQEDLRRLDADLAAGRIEPAAHRKQRDELLAQASGSTVPSPVA
FT                   SPLRRPAAWHSTNPANRANSANPANATDPTRPAIQPVDPRTAPPQRVDTPSSGHPTRAP
FT                   HPAPPWQRTDSGTQKTLSHPVVPPVPDHLTTAPSPADINPTRYLRVEGRVPGGQVSRFP
FT                   EVWPTGDRPEPPRPEENPEPAGRHRDGDGSRRRPTWLFLAAGVLVVLVMIVGGTMWLGS
FT                   GTDNPPQAGPPPGAPSTAAGARSDPLEERLPALPGVPNPNNSTMSVAKGRDLGLYLPKT
FT                   AELFTGNGATQVIFRGSGDGAVSYLVVVVPTTSAPNAQSVVETLYQQALDAGFKPVQSP
FT                   VRTVSGSDGAKFLNTTWYGSGNNVVIVGTAQPYRSQLGLSGEQDRAVKAFEDVLPAG"
FT   gene            132624..134393
FT                   /locus_tag="AMED_0123"
FT   CDS_pept        132624..134393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0123"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41947"
FT                   /db_xref="GOA:A0A0H3CTH8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTH8"
FT                   /protein_id="ADJ41947.1"
FT                   /translation="MSTEAPPRPERALGRLRPTPKAREGLFALLAGFVISGLFNYPVVL
FT                   HPKSLVTGDLGDPLLQAWQLAWQHHFVTSGGALWTGNTLYPAPDSYAFSDSLLGYLPLG
FT                   LFGDGPYTAIMRYNAVFLISFALAFAGAYVLIRQLGGNWQAAALAGTAFAWAPWRLTHA
FT                   SHLNILSAGGIALALFAIARGHGYSLRHGRRPELSRPWWAFVGWVVAAWQVSLGFAVGM
FT                   PFIYLLGVAGLLILITAVRRWPRFGTRLAVADGAGIAVFLAVTYLMTIPYRRVVDEYGF
FT                   TRAWKEVQLYSPPPQGLLAAPDSTWLWQKGPFNLWSGAFADPAWVSLPGASEKLLFPGL
FT                   ALLLVALAGLFFSVWSVRARVGLGIATVVVTVFALGSEFFGGDYTYYVLWRYLPGWDAL
FT                   RTPGRLMLWVLLLLAVLAAGALTRTAEWLRTRDTTYDQGRFLQVLLVVPVLFALLEGIP
FT                   DQPHPSPPGIPPDVAKAFEHDPKPALILPISQEVTPFSEFVYQFWSTDGFPPLANGHNG
FT                   LLPPQYGEILAAATTFPDAHSVDVLRKYGIQQVLVLKVGATGTPYEAALTRQLDGLPLT
FT                   RSESADLVTFTLR"
FT   gene            134501..135106
FT                   /locus_tag="AMED_0124"
FT   CDS_pept        134501..135106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0124"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41948"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUJ1"
FT                   /protein_id="ADJ41948.1"
FT                   /translation="MAYITLSTFVGYSASSGPSRSSFVRRQRRQYEDPARAAFNYYRRA
FT                   ANAVRSGRAANQDEVALRALVNAADERTKPHYAAIAEGWLRYLGRKSPKLVEVGRGRCR
FT                   IGELEIGVSPQMGLRKSDGRRYATWLYFKEEPLAKASAQLALWVLEQAMPDILPGGEAL
FT                   VIDVRRGKEYQLSARDRARLRPWARSEASAFLTLWDAA"
FT   gene            complement(135084..135764)
FT                   /locus_tag="AMED_0125"
FT   CDS_pept        complement(135084..135764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0125"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41949"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVK1"
FT                   /protein_id="ADJ41949.1"
FT                   /translation="MRVLFVHGAFVRDGAWWWQPTADVLAGHGLRSSAAVLPSCESQPR
FT                   GDLHADAEAVRVLLDASDEPALVVGHSYGGMVITTLGAHPAIHRLVYVTSFLPDVGEAL
FT                   ADFGTGEPPVHISHGDGTASVREELVRPRFAQDFDDATYAAAAGRLARQNEAVFGQPAT
FT                   RAAWRDVPSTYVVCGEDRATLPGTQRAQAARATDVVELPVAHHPFVTRPDLVAGVLLRP
FT                   RPTG"
FT   gene            135956..136438
FT                   /locus_tag="AMED_0126"
FT   CDS_pept        135956..136438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0126"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41950"
FT                   /db_xref="InterPro:IPR020323"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV90"
FT                   /protein_id="ADJ41950.1"
FT                   /translation="MYDKLAFWPSTYAHAWPGFREPAPSRTWDLSPGNLDRASAEFRLG
FT                   PYAVEEHQVATIALAAFREVCGPDDWMWALHWQHQSYRVRPHLMSGSARWPVPVFPRAD
FT                   YHLFLAADFSYGTLGHPWERTLCVFGEKLVPAFERLGEGVLSNVLRRDGKPSALAR"
FT   gene            136493..136873
FT                   /locus_tag="AMED_0127"
FT   CDS_pept        136493..136873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0127"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41951"
FT                   /db_xref="InterPro:IPR028965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CX90"
FT                   /protein_id="ADJ41951.1"
FT                   /translation="MTIQATASGDDDAALLERLVDRVHRAIRDAGDFDLVDLRWSAGMP
FT                   MLHFGGFDKHGGHLAPEILDLFTRAGELAPGSYGLLHTWDDQDTENDNNFRVYRMARGQ
FT                   VTEREDTHLTPVAPTILDTYEL"
FT   gene            137091..137163
FT                   /locus_tag="AMED_R04"
FT                   /note="tRNA-Gly-GCC"
FT   tRNA            137091..137163
FT                   /locus_tag="AMED_R04"
FT                   /product="tRNA-Gly"
FT   gene            137351..139012
FT                   /locus_tag="AMED_0128"
FT   CDS_pept        137351..139012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0128"
FT                   /product="RNA polymerase sigma factor domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41952"
FT                   /db_xref="GOA:A0A0H3CTI3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTI3"
FT                   /protein_id="ADJ41952.1"
FT                   /translation="MTELGTVPPPAASESDEQALLQRLRNGEDAAFGELFERHAAAVRR
FT                   LAQSLAADRSEAEDITAETFFRVLQALRRGAGPRDYVRAYLLTVARRVSWEWHGARRDV
FT                   PVSDDELTFRAGAGADTHARTAEHTLITTAFTSLPERWRTVLWQTEVEGEQPAMVAPHF
FT                   GLSANATAALARRARQGLRAAYLQAHLSVNRGPDSCRAVVEKLGGFTAGSVTGAEAERI
FT                   KAHLLGCSSCRATQDELRDVCSSLRAHAGVLVLLVPAAASLGGSGVLAGLGATVKGVLV
FT                   GSKVKIGLALASTAAVGAVGVAAGPVLFGSGPVQDIGLPGGAPELVVVPPSETHHQPPP
FT                   QEPPEPRIGIGVLNGRGTGVAVPPRARSGEQQVAANEVPGLPVAGDVPVAAVGGGAGDR
FT                   PAPREDLASSPFVASEHPASAPRLDSSRPAMTMTTESTDAPAPEDAGAPELSPTGGKPV
FT                   PPSGRPTDQPKKPAPKDDETGATETPTDASPTDTSPTDASTTEPPATEPPATEPSTTEP
FT                   STTVTPTSEKPCPSSASSDTGSGEPADPAPAAPSGS"
FT   gene            139126..139566
FT                   /locus_tag="AMED_0129"
FT   CDS_pept        139126..139566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0129"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41953"
FT                   /db_xref="GOA:A0A0H3CUJ7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUJ7"
FT                   /protein_id="ADJ41953.1"
FT                   /translation="MNRLVRGEDGRDWVVRAQMEWRAPATADDFEHDVAGSYGPGIAMI
FT                   VVTTLLAVILVVWTPDQVNVPAWVLLALLLVVLFFPLRWILRRPWTVVAETEGDVTGDR
FT                   PSERWVGTIRGMFTVQGEVKKISKTIQRHSLPDFDGPLHPVE"
FT   gene            139579..140439
FT                   /gene="mutM"
FT                   /locus_tag="AMED_0130"
FT   CDS_pept        139579..140439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="AMED_0130"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41954"
FT                   /db_xref="GOA:A0A0H3CVK6"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVK6"
FT                   /protein_id="ADJ41954.1"
FT                   /translation="MPELPEVEALAHHLRENAVGRTIFRIDVASLSVLKTATPPWTELH
FT                   GREITGATRHGKHLDVVAGDLHLVVHLARAGWLRWSDGLAAAPLKPGKGPISLRVHLES
FT                   ATGPGFDLTEAGTKKGLAVWVVKDPQEIASVARLGPDALAVDAAQLRELFAGKNTRLKW
FT                   ALTDQSLLAGIGNAYSDEIMHRAKLSPYATIGKLDEGALETLAEAIHDIETDAVERSVG
FT                   QKAARLKGEKRSGLRVHARTGLPCPVCGDTIREISFADKSFQYCPTCQTGGKPLADRRM
FT                   SRLLK"
FT   gene            140596..141921
FT                   /locus_tag="AMED_0131"
FT   CDS_pept        140596..141921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0131"
FT                   /product="two-component system histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41955"
FT                   /db_xref="GOA:A0A0H3CV95"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV95"
FT                   /protein_id="ADJ41955.1"
FT                   /translation="MDAVSGFPLAQIVPWGLVVLLVAAMIVLLVRQRKPASVVEDAMLQ
FT                   AVHRMSKAAPNLRAGLDEDAADKITTQLLQMLDCVAVGITDSEGTLLSWDGEANEHYVD
FT                   LVDAIGNAIRKHRREVVAHDRMPCNHRGTCRMKTAVIVPLLVEGETEAALIVVGRTRGR
FT                   LVQMADAVAQFVCTQFELSRLDESKQQLQQAEIKALRAQISPHFVYNALNTISALIRTD
FT                   PEEARELLQDFADFTRYSFRTSGMFTSLAEELRNIDRYLTIENARFGGRLEVRMKIAPE
FT                   VLSVVVPFLIIQPLVENAVKHGLASKPSGGCVTVIAQDYGTEALISVEDDGIGMDPRRL
FT                   KDVKNAHSTGAHVGLGNISQRMQQVFGSDYAVMVETAPGAGMKVTLRVPKFVPGVRPNM
FT                   PDYSSETDAGEADVPPQGGPAQLNGTEVNGVNGTRSGILPMS"
FT   gene            141941..142786
FT                   /gene="sohB"
FT                   /locus_tag="AMED_0132"
FT   CDS_pept        141941..142786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sohB"
FT                   /locus_tag="AMED_0132"
FT                   /product="serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41956"
FT                   /db_xref="GOA:A0A0H3CX94"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CX94"
FT                   /protein_id="ADJ41956.1"
FT                   /translation="MSVTDKLASRIPVLADRVERKDVVAVVKLHGVITPSPSPLARGAI
FT                   NLAAVETALTRAFGHDRLKAVALLVNSPGGAPTQSGLVAERIRQLADEKGVPVLAFCED
FT                   VAASGGYWLACAADEIYAHRTSMVGSIGVISGGFGFTGLLERFGIERRLHTAGANKSRL
FT                   DPFSPEKPEDVEWLKKMHTQLHELFVNWVKERRGDRLTDTEDLFTGDVWLGAKALDLGL
FT                   IDGLGSLRQIITERYPDAEISVAEPKKPLLARLGLGAPAAASAVLDAVTQKAAWARFGL
FT                   "
FT   gene            142944..144332
FT                   /locus_tag="AMED_0133"
FT   CDS_pept        142944..144332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0133"
FT                   /product="endo-1,3-beta-glucanase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41957"
FT                   /db_xref="GOA:A0A0H3CTI8"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR005084"
FT                   /db_xref="InterPro:IPR006584"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTI8"
FT                   /protein_id="ADJ41957.1"
FT                   /translation="MPHSRRLALGAVLGAALIAIPLTIPAAASIPPPEPGWTTVFADDF
FT                   TGGAGSLPSSANWIVDTGHSYPGGPGNWGTGEIQNYTASSGNLAQDGSGNLRITPLRDG
FT                   AGNWTSARIETQRTDFKPPAGGVMRIESRIQMPNVTGAAALGYWPAFWALGGPYRGNWW
FT                   NWPAIGEFDIMENVNGLNSVWGVLHCGVNPGGPCNETTGLPNNRACPGSSCQSAFHTYR
FT                   FEWDASSSPQVLRWLVDGQQFHSVSQNQLDATTWANMTTHQGYFVLLNVAIGGAFPNNN
FT                   SGTTTPGPGIVPGHPMVVDYVTVTTRGGGGTTTPPTTTTTPPSGGSSAYRTIQAESYSR
FT                   QSGLITEATTDTGGGQNVAAVANGDWALYPGVDFGGSAATNFQARVASGAAGGVSGLVE
FT                   VRLDSRSNAPIGSFAVANTGGWQSWRTVPANIGAVTGVHDVYLTFTSGQPADFVNLNWF
FT                   TFVH"
FT   gene            144458..145249
FT                   /locus_tag="AMED_0134"
FT   CDS_pept        144458..145249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0134"
FT                   /product="two-component system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41958"
FT                   /db_xref="GOA:A0A0H3CUK2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUK2"
FT                   /protein_id="ADJ41958.1"
FT                   /translation="MVLAVDDEPNGLDELVHCLRNSPHVAKVFPAIDASEALRLLSTDD
FT                   PRLRERKDRGLPIVDAVFADIDMPGLSGMEMSRVFAALRPSPALVFVTGHAEEAVNAFD
FT                   LGALDYVLKPYQQDRLDRAISRVLEKLAAAAAPPPGALGGEPVKNDDEVIPVELAGTTK
FT                   LIPRSSVRWVEAQGDYARLFTTEGSHLVRIPLAQLEERWEKAGFVRIHRSFLVALPLIT
FT                   ELRMGQGGYQVVIGNEEKVLPVSRRHTRALKDRLVGSGRNG"
FT   gene            145263..145793
FT                   /locus_tag="AMED_0135"
FT   CDS_pept        145263..145793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0135"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41959"
FT                   /db_xref="GOA:A0A0H3CVL1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVL1"
FT                   /protein_id="ADJ41959.1"
FT                   /translation="MTDDFYERRSNGVREPDPTLGRRARHRPLPQPADRAVVESLPPAP
FT                   ENEPPPKPEHHAKPKRERVILADPRRGAGSLRARVELEEQTSWGKLLVRDHLVKVQLRT
FT                   ALLLALLVVGVFGSLPVLFYLVPGFSQASLLGIPVAWLILGVLPFPFLFGVGIWYNRLA
FT                   ERNERAFVDMIEN"
FT   gene            145825..147615
FT                   /locus_tag="AMED_0136"
FT   CDS_pept        145825..147615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0136"
FT                   /product="sodium:solute symporter"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41960"
FT                   /db_xref="GOA:A0A0H3CVA0"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVA0"
FT                   /protein_id="ADJ41960.1"
FT                   /translation="MQLNPWALTGIVLVAVVTPYLGHRSSRSATSTHDFLVARRTVRSR
FT                   RNAAAISGEYLSAASFLGIAGIVLKDGADALWFPIGFTAGYLALMLFVAAPLRRSGAYT
FT                   LPDFVEMRLGSQGLRRFSTAFVVFIGILYMAPQLQGAGLTLATVVPVPAWAGAIVVMIL
FT                   VAFNVISGGMRAITVVQAFQYWLKLFAIAVPAFVLCMVFFTGGGPDGFRPLGAPAPPVF
FT                   INDTTVDVQTDVTLHVTSDTYLYAYGRTDNGPAAGPTHWTPLAPHTVSEGTKLKFVAGT
FT                   PVPVVSDASADNANWLHPASGSLTDLLQTYSLMFATFLGTMGLPHVLVRFYTNPDGKAA
FT                   RRTTVHVLLLLGLFYLFPTLLGALSRMYVPELLVTGKTDAAILQLPSAILPGVGGQLLG
FT                   AVTAAGAFAAFLSSTSGLLVSVAGVVSTDLLPGRVRDFRVAAGLVALFPIGLAVALRPE
FT                   DISLSIGLTFALAASTFSPLLVLGIWWRKLSWPGALAGMFVGGGLVLAALIVNVVSGYT
FT                   GGWAPWFVNQPALITVPAAFVTTYLVSRVTGYGRPEHVHDIMLRLHAPDPLGFMRDRAV
FT                   ARFGQAEEKTRIAGRGRHRK"
FT   gene            147747..148106
FT                   /locus_tag="AMED_0137"
FT   CDS_pept        147747..148106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0137"
FT                   /product="rhodanese-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41961"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CX98"
FT                   /protein_id="ADJ41961.1"
FT                   /translation="MGIVVSPAELPTAEVRDLPKDGLVLLDVREDDEWAAGHAPGAVHI
FT                   PMGELPVRVDELADLPDDQPIHVICRSGGRSARAAAWLNQSGWDAVNVAGGMGAWQREG
FT                   RPMVGEHPGIEPEVI"
FT   gene            148109..149146
FT                   /locus_tag="AMED_0138"
FT   CDS_pept        148109..149146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0138"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41962"
FT                   /db_xref="GOA:A0A0H3CTJ2"
FT                   /db_xref="InterPro:IPR025565"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTJ2"
FT                   /protein_id="ADJ41962.1"
FT                   /translation="MHPGQPPAGQPYPPGYWPRQAPPPTAQQLQGRTLAAQPEPYPYHR
FT                   RPVHRPKLRWVATPPPGAWPRRRVVAPEPYLGPPSYPVPPRWGFPNLVWRRPTSVPGTA
FT                   SDEVRPIDRVPVLSRSVVVVLFAFAALAVAAASAEIWRYVLLVQGRESALSRSVVAFSD
FT                   GFVLTAGLLASILALLPAGLSLWWLLVARQAAADVSGDDPPRPVWQVLVGVLVPVANLP
FT                   LALSVVGELEHAVLGRSRDVRPKPSRRVLVWWGAWLLNWVLLGVSICWRFRDDVQSMAD
FT                   SVVLVAVTDLSAAALAVMTALVVQRFSALLAPSEALAVREMRVLKVRGAPEPELRASRP
FT                   AGAAR"
FT   gene            complement(149143..149733)
FT                   /locus_tag="AMED_0139"
FT   CDS_pept        complement(149143..149733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0139"
FT                   /product="TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41963"
FT                   /db_xref="GOA:A0A0H3CUL3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUL3"
FT                   /protein_id="ADJ41963.1"
FT                   /translation="MSEGLRDRKKHETRRTISAVATRLFIRNGFEDVTIADIAAEARVA
FT                   KMTVTNHFPRKEDLVFDIREDFTSWPAALIRDSVFHDTRELYFEALGAEHALVGFSGPG
FT                   FVRMIKESPILTNALHEMHRERETALVDLLIRRHPEEELSPTLAAAHLATVLRVLFQEV
FT                   FDRTLENEKAIVEELWPIAEQAFDQLEPAYGGY"
FT   gene            149823..151175
FT                   /gene="emrB"
FT                   /locus_tag="AMED_0140"
FT   CDS_pept        149823..151175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="emrB"
FT                   /locus_tag="AMED_0140"
FT                   /product="MFS transporter, multidrug resistance protein B"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41964"
FT                   /db_xref="GOA:A0A0H3CVL5"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVL5"
FT                   /protein_id="ADJ41964.1"
FT                   /translation="MCMTTAVRPDAALWRLGGVLIMGAVLSILDATIVTVGIGSIAHDL
FT                   DSPLTTVQWVASAYLLAASAAIPLSGWLTDRFGGRAVWLAAVAIFTAGTLLCGFAWSAP
FT                   ALIAFRVLHGLGGGLMQPVGQAVFAQAAGPALGRMIGVITLPATVAPVLGPMLGGALVA
FT                   GLGWRWMFFGIVPLGVATFLCARRLLPAPAPGGVPAALDVRGLALLSPGLGAFVYGLAE
FT                   GVVVAWVAGAALLLAYGVHASRVASPVLELALFRNKGFAVASASTFLLGASLYSSMLLL
FT                   PLYYEQVEQASALRAGLLLAPQALGSAAVMLASGRLLARFGPRRTMLAGIALSLLGTIA
FT                   FTQLGSAPGGALLTLSLLIRGAGLGAATAPGMTTLYGSLERSHIPRAASAFNVVNRIGG
FT                   SLGTALLAAILHSELTAAPAPAAFGTTFTWALALSALTLIPALFFPQRSTR"
FT   gene            151172..152014
FT                   /locus_tag="AMED_0141"
FT   CDS_pept        151172..152014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0141"
FT                   /product="LmbE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41965"
FT                   /db_xref="GOA:A0A0H3CVA5"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR017811"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVA5"
FT                   /protein_id="ADJ41965.1"
FT                   /translation="MTYRLLSVHAHPDDESSKCAATLARYAAEGVEVLVATCTGGERGD
FT                   VLNPALDTPETWADLPAIRRREMAAAAEILGVRQRFLGLVDSGLPAEGEPLPEGCFAAL
FT                   PLSEAAAPLVALIREFRPHVVITYDETGGYPHPDHIRTHEVTVEAFTAAADPARYPGTG
FT                   EPWQPQKLYYQATLSRAWFQALHEATLAAGLESSMAEVLNELPPDKFPVTTKIRCEAHF
FT                   ATRDRALLAHATQVDPAHPFFAHSREIERQVWPHEDYHLAHPAPGPHLEEDLFTGVTP"
FT   gene            complement(152187..153353)
FT                   /locus_tag="AMED_0142"
FT   CDS_pept        complement(152187..153353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0142"
FT                   /product="cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41966"
FT                   /db_xref="GOA:A0A0H3CXA5"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXA5"
FT                   /protein_id="ADJ41966.1"
FT                   /translation="MFDPRDPAFLENPYPAFAALRSRGEVHFHDGLGLAIAVSHAASSA
FT                   VLRHRGLGRIWQDAQPLERFASFNLLHRNSLLENEPPAHTRLRRLIAGAFGRGHVQRLR
FT                   PMVATLAAHMVDDLAAAIAADGSADLLEHLAQPLPVAVIAELLGVPGTDGPRMVQLSNA
FT                   IVKMYEFDLPEEGRDAAEQAAAEFVDYVRSVAATRADAPGDDIISDLLRSELTPDELVA
FT                   TAVLLLMAGHEATVNVLGNGITALLTHRDQWERLLASPALLDSCVEELIRFDAPLQLFE
FT                   RTATEDVSIGGYVVSRGEKIGALLGAAARDPKVFDEPDRLDIGRTPNAHLGFGLGIHYC
FT                   VGAPLARVEIAAALSALAEKLPGLRLAGPPPRRPEFVIRGLRELRVTV"
FT   gene            153407..154288
FT                   /locus_tag="AMED_0143"
FT   CDS_pept        153407..154288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0143"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41967"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTJ6"
FT                   /protein_id="ADJ41967.1"
FT                   /translation="MGKGARKKGPKQASDRKPKVRDVFVGQPFEGLAAEPELIALREFV
FT                   PSATAQLTLADGGDVTLGTVLPMAAAAFVRSDGRRYLGLQVQTRSSDISRDLGRSLKWL
FT                   LDAKEGDVLGVPDTTTPPSADEHARLQDLLTPGAELDVTLHQDFGWWLPEDADATGDVA
FT                   VSLERANAAIMPTERLGSAAYWVLAGEKAHLRWVRPEPENLLLQALARLSAAGELGLGE
FT                   GSRYAGSFRAHGLLVPVWDLDPEAHAREWAEAKDALGARLETALKSLDDEPLNATERRA
FT                   RDGLIGRQLTLR"
FT   gene            154618..154932
FT                   /locus_tag="AMED_0144"
FT   CDS_pept        154618..154932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0144"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41968"
FT                   /db_xref="InterPro:IPR009297"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUL5"
FT                   /protein_id="ADJ41968.1"
FT                   /translation="MAEDGEYRPSSLGEVGFIHCSDFGTANLPANIRYRGRTDLVLLEI
FT                   DPAKVGSPVRWEDGVPPHPEGIWFPHVYGPIPHAAVVGVHEFRESEGGGFRLPDSLAHR
FT                   "
FT   gene            155245..155757
FT                   /locus_tag="AMED_0145"
FT   CDS_pept        155245..155757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0145"
FT                   /product="RNA polymerase ECF sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41969"
FT                   /db_xref="GOA:A0A0H3CVL8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVL8"
FT                   /protein_id="ADJ41969.1"
FT                   /translation="MPGEFVDFGDFVQATLPGLLRYGHALTGNPHDAADLVQTVLEKIG
FT                   SRWTYVHEKTGDPLAYVRRSMANAHVSRWRRTRRENLVADLPDTSPHVPADPFEHEPLW
FT                   RALRTLPPRQRAVMVLRYYEGLSEAEIAGVLGITQGTVKSQASKAIASLRMKLKSVDGE
FT                   GEGSGAG"
FT   gene            155754..156584
FT                   /locus_tag="AMED_0146"
FT   CDS_pept        155754..156584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41970"
FT                   /db_xref="GOA:A0A0H3CVA9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVA9"
FT                   /protein_id="ADJ41970.1"
FT                   /translation="MNISEDELEQRLRALFADERLDLPPPPDAGTVIVTGARRRRRRRH
FT                   TVQAVAGVAAAVVAVAGGLTMFRLHTEDGTAVISVPGTGADSKPPENLTQGRPPEPSAP
FT                   GPTGTQSIQASAPPGASTSSPPPKRPSSAPSPSTLAAVTSGPLLAADGFGRLKLGMSEA
FT                   DVAAQTITLSDAQAGAGCTVYKAQGSGLPASASVVISKAAGLVVVTPDVAAHTAEGIGA
FT                   RSTKDQILAVYPAAEEETGGVVAPAGPAAEYHFRLDQTGVVQTSLTSLTQDCAG"
FT   gene            complement(156651..157214)
FT                   /locus_tag="AMED_0147"
FT   CDS_pept        complement(156651..157214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0147"
FT                   /product="ferritin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41971"
FT                   /db_xref="GOA:A0A0H3CXA9"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR041719"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXA9"
FT                   /protein_id="ADJ41971.1"
FT                   /translation="MVVMALTKKKEPRSKFFELLQAQIHNEFNASQQYIALAVWFDAED
FT                   LPQLAKHFYKQSVEERNHAMALVQYMLDRDHHVEIPGTGEVRNDFSGVTELIELALNQE
FT                   KEVAADISAMVKAARAEEDYISEQFTQWFLKEQVEEISQMNTLLNVVKRANGNLFEVEN
FT                   HLARESVGDSGTDSQMPPVAGGKL"
FT   gene            complement(157350..158561)
FT                   /gene="arcA"
FT                   /locus_tag="AMED_0148"
FT   CDS_pept        complement(157350..158561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcA"
FT                   /locus_tag="AMED_0148"
FT                   /product="arginine deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41972"
FT                   /db_xref="GOA:A0A0H3CTK2"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTK2"
FT                   /protein_id="ADJ41972.1"
FT                   /translation="MIDETAPPRVDSEVGPLRAVLLHRPGNELKRLTPRNNDQLLFDSI
FT                   PWVGRAQAEHDAFAEVLRNRGVEVLLLADALRTALDDDRAHAAGVHAAVDDRRLGGDLA
FT                   DSLRSHLSSVDAAGLAEVLMAGMTFEELPSAEGASLVRMMNHPHDFAVDPLPNLLFTRD
FT                   SSVWIADRVAISSLTMPARRRETAVLDLVYAYHPQFRHAARAYGAHSAPIEGGDVMLLA
FT                   PGVLAIGVGERTTAAGAESLARSVFADGIAHTVLAVPIEQSRATMHLDTVCTMVDADAV
FT                   VMYPLARDSLTAFTLRPTGDGGVKVAGPAPFLVAAAEAMEIDRLRVIDTGLDPVTAERE
FT                   QWDDGNNTLALAPGVVVGYERNAETNERLEAAGIEVLPIAGSELGSGRGGPRCMSCPVR
FT                   RDPL"
FT   gene            complement(158576..159388)
FT                   /locus_tag="AMED_0149"
FT   CDS_pept        complement(158576..159388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0149"
FT                   /product="CAAX amino terminal protease"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41973"
FT                   /db_xref="GOA:A0A0H3CUM0"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUM0"
FT                   /protein_id="ADJ41973.1"
FT                   /translation="MTFTARSWLAPDRPEFPATVEDPAERRAIKLELLIVFGITLGLSG
FT                   VRSLLSLVDSLLQPVPLAQQQAQLNVPQAAASLIDLLKQLLSAAQLVGWGALGLYLLWR
FT                   AGIKISRLGLDRRSAGYDTLLTLGLAAAIGIPGLALYFVSYHLGFSLAVQPSTLGDTWW
FT                   RPITLTLSAFGNAFAEEVLVIGYLLTRLRQLGVRENNAVFGAAVLRGSYHLYQGFGGFV
FT                   GNFIMGLVFGRLWQKTNRLWPLIAAHTLFDFVSFVGYALLKGHVSWLP"
FT   gene            159411..159872
FT                   /locus_tag="AMED_0150"
FT   CDS_pept        159411..159872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0150"
FT                   /product="pyridoxamine 5'-phosphate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41974"
FT                   /db_xref="GOA:A0A0H3CVM3"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019920"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVM3"
FT                   /protein_id="ADJ41974.1"
FT                   /translation="MPRSIATNETVDRAALVEFLSTRHRAILLTTKADGGPQLSPVTCG
FT                   VDAEGRLVVSTYPKRAKVVNVKRNPDVSACILSDEWNGQWVQLNGTAEVLDVPDSVEPL
FT                   VDYFRSISGEHPDWDEYREAMVKQGKSIIRVTIESWGPIAKGGFPAELA"
FT   gene            complement(159864..160658)
FT                   /locus_tag="AMED_0151"
FT   CDS_pept        complement(159864..160658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0151"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41975"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="InterPro:IPR037119"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVB4"
FT                   /protein_id="ADJ41975.1"
FT                   /translation="MTEAPTSVRRPPAPNPAERAKTIATRNGPASLLPTCDRADLNGER
FT                   VVPVLHHVHRSGSVSVLLADDHPMVRAAKQAQRGELAVMVEVADQAPVDLREPIRGLLW
FT                   ITGWLRPLSPVSARARAVAIAETRPDERLLDVGHGVTLLRLTPASLVLADAEGTHSLRP
FT                   HMFSAAPPDPFHDYEAGWLRHLESDHSDVVEQLAKHLPSALRGGRIRPLGLDRFGLRLR
FT                   VESDTGDHDVRLAFSKSVESPAQLASELRRLVGCPFLRGRSG"
FT   gene            160813..161838
FT                   /locus_tag="AMED_0152"
FT   CDS_pept        160813..161838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41976"
FT                   /db_xref="GOA:A0A0H3CXB6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXB6"
FT                   /protein_id="ADJ41976.1"
FT                   /translation="MPIVPLPERVRAFELDPAMPSGALPIFGEYLDRLGDTANRRLVAG
FT                   FFLVFGIAQFVAGAGVALPVGTFALAGAIEGWWLYRAYDRVPERRLKREAFRQVDVTAD
FT                   GLVAAGRTVGVRLPDGRWLRVRLDEAHRLLVAGHRRVWLLGRGPKVFVGFPGVVRLRRA
FT                   AIHDGPPPGAAPIPEPAGSGSPRLDPVLTAHRHQLARDLRLTAAFLLVLAAFAAWVGLD
FT                   FPVVGWVAWPFGVGVLLGASVTAFRAIAYRRPLPADHWTELRAVLDGPVRMSRHGAARL
FT                   SGLTMLADGRVVPFRLPKADPSMAANIAATGRLWIAGAPRPGAAKTGLPGYPVLGTVWL
FT                   G"
FT   gene            162174..162515
FT                   /locus_tag="AMED_0153"
FT   CDS_pept        162174..162515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41977"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTK9"
FT                   /protein_id="ADJ41977.1"
FT                   /translation="MPGELGRSHRRRSGPRMPGAAQQLDRLVEHPLGIEVLRHRDDRAE
FT                   GGIDRAFRSAAIAVPKSVATSNGTAGCVSWKPRSSVAGHSRRPMTSTRSGPPRTEASAR
FT                   SSADSSSRA"
FT   gene            162789..164006
FT                   /locus_tag="AMED_0154"
FT   CDS_pept        162789..164006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0154"
FT                   /product="MFS transporter, multidrug efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41978"
FT                   /db_xref="GOA:A0A0H3CUM4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUM4"
FT                   /protein_id="ADJ41978.1"
FT                   /translation="MMRGRSLGPRFRWLWSAYAVSAFGTWLGFGAFPMLAILILHTGPA
FT                   GVSALAAVGPAVGALVAVPLGPWVDRRRKRPVMVGMDLVRFGALVSVPAAYALGVLSFG
FT                   QLLAVSVVVAAADITFTSASGAFLKGLVPPEDLLVANGRFESTNWTATALGPPLGGAAF
FT                   ALFGPVTSVVANAVSFLLSALGIRAIGGDDEPRPRTAGRPRLRDLADGWRFLLAHPGLR
FT                   PLLFNAMVFNGLVMAIDPLLAVLMLNQLGFTPWQYGLAFAVPCLGGLAGSRLTPRLVER
FT                   FGRHPVLLTSGAVRAGWLLALAFIPAGPGGLVYVMVVELGVIVSCSVFNPVLATYRLEQ
FT                   LPPDRIARTLSAWSVSTKAAIATLTAVWGLLAGLTGPRVAIGVAGVLVLATPLLLPRRD
FT                   RTPVAA"
FT   gene            complement(164003..164743)
FT                   /locus_tag="AMED_0155"
FT   CDS_pept        complement(164003..164743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41979"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVM9"
FT                   /protein_id="ADJ41979.1"
FT                   /translation="MKFARELAEPWGLLLAATSAGVAWAVQLPVVAAVGVGVAVLAARA
FT                   GVAVLGGEKEEPPAREARVLDVAPGSAEENWLRRAESAAEGFGSLSASLAAGPLAERVA
FT                   DMEPVVRETLSTLRRLAGRASATGQALARVDLDAVAHERRRLQRDLRTANPDVRGDLEQ
FT                   ALTAVQAQADVHARLSGARDKLLAQLQSGALGLDSLVARVAELTAATTDVTVDTGAVRE
FT                   LSDQLEGIRQGVLETEQATRKSLG"
FT   gene            complement(164743..166551)
FT                   /locus_tag="AMED_0156"
FT   CDS_pept        complement(164743..166551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0156"
FT                   /product="von Willebrand factor type A"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41980"
FT                   /db_xref="GOA:A0A0H3CVB7"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVB7"
FT                   /protein_id="ADJ41980.1"
FT                   /translation="MINSQPARRRRKILPFLAAIVVAIALIIGIRYWTSGSSDDADAPK
FT                   CSGADAIALNVASSPEKVGIVQEAAKAYSGRSVAGHCVDVIVKSKSSGVAMQALANGWN
FT                   EATDGPRPDVWTPAASGWVNLLRVNAKGDSASIVPDGDPQSIANSPLTIAMPKPMAEAL
FT                   GWPAKPLGWKDITALATDPAGWAKYGHPEWGKFRLGKTNPNISTAGLNATIGAYYAATG
FT                   TSSDLTAAALEKPEAKQFVSNIEQAIVHYGDNTLTFLTNLQKADDRGAALSYISAVTVE
FT                   ESSLIGYNQGNPTNDPAKVGQHAPPKVPIVAIYPADGTLNSDHPFVTLNWADPTRKQIA
FT                   ADFLGYLRGPETQQRFAALGFRSFDGKPGPQASTANGVQPDAKISFLQPPSPTVLAKLL
FT                   TTWTDLRKKANVLLVVDVSGSMGDEVKGTGKSKIDLAKQAAIDSLGQFVPRDQVGLWQF
FT                   ATHLDGDKDYQELLPVQPLGSNGKETLASRLSGLTPQSGTGLYDSSLAAYEYLKAHLDP
FT                   SAINAVVVLTDGRNEDPGGVDLDHLVPQLRPEGNAESVRLFTIAYGGDADQNVLKQIAE
FT                   ATAGSEYDSSKPDSINQVFTSVISNF"
FT   gene            complement(166632..167804)
FT                   /gene="hmgA"
FT                   /locus_tag="AMED_0157"
FT   CDS_pept        complement(166632..167804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmgA"
FT                   /locus_tag="AMED_0157"
FT                   /product="homogentisate 1,2-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41981"
FT                   /db_xref="GOA:A0A0H3CXC1"
FT                   /db_xref="InterPro:IPR005708"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXC1"
FT                   /protein_id="ADJ41981.1"
FT                   /translation="MPYYRRVGELPRKRHTAFRKPDGGLYAEELMGVEGFSADSALLYH
FT                   RGLPTAIVDAVAVEEDRGSLTPNHPLKPRAFQTRDLKFGGEADAVTDRRRLFGNSDVTI
FT                   GFVTATAPSPLYRNAAGDELFYVHGGSATFETIYGRLEVGDGDYVVIPTSCTYRVVPHG
FT                   EVNLFTLEARGHIGPPKRYLSAKGQFLEHSPYCERDIRGPSEPLLEDGEDVEVLVRHRA
FT                   GLTRYTYATHPFDVVGWDGCLYPWVFNIDDFEPITGRVHQPPPVHQTFEGPNFVVCSFC
FT                   PRKVDYHEGAIPVPYNHANVDSDELMFYVRGNYEARKGSGIGIGSLSLHPSGFTHGPQP
FT                   GAAEASIGAEFFDETAVMVDTFAPLELGEAADASEDPGYAWTWSRRGPKT"
FT   gene            167983..168744
FT                   /locus_tag="AMED_0158"
FT   CDS_pept        167983..168744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0158"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTL4"
FT                   /protein_id="ADJ41982.1"
FT                   /translation="MPEALRAHFAGRDSEHAGVLGVFLCQASRLPELITELIKIKPKQP
FT                   LPLSLIIDTGLGGVPKAISIVESRSELLALRMVEMPAPSDVDEVWLERVSEFVPEDVIR
FT                   VVEPRRGVGWLEGVRKVIEHGSWPKIRCGGQAGENFPSVDEVADFLAVVSGSAGASFKA
FT                   TNSLHRAVRHTDPGTGFVHHGFLNLLVASARSLAGGDVRAALESTDAQALADEARALSE
FT                   PAAKAVRALFASYAAASFEQPVADMGELGLL"
FT   gene            168741..169385
FT                   /locus_tag="AMED_0159"
FT   CDS_pept        168741..169385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0159"
FT                   /product="IclR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41983"
FT                   /db_xref="GOA:A0A0H3CUM9"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUM9"
FT                   /protein_id="ADJ41983.1"
FT                   /translation="MTSREGSLTLDRGLALLQAVADAGGDAATISELAVAIGASRAAVY
FT                   RLLVPLSERGLVWRDGTKVRLGVGLLRLAGQVLPQLRDAAGPVLRELAEKVGATAHLSV
FT                   AQGTQALAVAVVEPSWTSFHVAYRVGSRHQLTAGAAGKAMTLRPGGDGWVTSAGELQAG
FT                   ASGVAAPVRGVPGLRASVGVVSMEPLKAAEVGPQVVAAATRLADILKTDAP"
FT   gene            complement(169382..170044)
FT                   /locus_tag="AMED_0160"
FT   CDS_pept        complement(169382..170044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41984"
FT                   /db_xref="GOA:A0A0H3CVN3"
FT                   /db_xref="InterPro:IPR009339"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVN3"
FT                   /protein_id="ADJ41984.1"
FT                   /translation="MNKPSNAVSPLHGRVALGGIGLAVTISIDLHLRLSAQVSPIWQTL
FT                   SEYVYGKLGTSSAAPLFSVMCLALSLGSVALLAGIAKAHRPGTTAVCVLLGVWSAGLLV
FT                   CGLVPVDPDGQARSLAGQVHNIAALTAFITLPAAAFVLTKKDRERCPWEPRRTTIRRLA
FT                   TASFASVGVVLGGFVLTLVLGPAQQDITLGLFERLLFTVDVALLLTMVRPLLAVSRR"
FT   gene            complement(170101..170688)
FT                   /locus_tag="AMED_0161"
FT   CDS_pept        complement(170101..170688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0161"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41985"
FT                   /db_xref="GOA:A0A0H3CVC1"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVC1"
FT                   /protein_id="ADJ41985.1"
FT                   /translation="MVTLISAFGLVLAVELPDKTLVATLVLTTRFRGWPVFAGVCAAFA
FT                   VQCVIAVAFGSVLTLLPDVVLSLVVAAMFGLGSFMLLREGFSKADEAGDDASRVGPAPK
FT                   SFLRSAMTSFGVLFAAEWGDASQLATASLAARIGNPFAVGVGAFTALVVVAGLAVFIGA
FT                   KIRSRIKPKLIQRCAGFAFAGFAAFALVQLAF"
FT   gene            170875..171834
FT                   /locus_tag="AMED_0162"
FT   CDS_pept        170875..171834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0162"
FT                   /product="interphotoreceptor retinoid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41986"
FT                   /db_xref="GOA:A0A0H3CXC6"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXC6"
FT                   /protein_id="ADJ41986.1"
FT                   /translation="MGSQARAAQVEEVIRRLEAHYVFPDVAAKLAEVLRARLGEGTYAD
FT                   LGDADFATAVTADLQSVNDDKHLRLRHHAGPVAEDGDAEHASEDFRQTAELENFGIASA
FT                   RRLPGNVGYVDTTLLYPLDLAAAAVSAAMTLVAPADALLLDVRRNRGGTPDTSAFLQSY
FT                   LVDERTHYLDIYEREGDLVTQMWTLPYVPGPKFGGTKPIWVLTGPATFSGGEDLAFSLQ
FT                   RQGRAKTVGESTRGGAHPREQYKVDIYLDVTVSIARSYDPKSGENWEGIGVRPDIPVAA
FT                   DKAFDTAYELALRHVLELGDAGPRRVVADEARAALDEL"
FT   gene            171914..173389
FT                   /gene="cydA"
FT                   /locus_tag="AMED_0163"
FT   CDS_pept        171914..173389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydA"
FT                   /locus_tag="AMED_0163"
FT                   /product="cytochrome bd-I oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41987"
FT                   /db_xref="GOA:A0A0H3CTM0"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTM0"
FT                   /protein_id="ADJ41987.1"
FT                   /translation="MEVLELARWQFGITTVYHFLMVPLTIGLSILVAAMQTRWVRTGEL
FT                   RHLKMTKFWGKLLLVNFAMGVVTGIVQEFQFGMNWSAYSRFVGDVFGAPLAMEGLVAFF
FT                   VESTFLGLWIFGWDRLPKKVHLACAWAFSLATMASAYFILAANSWMQHPVGVTFENGKP
FT                   TMNSIWAVLTNNTALAAIPHTLAGAFSVAAAFLVGVAGWHLWRRGDHADVWRSSLRLGG
FT                   WVGVAAFAVLAITGDTQGKLMFEQQPMKMASAEALCHTEQPASFSIIAIGDVAGSNCED
FT                   VKTFNVPALLSFLAHNDFKTEVKGVEDLITEYQAKYGTNYPDDPALGSLAGKPIDYVPN
FT                   LPVTYWGFRMMIGFGAVSAGIGVLALWLTRRGRVPGSRWFPWLVLGGVATPFLGNSAGW
FT                   IFTEMGRQPFVVVPNPTGVDGVWMFTAQAVSRLTTGEVWTSLIALTTVYAALGVVELYL
FT                   MRKYVRGGVDAVMPPKKPDDSDKPGEDTLAFAY"
FT   gene            173504..174511
FT                   /gene="cydB"
FT                   /locus_tag="AMED_0164"
FT   CDS_pept        173504..174511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydB"
FT                   /locus_tag="AMED_0164"
FT                   /product="cytochrome bd-I oxidase subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41988"
FT                   /db_xref="GOA:A0A0H3CUN3"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUN3"
FT                   /protein_id="ADJ41988.1"
FT                   /translation="MSLEIAWFVVIAFFWLGYLFLEGFDFGVGMLLPVLGRDNTERRVM
FT                   VNTIGPVWDGNEVWLIVAGGAMFAAFPAWYAGLFSAAYLPLLLVLLALIGRGVAFEYRG
FT                   KVDSDRWRRTWDRVIMIGSWIPPLGVGLILATTVLGLPLDAEGNRVGSAFAAIRWDTLL
FT                   GAVAIAAFSITHGAAFLALKTSGDLRERARTLALRLLPIAMVPVVAFLSVVQWRAGTLW
FT                   TLLAFGISAVAAVVAWLRLRADRDGQAFAALGVVIAGAAVVMFGSLFPNVLPSTLDTAN
FT                   TLTIEGAASSPYTLTVMTWVAVFGAPAVLIYQGWTYWVFRKRIGTQHIPAVHAP"
FT   gene            174598..177771
FT                   /locus_tag="AMED_0165"
FT   CDS_pept        174598..177771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0165"
FT                   /product="fused ATPase and permease components of ABC
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41989"
FT                   /db_xref="GOA:A0A0H3CVN8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014223"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVN8"
FT                   /protein_id="ADJ41989.1"
FT                   /translation="MDSARPGKGPLGALPALVPAVRRALALVGFLSFVNAAALVAQAFL
FT                   LAGVLATIVGAGSGGRTAQLAALLALVATRALTGWAVRTVSARAAATAQRELRAKAVDH
FT                   ALRLGPEWIAQRGHGELTALTTRGLDALDAYFREYLPALVTAAVVPLGAGAAILFADWP
FT                   SGVIVALTVPLLPVFAILVGKYTADRVAGATDATHRMSGRLLELVRVLPVLTAFRRAAA
FT                   QAETVRRLSERHRRATLKTLKVAFSSAFVLELLATLSVALVAVVIGVRLAGGHLPLAIG
FT                   LGVLILAPECYQPLRAVGAAFHASEDGVEAVRRVADLLALPVPSAGTAIPARGELRVSS
FT                   LRVARRGGFAPDGESFVVRPGETVWLRAPSGGGKSTTLSALLGFVPAHDGAITVGSTDL
FT                   ADADLARWREQVAWVPQSPVFTGGTVREEVGSAGAVLADLGLAGLADRPVSQLSLGQRQ
FT                   RVAVARALHRVQGGAWLLLLDEPTAHLDEASARLVLDAVERAVDHGAAAVIAAHERTPA
FT                   VDLPSSPAAPAETSTVDSSAAPLRWRALLDGRLFGGAALGALALLAGVALTATSGWLIA
FT                   KASQQPPILTLTVAVVGVRAFGLGRAGLRYVERLVTHDAAFRIAGRVRVRLWNSLVRLG
FT                   PARSLRAGEGQRRLVGDVDTVRDLLPRVVSPPLVVALVAAGAIAVQTWVLPAAGVTLAA
FT                   AVALGLCAPWVALRAERRATSALAAGRREVAARVLVTFEAAAELLAFGAEGNHRRALAA
FT                   ADTRLVTQARRQAFGVGAAEALVTLVCGAAAVVSTALAAAAVAGGRLDPVLAPLLALVP
FT                   LALAEVLALLPPVAQHWDTLQRARRRLADVPEAPVLTSRGDRVELRGADLGWPGGPVVL
FT                   HDVDVDLAPGTYTAVVGPSGAGKSTLVAALLGFLPPRRGVVAVPEGVAWAPQEPMLAAT
FT                   TIAENLRLARPTATEEELRSALHGAALTDVSPETVLASGGTGLSGGQAQRVALARALLG
FT                   APSAGLVLLDEPTAHLDEATAQAVRAHLREALAGRTVVHVTHRADEADGADVVLEIRDG
FT                   RVVTRVPVS"
FT   gene            178332..179261
FT                   /locus_tag="AMED_0166"
FT   CDS_pept        178332..179261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0166"
FT                   /product="two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41990"
FT                   /db_xref="GOA:A0A0H3CVC5"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVC5"
FT                   /protein_id="ADJ41990.1"
FT                   /translation="MRGLALPADSAAGQVARGGEPVSSADFTVDPRTAPYVPAELHGYG
FT                   PFAAAPFGSGGRVLGSLTVYRKRGREPFSAGTVEMLVAFAAQAGVVLALAEGANARHRV
FT                   ALYEERERIARELHDVIVQRLYGAGMQLDRVRRNMRKRFAQADGARLSDAIDQLDQTIE
FT                   EIRGTVRALRSPEPRHDTGTPADLAESARGEVRIAGELLGYPPTLELSGEFADVPAERA
FT                   DHIRAALREALSNVVRHSGASETRVTLTRDSGGVKLRVRDNGSGVPQGVATRGLRHLAE
FT                   RADAAGGKFFLNSSPSLGTLVAFDLPLD"
FT   gene            complement(179458..180084)
FT                   /gene="devR"
FT                   /locus_tag="AMED_0167"
FT   CDS_pept        complement(179458..180084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="devR"
FT                   /locus_tag="AMED_0167"
FT                   /product="two-component system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41991"
FT                   /db_xref="GOA:A0A0H3CXD2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXD2"
FT                   /protein_id="ADJ41991.1"
FT                   /translation="MPIQVLLVDDHELVRRGLRDLLGDEPDIEVVAEASSVEEALAVAM
FT                   HVEPEVAVVDVRLGDGDGITLCRELRSKPNPPACLMLTAFDDEEAMVGAIMAGAAGYLL
FT                   KQVRGQDVVNAVREVAAGRSLLDPVSTARVLDKMRHPPTDELATLTERERDVLELIGQG
FT                   LSNREIAERLFLAEKTVKNYVTSVLAKLGMQRRTQAAAWIVRREK"
FT   gene            180370..180852
FT                   /locus_tag="AMED_0168"
FT   CDS_pept        180370..180852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0168"
FT                   /product="putative excalibur calcium-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41992"
FT                   /db_xref="GOA:A0A0H3CTM6"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008613"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTM6"
FT                   /protein_id="ADJ41992.1"
FT                   /translation="MSLFRRALTTAAAVAGLALLGPVPFASAQLATPLVGDLDCKNFQY
FT                   QEEAQAVLDATPGDPNDLDRDKNGIACETLPHRPKQPSTTTSTAEKPATTKHSAPKTTT
FT                   KKPATGGQVKVKPAGGVATGGGEPDDEVPGFLVLSGTLLAATVSGGMVLYLRRRPS"
FT   gene            180849..181499
FT                   /locus_tag="AMED_0169"
FT   CDS_pept        180849..181499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0169"
FT                   /product="peptidase C60, sortase A and B"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41993"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042001"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUN8"
FT                   /protein_id="ADJ41993.1"
FT                   /translation="MRHPRLWPAVAAVAAAFGVVLAVALVLVLSPKAPQEIAPPSPAAT
FT                   NPAGTASLAHPSPTAADGLPAAKPASLTIPAIGVRAEEIKDLGLTPEGALEVPGDATTV
FT                   GWFTGAPSPGEAGPAVLAAHVDYKHVPGAFSRLKELRPGEQAKVGRADGRVAVFTVYRV
FT                   DHYPKATFPTDQVYGDTPDPELRLITCGGAFDRASGNYLDNVVAYARLTAVEA"
FT   gene            complement(181469..183745)
FT                   /locus_tag="AMED_0170"
FT   CDS_pept        complement(181469..183745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41994"
FT                   /db_xref="InterPro:IPR032830"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVP4"
FT                   /protein_id="ADJ41994.1"
FT                   /translation="MTTADELLGRLAGLDTAALAKVLAHRPDVLQDPWPRRLDVVAARL
FT                   AAAESIDAALLGLPTPLVQVMRAVQLCYALGQRPAPVAEVARLLGTDAGAVESIVDDLA
FT                   ERALLWPAADGVVLPELLHRNSFAAEGLGQPVGGLLGELGTSRLAKLSRALGLPDTERK
FT                   PQLLLGLVQFFRDGDAVRDLFATAPEETQKLLRDMAEGVPEVQGLAPAGWAFDHGFLYG
FT                   TYYGTVAMPIEVSLALRGPDHQLPFTPGEPAYAVTHTGAEAAEAASAAAALRLLDRVSA
FT                   VLDLAAAEPLPLLKDGSIGTRLVKKLAKDTGATPAEIELAIDLAAQAGLLVADEPPPPR
FT                   RGQKAPAPTLAPDPDLARPAPALLYRLLLTTWWDPAPPEFETDVDALMRRLVLRLLARL
FT                   APGDALDIDALIRLAEWHAPLLPTDDIAGHVRDALGDGELLGVVAHGAVTAAGRALLAP
FT                   DRLVEVTGELVSRARTTALFGTDLTAIVPGSPDARLAALLDRVADREAQGTATSWRFSP
FT                   ASVRRAFDQGATTAGLLDDLRAIAAGDLPQPLVYLVNDVARRHGEAQVYDVASVVVGEP
FT                   AVLAELAAHRKLAKLGLRPVAPTVLTSTVDAARTLEALRDAGYAPTRHAADGSIVLPAR
FT                   DQAEPTLAVRDPEPGELPPDPAGHAERLLAAPASGPALLRGQLARAMSDRYAGRLTPKQ
FT                   QQLCWQLEAGLPVDIAYGGEHLVIAYPELDGDVLDVWSLRERTYRRLELSRIDLAQAST
FT                   AVSLA"
FT   gene            complement(183760..184563)
FT                   /locus_tag="AMED_0171"
FT   CDS_pept        complement(183760..184563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0171"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41995"
FT                   /db_xref="InterPro:IPR008613"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVC9"
FT                   /protein_id="ADJ41995.1"
FT                   /translation="MQPKKRFPNWLKIVLAAFTVLFVLGAVFGKAPEPKLTSAAAPATS
FT                   APRPTSTTASPAPTPAAVAYTVGSVTDGATVVVNGSDGTSKTVHVLGVIAPVASTGCYA
FT                   AESLAWATSTLSGNAVKLGAETAQGIALTLADGQDYATLAIQKGYLKYATTAALPALAA
FT                   GESAAKQAVSGLWGPPCQGTIDAPAPAPAPTPAPAPITTPKPAPATKAAPPPAPVETTE
FT                   DAPAPGVYYANCSAAKAAHAAPLHRGEPGYRPALDRDGDGIACER"
FT   gene            184755..186140
FT                   /gene="dnaQ"
FT                   /locus_tag="AMED_0172"
FT   CDS_pept        184755..186140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="AMED_0172"
FT                   /product="DNA polymerase III subunit epsilon"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41996"
FT                   /db_xref="GOA:A0A0H3CXD7"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXD7"
FT                   /protein_id="ADJ41996.1"
FT                   /translation="MIESLPLLGAGGCSAAGLEFTVVDIRTTGLRSGRVVELAAVRVSA
FT                   DGSFGGELTTLVDPGPGVPPGPALVHGITRGELDGAPSFGEVLGPFLDLCAGSVLVAHD
FT                   LASAGAFLDREIGALGVRMPVLPGVSTQAAARSVVRLPNYRPATVAHALGVPTRPGQSA
FT                   LSGARTVAQLVVGLFGRYGLTFASPPVLPGLPRFADGRLLPRGEALPAEPGWMAEAVER
FT                   IPGGGAGDAYLDLLAGVVADQHLAHDEVAALAVLASEAGLSEGHVRATHERLVTALREI
FT                   AERDGVVTAAESRELRQVATALGVADAGELQPTAAGKPTRVLVLGTTVAADRLRARVLA
FT                   EGVQLAKKLTASVTHLVADASVPADEPRLMRAAELGAVLLDVGVAPVALGFEPPPAPPA
FT                   ATAARMPKLVGGRVLMGIGLLLMFIVVVAMFAGTPLAAGIFLAVFGVGALLGGWWLAEP
FT                   APR"
FT   gene            186211..186549
FT                   /locus_tag="AMED_0173"
FT   CDS_pept        186211..186549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0173"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41997"
FT                   /db_xref="InterPro:IPR021388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTN1"
FT                   /protein_id="ADJ41997.1"
FT                   /translation="MAAIPELALRQIERWCAQRVPEHLQDRIRVECRPRGRAVTIVELR
FT                   APWSPQAGPDWSEQKIAQLRFDEFGIWSVWWADRNGKWLSYPDAPVASTPPALLAEIDR
FT                   NPGGVFWG"
FT   gene            complement(186546..186863)
FT                   /locus_tag="AMED_0174"
FT   CDS_pept        complement(186546..186863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0174"
FT                   /product="MazG nucleotide pyrophosphohydrolase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41998"
FT                   /db_xref="GOA:A0A0H3CUP0"
FT                   /db_xref="InterPro:IPR025984"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUP0"
FT                   /protein_id="ADJ41998.1"
FT                   /translation="MTFDDVTQRLRGFAAARAWEPYHTPKNLVMALSGEVGELTSLFQW
FT                   LTPEESDAWREDPALEGKVLDEIADVTLYLLQLADRLDVDLAAAAHAKIDRNEVRFPPP
FT                   A"
FT   gene            186999..187919
FT                   /locus_tag="AMED_0175"
FT   CDS_pept        186999..187919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ41999"
FT                   /db_xref="GOA:A0A0H3CVP8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVP8"
FT                   /protein_id="ADJ41999.1"
FT                   /translation="MKYLRSVRGRMLGIAFIPGGALVAVALVIAILLIHQAVRTRDTAV
FT                   ETAAAADRTARAVVALQAERSAAMAVPEQRSAAYATYTQRIESAIAGLRDYARHAPDAE
FT                   SACQQTTAVELLSVAEGMDRSDSLALAGLDNVTRGSFTSAVASYRTELARVVPQLTESG
FT                   RMAYDSLTRSAEWSRLAATENAFTAAEPLPVPEPTWRSSSYAVSAQLGLLYTQQSQYAV
FT                   QLTLDDGRRTLAGALAAGTALLLFAGLLMVVVRRLVARVPVPVVPIMVPTVHAAIPRPR
FT                   HARSRRPGLPDPWPLKAVFDDLRRR"
FT   gene            188047..189336
FT                   /locus_tag="AMED_0176"
FT   CDS_pept        188047..189336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0176"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42000"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVD3"
FT                   /protein_id="ADJ42000.1"
FT                   /translation="MDAETLADLLHAQAERDPELRHSLELRAATQSGDVTEAAHRLLDT
FT                   AVTDGNVEYTAKIGAVLDTLQRMLDAGSRADLAPLARRTVDDISEVLEQSGDHAGDLAD
FT                   RLDRAVELYARACAARPPDPEKLADWILEVEFDGPGRPVIDLAEFATALGEPGLKRIKS
FT                   TVDDVLAANGPGHRRDVAERLREQLAEVLGDVDELVAILSAKPPRVDVSLKIVRVLRAA
FT                   GRHSEAIAHAARALTHDKQPSPPEPESETSRRRKEFDAKPDRETFAALREAATADGKWT
FT                   VQRRDALACLRERAAEGVQQADELVRVLLDDGRPDEAWRACVRFGASAELKLELAEQRA
FT                   AEHPAETIPVFREHVDELIERKDPQAYQEAARRLKLLRTLHKRAETADEFTAYLAALVE
FT                   NHRRKTRLITEIRAARIAMPKAVTSPRTPR"
FT   gene            189563..191071
FT                   /locus_tag="AMED_0177"
FT   CDS_pept        189563..191071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0177"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42001"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXE2"
FT                   /protein_id="ADJ42001.1"
FT                   /translation="MSPVSRARKKAPQPVTHSVTGLFKDVLNDFSALGADPAPADVELL
FT                   ASEVLGQFHDLPVEDGEEPLGLELIAFAQRKITPGAAALLAALKVVAETDVERKAADAG
FT                   LQVVLGRGIPAPPWADGLGRVTAGECWRTGDVYGDESSLLCVFSHGDQAYGLLALLDFT
FT                   EGGRVRDLVVIDQPADVIAEMREQSDADPELVLFEAVDPAEAHRLIADGLAATDHLDEA
FT                   DVSEDYARFHAVALTWCRALPEPALVPEVAEWSDTERAAVVEQFVAASGEDADAARAIG
FT                   GLLLEHGLRTDPGNPLRVGPEKIARFLEGLLGEEYELDADHEDAVEPVVLAWVQWTGER
FT                   AHLTETAIAALDEAVSDYLSEYGDDDDSPLERYFADTADLSPTELADALERRMFAVPSL
FT                   TTEIDEEEVDLDPTDPDQRRALVIAEADEDEEERRLILRATIVDQLWDNEPAEVWPAVE
FT                   RLQEGELDRDEIFEQLIDTLENSLLDGENLEYDEDAYVEALAEL"
FT   gene            complement(191514..192446)
FT                   /gene="coaA"
FT                   /locus_tag="AMED_0179"
FT   CDS_pept        complement(191514..192446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaA"
FT                   /locus_tag="AMED_0179"
FT                   /product="type I pantothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42002"
FT                   /db_xref="GOA:A0A0H3CTN6"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTN6"
FT                   /protein_id="ADJ42002.1"
FT                   /translation="MTRVRELSPYVELHREQWKELRSSTPLPLTAAELLRLRGLGEQVD
FT                   LAEVADVYLPLSRLINLQVAARQRLYEATTTFLGDDSRGTKVPFVIGIAGSVAVGKSTT
FT                   ARLLRTLLARWPDHPRVDLVTTDGFLYPRAELMRRGIMHRKGFPESYDRRALLRFVTEV
FT                   KSGAERVAAPVYSHLAYDILPGQEQVVQQPDILIVEGLNVLQPGPRLMVSDLFDFSIYV
FT                   DAHTDDIQRWYVERFLELRHTAFADPASHFHHFAGLPDDEARAEARHLWHSINEPNLME
FT                   NIKPTRPRATLVLRKDCDHAINRVRLRKL"
FT   gene            complement(192559..193179)
FT                   /locus_tag="AMED_0180"
FT   CDS_pept        complement(192559..193179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0180"
FT                   /product="phage tail assembly-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42003"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUP4"
FT                   /protein_id="ADJ42003.1"
FT                   /translation="MTAESGTHAGREGAKPQVAPRAPELVLCAVDEPLADAWTAAAQKL
FT                   AGRVRVHRGSVLDVVAQAVVSPANSYGWMRGGIDAVYARAFPGVEQSVRSAVLAFHGGE
FT                   LPIGDAVVVPTGEAEPAWLISAPTMREPGELLPADTVHPYLAARAVFLTWRDGRLDHGP
FT                   VREFVHTIAMPGLGTGVGGVAPATCARQVAAAWDEVFGNRDAR"
FT   gene            193278..194186
FT                   /gene="pheA"
FT                   /locus_tag="AMED_0181"
FT   CDS_pept        193278..194186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheA"
FT                   /locus_tag="AMED_0181"
FT                   /product="prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42004"
FT                   /db_xref="GOA:A0A0H3CVQ3"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVQ3"
FT                   /protein_id="ADJ42004.1"
FT                   /translation="MSRIAYFGPRGTFTEQAARVLAPGEELIPVETIRQAMTAVREGAA
FT                   DAACVPIENSVEGVVPATLDALSESAPLVAVAETILPIHFSVLTRPGNPEIRTVASHPH
FT                   ALAQVREWLDANLPGANAVASSSTSAAAVGVLEGDFDAAVCAPVAVEHYALDVLATEVA
FT                   DVTDAATRFLLVRRPGELPEPTGADRTSVVAAAANRTGTLAELLTELASRGINLTRLDA
FT                   RPTRSNFGEYRFFIDFEGHVAEPRVLDALTALRRHCRNLRFLGSHPRADGVPTTIEPGF
FT                   GNDDFLEAAAWADAVRKGAQA"
FT   gene            194183..194800
FT                   /locus_tag="AMED_0182"
FT   CDS_pept        194183..194800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0182"
FT                   /product="phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42005"
FT                   /db_xref="GOA:A0A0H3CVD7"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVD7"
FT                   /protein_id="ADJ42005.1"
FT                   /translation="MRLLLIRHGQTDGNVRGALDTALPGPPLTDLGRRQATDLAARLAE
FT                   EPLVAVYASQATRAQQTAAPLAARFSVDVQVVDGVHEVVAGDLEGATDHASIRTYMDTV
FT                   RRWTLGELAPSLPGGESGTSVRTRMLDAVGRLRAKHEQADPDGVIALVSHGGAIRLTAE
FT                   WLAPNVHADVANAALIPNTGLVELVAQPDGRWRCLTWVDTPL"
FT   gene            194918..195559
FT                   /locus_tag="AMED_0183"
FT   CDS_pept        194918..195559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0183"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42006"
FT                   /db_xref="InterPro:IPR025326"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXE8"
FT                   /protein_id="ADJ42006.1"
FT                   /translation="MDMKLSRLFPVVAASAGALALSACGGGGTTNAANSSTPSTSATPT
FT                   ATTTVTTATPSPTSTPVAPPPAAQPADDGLCKSGDVKLSLGQGDSGAGSTFRPLLITNS
FT                   GGKPCTIQGFPGVSYVAGSDGHQVGKDAFREGTKGNAVKLNPGQTAAADIQFVNVRNFD
FT                   PGTCQPTPVKGLRIYLPQETASNFVPADGTGCAGTKIPGNQLAVKTVHPA"
FT   gene            complement(195582..196058)
FT                   /locus_tag="AMED_0184"
FT   CDS_pept        complement(195582..196058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42007"
FT                   /db_xref="GOA:A0A0H3CTP1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTP1"
FT                   /protein_id="ADJ42007.1"
FT                   /translation="MRTVDPGTGTDADPDFDESPAESESKPPPPARRLLVVCAVAGFLL
FT                   GGGVLGLLWGLSGVHAGALEDAVAACQALDRVGELPDTSRDAQPALTPGLSSERLHRMV
FT                   AARELAAAAAQVNANYQPLADQIDGVSRMVLSLHFNDISGQRHLTEAKEICGRI"
FT   gene            complement(196098..197345)
FT                   /locus_tag="AMED_0185"
FT   CDS_pept        complement(196098..197345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0185"
FT                   /product="major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42008"
FT                   /db_xref="GOA:A0A0H3CUP8"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUP8"
FT                   /protein_id="ADJ42008.1"
FT                   /translation="MVNARRLTWLLTSSAASHLGDGIGKVALPLLATTLTRDPVLIAGL
FT                   SATQFLPWLLFAAVAGALVDRIDRRRAMIVANTARAAAVGVLAVLVATGGMTIWLVYLT
FT                   ALIIGTAETIADSAANALIPAVVGDGSLDAANSKLQACEIVGQTFLGGPVGSLTFALFA
FT                   AFPFILNSVGFAIAAAVLLGLAGTYRGQAEAPVEPAKLRTELADGLRWLRRRPLLLRLV
FT                   VVAGLLSLVSELAQAQLVLYALEDLHLSDATFGFFAFVGGIGGLLGAGVTPRLVRAAGR
FT                   LAVVTGGIVCCGLGFGGMGLVRSPVAGAALFGLFAAAVVAVNVVLATARHTLVPGELLG
FT                   RVLGVWRTVVWGAIPLGALLGGVLTERLGSAARTFVVSGAAMLAIAAFAFGTLRRGRLG
FT                   DESDSAAALTHHDPGL"
FT   gene            complement(197447..197797)
FT                   /locus_tag="AMED_0186"
FT   CDS_pept        complement(197447..197797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0186"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42009"
FT                   /db_xref="InterPro:IPR010428"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVQ8"
FT                   /protein_id="ADJ42009.1"
FT                   /translation="MPVEMSREQFEELVSEALDEVPPEFARAMDNVVVLVEEFNDEAPD
FT                   ILGLYHGIALTERTSSYGGVLPDRISIYRQPILAMCEDEDEVVEEVLITVVHELGHHFG
FT                   IDDARLHELGWG"
FT   gene            complement(197797..198825)
FT                   /locus_tag="AMED_0187"
FT   CDS_pept        complement(197797..198825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0187"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42010"
FT                   /db_xref="GOA:A0A0H3CVE2"
FT                   /db_xref="InterPro:IPR026004"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVE2"
FT                   /protein_id="ADJ42010.1"
FT                   /translation="MSPSADRFPTATQTLRTRVVMGGIFAGALIALALSVVFSWSDGVI
FT                   GGAGGGAGKLSAAAQEAFHSPPGSCLTWDNPDASDARKVACTQPHLFEVTTLVDIGAQY
FT                   PAGAPVPSLDQWQQIAQQKCTADVKPYLGHKLDPYGKLTTNLLRPTPSQWEDGDRQLRC
FT                   GLQWAAPGGKLLPTTGPAKEQDQSLVFEPGTCLALRGKGVGDPIDCAKPHSYEIIATLD
FT                   LKTNFKDGYPAQDNQKSWLDTECTKAAADYTGGADLEAKKVILTWDLREQESWDAGSTK
FT                   VNCKVASVLPDKSGLQAVTGSVKAAPAAPDGGQPQDGGPPSDGGGGAATPNPAPSTAKQ
FT                   GG"
FT   gene            199085..199624
FT                   /locus_tag="AMED_0188"
FT   CDS_pept        199085..199624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0188"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42011"
FT                   /db_xref="GOA:A0A0H3CXF2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXF2"
FT                   /protein_id="ADJ42011.1"
FT                   /translation="MRFQDSNTRPKEPSLAEQRARQQALVQEERDEELARQADAKAATR
FT                   RKILIGSGVTVGLVGLVATFYTVAKPTEVTAVCTDSNGVVQNDDNCDENYVTSHGGHVS
FT                   GGFLFLPIGGGGFNSYRYNYGGYGTIGQRVSGGSYDPPSTRANVTTKTGKSVQRGGFGI
FT                   SGKSGGTGGSGKSGGS"
FT   gene            199625..200791
FT                   /locus_tag="AMED_0189"
FT   CDS_pept        199625..200791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0189"
FT                   /product="glutathionylspermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42012"
FT                   /db_xref="InterPro:IPR005494"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTP7"
FT                   /protein_id="ADJ42012.1"
FT                   /translation="MYRDRREPRRDWQRIVEEQGLVYGTPARDSSGRVRPYWDESVHYV
FT                   FDMDEVLSLEADVELLHSMCLEAVDNVVTTEGYQRFGIPEWVWPHIAESWKRQDPHVYG
FT                   RFDLRYDGKSPAKLLEYNADTPTTLLEASLLQWHWKTDVFPDDDQWNSIHEKLVERWSF
FT                   LRDKLPSNELHFTWSAADPSGEDNVTTAYLQETAAEAGLDTVGLAIEEIGWDPVLKRFV
FT                   DLEEQQMATVLKLYPWEWVVDEEFGRHAVESLPRTLWIEPLWKMILSNKTLLAILWENY
FT                   PGHPNLLPAFADDPGILTEYVRKPKLGREGANVQIVATGYETQTDGVYGAEGFVYQAFD
FT                   PLPEFDGYRPALGAWIVGDSSAGLGIRETGGLVTDDGAAFVPHRIVES"
FT   gene            200836..201288
FT                   /locus_tag="AMED_0190"
FT   CDS_pept        200836..201288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0190"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42013"
FT                   /db_xref="GOA:A0A0H3CUQ1"
FT                   /db_xref="InterPro:IPR007140"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUQ1"
FT                   /protein_id="ADJ42013.1"
FT                   /translation="MNTTLALSDTFGSDLVRGIGAILLYGVIGLLLMFAGFYAIDWTTP
FT                   GKLSKLVHAGLPNAVIVTASGLLAMSFIVVVAIFNSASDLTEGLITSLVYGLLGIAVQV
FT                   IAVRLLEWATRIDVASTIESEKFAPVSVVVAAAHIGLGLVVAVGIS"
FT   gene            201319..202233
FT                   /gene="dhaA"
FT                   /locus_tag="AMED_0191"
FT   CDS_pept        201319..202233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dhaA"
FT                   /locus_tag="AMED_0191"
FT                   /product="haloalkane dehalogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42014"
FT                   /db_xref="GOA:A0A0H3CVR3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVR3"
FT                   /protein_id="ADJ42014.1"
FT                   /translation="MGIVRLLRTPDDRFTDLPDFPFEPHYAELDDPHDGRIRVGYVEAG
FT                   PADGPVVLLLHGEPSWSFLYRKMLPVLASAGLRAIAPDLVGFGRSDKPANQADHTYARH
FT                   VEWMRGFAFEALDLHDVTLVGQDWGGLIGLRLVAEHPTRFARVVASNTGLPSGDHDMPA
FT                   VWHAFREAVEKAPVLDVARFVQSGCRSSLSDAERAAYDAPFPNESYKAGPRAMPGLVPY
FT                   RPDNPATEANRAAWKTLTELEIPFLVAFSDGDPITGALAPILQRSMKGAQGLEHPVIAG
FT                   AGHFLQEDAGEELAEHVARFVRG"
FT   gene            complement(202573..203865)
FT                   /locus_tag="AMED_0192"
FT   CDS_pept        complement(202573..203865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0192"
FT                   /product="aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42015"
FT                   /db_xref="GOA:A0A0H3CVE7"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVE7"
FT                   /protein_id="ADJ42015.1"
FT                   /translation="MTDELLARHRAVMPSWMSLLYEEPIEIVHAHDRRMTDSQGRTYLD
FT                   FFAGVLTNSMGYDVAEIGDAVRKQLDTGILHTSTLYLIRSQVELAERIAKLSNIPDAKV
FT                   FFTNSGSEANDTALMLATQYRRSNQVLAMRNSYHGRSFATVAITGNRGWSASSLSPVKV
FT                   SYVHGGYRYRSPFRTMSDADYIDACVADLVDVLDTATAGDVACLIAEPIQGVGGFSLPP
FT                   DGLFRAMKEVLDEYGVLFISDEVQTGWGRTGEHFWGIEAHGVTPDMMTFAKGLGNGLAV
FT                   GGVVARGDVLDCFQAQSFSTFGGNPVSMAGATAVLDYIKDHDLQANCAARGAQLLSGLR
FT                   AAESPIVAEVRGKGLMIGVELIKPGTTEPFVAAAARMLEETKKRGLLIGKGGLHGNVLR
FT                   LGPPMTLTAEEAQEGLDILVDALAATHAALS"
FT   gene            204062..205246
FT                   /gene="serS"
FT                   /locus_tag="AMED_0193"
FT   CDS_pept        204062..205246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="AMED_0193"
FT                   /product="seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42016"
FT                   /db_xref="GOA:A0A0H3CXF6"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXF6"
FT                   /protein_id="ADJ42016.1"
FT                   /translation="MVDKLLSLDARRRSSIAAADKLRNEQKLLGKQIPKAPPEEKQQLL
FT                   ATAKELAAQVKAAEVEQNTASEEFDQLFRTVPNLVHPDAPVGGEDDFTVVKHVGEPTKL
FT                   GFTPKDHLELLEALGGVDMERGAKVSGSRFYFLTGVGAQLQLGLLNMAIAQALENGFTP
FT                   MITPSLVRPEIMAGTGFLGQHSSEIYHLADDDLYLVGTSEVPLAGFHADEILDLNDGPN
FT                   RYAGWSSCYRREAGSYGKDTRGIIRVHQFDKVEMFVYAKPADAEAEHERLLGWEEQMLA
FT                   KIEVPYRVIDTATGDLGTSAHRKFDCEAWIPTQETYRELTSTSNCTTFQARRLAIRYRD
FT                   DNGKPQIAATLNGTLATTRWIVAIVENHQQEDGSVRVPEALRPFVGGKEVLTPR"
FT   gene            205311..206312
FT                   /locus_tag="AMED_0194"
FT   CDS_pept        205311..206312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42017"
FT                   /db_xref="InterPro:IPR024520"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTQ1"
FT                   /protein_id="ADJ42017.1"
FT                   /translation="MRNRWQVAAALAAVTVVTGCTVTVGGSASPVPGQGPVAQAVDACT
FT                   LLDQAQVDALGYQSPGRSVPENKERLQPPMCLWNSKDDIEPSAVLNVGLASDMDFNEYI
FT                   SGAVKKSEPQPVGGLNWTQYASILPDDCAFYALLGAKSFAYVSVSAGKLDRSCELAKTV
FT                   IPQVAAHLPGGQDAPPLTPSTSAKPEPGGPLLSADPCAALKPEQVAQLKDISPTGEKDT
FT                   SSTVPNASYCLWDDTDGDGGQKAFEVWFGPSTPVGEWPGAKGVNPAETVDVGGRKWGLF
FT                   PNMGGLRVTCGATLAITDTSSVQVVSGFIGDEAKTCDLVKQGLPLVTANLPG"
FT   gene            complement(206309..207496)
FT                   /locus_tag="AMED_0195"
FT   CDS_pept        complement(206309..207496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0195"
FT                   /product="FAD-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42018"
FT                   /db_xref="GOA:A0A0H3CUQ5"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUQ5"
FT                   /protein_id="ADJ42018.1"
FT                   /translation="MRNVVVVGGGIVGLAVAWELTRRGLDVTVLEKESRWAAHQTGHNS
FT                   NVVHAGLYYKPGSFKARMSVAGNRSIVDFARQYGVPVEVCGKLVVATHEREIPALNTLA
FT                   ERAEANGVPAKQISPAEAREYEPEVACVAALRVESTGIIDFPAVCHALVRLLDEAGVDL
FT                   RLNSPAVAIRAGSNGGVEVATGDDVVQADALVNCAGLHSDRVARLAGLTPSAKIVPFRG
FT                   EYYELKPDRRHLVKGLIYPVPDPTLPFLGVHLTRMLDGSVHAGPNAVLALRREGYRWGD
FT                   FSAKDVAEVAAFPGVWRLARKYAFPTGLDEVRRSFSKKRFAASLARLVPAVTEDDIVRH
FT                   GSGVRAQAMRRDGSLVDDFLIETARDQVHVLNAPSPAATSALEIARHIADQVSEG"
FT   gene            207575..208183
FT                   /locus_tag="AMED_0196"
FT   CDS_pept        207575..208183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0196"
FT                   /product="TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42019"
FT                   /db_xref="GOA:A0A0H3CVR7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVR7"
FT                   /protein_id="ADJ42019.1"
FT                   /translation="MSGKRLTREARRERILAAAGEVFASSGYDAAGMREVAAAAGISTP
FT                   VLYDHFPAKAQLYAALLESEVDGLLTGWAALPASDDPEVLLRSRVSAIFQWIEANERGR
FT                   RMIFAEAPSDPAVAAVHRRGQARATDRLASLFHGVPLELTSRIPRPLADEVLAEACKSA
FT                   LNSIATWWWDHREIPRDEVVALTVDLLWRGLATLIKGER"
FT   gene            208180..208665
FT                   /locus_tag="AMED_0197"
FT   CDS_pept        208180..208665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0197"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42020"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVF4"
FT                   /protein_id="ADJ42020.1"
FT                   /translation="MSTETYRRAAETRDVELAMTAFAPDAVLHSPLTSRVRFTGHAELR
FT                   PLIEVAYRHLEDISFHTDVGDARTRVVVYTARIGGEPIEEATLVRLNDDGLIEEATLFV
FT                   RTLPGLVALMDRFGPDLARENGRPVVARVLGVLVKPLLAMVRSGDRRAVPLVSGRGA"
FT   gene            complement(208688..209548)
FT                   /locus_tag="AMED_0198"
FT   CDS_pept        complement(208688..209548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0198"
FT                   /product="XRE family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42021"
FT                   /db_xref="GOA:A0A0H3CXG0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXG0"
FT                   /protein_id="ADJ42021.1"
FT                   /translation="MPKTDTVTPRARTLAAAIREVRTDAGCGLRELARRIGIHFQLLSQ
FT                   WEYGLRNPRLEDVTAILGALGVVGDRKQRILALTRGASEPGWITYGTAGMQLAAVIECE
FT                   KAAKSIVEWSPMGIPGLLQTPGYARAMFTAYGRTAEEVDRKVALRMKRAEMLAADRTFE
FT                   AIIGEAALRDRIGTPTTMFDQLHSLIEKSTRSVTLRVVPAACGWHPGLAGPFLLYSLTD
FT                   GTSVVYLEHLSCGAFVLDGHDVGVYRAGLKKLRALAMSATESTAFIARLADEIEGVELS
FT                   ALAGE"
FT   gene            complement(209558..212659)
FT                   /locus_tag="AMED_0199"
FT   CDS_pept        complement(209558..212659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0199"
FT                   /product="SARP family transcriptional regulator fused with
FT                   ATPase domain"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42022"
FT                   /db_xref="GOA:A0A0H3CTQ6"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTQ6"
FT                   /protein_id="ADJ42022.1"
FT                   /translation="MRFGVLGAVAAWRPDGTQVAVGGPRSRTLLALLALDAGRFVPAER
FT                   LIDGMYGEHPPDGAANALQSQVSRLRTALKDLAPVEFTAAGYRLAVAPDEVDVHCFERL
FT                   TRAGRALLKNGEHGRAAEVLGEALALWRGPAFTDLADAPFAATQATRLEELRADAADDH
FT                   VEARLALGQAEDVLAGLRETVAAQPLRERPRAQLVRALAAAGRPADALAAFEDARRTLA
FT                   DELGADPGPELAEAHLAVLRGETEKPVLPALPAQLTTFVGRDAELRQVTELLARARLVT
FT                   LTGPGGTGKTRLAIEVAAAQAGPVAFVELAPHGGADVAGAVLAALGLRESSRGGPQDPV
FT                   ERLVPALRDRPVLLVLDNCEHVVDVAARLAARLLAACPGLRVLATSREPLGITGEQLAP
FT                   VPRLAVPPPGTAAAQASAFAAIRLFAERAAASDPAFALDESTIGDVQHVCAALDGLPLA
FT                   LELAAARVRTLDLGEIAARLDDRFRLLARGSRTAAARHRSLRGVVEWSWDLLTGEERSL
FT                   ARRFAVFSGGATAAAAAEVCGADVDLLPELADKSLVEAVGGRFRMLETIRAFGGEKLAE
FT                   AGEAEKFHRAHAEYFLRFAAEADPMLRTAEQLEWLARIDADYDNILAALRWSTENDVAL
FT                   ALRLVPSLAMYWWMRGRRFEGAGLSLAVVSRCSPELREEYAEEFLVCVLGALAGQRHES
FT                   LEQYLPLVRRYATDGSWAPRNPMLVMLLGVVAGPPGDDAERLGHGLLAAGDAWGWALLP
FT                   MGKGLRAMMSGDLAGAEEGLREGAAQFRALGERWGLSMALDHLSQLLTWRGEYAAALPL
FT                   MDEALGLMHEIGATDDVADLVCRRAWTHLLSGDHARARADYELAAATARRSGMPESRAA
FT                   AYVGSANLARLSGDLAAARELCERALAECPGGSFSSETVRATALIALGWLALAEGDRSS
FT                   AVSLHRSAVLIGRQWNASDVVAFALEGLAGAAQPAPAAVLLGAAAAIRGTEISGPDVTA
FT                   VRGRLVASLGVDGFERAYRTGLGMSAQKALEHSIEGEVSTSSDT"
FT   gene            212823..213920
FT                   /locus_tag="AMED_0200"
FT   CDS_pept        212823..213920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0200"
FT                   /product="pyridoxal phosphate-dependent aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42023"
FT                   /db_xref="GOA:A0A0H3CUR0"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUR0"
FT                   /protein_id="ADJ42023.1"
FT                   /translation="MGEEELAAVAEVFRSGWLAGAGPACRRFEERFAEVTGTAHALTTA
FT                   NCGSALFLGLKVLGVQPGDEVIVGDYTFPATGHAVVQAGAKPVFADIRPDVFSADPAHV
FT                   EALITPKTVGILAVDVAGQPGDFDEYRAIAGKHGLWLFEDAACAAGATYKTRPAGSLAD
FT                   LAAFSFHGRKGITAGEGGALVSDREDLIAHARKLHTYGIEPAISREGSDTLPIPEFHEL
FT                   GYNFRLSDVQAAIMNVQLDRLPDLLAARRSVAKRYHEAFDDVDALTVPVALSDREHPWQ
FT                   AYLLTVAPAVSRDTVAMRIREQGVQCNFGTYASHLQPIYGPQAPLPVSADAFARQLAIP
FT                   MHANLTDAEVTRVAEVVREAVQSLS"
FT   gene            213944..214873
FT                   /gene="galE"
FT                   /locus_tag="AMED_0201"
FT   CDS_pept        213944..214873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE"
FT                   /locus_tag="AMED_0201"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42024"
FT                   /db_xref="GOA:A0A0H3CVS2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVS2"
FT                   /protein_id="ADJ42024.1"
FT                   /translation="MSDKKVLFTGGGGFIAAHVIPLLLEGGYTVRIFDNMTRGDRARVN
FT                   EFVATGQVELVEKDVRYGGAVREAMRGCTHVIHFATVSINKSIADPHESIDINMIGNHN
FT                   VFAAAADEGVERLVFASTASVYGDPKRLPMHEDDELRPLTPYCISKRAGEDLLGFYERQ
FT                   KGLSWNALRFFNVYGPGQKIEAYYTSVINHFIQRLRAGQPPIIDGRGDQSMDFVHVTDL
FT                   AKAVVAALESERANLPINIGTGIDTSIAALAKILIEAVGVDVEPLFNERDVLVSRRAAD
FT                   ISRARDVLGWEPRITVEDGMRDLVRETE"
FT   gene            214906..216102
FT                   /locus_tag="AMED_0202"
FT   CDS_pept        214906..216102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0202"
FT                   /product="glucosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42025"
FT                   /db_xref="GOA:A0A0H3CVF9"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVF9"
FT                   /protein_id="ADJ42025.1"
FT                   /translation="MRIAVVNNFFPPRVGGSAHMAASLAGQFAAAGHEVLAITAAYGEA
FT                   PAEEERDGYRVVRLPAVKMPQIGLSIDFDMSFASLRPGNWRRLWKLLDEFKPDAIHLHG
FT                   QFFDLSWLAGIWARRHDVPALLTIHTLLISDNKLYGGVFRLLDAVLVRPMLAYMKPRYV
FT                   ILDKLGVDYCVDRYGTSDANSEYFPIAVDTGHFAKPVTKDVRAEHGVGDAPLIVSLGHV
FT                   IPLRNRLPLIEALPSILDKHPGVRVVVVGRVYHDAFLKRAAELGVSDALVVTGAVPKED
FT                   VPAYFAAADIVTHDLNGGCGTASLEAMLSGTATIASVTEDNYPGIELRNGENVLLVRPD
FT                   DAEAVARTVIGLLDDPARRALIAQRESELVRSNFGLDVVAEEHLRTFEKLVSEADVLR"
FT   gene            216089..216715
FT                   /gene="maa"
FT                   /locus_tag="AMED_0203"
FT   CDS_pept        216089..216715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maa"
FT                   /locus_tag="AMED_0203"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42026"
FT                   /db_xref="GOA:A0A0H3CXG4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXG4"
FT                   /protein_id="ADJ42026.1"
FT                   /translation="MFFDDERSHRLRPQILTELVSQYMNDAERAQFYGLPSTCRVRERV
FT                   KIISPENLKMGEHCWIGEGAALDASGGLEIGEHTSIGLNTLIFTHSSWLANMTLQNHSG
FT                   SDLIERKPVKIGKGCFIGGLVVIMAGVTIGDFATVQPNSVVAKDVPPRTLVAGNPARVF
FT                   QRYDEEYIQSEVDRVRAENARRRAIAEERGSDASGWGAPSGDFSE"
FT   gene            216981..217493
FT                   /gene="rpoE"
FT                   /locus_tag="AMED_0204"
FT   CDS_pept        216981..217493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoE"
FT                   /locus_tag="AMED_0204"
FT                   /product="RNA polymerase ECF sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42027"
FT                   /db_xref="GOA:A0A0H3CTR1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTR1"
FT                   /protein_id="ADJ42027.1"
FT                   /translation="MARGDEEFAEFVRASSARLTHAAFLLTGDRHQAEDAAQTAFTRTY
FT                   AAWSRVRHKDAYGYARTVLVNHVIDGWRRPIREYATEAMPERPDRFDVDKAVTQRAWLT
FT                   AVLKTLTARERAVVVLRHFFDLPEADVARELGVSLGTVKSTNSRALAKLRLVAADPENT
FT                   LIGRSGR"
FT   gene            217490..218200
FT                   /locus_tag="AMED_0205"
FT   CDS_pept        217490..218200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42028"
FT                   /db_xref="GOA:A0A0H3CUR4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUR4"
FT                   /protein_id="ADJ42028.1"
FT                   /translation="MNDLDDFRAALRQPPGEPFAEPDLARIMADGTRLRRRRRLLTGTA
FT                   GIAAAAAVVLVVVLAIQLRQPVSAPVAQPPSPAPAVSTTSAAPPAEQPIGDVIGTGIRT
FT                   QSGELVFYARAVDAPELPDIRFGLVAGFRSGTSLQSVLATNEVRGSDRSFGFHATDGGE
FT                   VIRDQLIPVFGYFAGPAAKITTTVHGQTVEAHLAKWTADPKVVIFWFDPAAVPDSAVLT
FT                   PLVAYDTDGKRLTR"
FT   gene            218241..219626
FT                   /locus_tag="AMED_0206"
FT   CDS_pept        218241..219626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0206"
FT                   /product="predicted aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42029"
FT                   /db_xref="GOA:A0A0H3CVS6"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVS6"
FT                   /protein_id="ADJ42029.1"
FT                   /translation="MASRRAFLTASAALGMVAAVPAGAAELGDRGPGVPVRPQRPDAEL
FT                   RALLRQVDERRIEATVRRLAAFGTRHTLSAQDDPVRGTGAARDWLFAQFQQVAAASGGR
FT                   LSVELQSYVQPPADRIPVPTKITNVVATLRGATDLGRVYVVSGHYDSRRTDVMDFTGDA
FT                   PGADDDASGVALALELARVLSTRQPAATIVFAAVAGEEQGLYGSRYMAQQFKAAGTDVQ
FT                   AMFTDDIVGSSRADDGTRDPFTIRLFAEGVPTAETPAEASLRRSIGGENDSPPRQLARF
FT                   VKAVAENDATGMTVRVIYRRDRYLRGGDHIGFLEQGYPAARFTEPNEDYAHQHQDVRVE
FT                   NGVRYGDLPEFCDFPFIARVARVNGAALWSLATAPGTPKGAKIRTTALTNDSELLWDAT
FT                   PGATSYEVVWRETTAPDWTHAIDVGPALTAKIDLSKDNVFFGVRAVGPGGRRSPAAFPA
FT                   PVS"
FT   gene            complement(219623..220579)
FT                   /locus_tag="AMED_0207"
FT   CDS_pept        complement(219623..220579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0207"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42030"
FT                   /db_xref="GOA:A0A0H3CVG4"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVG4"
FT                   /protein_id="ADJ42030.1"
FT                   /translation="MTHRIALVGTGNMGSLHARVLAGNERVDLVRVIDPREEAGKAVAE
FT                   RYETQWTPEIGELSDVDAVVLASATEVHYDLAQEIFRQGKPMLVEKPVCNSFEKSQEIV
FT                   ALSAKNDIPLMCGLLERYNPAVMTARALVQEPIHLMARRHGPYAPRIKTGVAWDLLVHD
FT                   VDLAIQFFGGATPSRVTSGAGYFHPQSVEGAEDTIETVLSFPTGLATVSASRLGQRKVR
FT                   SLMVSELDRLIEIDLLRRDVTIYRHISHDSVTPDGLGYRQQTVIEIPELVTAREPLATQ
FT                   LDRFCDLLEGKIDADTERDLILPSHHVVEQVLTQAAA"
FT   gene            complement(220576..221682)
FT                   /locus_tag="AMED_0208"
FT   CDS_pept        complement(220576..221682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0208"
FT                   /product="aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42031"
FT                   /db_xref="GOA:A0A0H3CXG8"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXG8"
FT                   /protein_id="ADJ42031.1"
FT                   /translation="MIPITVVDVRDAEDLVVEVLRSGAIAQGPMVKRFEDAFAAVSGTK
FT                   HAIAVNNGTTALVAALQVLDLQPGDEVITSPFTFVATLNAILEAGATVRFADIRRDDFA
FT                   IDPDAVAKTVTDRTKVLMPVHLYGQTADMGKLAPLAAERGLHVIEDSAQAVGASFEGKP
FT                   AGSFGIGCFSLYATKNITTAEGGVITTDDDALADKLRVLRNQGMRARYQYEVAGHNYRM
FT                   TDLHAAVGIPQLAKLDQLTAARQANAKRLSEGLAGTPGLDLPQVLPGREHVWHQYTVLV
FT                   GPHAFLSRDELAAALTERGIGNGIYYPKIVFDYDCYAGHDLIPGARVEDFPVARAVSEQ
FT                   ALSLPVHPHLTESDLDTIIETVREVLGA"
FT   gene            221832..222551
FT                   /gene="lpxA"
FT                   /locus_tag="AMED_0209"
FT   CDS_pept        221832..222551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxA"
FT                   /locus_tag="AMED_0209"
FT                   /product="UDP-N-acetylglucosamine acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42032"
FT                   /db_xref="GOA:A0A0H3CTR6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTR6"
FT                   /protein_id="ADJ42032.1"
FT                   /translation="MANRIHPTAVVGAGVELGEDNVIGPFAVLAGPVRIGDGNWIGPHV
FT                   TIGTPGEDRSRPHPAAWEDTPTGDPDHDGHGVVIGSRNRIREYVSVHQGTWRTTTVGSD
FT                   GYYLRNSHIAHDCLVGDGVTIASNAVTGGHCHIWDGANLGMGAILHQKVVIGPGAMIGM
FT                   GSAVRREIGAFTIAVGNPARVTGVNVVGLSRRGLDEETIEALGPWLKGKEGLPDVTLPH
FT                   DLSTLVKAWDARPREEH"
FT   gene            222565..222837
FT                   /gene="acpP"
FT                   /locus_tag="AMED_0210"
FT   CDS_pept        222565..222837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpP"
FT                   /locus_tag="AMED_0210"
FT                   /product="acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42033"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUR8"
FT                   /protein_id="ADJ42033.1"
FT                   /translation="MSAELNAQAAGPLAPKLREVFVEALDLDGGVDVENLKYRDIEAWD
FT                   SVGHMALVAAIEDEFDVEFDTDQVIDMSSFKVAVDMVTELQSKND"
FT   gene            222839..223564
FT                   /gene="fabG"
FT                   /locus_tag="AMED_0211"
FT   CDS_pept        222839..223564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="AMED_0211"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42034"
FT                   /db_xref="GOA:A0A0H3CVS9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVS9"
FT                   /protein_id="ADJ42034.1"
FT                   /translation="MPLSGRVALVTGGTRGIGLATARVLVEAGATVVLTGRDEARAKEA
FT                   AASVGASGLALDVTDAKAVSSLVRGVAKEHGKLDIVVANAGIMEDALLGMIKEELVDTT
FT                   LSTNVAGTLHTVQAAARAMMRKKTGSIVVLASIVGEYGSAGQTVYAASKAAVANIARSA
FT                   AKELGRSGIRVNAVAPGVIETDLTAGLSEGAKAENSSRTPLGRLGRPEEVANAIRFLVS
FT                   DEASFITGQVLGIDGGLVL"
FT   gene            223561..224955
FT                   /locus_tag="AMED_0212"
FT   CDS_pept        223561..224955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0212"
FT                   /product="AMP-dependent acyl-CoA synthetase/AMP-acid
FT                   ligases II"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42035"
FT                   /db_xref="GOA:A0A0H3CVH0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVH0"
FT                   /protein_id="ADJ42035.1"
FT                   /translation="MTLLGAGARLVDVAGGRTLAGAELSAEVGRAGEALAALPAGVVFA
FT                   RMAVDLDSVLTYLGAFESGRAIALIDPALDADVLAGLVSRFRPAAVLSASGDAPDGYFV
FT                   RGDDWVRSSADGVVPHPDLAVLLPTSGSTGNPKLVRLSRQAILTNADAIAQVLHIDADE
FT                   VAPTCLPLHYSYGLSVLNSHLVRDATIVIEPSGVLGRGFWDAVNTHGVTSLSGVPYHYE
FT                   MLRRLKFDPAKYPTLRTLTQVGGKLRDELIAEFNDKMVAVGGRMYVMYGQTEASPRMTT
FT                   VPAERLAEKLGSAGPALPGGKFSVRRDDGSETTHPKIVGEVVYRGPNVMMGYADDESGL
FT                   AKGDEFGGVLATGDLGYLDQEGYLFITGRLKRIGKVFGNRVSLDDLEQAARTAAVGIDV
FT                   VAAVAAGDKVVLFAEGVDKDICKDASRALSERLHLHVSGFDVRPIDTVPLLASGKIDYR
FT                   SLEAKV"
FT   gene            224952..226004
FT                   /locus_tag="AMED_0213"
FT   CDS_pept        224952..226004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0213"
FT                   /product="acyl-protein synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42036"
FT                   /db_xref="GOA:A0A0H3CXH2"
FT                   /db_xref="InterPro:IPR007534"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXH2"
FT                   /protein_id="ADJ42036.1"
FT                   /translation="MSVFTRSTSDREALLLPELVSLTAHHRANSEGYDRILASLGIAPS
FT                   ASFGAIADLPWLPVRMFKTHDLKSVPDSEVFKTLTSSGTTGAGASRIYLDKEAAAAQTK
FT                   QLGATLQEVLGGERLPMLMVDTIGIIKNRRSFSARGAGVLGMANFGRKHTYVLDENDQP
FT                   DVEAVKKFLAEYGDKPFLIFGFTFMVWLYLYEVARDHDLDLSNGILIHSGGWKKLIDRA
FT                   VDNTEFRRRFKEDTGLTRIHNYYGMIEQIGTVFLEGPSGNSLYCPDFADVVIRNPETWE
FT                   EQPVGEPGVIEVVSTLPRSYPGHVLLTEDLGVCNGIDDGDWPGKHFSVLGRLPKAEARG
FT                   CSDTFSGAAA"
FT   gene            226001..227245
FT                   /locus_tag="AMED_0214"
FT   CDS_pept        226001..227245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0214"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42037"
FT                   /db_xref="GOA:A0A0H3CTS1"
FT                   /db_xref="InterPro:IPR008670"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTS1"
FT                   /protein_id="ADJ42037.1"
FT                   /translation="MTSLTQRFPTAPAVSVNDLVGELRAEPPGGRLKVGDPRIVEFVTK
FT                   FARKLLAPATARRFPELASLGFFLRKGEIAKALSTLDTSGTALRFPRGLVFHVPPANVD
FT                   TIFVYSWALSALAGNHNVVRVSSRSAGAAEAVLEALNAALSEVDPATAAAITATQRMVT
FT                   YDRSDEVSGALSLAADLRVIWGGDGSVAALRQYPLAPHARDLTFPDRSSFAVASVAGWQ
FT                   RASSEERRAAAEGFYNDSYWFDQAACSSPRAVFWVGDEPGARAAGQEFRELLAAVLETK
FT                   QHVTEPAMAVQKRVSAYGAAADGLVKEIAFQGNGLATLELTDPAVLPREWLGAGTFANA
FT                   RVPSLADLVPIVLRKDQTVSQFGFTAEELTAFAHELAGRGVDRIVPFGSALTFSAVWDG
FT                   YDLLSEFSRLVTVQA"
FT   gene            227258..228226
FT                   /locus_tag="AMED_0215"
FT   CDS_pept        227258..228226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0215"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42038"
FT                   /db_xref="GOA:A0A0H3CUS3"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUS3"
FT                   /protein_id="ADJ42038.1"
FT                   /translation="MTTVEDLPAAGKQPKSARAKILDVVRWVAILLVIGFAAKQLAANW
FT                   GEFWHTLRDVAWESSLLSLVALVAAILVSTWGWQMMVDDLGEPIGYARGAQICLVGSLG
FT                   KYVPGSVWAYLLQMELGRKAGLARARIFTGSLIQLGVGVVSALVVSLLAAPAVFSNSPR
FT                   ALWLFVLIPLGLAMLHPKILTWGTSLVLRILRRPPLQHPLGWRVIGKVFGASTAAWCLQ
FT                   GVHLWLLANSVGTPGLSGFVLCVGAMAVAMTVGTFAFILPSGVGVREVAQVAVLTASGL
FT                   TVGQATAFAVASRVMFTVADLLTAGFAAVAARSVRPAPTPA"
FT   gene            complement(228399..228611)
FT                   /locus_tag="AMED_0216"
FT   CDS_pept        complement(228399..228611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVT4"
FT                   /protein_id="ADJ42039.1"
FT                   /translation="MLLANRFRNYSTDPAVRAAVRRLNIHWVILGKPATDPGRPYQPGL
FT                   TGLAGEPFLTAVYRNPDAVIYRLVP"
FT   gene            complement(228668..229207)
FT                   /locus_tag="AMED_0217"
FT   CDS_pept        complement(228668..229207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0217"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42040"
FT                   /db_xref="GOA:A0A0H3CVH5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVH5"
FT                   /protein_id="ADJ42040.1"
FT                   /translation="MIAAPGLVIGLAAGLRGWVLAGMAPLLSYAAGGLTGPWAAAAGLS
FT                   FTPLTYAVSTVVFAAIAFGVRRWTVRHRRPAPDPGLWARRGHLAVLAGLLFATATGTAA
FT                   ALLGLGRIGALPQGFDAVYHGNAVRYIAATGDGSLFGTGHVNWYGDAAPVFYPNAYHLL
FT                   AAVTYRLGGVSIPETL"
FT   gene            229502..231319
FT                   /locus_tag="AMED_0218"
FT   CDS_pept        229502..231319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0218"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42041"
FT                   /db_xref="GOA:A0A0H3CXH9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXH9"
FT                   /protein_id="ADJ42041.1"
FT                   /translation="MVYAVVVAWLVVAAIVVLTWHRLDTDRGWRAFVLTLTLGLSLLHQ
FT                   LLFATVTEDALVTFRYAQNIADGNGPVFNPGERVEGYTNFSWLVLVALPRAAFGADVRT
FT                   TAVVFGVLAALGCVLVSCFLANRIVAAAAPDGAQPRPAIGVAAAVLTASAGGLAVYGAS
FT                   GSEVPLFVLLVLATGYALAARRPVVAGVLVAFAVMTSPEGLVIGVLAGLWLVGAALKRK
FT                   HSWWAPVGYVQGALVFLIPRLAWRATFYQHFLPAPLAAKLGGTLGERVAAGWPYLSGFA
FT                   LAHQGFLLLGLVAAVALVLRRTEPAVRGSRAAESPARGGTAAFRGTRAAEPPARGEAAA
FT                   FRGARAAESPARGDAVVGTAVEAKALLWLLFAMAAGLAAAAVLIGGDPGPSWRLLAPLP
FT                   PLLAVAAAGTYGVLTADAVGKPSPKPRAAGTLLVPVTACGLAGIAVLVSVFSPEMLDRV
FT                   RVWHSHGTELAEIGGWLGDYLPPGSVVSAAAPGALAAHGGQLLIIDVLGRTDDHIAREG
FT                   RHDGGIATDYDYVVNGRRPTVAVPADDGYADRQHCAIDPVYAGKYEVATFRRVGTPYWV
FT                   SVYPRAEQAKALVADLDKGPDFRYVPCPA"
FT   gene            231316..232794
FT                   /locus_tag="AMED_0219"
FT   CDS_pept        231316..232794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0219"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42042"
FT                   /db_xref="GOA:A0A0H3CTS6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTS6"
FT                   /protein_id="ADJ42042.1"
FT                   /translation="MKLEAPDRQLSAEARLGLGVFGTSLALFVVRFLVPRPIAMSNNGD
FT                   GGRVLCGAGITWKGLPEPFVHLAYPPAPGTPPCRPTYLLTQSWLADLAVRIGRLIGLHG
FT                   TLSLVILGLLSSVVAAAASTAIVLGLPHPRRTRLFVAAGLLLVVADSAFFGYFAAILGE
FT                   GAAFLGLLLAVGGLLLTAREGRWSHAGVAVTFVGGVLAVNAKVQTLTILPILALAILLV
FT                   RPGGRRGVRRWAPAVLVIGAIGAVTLFAQQSVEPARAPDGTYTAFPGDDSREINVFNSI
FT                   FLNIVDGKHDTRADLAELGLPPSFAQYAGNGWWHPHPATLDPLYPQYRDRISRRNVVTY
FT                   FATHPGRTLEVLNRAAADQLTARPGYLGSFDQSAGFPPHAQEYRVPVVSWLTGLLAPLG
FT                   LFALVPIWLFVLVRVWWQRRTALGVVLAFLFTVSVTQFGTAALGDGIEGVKHQAVALFT
FT                   ILLAVVLSIPRPTRVSSPALCSSPLNDGPQPTVA"
FT   gene            232804..233532
FT                   /locus_tag="AMED_0220"
FT   CDS_pept        232804..233532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0220"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42043"
FT                   /db_xref="GOA:A0A0H3CUS7"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUS7"
FT                   /protein_id="ADJ42043.1"
FT                   /translation="MADLVYPPVIAAARTMFRVLDNRIRIDGAEHIPRQGGAVIACNHV
FT                   SYLDFIFCGLGARPAKRLTRFMAKKEIFDNRIAGPLMRGMHHISVDRSAGLASYREALG
FT                   KLQAGEVVGVFPEATISRSFTVKEIKSGAVRMAAAANVPVVPMALWGTQRLWTKGRPKD
FT                   LTRRHVPVSILVGEPMHPAKGDDWDIVTKELRTRMSALLDRAQAEYPDRPASDEDRWWL
FT                   PAHLGGTAPTPAEAAELDRR"
FT   gene            complement(233537..234337)
FT                   /locus_tag="AMED_0221"
FT   CDS_pept        complement(233537..234337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0221"
FT                   /product="haloacid dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42044"
FT                   /db_xref="GOA:A0A0H3CVT8"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVT8"
FT                   /protein_id="ADJ42044.1"
FT                   /translation="MIASDVDGTLLGPSESLTGRTIATVRRVIEAGVPFVLASGRPPRW
FT                   IAPIAKPLELTGYAVCANGAVLYDCGREEIIEVHGLLAPTLLHDIAHALDKALPGCRLA
FT                   TERVSTGAVDHDMRNFVIEPDYHNPWGDGEGRTGPRAEVLGHPAIKLLVSHRGMASQEM
FT                   ADAVNALFDREVDVTYSSSGGLVEVSAHGITKATGLADVAERLEVDPEQVIAFGDMPND
FT                   VEMLRWAGHGVAMENAHPRLLAVADEVTGPAGEDGVAQVLERWF"
FT   gene            234434..235315
FT                   /locus_tag="AMED_0222"
FT   CDS_pept        234434..235315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0222"
FT                   /product="luciferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42045"
FT                   /db_xref="GOA:A0A0H3CVH9"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVH9"
FT                   /protein_id="ADJ42045.1"
FT                   /translation="MRVGIVILPEDRWWAAEPKWRAAEEYGFDHAWTYDHLGWRNLVDG
FT                   PWFSAIPTLTAAAMVTSRIRLGTFVASPVARHPVPFMRELNTLDDVSDGRLVLGVGAGV
FT                   DHHHYDGAVLDAPELTPKQRVDRFTEFVEALDGLLMTDKFDFDGEYYRAREARNLPGPV
FT                   QRPRLPFVVAANGPRTMTLAARFGAGWVTTGKGGATADEWWAGIKQLTEVFDQRLDAVG
FT                   RERASIQRHLSLDASPVFSLSSVEAFRDAVGRARELGFTDVISHWPRSSSPYEGREAVL
FT                   EQVASDVLPELH"
FT   gene            complement(235453..237462)
FT                   /locus_tag="AMED_0223"
FT   CDS_pept        complement(235453..237462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0223"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42046"
FT                   /db_xref="GOA:A0A0H3CXI3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXI3"
FT                   /protein_id="ADJ42046.1"
FT                   /translation="MPAPEDFWSYFAAVATYVAVLAVPGGVVGWAAGLRGWALAGLAPL
FT                   LSYAITGLAGPWLAIAHIPYGSLSVAVCTLLLAAVLYGLRRLFTGRGWSTPGAEEPAEP
FT                   WTRRAHLAVGACVAIAVAVSVAVVVTGRGGTTAVFQRWDTVFHANGIRYIAETGDGSLT
FT                   GMGTINWYPAGSFYPNAYHLVGALVYELSGTSVPVTLNAITMPIAGLFALAMAALVRQL
FT                   GGRAVFAGSAALVAGGATTGAYESVSSGLLPFALGIVLTPLAVIALQRFVVRPGVDTGA
FT                   VLALSATGLLAAHSSALFGAILFAFPLVVQRWYRALRGRRVDGVPEGRAAWRVAGGDVL
FT                   WVLPVMVAAGLLAAPMILGAIGFTSGSYPYYAWGSHMPVWKALAMLATFKQVLPVPQIW
FT                   LTVFLAIGVLTLGALRRMRWLVLSALGLSALFVVVACFGGEHWVISLSRPWWNDRFRLM
FT                   ALASIPMCLLAAHGMSEAQRWLAKLASGRAWVRARPWLTGRVGLATAVLLVVAMGVLTG
FT                   GFYRAANAKTVSLLYYNGLPGEVVPPVSQDEIDAMDHLGTLGIPAEQKVLNDRLDGTAW
FT                   MYALTGVHPVAGHYDAGVAPPDALYLARHFADYDSDPEVRAAVRRLDIHYVLVGSGTIR
FT                   RDTPIARGLQHLDGHDFLEVVYRNPGAVIYRIVK"
FT   gene            237542..238765
FT                   /gene="glf"
FT                   /locus_tag="AMED_0224"
FT   CDS_pept        237542..238765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glf"
FT                   /locus_tag="AMED_0224"
FT                   /product="UDP-galactopyranose mutase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42047"
FT                   /db_xref="GOA:A0A0H3CTT0"
FT                   /db_xref="InterPro:IPR004379"
FT                   /db_xref="InterPro:IPR015899"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTT0"
FT                   /protein_id="ADJ42047.1"
FT                   /translation="MSAHTNPAKITEDDFAGYDLVVVGSGFFGLTVAERAAAELGKKVL
FT                   ILERRSHLGGNAYSEPDPETGIEVHKYGAHLFHTSNKRVWEYVNRFTEFTNYQHRVFAR
FT                   VKDQVYSFPMNLALINQFFGKSHTPDEARELIAKQSSEFETSAAQNLEEKAISLVGRPL
FT                   YEAFIRGYTAKQWENDPKNLGENIITRLPVRYNFDNRYFNDTYEGLPVNGYTAWLEKMA
FT                   EHENIEIRLNVDYFDVREHIPAGTPTVYTGPLDRYFGYSAGRFTWRTVDFESEVAETGD
FT                   FQGTSVVNYNDQEVPYTRIIEFRHFHPERDYPKDKTVIFREYSRFAGEEDEPYYPINTP
FT                   ENREKLEAYRELAKAEAREKNVLFGGRLGTYKYLDMHMAIGSALSAFDNKIAPHLTDGA
FT                   PLDGSLDA"
FT   gene            238758..239276
FT                   /locus_tag="AMED_0225"
FT   CDS_pept        238758..239276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0225"
FT                   /product="membrane-associated phospholipid phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42048"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUT3"
FT                   /protein_id="ADJ42048.1"
FT                   /translation="MLEKGQPAGEVAVLAKAQGFLKSEASVKAARGMSHFGEHALGWFG
FT                   LGLLGAVVDKERRTDWLVASAGVVGAHAASIAVKRVVRRPRPDHPSVEVLVGTPSKLSF
FT                   PSSHATSTTAAAVLYSGLTGRNLVPALVPPMLASRLVLGVHYPTDVLAGAALGGLVGGL
FT                   IRRKLKKNP"
FT   gene            239273..240223
FT                   /locus_tag="AMED_0226"
FT   CDS_pept        239273..240223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0226"
FT                   /product="phosphoribose diphosphate:decaprenyl-phosphate
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42049"
FT                   /db_xref="GOA:A0A0H3CVU2"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVU2"
FT                   /protein_id="ADJ42049.1"
FT                   /translation="MSETTEQRNSDETAEAVEPAAARGPFGLVGGVIKTARPRQWVKNV
FT                   LVFAAPFFAFSKSTDRTGLLIDAIIAFVAFSLTASSVYLINDAIDVEADRAHPTKRNRP
FT                   IAAGIVPVPLAYGAAVVFFLAGLGVSFLASWQLAVVLGVYEAVQLGYCFGLKHQPVVDL
FT                   AIVGSGFLMRSIAGGVAGGIALSQWFLLVTAFGSLFMVAGKRYAEIMLFERTGAKIRSS
FT                   LKKYSASYLRFVWATSAAILIMSYCLWAFEIRQTEHNSVWALISMVPFLVAVLRYAVDV
FT                   DGGIAGEPEEIALKDRILQVLGASWVIILFLAFYL"
FT   gene            240342..240947
FT                   /locus_tag="AMED_0227"
FT   CDS_pept        240342..240947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42050"
FT                   /db_xref="GOA:A0A0H3CVI4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVI4"
FT                   /protein_id="ADJ42050.1"
FT                   /translation="MNDQPREQKAPDGPDQPTVEHPAQANQPTAATGEPTAAPGNPATP
FT                   AAEPERPDQPTPTTAAPGAAAPAAPGEASGPAPADQTAVHGQQPPPTPQLSQPGPGPHY
FT                   ASWGPPPAAARPSGGFRRFVGHRATQLVAVGVLGMLVGAGIVGGVAAASHHGPRDGRPG
FT                   IHRQYNGPDQGFNGRGPGFGGRGPGGQGNGGTGSGDGI"
FT   gene            241037..242554
FT                   /locus_tag="AMED_0228"
FT   CDS_pept        241037..242554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0228"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42051"
FT                   /db_xref="GOA:A0A0H3CXJ0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXJ0"
FT                   /protein_id="ADJ42051.1"
FT                   /translation="MRSAPAELPKVVRALPAAIPVARSWALPAGAAAASALVFALVSSH
FT                   LIDDTYITLSYAKNLAFHGHWGLIEQGTANTATSPLNVLALGAVTFVVRDAVLAAGVVF
FT                   VAAQVLLVLGLRRLGERTGLPPAFAPLTFALLLVNPLLLSSIGLEVALGATGVVWTLVY
FT                   AGERRAGRLGVVIGLLALVRIDLLLIAAVLFAARREFWAGIWQTVFAALAVTLPWFGFS
FT                   WVVLGSAVPDTLVIKISQQSWGPFSFTNGPLLYWRNFPAAATLSFLPLILAALAGVAWL
FT                   VQYRRGSGTARRLTPFAALAAAGALHYLAYSRLGVPPYHWYYAPSIIGATIFLAACASA
FT                   VPERVRRGTWTVAGAALAASVAVYALPGVPRQFAPITSNHASTTEYREIGQELAALAHG
FT                   RKVETAGEVGALAYACDCELVDEFSDRGAVDPAIAETKRRSDDLGRALLEANFHNFDHS
FT                   VGPISPDLVLATTRRTPPRTALASWHIDSPWVGSQNLYLVPAHALGG"
FT   gene            complement(242571..243326)
FT                   /locus_tag="AMED_0229"
FT   CDS_pept        complement(242571..243326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0229"
FT                   /product="short-chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42052"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTT5"
FT                   /protein_id="ADJ42052.1"
FT                   /translation="MIDAVGNPQSLLLLGGTSDIALAIAEKYLAEKPLRVVLAARPSPR
FT                   LDAAAQRLKDRGAEVSTVDFDAKDTASHPGVLAKAFDGGDIDVAVVAFGLLGDPEEVWQ
FT                   DHAKAVELATVNYTAAVSVGVALSEKLKAQGHGTVIALSSVAGERVRRSNFVYGSTKAG
FT                   FDGFYLGLGEALAPFGAKVTVVRPGHVKTKMTEGLKDAPLAQTAEQVAEIAVGAARAGK
FT                   DLVWAPAPFRLVMSALRHVPRPIFRKLPI"
FT   gene            complement(243323..244693)
FT                   /locus_tag="AMED_0230"
FT   CDS_pept        complement(243323..244693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0230"
FT                   /product="FAD linked oxidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42053"
FT                   /db_xref="GOA:A0A0H3CUT7"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUT7"
FT                   /protein_id="ADJ42053.1"
FT                   /translation="MTHAPETQRRTLTGWARTAPTTADVLSTPDLETIARAVAQAGERG
FT                   VIARGLGRSYGDPAQNAGGLVIDMTPLNRIHSIDPDSALVDVDAGVSLDQLMREALPYG
FT                   LWVPVLPGTRQVTIGGAIANDIHGKNHHSAGSFGNHVVSMDLITADGQIRTLTPEGPDA
FT                   ELFWATVAGIGLTGIIVRAKIRMTKTETAYFLADNERTNNLDETLELVSNGSDDNYTYS
FT                   SAWFDTISTGSKLGRAAFGRGSLAKLDELPPKLRANPLKFDAPQLATLPDVFPNGLANK
FT                   LTFGAIGELYYRKTPKAARGVIQNLTAFYHPLDMFGEWNRAYGSKGFLQYQFSTPPNAH
FT                   EPLRNIVRKIAESGHVSFLNVFKRMGEGNAAPLSFPHPGWMVCVDFPIKDGLSRFCQEL
FT                   DEDVLELGGRLYTAKDSRTSPETFAKMYPRLEEWRKVRASIDPEGVFASDMSRRLEL"
FT   gene            245035..245355
FT                   /locus_tag="AMED_0231"
FT   CDS_pept        245035..245355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0231"
FT                   /product="GtrA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42054"
FT                   /db_xref="GOA:A0A0H3CVU7"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVU7"
FT                   /protein_id="ADJ42054.1"
FT                   /translation="MATSPWVDVARAISFIVGTTTAFFLNRKFTFAGGRRDGKAQVGSF
FT                   VLLYTVTFFVAVGVNQLMLNVLPESAWQRTLCWAVSQATATVINFVMLKWVVFREPSTE
FT                   EN"
FT   gene            245364..247283
FT                   /locus_tag="AMED_0232"
FT   CDS_pept        245364..247283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0232"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42055"
FT                   /db_xref="GOA:A0A0H3CVJ0"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR040492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVJ0"
FT                   /protein_id="ADJ42055.1"
FT                   /translation="MPGKTATPAPTTEAGPAVETRFTEHTPQGRLTAQRGLYAGPAPIV
FT                   SKDLYAELEWGAAVRERASIALEPATKVSGNTYFGRFPASYWQRWTNVSEVSVEAVVTG
FT                   TGLLSMGASDVEGEPRVVAAEQVKDAKQAKLSLTGKLDKFYDGGALWLDLETEGGQTLR
FT                   VEQVRWTVEAPEKIRPTAVTICTMNRADDCLKNLQALAADVSSLETLDAIYVADQGTDL
FT                   VESRDGFEQVAKDLADKLHYIKQPNLGGAGGFTRGLFEVAGHTATEHANVLFMDDDVLL
FT                   EPDLVIRMTAFSNRAADPIIVGGQMLNLFHPNQLHVGAEYARLNTLEPGQPVEHSLTTA
FT                   DLLGVDEETLKPNRQERRLDAGYNGWWSCLIPYEVVKATGYPLPFFFQWDDAEYSYRAR
FT                   AHGFPTVTLPGAGVWHADFHMKDWDEWHRYFNLRNSIITAALHSPFNLNLLSRVLIAQL
FT                   VRYLLGMQYGLSATLIKAVEDFLKGPEILRDGGVEAMKEIRRIREDYPETKRHKATDVP
FT                   GIASSDIGIINSSPRPALQRVVLIRRVLDRILGRSRFGLGAVPIDEANWWHIALFDTAV
FT                   VTDANQEGVRVRSYDRVKMFALAKQGARVVQRLRKEGAAVQEQYKRAMPELTSRENWKR
FT                   LYKL"
FT   gene            complement(247335..247580)
FT                   /locus_tag="AMED_0233"
FT   CDS_pept        complement(247335..247580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0233"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXJ7"
FT                   /protein_id="ADJ42056.1"
FT                   /translation="MADPKPALVLHLATGGEPLLFALTTEESGKLAGKLAQLVKTGAVE
FT                   SVTTKDDSVVAVNFAHVAAAYIDDLARKSTVFGMHA"
FT   gene            247876..248640
FT                   /locus_tag="AMED_0234"
FT   CDS_pept        247876..248640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0234"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42057"
FT                   /db_xref="InterPro:IPR025734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTU0"
FT                   /protein_id="ADJ42057.1"
FT                   /translation="MPHSFSLSLAAVDILLEQLGLGRAPTPFEVPHVGTTVEQRAMIRD
FT                   AVVRDLTGRGLWSRGRLDPDAELALATFVRGSVSINAAAELGDRHLFARVASDGQFAVL
FT                   ARQQENLLVFEEVRPTGIVPAIVDLLPLTPAAPGQSVTISRPVQQPRHQRRDEAYDPFA
FT                   GVSAPRSHSGAGGPQVRMIERVFQEPKKRVGQFTAQTRGGTFPPLAWFDTPSGRWLMSS
FT                   RAADDGQRWITYAPADNARLAQQLYAQLEGQF"
FT   gene            248771..249220
FT                   /locus_tag="AMED_0235"
FT   CDS_pept        248771..249220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0235"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUU1"
FT                   /protein_id="ADJ42058.1"
FT                   /translation="MLIADGGGGGSIADIVNPLSSAGMSAAVKSVTAETQKLVDAAKGG
FT                   GFKITPEGVKPIRDALTELVNDLGDLQYKSFLLDQTPQLGNHPYGLAVAKHDQKSASAA
FT                   DGGATQVLQELREVARQADEALARAAGLYKETESQAFSALQTKQA"
FT   gene            249428..249796
FT                   /locus_tag="AMED_0236"
FT   CDS_pept        249428..249796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVV2"
FT                   /protein_id="ADJ42059.1"
FT                   /translation="MSGYGEFNEPQNKTVGGVRSCSYRQKIASASENAKVIGVNVRDTA
FT                   SVAQVNDTGGGVVDKDVNGRKAREASGGASLPACTLALPVGDSSRVDVAVIGADSADQA
FT                   CQLAEAVAKAVEPRLPKG"
FT   gene            249806..251299
FT                   /locus_tag="AMED_0237"
FT   CDS_pept        249806..251299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0237"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42060"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVJ6"
FT                   /protein_id="ADJ42060.1"
FT                   /translation="MTTQQGPRPKTEDKTPQQVQDMAPAERDAYLQQKAEEGVDPGNWL
FT                   FGAVQQWMAQARAKNQAQQMGDKNVKAATQGRDVEYVQGLNPSSADYQGSDHAQLKEYL
FT                   DTNLDVDQVSEVSTAYHEVHQVFDKFAQSMNTAVNASKGTWEGSAAENAQQYFTSLGKW
FT                   SDANSQNAKLASETIYDQGQAAATAKNSMPAPIPFSWKDEFKDWATSNPFSLPDNVDKS
FT                   LQKQKDSQAAHDEAASVMATYDKNLYEAASKQPAFAPPPSFSTGGGSDDPNGTGDKNGI
FT                   NTPSSVNVPGSHPGTTPGGTAQGFVSGSTPGPLGGPAAHTISGPGSTTGSGFVPAGTTT
FT                   PSGFTPSSVPAASTSNSNQQFGGMPPMSPMPMGGGMNFGGDEAYNSKIGGGGGGRGGGF
FT                   GPGGSGAGNATGAGAASGAARPGGIGAAEAAAGRGMGGLGAGASGRGGGMSPGGGLGRG
FT                   QKGEGDEDTEHSRPTYLVEGDPDEVFGTDLRTAPPVIGE"
FT   gene            complement(251358..252269)
FT                   /locus_tag="AMED_0238"
FT   CDS_pept        complement(251358..252269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0238"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42061"
FT                   /db_xref="GOA:A0A0H3CXK2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXK2"
FT                   /protein_id="ADJ42061.1"
FT                   /translation="MMASETRQLPDGAVVGVVVTRHRRELLADSLKVIAAQTRPVDHLV
FT                   VVDNGPDDSAREVVENYPLPHTYLPSHRNLGGAGGFALGMLHALSLGADWIWLADDDGR
FT                   PADENVLAILLEEAEKRDLAEISPVVSNIDAPDKLAFPLRRGLTWKRSQSELGADFLPG
FT                   IASLMNGALFRASTLDVVGVPDLRLFFRGDEVELHRRLVRSGLPFGTSLKTKYLHPDGS
FT                   DEFKPMLGGKFHAQDPENEVKRYYTYRNRGYLLSQPGMRKIGALEIVRFGLYFVGVKRD
FT                   PKAFLQWLKLVRQGRAEKFYRY"
FT   gene            complement(252266..253081)
FT                   /locus_tag="AMED_0239"
FT   CDS_pept        complement(252266..253081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0239"
FT                   /product="ATPase component of ABC-type
FT                   polysaccharide/polyol phosphate transport system"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42062"
FT                   /db_xref="GOA:A0A0H3CTU4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTU4"
FT                   /protein_id="ADJ42062.1"
FT                   /translation="MVSIDVHNAFVDFPIFDAKTRSMKKKVLGKVGGKIGTDTKVPIIE
FT                   ALHDVTLNLREGDRVGLVGHNGAGKSTLLRLLAGIYEPTRGSSRIKGKIAPVFDLGIGM
FT                   DPEISGVENIIIRGLFLGMTAKEMEKRVDDIAEFTELGDYLQMPLRTYSTGMRVRLALG
FT                   VVTSIDPEILILDEGIGAVDAAFLNKARDRLKDLVKRSGILVFASHSDEFLFELCDSAI
FT                   WMDEGHLKQQGSLRDVLTSYKGRDPFENMSQETLERFGIEPVATTNGGE"
FT   gene            complement(253085..253996)
FT                   /locus_tag="AMED_0240"
FT   CDS_pept        complement(253085..253996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0240"
FT                   /product="permease component of ABC-type
FT                   polysaccharide/polyol phosphate transport system"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42063"
FT                   /db_xref="GOA:A0A0H3CUU6"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUU6"
FT                   /protein_id="ADJ42063.1"
FT                   /translation="MTTSASPTSDSKTFSRAFADIKAGISARELWGHLGWQDIKQRYRR
FT                   SVIGPFWITISQAVLALGLGLLYSQLFKLPVEVFLPYISTGFIIWGFISGCLSEGMETF
FT                   IANEGLIKQLPAPLSVYMLRTVWRQTLMLAHNMIVYVAVLAIFFSALSNRYSLLGDGSC
FT                   VPGHICHPGLSWNILLAIPGFVLLALNAAWVTLLFGIISTRFRDIPQVINSLIQLLFYG
FT                   TPIVWPVDQLMTGGTREGASWILPIVKVNPLYHFMQVVRAPLLGQEFSVGNWIVVGSIT
FT                   VVGWALALVAMRNYRARVSYWV"
FT   gene            complement(254241..254822)
FT                   /locus_tag="AMED_0241"
FT   CDS_pept        complement(254241..254822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0241"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42064"
FT                   /db_xref="GOA:A0A0H3CVV6"
FT                   /db_xref="InterPro:IPR019695"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVV6"
FT                   /protein_id="ADJ42064.1"
FT                   /translation="MEHMTEPNFTAGDPGQESSPHVVVVGPDGTPVGATQLPSPDSEGD
FT                   HPESVGDLVEEPAKVMRIGTMIKQLLEEVRAAPLDDASRTRVREIHQTSIRELEKALAP
FT                   ELQDELERLVRPFTDDSTPSDAELRIAQAQLVGWLEGLFSGIQTALFAQQMAARVQLEQ
FT                   MRRGLPAGPSGAVGHGHEHGPGISGTGQYL"
FT   gene            254957..256156
FT                   /locus_tag="AMED_0242"
FT   CDS_pept        254957..256156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0242"
FT                   /product="cysteine desulfurase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42065"
FT                   /db_xref="GOA:A0A0H3CVK0"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR011340"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVK0"
FT                   /protein_id="ADJ42065.1"
FT                   /translation="MAFDVARIRGLFPALGDGWIHFDGAAGMLVPEQVASAVSTAMRAP
FT                   VSGPGGAFPASQRAESIVTAARRAVADLVGADPAAVVLGPSAPVMLRRLVDALAERWTI
FT                   GDELVVSRLDEQANLAPWQRAAKRVGAVIRWGEIDIETCELPAWQYEQLVSARTKAVAV
FT                   TLASGSVGTRPDVPTIIEFAKRVGALVVVDATYAAPFLPLDINALGADVMVVSAQAWGG
FT                   PSVGALVFRDPELIERIPSASLDPMARGAARLELGPHAYPLLAGLIASIDYLSGLDDAA
FT                   TGSRRERLVTSLGSAKSYHAGLLAQLSTELLSLRHIMVIGNAMRRIPALAFAVAGKKSP
FT                   EVAEYLAKQGLCAFADDGTSGVFASLGVGEVGGAVRIGLAHYSNVFEINQLVRVLDELR
FT                   "
FT   gene            complement(256153..257130)
FT                   /gene="qor"
FT                   /locus_tag="AMED_0243"
FT   CDS_pept        complement(256153..257130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qor"
FT                   /locus_tag="AMED_0243"
FT                   /product="NADPH:quinone reductase and related Zn-dependent
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42066"
FT                   /db_xref="GOA:A0A0H3CXK8"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXK8"
FT                   /protein_id="ADJ42066.1"
FT                   /translation="MYAITIREPGDPDVLEWAEVADPRPGPGEVLLEVAASAVNRADLL
FT                   QRQGQYPPPPGASETLGLECSGTIAELGEGVEDWNVGDEVCALLSGGGYAEKAVVPAGQ
FT                   LLPVPGEIDLLTAAALPEVACTVWANVVMHAKLTEGEVLLVHGGAGGIGTHAIQVGKAL
FT                   GATVAVTAGSPERLESCRQLGADITIDYKEEDFVEVLKKETGGANVILDNMGAAYLGRN
FT                   VDALQQDGRLVIIGMQGGVKGELNVGALLGKRASVFAAGLRFRPLDQKAAIVGDVRDRL
FT                   WPLVAEGLVKPIVGQVVPMAEAATAHRIMEEGSVFGKVLLAAKS"
FT   gene            257272..258753
FT                   /locus_tag="AMED_0244"
FT   CDS_pept        257272..258753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0244"
FT                   /product="glutamate carboxypeptidase II"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42067"
FT                   /db_xref="GOA:A0A0H3CTV0"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="InterPro:IPR041756"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTV0"
FT                   /protein_id="ADJ42067.1"
FT                   /translation="MLGLTPAAAADTVPDGPALAKQLVKKVDANGVNRHLIALQRIADT
FT                   NGGTRAASTEGHKKSAEYIATKLEAAGFQVTRQEFPFTYSQTLAEKLTAGGANVPVIAM
FT                   EYTKSTPVGGITAPLAVVAVDDTSGCEATDYTADVAGKIALIKRGGCSFAQKQQTAAAA
FT                   GAIGAIVYNNTDGALNGTLGGPENAKIPTGGVTAAAGAQLATLGGQNVTLELRAFQEAR
FT                   TSYNVIAETKTGRKDNVVMLGSHLDSVPAGPGINDNGSGSATLLETALQLGSSPKVNNG
FT                   VRFGFWSAEEFGLIGSTYYVDQLTFEQQLDIALYLNFDMIASPNAGYFAYDGDNSDGVG
FT                   AGAGPYGSAQIEKTFVDFMQAARGVSLEGTDFTGRSDYGEFIAVGIPAGGLDTGAEVLK
FT                   TPAQAAKWGGTAGIAFDPCYHQACDNLGNIDRVALDRNADGVAWALGVYATSTESINGV
FT                   QPGKAKAAKQKAAERGAQRNFSARAVAGDPHALTA"
FT   gene            complement(258805..259731)
FT                   /locus_tag="AMED_0245"
FT   CDS_pept        complement(258805..259731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0245"
FT                   /product="metallopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42068"
FT                   /db_xref="GOA:A0A0H3CUV0"
FT                   /db_xref="InterPro:IPR007343"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUV0"
FT                   /protein_id="ADJ42068.1"
FT                   /translation="MRFDDDAGLDASEVQDLRGSGGGGGGIGGRVALGGGGLGVVGLII
FT                   YFVLSQLGGVSTGGSGLSGGLGSVGSGQQVDNSKLSSECKTGADANKNHDCAIVAVVNS
FT                   VQDYWTQQFARSGSTYRKAPTKFFNGGVRTGCGSATSDTGPFYCPADSDVYIDLSFFDE
FT                   LKTRFGAQGGLFTEAYVLAHEYGHHVQNLLGTSKKGTGTGPTSGSVRLELQADCYAGVW
FT                   GNHASTTPTESGKPLITDVTQDDINSALDTASRIGDDYIQENLGGGQVDRSKFTHGTSA
FT                   QRKKWFTTGFQTGDPARCDTFGTSNLG"
FT   gene            260257..260712
FT                   /locus_tag="AMED_0246"
FT   CDS_pept        260257..260712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0246"
FT                   /product="MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42069"
FT                   /db_xref="GOA:A0A0H3CVW2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVW2"
FT                   /protein_id="ADJ42069.1"
FT                   /translation="MRWLNDAEMAAWRSYVVATLLLRQRLHRELSECHEVSLVDYEVLV
FT                   CLQMQPDRRMRMSELAFMMGSTKSRLSHQVAKLEEASLVRRARDPEDKRGVITELTDEG
FT                   EALLEKAAPTHVEGVREHLIDLLSPEEQATIAAAFERVRAHLSEPES"
FT   gene            260746..260832
FT                   /locus_tag="AMED_R05"
FT                   /note="tRNA-Ser-TGA"
FT   tRNA            260746..260832
FT                   /locus_tag="AMED_R05"
FT                   /product="tRNA-Ser"
FT   gene            complement(261001..261819)
FT                   /locus_tag="AMED_0247"
FT   CDS_pept        complement(261001..261819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0247"
FT                   /product="patatin-like phospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42070"
FT                   /db_xref="GOA:A0A0H3CVK5"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVK5"
FT                   /protein_id="ADJ42070.1"
FT                   /translation="MGGGGVAGIAWTTGLLAGLAGHGQDLTGADLLVGTSAGSVVAAQV
FT                   TSGRSLDELYARQADPARQTPEIPAEIDFEKFAADFGGAVTGASDPAEVRRAVGQLALA
FT                   TETVSEADRIEVIAARLPVHEWPAQRLVIVAVDAETGEPRRFDRESGVSLVDAVAASCA
FT                   VPGVWPTVTIDGRRYLDGGVRSAENADYATGFTRVTVVSPLGVDAPLPMEKPLPEVLDD
FT                   LRAAGAEVTLITPDEASRAAIGENPLDPARRTPAAEAGRAQGAALTLTWS"
FT   gene            261922..262356
FT                   /gene="yaeR"
FT                   /locus_tag="AMED_0248"
FT   CDS_pept        261922..262356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeR"
FT                   /locus_tag="AMED_0248"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42071"
FT                   /db_xref="GOA:A0A0H3CXL5"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXL5"
FT                   /protein_id="ADJ42071.1"
FT                   /translation="MTAKIEGFHHVKFPVRDLARSREWYERVLGLDVTHEFPDDDGVVR
FT                   GVAGTIDGVPVALRVQEAAAAGLAGFDPVCFSIADRAAADAWIVRLDELGVEHPPLFEA
FT                   TTGWMVRFNDPDGTEIRLYSLAKDDGVDHSGERGYAQPVR"
FT   gene            complement(262358..262639)
FT                   /locus_tag="AMED_0249"
FT   CDS_pept        complement(262358..262639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0249"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42072"
FT                   /db_xref="InterPro:IPR018735"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTV7"
FT                   /protein_id="ADJ42072.1"
FT                   /translation="MCRNITTLRGLQPAATGEEIEAAARQYVRKVTGVQSLSDATREPF
FT                   EAAVAEITEITARLLEQLPERRQPPATVPPLRRPEVQARIAAKALRQL"
FT   gene            262704..263681
FT                   /locus_tag="AMED_0250"
FT   CDS_pept        262704..263681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0250"
FT                   /product="malate/L-lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42073"
FT                   /db_xref="GOA:A0A0H3CUV4"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUV4"
FT                   /protein_id="ADJ42073.1"
FT                   /translation="MTPEPALGKVGEVPLRPRPFRSTRAEPAILEEELPETPIPEQAWP
FT                   RVRADELVTLVAHVFAAHGLPEARARIAAEALCHGDLTGSPETGVADLTRVHLPLLKNG
FT                   LVVPHAEPLMIADRGAAALIDYRRALGLWAVGDAMDRAVTRAGRFGVGLVSLRGIGPFG
FT                   RAGHHAARALPHAMIGLVLAAGGEPGQPMNPLGMAAPGGAYPEFVFDMDRPGSEAAGLT
FT                   LLVDVLAGVLSGVADHEHDTGLLVLAIAPTTLRSADGFYRAASALFGSMLGWDGGAPIR
FT                   YPGWREAQHLEQCRALGVPLAGPVRRELDALARSLGLPALTSVG"
FT   gene            complement(263678..263902)
FT                   /locus_tag="AMED_0251"
FT   CDS_pept        complement(263678..263902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0251"
FT                   /product="RNA-binding S4 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42074"
FT                   /db_xref="GOA:A0A0H3CVW7"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVW7"
FT                   /protein_id="ADJ42074.1"
FT                   /translation="MSEPVDVPITGEPIRLGQFLKLAGLAEDGSHAKDLIDAEEVTVNG
FT                   EVETRRGRQLTDGDVVAVGPDRGKVILVR"
FT   gene            complement(263921..264721)
FT                   /locus_tag="AMED_0252"
FT   CDS_pept        complement(263921..264721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0252"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42075"
FT                   /db_xref="GOA:A0A0H3CVL0"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVL0"
FT                   /protein_id="ADJ42075.1"
FT                   /translation="MIVRRPAVLLTLAAIVLLGVSFVVVFAARPAQLAHATTPDQATAE
FT                   AAPAPDLPAVSSPAVGALFAEGEHYCTASVVHSERGDVLLTAAHCIHNGEGGGYLTGVT
FT                   FAPGYHDGVAPFGYWTVADELVAPGWAASSDPDLDVGFATARQAGTTKSLESLVGANLL
FT                   ATGTAFEQAITLTGYPDDSEVPAVCQNTTAKQDTYQLRVDCAGFPTGTSGGPWVAGQNP
FT                   QTRLGTVIGVIGGFEFGGDDADTSYSSYFDTDVLALYRQTTART"
FT   gene            264877..265689
FT                   /locus_tag="AMED_0253"
FT   CDS_pept        264877..265689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0253"
FT                   /product="short-chain dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42076"
FT                   /db_xref="GOA:A0A0H3CXM1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXM1"
FT                   /protein_id="ADJ42076.1"
FT                   /translation="MKQFADKVVVVTGAGSGIGRALACEFARRGARVALSDVVTANAEE
FT                   TAELAGGNARAYTLDVADRSAVLAHAEDVAGEFGAVNVVVNNAGVALGATVEEMSFEDY
FT                   DWLMGINLGGVVNGTKAFLPHLIASGDGHVVNISSVFGFVGVPTQSAYNAAKFAVRGFT
FT                   EALREEMLIARHPVAVSCVHPGGIKTNIVRNSRSAADDQEKAAQGFERIARTTPEKAAQ
FT                   TILRGIERKSARILIGPDAYVIDAIPRVLGSAYQRPLAALARLGLKQN"
FT   gene            265787..266425
FT                   /locus_tag="AMED_0254"
FT   CDS_pept        265787..266425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42077"
FT                   /db_xref="GOA:A0A0H3CTW3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTW3"
FT                   /protein_id="ADJ42077.1"
FT                   /translation="MLRTAPRSATRPSRDRAAVELLDRTGIVAASLPRRRRTGGEVPAV
FT                   EPIYTRPPVCDQDLRPKSVVIRRRARTWLGGGAAVLLVGAGWLGGGLFTGGLFNPAPEH
FT                   DVAQLDARPAVAAAPAPEPPVAQAPPAPAVVTAAPETVYVPVPAKPAPKQVPAQAQAQA
FT                   KPQPKKPVPDEEAEARVDLPSSATPPPASNPIQAWVDVAESMARRYGGR"
FT   gene            complement(266427..267086)
FT                   /locus_tag="AMED_0255"
FT   CDS_pept        complement(266427..267086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0255"
FT                   /product="two-component system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42078"
FT                   /db_xref="GOA:A0A0H3CUV9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUV9"
FT                   /protein_id="ADJ42078.1"
FT                   /translation="MIRTLIVDDDFRVAGVHAGFVEEVDGFAVVGTAHTAAEARARVRE
FT                   LTPDLILLDVYLPDESGLAVLPELQTDTIVLSAATDSASVAAAIRAGALNYLIKPFTTR
FT                   QLAERLTSYARFRGLLAEDRALAQDDVDRAYRVLHDQDRTTAPKGQSTATSRLVSEQLR
FT                   RAGRPLSAAEVAGELGMARATAQRYLTALAESGTVQMRLRYGATGRPEHEYRWSEA"
FT   gene            complement(267083..268666)
FT                   /locus_tag="AMED_0256"
FT   CDS_pept        complement(267083..268666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0256"
FT                   /product="two-component system histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42079"
FT                   /db_xref="GOA:A0A0H3CVX2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVX2"
FT                   /protein_id="ADJ42079.1"
FT                   /translation="MRFSRQVLLLQIGVVLLVVGIGVALVSVLLSRTLTDQFSERALAI
FT                   AKSVAVDPVVMADTAAKIPGGALQERALAVRERTDALFVVITDDNSIRLAHPTPSEIGK
FT                   KVSTSADRALAGFDDVNTVASGTLGLSVRSKTPIWTPDHRRVVGEVSVGFDVADPTGAF
FT                   NRLLTITLLFAGGALLLGAGASALLNRRLRRVTHGLEPHELTELLYEREAVLHGIGEGV
FT                   LAVDENNRVSVRNDEAERLLGTELPIGAAMSELELSPRLHKAVAEGRPVDNLLAVAGNR
FT                   VLVINSRAVRLDDRPIGTVLTFRDRTDLDTLTRELDGIRALSDGLRAQRHEFANRLHTL
FT                   YGLLQLGHHTEAVEYLQTLTDSSSARPSELGDAVADPYLQALLVAKTEQAQEKGLVLKL
FT                   AEDTWVPTTVTDPIAANTVIGNLVDNALHAARMGPRRPATVEIGLLAEGGTLHVSVVDS
FT                   GPGVPADLRRRLFDEGVSTKIAPGHGLGLALARQAARARGGDVWLADPGEGEPGALFVA
FT                   KLPGMLTEDG"
FT   gene            268858..269664
FT                   /gene="ssuB"
FT                   /locus_tag="AMED_0257"
FT   CDS_pept        268858..269664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssuB"
FT                   /locus_tag="AMED_0257"
FT                   /product="ATPase component of ABC-type
FT                   sulfonate/nitrate/taurine transport system"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42080"
FT                   /db_xref="GOA:A0A0H3CVL4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVL4"
FT                   /protein_id="ADJ42080.1"
FT                   /translation="MVPPLIELTGATKRFPSGSGSVHTAVRDLTMTVQPGEFVAVVGPT
FT                   GCGKSTTLSLVSGLQPPSAGRVRVNGEDVKSIPDGVGYMFQTDAVMPWRSVLENVASGP
FT                   RFRGVPKAEARAQAVDWIGRVGLAGFEKYYPHQLSGGMRKRVALAQTLVTRPKILLMDE
FT                   PFSALDVQTRALMQDELLRLWSGSGAAVIFVTHDLDEAIALADKVVVLTTSPATVKDVF
FT                   EIPLERPRKVEDLRLTEEFRKLYADIWESLRSEVDKAREKGASNVA"
FT   gene            269654..270541
FT                   /gene="ssuC"
FT                   /locus_tag="AMED_0258"
FT   CDS_pept        269654..270541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssuC"
FT                   /locus_tag="AMED_0258"
FT                   /product="permease component of ABC-type
FT                   sulfonate/nitrate/taurine transport system"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42081"
FT                   /db_xref="GOA:A0A0H3CXM6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXM6"
FT                   /protein_id="ADJ42081.1"
FT                   /translation="MSLETPAAPSAPLPVLETEQDILARAKQASAKRKRNIWLLRLAIV
FT                   VVWLGSWELTATYWIDPFFYSKPSKIWERLVEWFSAGTDFGSIWYQILVTVEEAAIGFV
FT                   IGAIFGVVFGVVLGRSSYLAQVLAPFIKAANALPRIVLAALFVIWFGLGLSSKVATVVV
FT                   LVFFAVFFNAFTGAREVDRNLIDNARILGATRGQVLKSIVLPSATSWILSSLHVAFGFA
FT                   LIGAVVGEYTGAKAGMGFLIANAQGTFDTAGVYAGMLIITVVALLAEWGISTLEGRLLR
FT                   WRPPSASEAAIKAV"
FT   gene            270567..271598
FT                   /gene="ssuA"
FT                   /locus_tag="AMED_0259"
FT   CDS_pept        270567..271598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssuA"
FT                   /locus_tag="AMED_0259"
FT                   /product="periplasmic substrate-binding component of
FT                   ABC-type sulfonate/nitrate/taurine transport system"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42082"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTW6"
FT                   /protein_id="ADJ42082.1"
FT                   /translation="MVAAVAVAAAGLTACRDSREISLGTTGQPHIKIMVGGLSKVIYLP
FT                   GQLAQQIGAYQKQGLDVELFDQPSGANAETSLLAGEVQAVVGFYDHTIDLQAKEQCIES
FT                   VVQFANVPGEAEMVATKKAGEVKSGADFKGRNLGVTSLGSSTDFLTKALAARGGVSSKE
FT                   YTPVKVGAGQTFISAMNQGSIDAGMTTDPTIAQLTKTGQAKVLYDMRTPEGTKAALGGL
FT                   YPASSLYMGCEIVKRYPDIVQKLANAYVETLKWISAHTPDQVAAMMPPSFAGGDKALYV
FT                   KSLEDSLPMFTKDGRMDPAGAQNVLKVLGASSSNVKPKKDKIDLSKTYTTRFVDAAHAQ
FT                   AQQ"
FT   gene            271819..272529
FT                   /locus_tag="AMED_0260"
FT   CDS_pept        271819..272529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0260"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42083"
FT                   /db_xref="GOA:A0A0H3CUW3"
FT                   /db_xref="InterPro:IPR000250"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR038656"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUW3"
FT                   /protein_id="ADJ42083.1"
FT                   /translation="MSKTLRVLTAIAAAAAGLAVSGTAHAAVEYGAHVFDVHRHGQEFS
FT                   GGNWGGYVSFGSFTTATASWTEPSVSCTSTNDLFAPWVGIDGDGSSTVEQTGVETDCSS
FT                   GRPVYSAWYEMYPAAPVYYSVSVSAGDHITATVTRTATNTYRLDLSDTTKGWSKSTTKS
FT                   LTSKHASAEAIIESPTDSYPSISGGITFTGVKFNGTNLASTSPSGLNADDKGRYTWTPG
FT                   AIGSDGQSFTMTRH"
FT   gene            complement(272537..273145)
FT                   /locus_tag="AMED_0261"
FT   CDS_pept        complement(272537..273145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0261"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42084"
FT                   /db_xref="GOA:A0A0H3CVX7"
FT                   /db_xref="InterPro:IPR009781"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVX7"
FT                   /protein_id="ADJ42084.1"
FT                   /translation="MGVVVATLVLQVALPADMVLHPRWLLPAVSALLVVALLLANPGRM
FT                   THFSTVERVISLLLVAAVTAVNAFSAVSLVLAIAGGTIGDRAGAVLVTGGTVYWTNIVA
FT                   FSLWYWEFDRGGPGRRAAGRAEFPDLQFPQMADPGLAHQDWEPSYLDYLYFSFTNSAAF
FT                   SPTDVLPLRIWAKMTMMLQAVISLVLAVMVVAWAINNLK"
FT   gene            complement(273237..276146)
FT                   /locus_tag="AMED_0262"
FT   CDS_pept        complement(273237..276146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0262"
FT                   /product="LuxR family transcriptional regulator fused with
FT                   ATPase domain"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42085"
FT                   /db_xref="GOA:A0A0H3CVL9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVL9"
FT                   /protein_id="ADJ42085.1"
FT                   /translation="MWLAAPRPTSVSVRSGPARLTGRDTELDAIVAVLRRRPAAVLIEG
FT                   EPGMGRSRLLAEIGRRKEFDGGRVLTGACQPLREPFPYGPVLEALRAVGATPLGPLSPV
FT                   AGVLRPLLPELAEALPPRPEPLADPVAERHRVFRAMRELLAACGPALVLIDDLQWADED
FT                   TRDFLRFLAGTMPPELAVVATHRSATEAGAGARGALFRTGPAVHSARVSLGALDVAAVR
FT                   ELAADLLELPRVTDDFAAKLHECTAGIPFVVEETLRALKEAAERLPVGEVLSDRLLENL
FT                   EVPLLLREAVTERLSALPEPAVRLAGAAAVLGVGAEADVLGELAGLSGDTLRTALLGTL
FT                   SGGVLGEVGDGRYGFRHPLARKAVYDTVSGPERALLHAQAIRVLAAQPSPPLTLLARHS
FT                   RAAGRVDQWRHYAEAAADEAITRGETSRAIDLLQAVLAEPGPSQADVGRVAGKLSQVAL
FT                   RGFRPEVLGTLQRVLEEVTLPPSVRGSIRLSLGMLLVRTIGGLGRGRLEVERAVGELTD
FT                   RPDLAARGITLLAQPIDGLTPLSWHESWRARAGEVYERLDDPELRLALTADRIAAASHV
FT                   GDGSAWAEFEALSDTVGTVAERVQLARLWCNLADGQSWAGHLDRAERLVTEGVRRATDA
FT                   GALYAIGLIQGTRVRLDWVRGRWTGLAETAEQLRDSYPELGPIVMESSLVLGGLAAVRG
FT                   EFAAAQRHLTAASVHAPDRGPIPVVLSAAGVLISVLLATDDVDGACAAADTAVAAAGRK
FT                   GVWIWAAALVPAAAQAYARAGRWPEADNVVEAFARGIEGRDAPMAAAALTAGRAVLLEA
FT                   RGKHLAAATLYDEAVSGYAALPMPYPATAMRERASMCRLAAGNRSAVDELTAAAEAYEQ
FT                   LGATRDAGRCRHQLREHGAWAPSQRGRRGYGSELSPREREVARMLAEGRTNREIADGLF
FT                   LSPRTVEQHVAKVLRKLGARSRTDVARKLPGEVTTAPAG"
FT   gene            276655..277758
FT                   /locus_tag="AMED_0263"
FT   CDS_pept        276655..277758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0263"
FT                   /product="serine protease precursor"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42086"
FT                   /db_xref="GOA:A0A0H3CXN2"
FT                   /db_xref="InterPro:IPR001316"
FT                   /db_xref="InterPro:IPR004236"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR035070"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXN2"
FT                   /protein_id="ADJ42086.1"
FT                   /translation="MKIARLLGAAATAVMATGALAATAVPASGQDLLNPDMVPAMQRDL
FT                   GLTHDQALARLKNEDVANKVTESLTAALGDAFGGATYNAATGKAHVTTTNAALAGKIRE
FT                   AGAEAEVVKFSARQLNSTVDRLNAADKAAPAAITGWGVDDATNRVTLDVLQGQRAAADA
FT                   FLAKSNVDKTAVTIRETATKPTTFANIRGGDAYYIGGSARCSVGFSTTTGFLTAGHCGA
FT                   LTGGGALTGSNGASLGSWITYRFPGSDYAAVRTNSNWTPVAQMNNGTAVRGSSNAATGS
FT                   SVCKAGSTTGWTCGTIGAKNQSVRYSEGTVNGMTATNVHSAAGDSGGGFIAGNYAQGLL
FT                   SGGNSSVTYFFPIAPALSGTGTTLKTS"
FT   gene            complement(277851..278255)
FT                   /locus_tag="AMED_0264"
FT   CDS_pept        complement(277851..278255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0264"
FT                   /product="sporulation and cell division protein SsgA"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42087"
FT                   /db_xref="GOA:A0A0H3CTX0"
FT                   /db_xref="InterPro:IPR006776"
FT                   /db_xref="InterPro:IPR038658"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTX0"
FT                   /protein_id="ADJ42087.1"
FT                   /translation="MHTDAVHQSQFVLLNESTTPVLSRLSYHAHEPFAVTVAFRTERGR
FT                   WIEWTFARDLLVAGLDEPAGLGDVRIRPDLSDDEDFLTLEIESPDGYASFELEVEDVRT
FT                   FLDASTELVPLGEESAHFDVDGLIEEISNV"
FT   gene            complement(278453..278926)
FT                   /gene="lrp"
FT                   /locus_tag="AMED_0265"
FT   CDS_pept        complement(278453..278926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lrp"
FT                   /locus_tag="AMED_0265"
FT                   /product="Lrp/AsnC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42088"
FT                   /db_xref="GOA:A0A0H3CUW8"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUW8"
FT                   /protein_id="ADJ42088.1"
FT                   /translation="MRTPDLDQLDIAILACLQADARTIAETIGAKVGLSAAAVQRRIKR
FT                   LREAGVIEREVAVLSPEALGLGMTFVVTVEMERENLAVFDGFRRQVLAEDAIQQCYYVT
FT                   GTADFVLIVTCPDMAAFEAFTRRMFFDNPNVRHFTTSVAMDRVKVGLSLPLDP"
FT   gene            279128..280117
FT                   /gene="fabH"
FT                   /locus_tag="AMED_0266"
FT   CDS_pept        279128..280117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabH"
FT                   /locus_tag="AMED_0266"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42089"
FT                   /db_xref="GOA:A0A0H3CVY2"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVY2"
FT                   /protein_id="ADJ42089.1"
FT                   /translation="MPAPAAVLTGLGSWLPTKVLDNHEIAARLDTSDEWIRTRTGIRER
FT                   RVAGPGESTVDLAVGAGREALGGTSADAVVLATATPDQPCPASAPQVAARLGLGTAAAF
FT                   DVNAVCSGFVYALATAAGFIAGGLAERVLVIGADTFTTLIDPNDRTTVPIFGDGAGAVL
FT                   LRAGEAGEPGAFGPFDLHSEGEHAELLWVEAGGARKRLSDTPADRFLAMQGTAVFRHAC
FT                   ARMAESSRTVLDRAGWMVGDVDRFVGHQANIRILQATAKQLGMPADAVVANIDRVGNTS
FT                   AASIPLALADAHADGTLVPGHRVLLSAFGAGLTWGSTVLRWPDLDQLP"
FT   gene            complement(280105..281598)
FT                   /locus_tag="AMED_0267"
FT   CDS_pept        complement(280105..281598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0267"
FT                   /product="adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42090"
FT                   /db_xref="GOA:A0A0H3CVM4"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVM4"
FT                   /protein_id="ADJ42090.1"
FT                   /translation="MRKIAVKNFRVVLRTSLGFAGLGLGSSVAGSGVVALLLVLQGLPN
FT                   DVGDRGWVLGLTAAGIVAAALLAGTLWTAWLQRRTVIWFVLGRPPSASEARRALRLPVD
FT                   MAVVSGTLWLIGTVILTVLAGTLGSSDDAVGMATVIGLGGLTTVGLTYLAAEWVARPVM
FT                   TIALDVLPPRGSLPVTVLTRLVVTWALASGVPLVGVLLIATPPEPGSGDHTASLIMLSV
FT                   IGLGVGAIGTALLARAVAAPLHRLRVALDEIARGNNDVVVDVDDSSEIGLLQTSVNQLA
FT                   AGLREQARMRDLFGRHVGAEVARHALEYGASLSGDVREVTALFVDVVDSTALAYRTPPE
FT                   ELVGKLNRLFAAVVSAVNARGGLVNKFQGDAALCIFGAPTRLADAPTAALAAARAIRDA
FT                   VRAAGELDLGVGVSSGPVFAGQLGTSSRFEYTVIGDAVNEAARLTELAKAVPSRVLASD
FT                   AVVSTALAGEAAHWQKHGELELRGRAEATPTWTTGPQGS"
FT   gene            complement(281635..282048)
FT                   /locus_tag="AMED_0268"
FT   CDS_pept        complement(281635..282048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0268"
FT                   /product="putative polyketide synthase protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42091"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXN7"
FT                   /protein_id="ADJ42091.1"
FT                   /translation="MTDFAWLEQVPSDRPALIVAEGLTMYLKPESGTELFRRLVEKFPS
FT                   DELICDLFSRTAIKTQKLNGPVRKAGATLYWGVDDPRELERCGLTCESSLDAGHWASPE
FT                   VPARLGRITRFQLRMLKVFPPPARTAHIVRYRF"
FT   gene            complement(282185..282874)
FT                   /locus_tag="AMED_0269"
FT   CDS_pept        complement(282185..282874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0269"
FT                   /product="GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42092"
FT                   /db_xref="GOA:A0A0H3CTX4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTX4"
FT                   /protein_id="ADJ42092.1"
FT                   /translation="MDTEQVWSATVDRLRARIDSGDLPPGSRLPAERVLCEELGISRGS
FT                   LRQALRVLASIGYVQIRAGSGTYVREQQEQPLRTWFTEHDQLVEKLFDLRATVEPTLAE
FT                   RLARHAGAKTVSRLEDNVAEMAQAAEAGDMLHVIAADAEFHRVIAQNAGNDDVAGLLRS
FT                   VLALVGEERRAALRLPGQIRKAVADHRAILDAIRRSDPAAARELTLKHLVDAKTYAHDY
FT                   AAHPETR"
FT   gene            282918..283559
FT                   /locus_tag="AMED_0270"
FT   CDS_pept        282918..283559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0270"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42093"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUX3"
FT                   /protein_id="ADJ42093.1"
FT                   /translation="MITGMDILGAWVRGWAVSRATPAPVAEPDGYRVEVGLPGHRVRYL
FT                   LRAPATVSARARAVAEPGTWLKTCGSRSAVLPGLTPAWTAGETEYLMAFEGPLPAVAVP
FT                   PGYAVTVVGDGPAWDVVVSFGEAPAARGRIAVAGGVAVFDKIETEPARRRRGLGRVVMH
FT                   RLGEAAGARSSALLASEAGRGLYRALGWRVVSDVVPAHVPEGGQEPEVAV"
FT   gene            283621..284394
FT                   /locus_tag="AMED_0271"
FT   CDS_pept        283621..284394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0271"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42094"
FT                   /db_xref="GOA:A0A0H3CVY7"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVY7"
FT                   /protein_id="ADJ42094.1"
FT                   /translation="MTWWHALIVVVAGIWAGTINAVVGSGTLVTFPVLVALGYPPVTAT
FT                   TSNAIGLAPGTLSGAWGYRHELTGYWRQTAKFAVASFFGAIGGTILLLSLPKDAFEAVV
FT                   PVLVGLAVILVIVQPKVSKWVAKRREENGEEHKPGPLLMFFIFLIGIYGGYFTAAQGVM
FT                   LMAVMGMLLSEPLQKLNGVKNVLAAVVNLVAGIIYAFVAPVSWAVVLWLAVGSTAGGFL
FT                   GAKIGRRLPPAVLRGVIVVIGVAAVVQLVVKQFAK"
FT   gene            complement(284466..285542)
FT                   /gene="hisC"
FT                   /locus_tag="AMED_0272"
FT   CDS_pept        complement(284466..285542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisC"
FT                   /locus_tag="AMED_0272"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42095"
FT                   /db_xref="GOA:A0A0H3CVM8"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024892"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVM8"
FT                   /protein_id="ADJ42095.1"
FT                   /translation="MPSVSPRADLESLPKYVPGRTIEGAIKLASNEVPGGALPSVAQAI
FT                   AEAAAGVNRYPDTGSQVLRERLARELDVPVEHVAIGCGSVSLCQQTIQAVCAPGDEVIF
FT                   GWRSFEAYPIVTQVANAVSVKVPITEGQELDLDAMLAAITDRTRVVFVCNPNNPTGTAV
FT                   RRAELERFMAAVPEHVLVVLDEAYKEFVTDPEVPDGVEYTRSRSNVMVLRTFSKAYGLA
FT                   GLRVGYAVAPEPIADALRQVYVAFSVNMLAQVAALASLDAADELLARCQDIVVERERVR
FT                   EALLEAGYRVPDTQANFVWLPLGDQAVPFAEHALDRKLVVRPFAGDGVRVTIGTREEND
FT                   LFLAAAREFLIRTKAGRP"
FT   gene            285689..286318
FT                   /locus_tag="AMED_0273"
FT   CDS_pept        285689..286318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0273"
FT                   /product="carboxymethylenebutenolidase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42096"
FT                   /db_xref="GOA:A0A0H3CXP2"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXP2"
FT                   /protein_id="ADJ42096.1"
FT                   /translation="MTSTSTVDYQRTDGGTLRLTFSEPEGALRGGLVVLHEADGVTDGV
FT                   RLLLASLATEGWLTVTPHLENDRLTQQDLLDATDLTLAWLVERGVQADLLGVMGFDLGG
FT                   SAALVVASHRKLGAAVSVGGQQAVELPALVEIAGRLTSPWLGMYGDAGDEAGGADVERL
FT                   RDAAASAKVATNVVHYPGANHRFDADPDAAAEAWQRTLNWFDAHLR"
FT   gene            286404..288383
FT                   /gene="acsA"
FT                   /locus_tag="AMED_0274"
FT   CDS_pept        286404..288383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acsA"
FT                   /locus_tag="AMED_0274"
FT                   /product="acetoacetyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42097"
FT                   /db_xref="GOA:A0A0H3CTX8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR005914"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTX8"
FT                   /protein_id="ADJ42097.1"
FT                   /translation="MTHTADAPEVLWRPEPGHVADTKIEAFRRWLRAERGVEVDDYRAL
FT                   WEFSVERGPDFWAAVADFLSVRWHDQPGEVLSGGMPDAVWFEGGTLNYAEHALTPGVAG
FT                   AAKADDETAVIFHREDGFASHLTYGELRAQVAAARAAFLELGVGKGDRVVALAPNCPQT
FT                   LVAFLAAASIGAVWSSCSPDFGVRAVADRFVQIEPKVLFAVNAYAYNGRQFDIRTTIAE
FT                   LQAQLPSLAATVLVEYVGEGRMDGALDWAELLARHAGAPLLFEPVEFAHPLWVLYSSGT
FT                   TGLPKGIVHGHGGITLEHLKALALQTDLGPGDRFFWFSTTGWMMWNFLISGLLVGTTIV
FT                   LYDGSPGYPDLNALWHLAEQHRVTYFGTSAPFIQSCLKAGLKPAERYDLTGLRALGSTG
FT                   APLSVEGFRWIVDEVGKNVQICSVSGGTDLCAAFVASAPDVPVWLGELSCPALGAAVNA
FT                   FDEAGNAVVEQVGELVITQPMPSMPVFFWNDPDGSRLREAYFEMYPGLWRHGDWIRITN
FT                   RGSAVIYGRSDSTLNRGGVRMGTAEFYRVVEGYDEIADSLVVDTSAAGNEDGQLICFVV
FT                   LAGGVALEDVEPRLRKELRSALSPRHVPDRFVVVSEIPRTLNGKKCEVPVKKILAGVAP
FT                   DRAVSRDALANPAALTPFVELAGG"
FT   gene            288421..290136
FT                   /gene="lysS"
FT                   /locus_tag="AMED_0275"
FT   CDS_pept        288421..290136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="AMED_0275"
FT                   /product="lysyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42098"
FT                   /db_xref="GOA:A0A0H3CUX8"
FT                   /db_xref="InterPro:IPR024320"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUX8"
FT                   /protein_id="ADJ42098.1"
FT                   /translation="MVTGTRAQITWKAAGATTVGVITWVTRLAGLMTLGSILIPAGRRS
FT                   LRGHLAEWLELPQEATVAAATVALVMGVLLVMLAAGLRRRKRRAWQLAVGATVLLTMSH
FT                   LGLKHVFGAGLVSVVLLVGLIANRRYFVAKPDPVVGRWRAVRVFVQLALAGFVINVILL
FT                   SVAPRAALEPMGFGDRLAESALALVAASGPAVFHQMWLEDFTTAVGLLFGLAALLVSAY
FT                   FLLRSAEPAPRLSDEEVARLRRLLDEHGERDSLGYFALRRDKFAVFSRTGKAAVTYRVI
FT                   AGVALCSADPLGDHEAWPGAIEEYLEVCRRGGWVPAAMGVSELGATVWARFGLEVLEIG
FT                   DEAVVDAAGFTLDGRTMRGVRQAAARTKRAGYKVLVRRAEDLRPGELEELEVLAATWRG
FT                   TDTERGFSMALGRMGDPRSVLVTAEQGGRVRGVLQFVPWGPTGLSLDVMRRDRSADNGV
FT                   NELMISELLLAAGRHGVSQVSLNFAAFRALMEQGQRIGAGPVAKTAAKVLHFFSRWIQI
FT                   ETLYRFNAKFQPRWVPRYLVYPGVRELPRVGIATFEAEGLGGRSPRLLRLLRRA"
FT   gene            290202..290291
FT                   /locus_tag="AMED_R06"
FT                   /note="tRNA-Ser-GCT"
FT   tRNA            290202..290291
FT                   /locus_tag="AMED_R06"
FT                   /product="tRNA-Ser"
FT   gene            290333..290406
FT                   /locus_tag="AMED_R07"
FT                   /note="tRNA-Arg-ACG"
FT   tRNA            290333..290406
FT                   /locus_tag="AMED_R07"
FT                   /product="tRNA-Arg"
FT   gene            290624..291868
FT                   /locus_tag="AMED_0276"
FT   CDS_pept        290624..291868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVZ2"
FT                   /protein_id="ADJ42099.1"
FT                   /translation="MEEHAEPQPEAAPKRRVVRAADEPVHRLLGWQRLAGNQAVVAMLG
FT                   KSEPAVPVQRLMVRMPNPYGEGMHNMVGDAEVDEIEESLTAKGAAGAGGKHAWDGSWTF
FT                   PPTPTTEASVFYGHGNRAKLGGVTPVDFVADVSDDQRQLKKDTAFKFVACGGGRAQAAA
FT                   GTAYGHEVAEFLRASQTIVPGEDWSGALKATEGLVYYTNTYKTVVPEIPPAIDKLLIAR
FT                   TATAESNVRKRVTALVRDQLAAVATAQRARDFAEFRDAVATWYESDAALAGRAASVRKI
FT                   VIPVAGLSNTWLGAKLNSAMDTMFGGDVGWLSLQEAFLQTLSSGNCLFDVYQLFAGIEA
FT                   DMKLVAKAIWAEFRNELQRQAAVPARDTGPAGRIGTHDPSTAASPDERFAKWQDFGDVL
FT                   WTQWKANRLQGGNPT"
FT   gene            292077..293705
FT                   /locus_tag="AMED_0277"
FT   CDS_pept        292077..293705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0277"
FT                   /product="chitinase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42100"
FT                   /db_xref="GOA:A0A0H3CVN4"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018366"
FT                   /db_xref="InterPro:IPR029070"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVN4"
FT                   /protein_id="ADJ42100.1"
FT                   /translation="MSRKRWHLLGLFTAVGALAIGLVTVPASAAGGVSATFSKGSDWGT
FT                   GYEGKYTINNGSGSTLATWTVEFDLPSGAKIGSLWDGSYTASGQHVTVKNTWNGNVGNG
FT                   ASASFGFNVSYSGTYAAPANCKLNGGSCDAGGGTPTTTPTTPTQPTTTPTTPTTPTTPT
FT                   TTPPPPPGGLKNVGYFVQWGVYGRNYHVKNIETSGSASKLTHINYAFGNVTNGQCTAND
FT                   DPYADYQKTYDAAGSVDGVADTWDQPVAGNFNQLRKLKKLHPGLKVIWSFGGWTYSGGF
FT                   GQAAQNAAAFAQSCYNLLKDPRWADIWDGIDIDWEYPNACGLSCDTSGAAAYKNLMGAL
FT                   RSKFGSSFLITSAITADGSNGGKLDVADYGGASQYVDWYNVMTYDYFGAWAAQGPTAPH
FT                   SPLTNFAGIPTPGFYSDAAIQKLKSKGVPSSKLLLGIGFYGRGWTGVTQSTPGGTATGP
FT                   APGTYEQGIEDYKVLKNTCPSTGTFAGTAYAKCGSNWWSYDTPATIGGKMSYAKQQGLG
FT                   GAFFWELTGDTTGGELISAMKNGLS"
FT   gene            293702..295048
FT                   /locus_tag="AMED_0278"
FT   CDS_pept        293702..295048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0278"
FT                   /product="chitinase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42101"
FT                   /db_xref="GOA:A0A0H3CXP7"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018366"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXP7"
FT                   /protein_id="ADJ42101.1"
FT                   /translation="MTRRWWPALGLAAAAATIGAMFVIAPANAAGGVSATFSKGSDWGT
FT                   GYEGKYTIANGSGSTLATWTVEFDLPSGAKISSLWDGSYTASGQHVTVKNTWNGNVANG
FT                   GSASFGFNVAYSGSYAAPSNCKLNGGSCAAGGTPPTTTTPPTTTTPPTTTPPPAGGRGA
FT                   PYLYMGWGSPPNPQTVMNATGIKWFTMAFINASGGCTPAWDSSRPLSGSADANAIAQIK
FT                   AAGGQVIPSFGGWSGNKLGPNCSTPSALAGAYQQVINAYGLKAIDIDIENSDEFENEAV
FT                   QDRILGALKIVKQNNPGIQTILTFGTSTTGPNYYGNRLIDQSKALGANVDVFTIMPFDF
FT                   GGGANMYNSTVSAANGLRDKLKSTFGWSDATAYAHLGISGMNGLSDQQELTDLPTWTQI
FT                   TNWAKSNKIARLAFWSVNRDRGCPGGGVQSACSGIAQNDWDFTKVTAGF"
FT   gene            complement(295163..296464)
FT                   /locus_tag="AMED_0279"
FT   CDS_pept        complement(295163..296464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0279"
FT                   /product="2,2-dialkylglycine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42102"
FT                   /db_xref="GOA:A0A0H3CTY3"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTY3"
FT                   /protein_id="ADJ42102.1"
FT                   /translation="MAESFWADVDRHLVRYGGTFTPEIIDRAEGSFLFTEDGRRILDFT
FT                   SGQMSAILGHSHPEIVETVRRQVGKLDHLFSGMLSRPVADLARRLAETLPAPLEKALLL
FT                   TTGAESNEAAVRMAKLVTGKHEIVSFARSWHGMTQAAASATYSAGRRGYGPATPGNFAI
FT                   PAPNAYRPDFTDASGSLDWRRQLDFGFEMIDAQSVGSLAACLVEPILSSGGIIEPPPGY
FT                   FAALAEKCRERGMLLILDEAQTGLCRTGNWYAFERDGIVPDILTLSKTLGAGLPLAAVL
FT                   TSAAIEQEAHDRGFLFFTTHVSDPLPAAVGNTVLDVLTRDRLDARALSLGAVLRRGLEE
FT                   LAAGHEVVGDIRGRGLLAGLELVVDRETKRSSDELGARVTQRCLELGLHMNIVQLPGMG
FT                   GVFRIAPPLTASEEEIALGLSILDQAIGEAVKLL"
FT   gene            296552..297469
FT                   /locus_tag="AMED_0280"
FT   CDS_pept        296552..297469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0280"
FT                   /product="LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42103"
FT                   /db_xref="GOA:A0A0H3CUY2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUY2"
FT                   /protein_id="ADJ42103.1"
FT                   /translation="MLNPWRLRLLSRLDTLGTVRAVAQDANLSASSVSQQLAVLEAETR
FT                   TQLLERTGRRVRLTPAGLMLARRARVILDHMDTVEAELRSLGEEPAGLVRLGAFQSAIH
FT                   TLAVPAVTRLAHPHLEVQLLELEPHESIPALRGGDADVIITTTDFVELPLGPDLDIVPL
FT                   ATDPIVLVTPPEAPRGPAVLSAYADAPWALDAPQSYMANLTLRLCRESGFEPRVVCRFS
FT                   NYLMTLQHVEAGLSIALLPGLAVDRRYRVATRELATPVTRTIAAVVRRGTPLRAGVNVV
FT                   LDALRQPPELPELPEWVGLRSSSP"
FT   gene            complement(297543..298586)
FT                   /locus_tag="AMED_0281"
FT   CDS_pept        complement(297543..298586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0281"
FT                   /product="TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42104"
FT                   /db_xref="GOA:A0A0H3CVZ8"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011717"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVZ8"
FT                   /protein_id="ADJ42104.1"
FT                   /translation="MPGRLKKFDEFFQRKAAEGGNVVAMARMGAAMRERGELPEAESWY
FT                   RKAAMGGDRVSMTALAHLLAERGAQEEAERWYHEAALAGEPHGMQHLAKSCERRGKRDD
FT                   ARHWYGEAARTGDLPSMAALGRLLREDGKGDEAESWLRQAAEAGFTGAMIDLGVVLRDR
FT                   GQAAEAARWWRSAVQAGDLAATCQLGRQAERLGRPSDAESWYRQGARGGHVEAVTRLGL
FT                   LLHRRGDLEEAETWYLEAAERGDPAAMTNLGVLARNRGDEGEAAAWYRKAAEHGSIPAL
FT                   TNLGHLAEHREDLATAEQWFRRAAETGDVQGMLSLARMLRARGAAHEAELWLARAETVQ
FT                   DEREHQH"
FT   gene            298765..299436
FT                   /locus_tag="AMED_0282"
FT   CDS_pept        298765..299436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0282"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42105"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVP0"
FT                   /protein_id="ADJ42105.1"
FT                   /translation="MAARGFRLSVTQRTLLVVTILALALFGYWATRGAGAAPPTSGAPV
FT                   PVSAADAQKQLDELAIGARTSMDGYSREKFPHWDSQGSGCDTREVVLKRDGKDVKTDKD
FT                   CRPTSGTWTSVYDEETWTKATDVDIDHMVPLGQAWASGAKSWTTEKREQFANDLTRPQL
FT                   FAVTDNLNQQKSDKAPDEWKPPLVAFWCTYATDWIVVKHYYGLTITQGEKTALTDMLRR
FT                   C"
FT   gene            299447..300085
FT                   /locus_tag="AMED_0283"
FT   CDS_pept        299447..300085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0283"
FT                   /product="alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42106"
FT                   /db_xref="GOA:A0A0H3CXQ3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXQ3"
FT                   /protein_id="ADJ42106.1"
FT                   /translation="MTTFALIHGGGGSGWDFHLLIPELAARGHDAVAPDLPITDSSAGL
FT                   AEFTETVLAALGDRTDVAVVGHSYGGFTAPLVAAKVRARLLVYLAGMIPAPGEPPGQWW
FT                   GNTGFEAPKGLTETEQFFNGVPADLAEQCQAHGREQASKEWDEPWPLPAHPDVPTRVLL
FT                   ARDDRFFVPDFQRRVARERLGIEPDELDGPHCVPLSHPGALADRLVSYL"
FT   gene            300211..300954
FT                   /locus_tag="AMED_0284"
FT   CDS_pept        300211..300954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0284"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42107"
FT                   /db_xref="GOA:A0A0H3CTY8"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTY8"
FT                   /protein_id="ADJ42107.1"
FT                   /translation="MRFAHVLALTAIAAGSFLAAPAASAATLPACRHFYTGSIPDRPVT
FT                   GGHGPGTLVGAVDVGNRLPAPGSVSGGLGTDGKVAFTFARVAGAKAYRAFRNGQALQWI
FT                   SDWGQPTLTVTDASPCQNANYQLYAMTAEDNSPGSLGQVSTAYRLDGANRLAAYRIPAG
FT                   TTLNYRVTAYNDVAQTALGYQAGPGFCAVDARNIPWGTRFSVPGYGECYAADIGSWISG
FT                   DIVDVWLPGSQADAWGIQRLTLTVR"
FT   gene            complement(301136..301774)
FT                   /locus_tag="AMED_0285"
FT   CDS_pept        complement(301136..301774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0285"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42108"
FT                   /db_xref="GOA:A0A0H3CUY6"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUY6"
FT                   /protein_id="ADJ42108.1"
FT                   /translation="MMTPEELLTTTRTVRKRLDLERPVPLDLVKHCIQVALQAPSGSNT
FT                   QRWQWLVVTDVDQRAALGEIYRRACEEYLASPNAAGKLFADDPERAQVQQRVGDSVAYL
FT                   ADRMGDVPVLVVPCLETASSELPPGNQAGLWASLLPAVWSFMLAARSVTLGTAWTTLHL
FT                   KYEQEAAEVLGLPKNVHQAALIPTAFYTGDTFKPAARQPLDEVLHLDRW"
FT   gene            complement(301793..302770)
FT                   /locus_tag="AMED_0286"
FT   CDS_pept        complement(301793..302770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0286"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42109"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW04"
FT                   /protein_id="ADJ42109.1"
FT                   /translation="MENRKIARLGREVSVVGLGCWQLGADWGEVDENDALGVLHAAADN
FT                   GVTFFDTADVYGDGRSERLVGRFLAERGDVFVATKMGRRVEQVPENYVAANFREWNDRS
FT                   RRNLGVDTLDLVQLHCPPTPVYSSDAVYDALDAMVDEGRIKAYGVSVETCEEALTALAR
FT                   PNVASVQIILNCLRLKPLERVLPAAAEAGAGIIARVPLASGLLSGRYTASTTFAENDHR
FT                   NYNRHGDAFDVGETFSGVPYEVGLEAVERLRGLVPSGRTLAQFALRWIIDQPGVSTVIP
FT                   GARNAGQAEANTAAAALPPLSAEATAAVRETYDELIRPLVHDRW"
FT   gene            302813..303313
FT                   /locus_tag="AMED_0287"
FT   CDS_pept        302813..303313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0287"
FT                   /product="MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42110"
FT                   /db_xref="GOA:A0A0H3CVP5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVP5"
FT                   /protein_id="ADJ42110.1"
FT                   /translation="MAMTGDPERRGPEGLGTRMRHVLEILDGDVARFLADIGLDDYRPR
FT                   YSPVVRALLARGPLAIRDLAEEMRVTHSAASQTVAQMHRAGFVSLEPGVDARQRIVSLT
FT                   ARTRELLPLIEAEWTATTEATAALEAELPYSLRALLDDIVEALERKPFRQRIGETTAAQ
FT                   ELR"
FT   gene            complement(303327..303746)
FT                   /locus_tag="AMED_0288"
FT   CDS_pept        complement(303327..303746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0288"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42111"
FT                   /db_xref="GOA:A0A0H3CXR0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXR0"
FT                   /protein_id="ADJ42111.1"
FT                   /translation="MTTSRTPQRTATAAAPLRVLLPADVTAPALARHEVRAALLRLGVG
FT                   ERQLEDILLATSELVTNAFEHGERPQRLELEYAAGRLTLRVHDTGRMLPELRAPSPAEA
FT                   RSRGLVLVQALSLDWGFERCPGGKYVWAVFPLPDA"
FT   gene            complement(303809..304588)
FT                   /gene="sigB"
FT                   /locus_tag="AMED_0289"
FT   CDS_pept        complement(303809..304588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigB"
FT                   /locus_tag="AMED_0289"
FT                   /product="RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42112"
FT                   /db_xref="GOA:A0A0H3CTZ4"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014322"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CTZ4"
FT                   /protein_id="ADJ42112.1"
FT                   /translation="MSDPAGSSGNDLDVGALFTRLAALPADSPERERIRDTLVRTHLEL
FT                   ARNLARKFRNRDEAMEDLVQIATVGLIHAVDRFDPAQGTDFLAFAVPTISGELRHHFRD
FT                   NSWSVRVPRRLKELNANISAAREELTVQLSRAPKPSEIAARLGVPIEDVYEGLRAGQGR
FT                   YGASLDHLLENAAHTRFGAPDAELGQAELREALRPMLESLPERERKIVALRFGSGMSQS
FT                   DIARRVGVSQMQVSRLLAATLKKLRSGLDESELADGT"
FT   gene            complement(304585..305001)
FT                   /locus_tag="AMED_0290"
FT   CDS_pept        complement(304585..305001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0290"
FT                   /product="anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42113"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUZ0"
FT                   /protein_id="ADJ42113.1"
FT                   /translation="MEDNAPLVPEGAQVIEVRTAAIPHVVPTLRTIVADIAMRQDFDLD
FT                   AVEDLRMAVDEACSLLLPASSDGRLTCVFSWNGPRIEVSVSVLADSADHEDDAGLSWQL
FT                   LTALATTAERTITPENGRYLSRVDLVRESQAADS"
FT   gene            305165..305473
FT                   /locus_tag="AMED_0291"
FT   CDS_pept        305165..305473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0291"
FT                   /product="transcriptional regulator WhiB"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42114"
FT                   /db_xref="GOA:A0A0H3CW08"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW08"
FT                   /protein_id="ADJ42114.1"
FT                   /translation="MADVSRLPNVVAEEWEWQLRGSCRGADSSLFFHTDNERGSARERR
FT                   EARAKAICQACPVLAQCRKHAMTVQEPYGIWGGLGEIERRQLFLRQRRAARKTMSAH"
FT   gene            305692..306045
FT                   /gene="spoI"
FT                   /locus_tag="AMED_0292"
FT   CDS_pept        305692..306045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoI"
FT                   /locus_tag="AMED_0292"
FT                   /product="anti-anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42115"
FT                   /db_xref="GOA:A0A0H3CVQ0"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVQ0"
FT                   /protein_id="ADJ42115.1"
FT                   /translation="MPAADQNATPPGFGITLDTDATEPRVVVTGELDLLTSPQLQEALA
FT                   GLIADKRAQRVVADLTGVTFFDSSALNVVLRAQRQAGEQDVELAVVPSPAVSRVIELTG
FT                   VAEHLSVSEDPQA"
FT   gene            306144..306893
FT                   /locus_tag="AMED_0293"
FT   CDS_pept        306144..306893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0293"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42116"
FT                   /db_xref="GOA:A0A0H3CXR5"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXR5"
FT                   /protein_id="ADJ42116.1"
FT                   /translation="MALAPAVGAGSVHQAVVFAATTAGFALLPDLDHPGASASRLLGWL
FT                   TGALSWLLRRVSAGFYALTKGPRDENVSGKHRHLSHTVLFAAGLGLLTSWGTTEGGPWA
FT                   VVGVVVFGLMLAEGALGDWLLPVSGAAVAWWFFTAPPDRAGELASISGWLGIAVAAGCL
FT                   THCLGDALTEAGCPFLFPIPIAGETWYEIRPPRVLRFRTGKKVEKRLIFPVFALLGVLL
FT                   VPGVWEHTVSTFERLFIPPSSQQATTP"
FT   gene            complement(307166..307597)
FT                   /locus_tag="AMED_0294"
FT   CDS_pept        complement(307166..307597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0294"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42117"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CU01"
FT                   /protein_id="ADJ42117.1"
FT                   /translation="MPRTVPEIAALVRSGLSTLDVAPFASLFAADAVYEVPFLGERIEG
FT                   REAVVATLTAGGVRARAAGLTKAQVTTTLAESGFVVELVVSGPGIEFPSSVGLITVVEG
FT                   EITSYRDYPDTSAAAKLARSSNPEGGERVVKAESPQIAE"
FT   gene            complement(308207..309433)
FT                   /locus_tag="AMED_0295"
FT   CDS_pept        complement(308207..309433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0295"
FT                   /product="major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42118"
FT                   /db_xref="GOA:A0A0H3CUZ4"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUZ4"
FT                   /protein_id="ADJ42118.1"
FT                   /translation="MGVLRNRDFRRLWLADLASQLGSRIDVLAVPLLAVTVLDAPVFEV
FT                   SLLRTAATLPYLVLGLQVGVWCDRIRHRPVLIAADAGRAVLIASVPVAALFGVLGMAQL
FT                   LAVVLGVGLLGVFFDVAHQTYVPQLVRLEQLPEANTRLQTNRSLAAVAGPGLAGVIVQA
FT                   LGTAAALAADAVSYLWSALWLRRIETPDRRPEPRERRLLREIGEGLRLVRDDRVLLAIS
FT                   AHGAVSSFFQSAHLAIVIVFLAREVGLSPWVIGVLGTASLTGALTAGLTARWLGDRIGQ
FT                   ARALWGAAVLFGLAYQFYPFTGRGWALACYVVAGFFSSYSVIVLSVFGVSFQQAVTPPE
FT                   LLGRVNAISQTLVFGIVPLGSLLGGTLAGTVGMRATLHIAAAGVLASAAIMVWSPLRKL
FT                   RDLTPADRR"
FT   gene            complement(309531..309914)
FT                   /locus_tag="AMED_0296"
FT   CDS_pept        complement(309531..309914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0296"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42120"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVQ4"
FT                   /protein_id="ADJ42120.1"
FT                   /translation="MHRQSRQIEVSGKGDEVEVGVTEVTEVAGGRVTSTTLVVVVAGGV
FT                   STEVTVAAGADSVTVTGTAETVLVGGGSVVSAVRGAGRPATSVAATSNPVAKPARPVTA
FT                   AEPQVGRLVIRAPPRHVQRRYED"
FT   gene            309909..310412
FT                   /locus_tag="AMED_0297"
FT   CDS_pept        309909..310412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0297"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42119"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW13"
FT                   /protein_id="ADJ42119.1"
FT                   /translation="MQPGGGRRRLVGMRYVLGFAMLAAVTAGCTGPEVACTAIGVPVGI
FT                   SLSIPSPDGISKATLEACWRDRCGTHEVGLYPETSAGATTCTGTGPDSSCGTSMVPTGG
FT                   LHGFATIPDLPAEPVKVTVRFDDGKPHTVEVKPSFTEPNGPACGKAGPQAQLVAGAGHE
FT                   LRVR"
FT   gene            complement(310409..312043)
FT                   /locus_tag="AMED_0298"
FT   CDS_pept        complement(310409..312043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0298"
FT                   /product="putative exporter of polyketide antibiotics"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42121"
FT                   /db_xref="GOA:A0A0H3CXS2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXS2"
FT                   /protein_id="ADJ42121.1"
FT                   /translation="MTATLDRPAVVAPAHELAGTWHLIRLALRRDRVILPIWIVLLSVV
FT                   PASTVKTFTQFYPTVADRLALQAGANANPSYALLYGPPFDLTTAGGFIAWRMCGFLALL
FT                   TGLMVVFTVTRHTRAEEDTGRAELLASAVVGRYAALTAALLVAGGASVLTGLIQAVTMI
FT                   GAGLPAAGSLAFGASEALAGLVFTAVAAVAVQLAEYSRTANGIGTAVVGAAFLLRGAGD
FT                   STVDARWLSWLSPIGWVQQVRAFAGERWWVLLLPVVFALVAGGIGYWLLPRRDVGVGFL
FT                   PPRPGPARAAASLRSPFALAWRLHRGPLLGWTIGTAVVGAVFGSIASGIGGLVGSSPQA
FT                   QQIMARLGGSHALTQAFLAAMAGMFAMVASLYGVQAVLRMRGEETAIRLEPVLATSVGR
FT                   LRWAGSHLVFAFFGTAVLLLSGGVFMGLANGLRTGDVGGSLADTLAGMLVQLPATWVVV
FT                   ALAVAIFGVLPGFSAAAWAVGALALLLSLFGPILDLPQAVLDVSPFQHPPKIPGQAFTE
FT                   TPLVWLLAVAIVALVAGLAGWKRRDVG"
FT   gene            complement(312040..312936)
FT                   /locus_tag="AMED_0299"
FT   CDS_pept        complement(312040..312936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0299"
FT                   /product="ATPase component of ABC-type multidrug transport
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42122"
FT                   /db_xref="GOA:A0A0H3CU06"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CU06"
FT                   /protein_id="ADJ42122.1"
FT                   /translation="MDNAISVTGLHKSFGRTKALDGLNLQVPAGEVHGFLGPNGAGKST
FT                   TVRVLLGLLHADAGDVRLLGGNPWKDAASLHRRLAYVPGDVNLWPNLSGGEVIDLLGRL
FT                   RGGLDEKRRAELVERFDLDPKKKGRTYSKGNRQKVAIVAALASRVDLLILDEPTSGLDP
FT                   LMEATFQYAIQEEREQGRTVLLSSHILAEVEALCDKVSIIRNGRTVESGTLAELRHLTR
FT                   TSITAELAGPPNGLTRLSNIHDLKIEGNRVRFDVETRSLDEALRQLTEVGVRSLVSQPP
FT                   TLEELFLRHYTTAASAK"
FT   gene            313030..313518
FT                   /locus_tag="AMED_0300"
FT   CDS_pept        313030..313518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0300"
FT                   /product="MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42123"
FT                   /db_xref="GOA:A0A0H3CUZ8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUZ8"
FT                   /protein_id="ADJ42123.1"
FT                   /translation="MTTPDTKRDEDAVRRYVESLGLVLSQIGMQRMPARVFAALMTTDE
FT                   GRLTAADLAAQLQVSPAAVSGAVRYLEQIGLVAKEREPGERRDHYRLYDDLWYATFMKR
FT                   DRMITMWRDAAENGIDALGEDTPSGRRLAEMRDFLSFMLEELNRMYERWHKLHEEKNA"
FT   gene            complement(313515..314078)
FT                   /gene="rutR"
FT                   /locus_tag="AMED_0301"
FT   CDS_pept        complement(313515..314078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rutR"
FT                   /locus_tag="AMED_0301"
FT                   /product="TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42124"
FT                   /db_xref="GOA:A0A0H3CW17"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW17"
FT                   /protein_id="ADJ42124.1"
FT                   /translation="MGSREEIVAAAAKVMREQGYAHATTKVIAQTAGYSEALLYKHFRD
FT                   KTDLFRSVLAEELPALGATLAELTADPGQAPLRDNLVRVARLGLAFYVDSFPIAVSMFS
FT                   SRELLRSHRERLRGHGPHLPVRAVAGYLRAEQALGRLKADTDVEAAAALLLGACFQQAF
FT                   LATFEETEPADQAERLADVLLAGL"
FT   gene            314162..314770
FT                   /locus_tag="AMED_0302"
FT   CDS_pept        314162..314770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0302"
FT                   /product="putative NADH-flavin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42125"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVQ9"
FT                   /protein_id="ADJ42125.1"
FT                   /translation="MKITVLGATGGVGGEVVKQALDRGWDVTAVVRDPAKLKLPARVVV
FT                   AGFPDHEKLAAAVEGRDAVISAVGSRDRGPTTVCVDGARAAIEAGAKRLLVVSASGMHT
FT                   EGDGFFTRSLVKPLLNRVLKHGWADMLAMEAVVEATDLDWTIVRPPMLLNGPRTGKVAS
FT                   RLDGNVRTFTIRRADVAAYLLDAVADPTLIRRKVSIAHG"
FT   gene            314780..315445
FT                   /locus_tag="AMED_0303"
FT   CDS_pept        314780..315445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0303"
FT                   /product="SGNH hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42126"
FT                   /db_xref="GOA:A0A0H3CXS8"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXS8"
FT                   /protein_id="ADJ42126.1"
FT                   /translation="MVLLAQALYVKRKTPRLPGAAGPTEGLVPGHGEPFRLAVLGESTV
FT                   DGVGAADHEEALTGCLARELARDGRAVRWQAVGRTGANARVVRAELVPEVRPADLVVIA
FT                   LGVNDTIELRTAAGYRRDLLRLVLELRRRLGPVDVLLAGVPPMARFPALPRPLRDVLSA
FT                   RSTALDHATATLERIPGVRHVRMDPALLDPAAFASDRFHPGAAGYARWAGTLAHAVIS"
FT   gene            315862..316467
FT                   /gene="rpoE"
FT                   /locus_tag="AMED_0304"
FT   CDS_pept        315862..316467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoE"
FT                   /locus_tag="AMED_0304"
FT                   /product="RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42127"
FT                   /db_xref="GOA:A0A0H3CU12"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CU12"
FT                   /protein_id="ADJ42127.1"
FT                   /translation="MTDVQTTEVDPPWEGLTGAELHAACMQAARDGDRRAMARLVEELT
FT                   PLVWHVARANGLDRAVAEDVVQTVWLALFSQLGKLRDPKALAAWLITTTRREATHPFGR
FT                   RMQPVPLSDEVAETMPSTQPAPEDEAVRADRDRRVWRAFVRLPHRCQELLRLTVLAGRA
FT                   EYQLVAEALRMPRGSVGPTRGRCLDQMRDLLASEGGSR"
FT   gene            316464..316943
FT                   /locus_tag="AMED_0305"
FT   CDS_pept        316464..316943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0305"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42128"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV01"
FT                   /protein_id="ADJ42128.1"
FT                   /translation="MNDLGAPGGQASFGDDVLLADIGRFLDELDPPPGDLVQRVQFALA
FT                   LEDLDVEVARWERLDDLAGVRGGGTGTITFTVSDLTVMINLTKMGKLHRIDGWLVPAGQ
FT                   YGVEVRVAEHGTSSTTADEGGRFVLDNVPRGTTQILVHLGDVSCRRTVVTPTVVL"
FT   gene            complement(316940..317689)
FT                   /locus_tag="AMED_0306"
FT   CDS_pept        complement(316940..317689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0306"
FT                   /product="chitooligosaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42129"
FT                   /db_xref="GOA:A0A0H3CW21"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW21"
FT                   /protein_id="ADJ42129.1"
FT                   /translation="MVAAAALALTGCSGHEPDQRESATSQPNPAPQGLNPDVKTSGPYP
FT                   FGTVQQKVPPIENGQVPLIRRITTDKPYVFLTMDDGAVQDPDALKLMQQNGTHPVLFLN
FT                   QKYVKGHEAYFKQILDATGATLGDHTVSHPNLKGKPYEFQRKEICDDADDFQRDLGVRP
FT                   SLFRPPFGNYDQNTLRAAAACGMRASVLWTAAVNDGVVQFQSGDKLKSGDIVLMHFRKT
FT                   FKEDYTAFVERAKKDGLTPVPLADFLG"
FT   gene            complement(317804..318253)
FT                   /locus_tag="AMED_0307"
FT   CDS_pept        complement(317804..318253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0307"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42130"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVR4"
FT                   /protein_id="ADJ42130.1"
FT                   /translation="MGRKYSYEVNRTSTAPPEALFALEADGPRWAEWGKPLIVQARWAR
FT                   RGTTEPDGVGAVREVGMWPVLIREETLEYEPGRKHVYAFAGGKPIKDYRAEVLFTPTDG
FT                   GGTHLRWTGSFTEPVKGTGPALAATLRIVIRLFSAKLVKAAETGR"
FT   gene            318322..320289
FT                   /locus_tag="AMED_0308"
FT   CDS_pept        318322..320289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0308"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42131"
FT                   /db_xref="GOA:A0A0H3CXT4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXT4"
FT                   /protein_id="ADJ42131.1"
FT                   /translation="MSTPRPDLAAPHWLVQLLRSTPVPVPWNMVARAVVALAVPLAIAY
FT                   AAGDIAVGALISTGALPAVLSESAGPYRYRARRLGGATLAATAGYLAGLLTGGTPALSM
FT                   PTVILVAAVSAVISAAGSNASVAGLQMLVFCVIATGQHATGVRVEVLFGCFCLGAAWSL
FT                   LVALVTWTVRATSPERTAVAHVYVELAAMLSATDEAVSRVARHRLTTAMNTAYDQLLTA
FT                   RSWLSGRDAAYRHLLNLLSATTPAVEASVAMVNAGRRPAAEVIDHFVALSAAVLAGQPL
FT                   PAPPPVPPGDPDPVLAALYAGLVRIGKGDDRKRRLPTPWHRRLREWAASLASGPLTWIA
FT                   ALRLTLCVAIAEVVGLLVPLERSYWITLTVGIVLKPDFGSVFGRAVLRGIGTVIGVGIG
FT                   AAVLGLGANGWVLVVLSAIFAGGIAVGKVRNYGIQSAFVTPLIILQMGLAHTGNWSVVL
FT                   ARLVDTVLGCVIVLVFGYLLWPGSRRPRVGGRLADGLDAVAKYVSHALVEASSGEARLA
FT                   RSRARRGAYRALADLRTAFQQAVVEPSAHGRQAVAWWPVIAAQERVADAVTEVGVTIGR
FT                   GVPPPAPADVELLTAALGELASAVREQRAPRSMPLPDAPQLSGVVDQLESAFDAVRGPD
FT                   LAERAPLGLVRRFLPYHRRT"
FT   gene            320313..320516
FT                   /locus_tag="AMED_0309"
FT   CDS_pept        320313..320516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0309"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42132"
FT                   /db_xref="InterPro:IPR028037"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CU19"
FT                   /protein_id="ADJ42132.1"
FT                   /translation="MGIDFEALKGKAEEALREHNDKIEEGLDKAADFAKSKFAGHDGQI
FT                   DSGVEKAKDFLNKFDDTPDAPR"
FT   gene            complement(320517..321470)
FT                   /locus_tag="AMED_0310"
FT   CDS_pept        complement(320517..321470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0310"
FT                   /product="prephenate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42133"
FT                   /db_xref="GOA:A0A0H3CV05"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV05"
FT                   /protein_id="ADJ42133.1"
FT                   /translation="MIGLGLIGGSLLRAAAAHGRTAWGAAVSEVDADAASRAGYDVTTD
FT                   VEAALHRAAAEDAMVVLAVPLPAVEDLLRLVNQHASHCLLTDVTSVKAPVLDAVRRRVP
FT                   YTRYVGGHPMAGTSNSGWLAGDATLFQGAAWVVAVEEDTDLDAWAEVAKLVLDIGAHVV
FT                   PLPAESHDEAVARISHLPHLLAAILATIGAEGGPLAMSLAAGSYRDGTRVAGSNPQLVR
FT                   AMTEGNRDALLPIVDEALGRLGAARGSLASTGGLAATINAGYEGAQALAASLDVERAGV
FT                   RISLAAPDARQGLIALGERGGRITGLADGIATGEVQ"
FT   gene            complement(321521..323533)
FT                   /gene="fadH"
FT                   /locus_tag="AMED_0311"
FT   CDS_pept        complement(321521..323533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadH"
FT                   /locus_tag="AMED_0311"
FT                   /product="NADPH-dependent 2,4-dienoyl-CoA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42134"
FT                   /db_xref="GOA:A0A0H3CW25"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW25"
FT                   /protein_id="ADJ42134.1"
FT                   /translation="MSPYPHLLSPLDLGFTTLRNRVLMGSMHTGLEDKAAHFPALAEYY
FT                   AERARGGVGLIVTGGFAPNRTGWLLPLASKLTTSAEAKRHRQLTTPVHEAGGKIALQIL
FT                   HAGRYAYHPLSVSASSIKAPINPFRPRALTGYGVRQQIRAFADCAALAREAGYDGIEIM
FT                   GSEGYLINQFLAERTNKRTDAWGGTPEKRRRFAVEIVKRTREKAGDDFIIIYRLSMLDL
FT                   VPGGQRWEDVVALAQEVEAAGATIINTGIGWHEARVPTIVTSVPRAAFTWVTGKLKPHV
FT                   TIPVVTSNRINMPQVAEEALSSGDADLVSMARPFLADPEWIRKAETGRDDEINTCIACN
FT                   QACLDHAFKRKLVSCMVNPRAGHETTLTLAPARRTKHVAVVGAGPAGLAAATALAERGH
FT                   SVELFEADAEIGGQFGIARKIPGKEEFAETIRYYRRRLEVTGVKLHLGKRVAAAELTGF
FT                   DEVVLATGVAPRVPSLPGIDHPKVLSYVDVVKHGKPVGERVAVIGAGGIGVDVSEFLTH
FT                   TSSPALDLDAWLAEWGVTDPEQAAGGLGTPRPEPSPRQVFLLQRKKSGIGAGLGKTSGW
FT                   VHRAALKAKKVEQLTGVTYERIDDDGLHITVDGEPRLLDVDTVVVCAGQEPVRDLADDL
FT                   RAAGLPVHLIGGADVAAELDAKRAIDQGTRLAAAL"
FT   gene            complement(323607..324152)
FT                   /locus_tag="AMED_0312"
FT   CDS_pept        complement(323607..324152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0312"
FT                   /product="PadR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42135"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR018309"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVR8"
FT                   /protein_id="ADJ42135.1"
FT                   /translation="MALEHAILVSLSERAGSGYELTRRFEKSIGLFWSATHQQIYRVLK
FT                   RMEEAGWVAVDVVAQSGRPDKKVYTVSDRGRAELVRWLAEPDPSAGPVELAVKIRGATF
FT                   GDPAKVAEEIVRHRAKHAERLDVYRQIEKRDFPAPAALTGRHLHQYLVLRGGIRVEEGQ
FT                   VEWFDEVLTALHHPKDAR"
FT   gene            324266..325195
FT                   /locus_tag="AMED_0313"
FT   CDS_pept        324266..325195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0313"
FT                   /product="patatin-like phospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42136"
FT                   /db_xref="GOA:A0A0H3CXT8"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR037483"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXT8"
FT                   /protein_id="ADJ42136.1"
FT                   /translation="MHPVLELISERMAAGSVPGERTDGRRLALAIEGGSSRGTYSSGMV
FT                   LALDELGVTPAFDAVYGSSAGALNGAWLLCGRSATGVRTWWNPVVMRRIINPLHTLRGR
FT                   AVIDLEYLVHQVYSVLEPMDFPAILANPVTFHPLATDADTGESTDLHPFLDDVDAVKVA
FT                   LAASSCMPVLAGPPIPMAGRRFVDAGVAEPIPYRTALAQGATDVLVLRTRRADELPVRP
FT                   PRMHDVVVPRFLRRQAPGAIPAWQDTYRRDVEDEETLTTDPRILSVRPPAGAPDVAVLE
FT                   RDPEVLRRAVDLGKSAVLDVLDGLREAS"
FT   gene            complement(325192..326034)
FT                   /locus_tag="AMED_0314"
FT   CDS_pept        complement(325192..326034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0314"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42137"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CU24"
FT                   /protein_id="ADJ42137.1"
FT                   /translation="MINHDDALKAVASSLDRPSAARIYDYFIGGNTHYAIDRDFAEKVR
FT                   ARLPLIGEYCLTSRQFLGRAVRQCVHEGIRQFVDVGSGLPTAGNVHEVADDTSPRLDTR
FT                   VLYIDNEPIALAHSTLLLADTADPERHHAIAADFLQEDDLWERVKASDIIDVREPIALV
FT                   VNAVMHFVKDEQDPDRLLAFYRERLAPGSLLVLSQMTNENPVNDDERQALLDLLEYYET
FT                   TTNPGFLRTMAEFERFFGGWPLLEPGLVYAPAWHPDEHTVFAGSPSESRVIGGVARKP"
FT   gene            complement(326072..326521)
FT                   /locus_tag="AMED_0315"
FT   CDS_pept        complement(326072..326521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0315"
FT                   /product="MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42138"
FT                   /db_xref="GOA:A0A0H3CV10"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV10"
FT                   /protein_id="ADJ42138.1"
FT                   /translation="MASLRLDDQLCFGLYSASRAVTSLYRVVLEDLDLTYPQYLVMLAL
FT                   WDRDHRLVKELGAELNLDSGTLSPLLKRLQTAGLVVRNRQADDERSVRVSLTESGKALH
FT                   EKARGVPDVIGAAMGLDEAGLARMRAELDRLTESVNAYREALSPA"
FT   gene            326677..327639
FT                   /gene="aes"
FT                   /locus_tag="AMED_0316"
FT   CDS_pept        326677..327639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aes"
FT                   /locus_tag="AMED_0316"
FT                   /product="putative lipase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42139"
FT                   /db_xref="GOA:A0A0H3CW30"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW30"
FT                   /protein_id="ADJ42139.1"
FT                   /translation="MTANPHNLALEPAAQAFAEATDQPPYLFQLAPEEGRKAVDGVQDG
FT                   EVAMAPAEIEVLSVPGGPNGDVETRIVRPAGVEGPLPVIVYIHGAGWVFGDFHTHERLV
FT                   RELAAGVGAAVVFPEYSRSPEARYPIAIEENYAVAKWVAQHGAEKGLDTARIAIAGDSV
FT                   GGNMTAALTILAKQRGDVTFKQQVLFYPVTDANFDTESYGQFAEGYFLGREGMKWFWDQ
FT                   YTTDPAQRAEITASPLRASLDELAGLPPALVITGEADVLRDEGEAYAAKLRQAGVPVTA
FT                   VRYQGIIHDFVMVNALRETHAAEAAITQAVTVLARALAE"
FT   gene            327784..328992
FT                   /locus_tag="AMED_0317"
FT   CDS_pept        327784..328992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0317"
FT                   /product="esterase/lipase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42140"
FT                   /db_xref="GOA:A0A0H3CVS3"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVS3"
FT                   /protein_id="ADJ42140.1"
FT                   /translation="MHLSNIRLDSPITMSVVIAVTLLAIIAIPLFWERWKRKLLWRTVT
FT                   ILCAVVSIVVTTGLAGNLIGGFFPTLGSLLGTGAYAANTIDAETSANGENLEVVREVGA
FT                   AHAKEGKGTVAHMKVTGRRTKLTRDVTVYLPPQHFEPAYRNLRFPVIEWIPNYPSGPEV
FT                   VTDGYKLPEHLDAAIAKRVLPPVVVIMPDPTGVPKIGHDTECVDEVDGTANDTYLTADL
FT                   REWALQKLGVSADRKAWTFAGWSSGGYCAMNLVTRHPQWYGQAVSVSGYDRAQMDAETE
FT                   NLYKGRQDVDDANNVGITVRLHPSPVDILAIWGENEKFESAAAELIRAGVRPPVRFSSW
FT                   RVPDAGHNMNTFKSQIPEILTWIGAHTTPPATAGRQVETTGGVQPWPLPRSGAAGGLTD
FT                   ADQ"
FT   gene            complement(328999..329895)
FT                   /locus_tag="AMED_0318"
FT   CDS_pept        complement(328999..329895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0318"
FT                   /product="putative alanine rich lipoprotein LppW"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42141"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXU3"
FT                   /protein_id="ADJ42141.1"
FT                   /translation="MRKLSGIFLVGLCLGAVGAVVVTARHSSAAVPQPIAAAEFVTPTS
FT                   ATPTPTPTSTPAPAAKTEPSASSATSAPAAKGQPANVNAAALDNIVGDGEVSAVVFDRE
FT                   RGAVVTSVRADRAYTSASLVKLLIALSALEQGGPVADVQRMLSRSDDDLASRFWTAYGG
FT                   PSIVTHWTTKLGLTGTRPPEEPGRWGDTRITASDIVRIYRYLLDHKSIAILNALHDATE
FT                   RGADGFRQYFGIPDAAAGQQWAVKQGWSCCRPTRMLHTTGVVGHYIVVVLTEHPAKVDY
FT                   ATGSRRVTEIVSTLLGG"
FT   gene            330086..330799
FT                   /locus_tag="AMED_0319"
FT   CDS_pept        330086..330799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0319"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42142"
FT                   /db_xref="GOA:A0A0H3CU29"
FT                   /db_xref="InterPro:IPR025492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CU29"
FT                   /protein_id="ADJ42142.1"
FT                   /translation="MVHAKGARIRVRGLQPAQVLAGLAGIAFLVVGIIGFSRTGFGNFA
FT                   GHHDAGFWRFSANPLMSLVRVVTGVVGLLFAFGSGRARAFGWLLFIGYGLLFVWGLMID
FT                   GLISTNPFANAGNPLDIGRADTWLHLGIAALGLLIAVLPARRTILLPEDETVDEPVVAE
FT                   QRTEVIDRTGRTDRTDRVGPVDRTDRIEADRVHTDRVNSDQVTEEPRRRSFLRRDHKGR
FT                   GPEVTREERPPGLAH"
FT   gene            complement(330815..331813)
FT                   /locus_tag="AMED_0320"
FT   CDS_pept        complement(330815..331813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0320"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42143"
FT                   /db_xref="InterPro:IPR005297"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV14"
FT                   /protein_id="ADJ42143.1"
FT                   /translation="MLRTRIAVSVAAAAAGLAVLTACSGAETAQPVVAPAAAGGNGGGQ
FT                   AANGQVGNAAPASNESKLVVADVASVGQVLTDQNGMTLYRFDKDTAKPPKSNCDGDCAK
FT                   AWPPMLATGDVQVQGVDKNNVGKVTRSDGTEQITVGGWALYRYAKDTKPGDATGQGVGG
FT                   AWYAANAKGGKAGQAAATGSESGGVKLSASKIDGLGDAIVDQNGMTLYLFTKDTKKKAS
FT                   ACNGDCAKTWPPVLSNGKVELQGIDSKLLGSIKRQDGTEQVTIGGWPVYNFSKDLKPGD
FT                   ANGMGVNGTWFVIEPNGCKVGTTPSATASKAPAADSNTGSSNDSGGTGTTY"
FT   gene            complement(331916..333586)
FT                   /gene="pcaB"
FT                   /locus_tag="AMED_0321"
FT   CDS_pept        complement(331916..333586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaB"
FT                   /locus_tag="AMED_0321"
FT                   /product="3-carboxy-cis,cis-muconate cycloisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42144"
FT                   /db_xref="GOA:A0A0H3CW34"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW34"
FT                   /protein_id="ADJ42144.1"
FT                   /translation="MSVPDPIVMPSPRSAACDADAMTVDPDSGLLSPVRAGTPAEASTG
FT                   DEAWVRAMLDAEAALARAQARLGTVPPEAADAITEAAGQARIDVAELARGSRATANPVV
FT                   GLVKALTAAVGELAPAAAEYVHRGSTSQDIFDTAMMLVADRTLRPLAADLDATAEALAG
FT                   LARAHRDTTMAGRTLTAHAVPTTFGLKAAGWRQLVLDAAVRIRRVLDGGLPVSLGGAAG
FT                   TLAAYVEYARLADEPSGGGGGGGGGGGGSTPATVPVPGASMPTAIPDTSTPTAIPRAST
FT                   PTAVPGASTPASVPGAPEAARDADVGGYVNRLTAAFAEETGLAAPVLPWHSLRTPVADL
FT                   AGALAFTAGALGKLAVDVETLSRTELGEVAEPAADGRGGSSAMPHKRNPVLATLIRSAA
FT                   LQVPVLAAGVTQSMLAEDERSAGVWHAEWQLIRECLRLTGGAAHTAAELARGLTAAPGR
FT                   MRANLASTHGLIVSERLSAVLAPLLGKAKAKELLGEASRRAVREDRPLRDVLDELPAIT
FT                   GVLTAAALDELLDPAGYTGAAGALVDRALGDGPQPGGSD"
FT   gene            333592..334233
FT                   /locus_tag="AMED_0322"
FT   CDS_pept        333592..334233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0322"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42145"
FT                   /db_xref="GOA:A0A0H3CVS7"
FT                   /db_xref="InterPro:IPR010617"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVS7"
FT                   /protein_id="ADJ42145.1"
FT                   /translation="MTSAPSAEDTAGSEARAIAAERLTFFSDAVVAIAITLLALELPLP
FT                   EGATSAELLRSLGHLRSEYVSFLISFIVIGGHWRAHHRLFNYVTTLGGGLARLTFGWLL
FT                   MQVIMPFATKVISEEGGFEFRFVFYAVVQVVALTLFLLMAWQIKRNHLYRADTPPELFG
FT                   KVYRGIGAMIAAFAVSIPVAFFTHWAYACWIVVPLVVSLLSRFRRRTAAA"
FT   gene            complement(334238..334780)
FT                   /locus_tag="AMED_0323"
FT   CDS_pept        complement(334238..334780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0323"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42146"
FT                   /db_xref="InterPro:IPR007061"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXU8"
FT                   /protein_id="ADJ42146.1"
FT                   /translation="MTEHMIPVAAPPRLTAPRTDPAPVADERRALTESLDYYRRTFELK
FT                   CAGLDPAQLAERSVPPSTLTLHGLLRHLTGCERWWFRIQFTGEDVPNLYYSDDDPEQDF
FT                   TDLGGDVDEAFSLWHAECARSREIVAASSLEQTGIRRSTGEPFTLRWLMLRMIGEYARH
FT                   IGQADLIRERIDGATGE"
FT   gene            335018..335839
FT                   /locus_tag="AMED_0324"
FT   CDS_pept        335018..335839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0324"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42147"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CU34"
FT                   /protein_id="ADJ42147.1"
FT                   /translation="MLAALAAAALGASPAVASAAPPASTIEVSATTVRAGTTFTVTEQL
FT                   TNPTDFTITGAKAALYVKEKPIADVVDLVSCTGTIAPCAPYLSSFRGGVGDLGAGESRT
FT                   VTFTLRVKDDVAPGQFTLQHQFAGDNYAFAVEDGPAVTIAPPDEADVKVVLTATPRAGF
FT                   VAQVDYVIKVSNTGPATATGVRVTAGAGSGRTVVSMAGCTRSGATLTCAIGTLAPGASA
FT                   TAKFTSEGGFFAWGAFTATAQRAASTPADPEAANDKSSKKCTAYTGLFVQC"
FT   gene            complement(335892..336428)
FT                   /locus_tag="AMED_0325"
FT   CDS_pept        complement(335892..336428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0325"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42148"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV19"
FT                   /protein_id="ADJ42148.1"
FT                   /translation="MPGSLLILTGPPGAGKSTVARMVAADGVRPTVHLHTDSFYVWIRT
FT                   GFVPPYLPEAARQNEVVLGVIAEAACGYARGDFDVVLDGVVGPWALQPFREAAKRDGLD
FT                   LYYVVLRPSLEATLARGTAREAKELVDVEPLKGMHAAFVGLGALERHVMDTTEQAAEET
FT                   ADAVRRRARSAAFAL"
FT   gene            336540..336615
FT                   /locus_tag="AMED_R08"
FT                   /note="tRNA-Lys-TTT"
FT   tRNA            336540..336615
FT                   /locus_tag="AMED_R08"
FT                   /product="tRNA-Lys"
FT   gene            337305..337748
FT                   /locus_tag="AMED_0326"
FT   CDS_pept        337305..337748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42149"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW38"
FT                   /protein_id="ADJ42149.1"
FT                   /translation="MSSRAEMGIVLLAICALLVTTVFVGARWREKTGGLGQVPPPAPKY
FT                   ARRIAALRDEDYDLVLRGGAIVNGVSATWPFAVLLVSRDQIELRVRVLVPIRIARAEVT
FT                   GVRRVRGLYSRGFKFRTESGRLDKVSFWPVGKAAKQLAELGWQ"
FT   gene            complement(337823..338704)
FT                   /locus_tag="AMED_0327"
FT   CDS_pept        complement(337823..338704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0327"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42150"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVT0"
FT                   /protein_id="ADJ42150.1"
FT                   /translation="MAMAAAPASAATSSADLPEGMTASYIVVDQETGTVSASDEHKQYR
FT                   SASLVKLFIALDYLESHGPDYEIPADDLALLEPMLRSSNDDAASTLWVRDGWDEIVKRM
FT                   VTTIGLTDTAPPTARGKWGYTAISAADIAKTYQYILHDANPKYRDFIMGNLAQSTKCGS
FT                   DGFDQSFGLPSAVPGPKAVKQGWSGFGAAPAPGQECTGTNARTLRVLNSPEVKAATAVA
FT                   SSGEGTLGAKSAFSAQDIDLTSRAMHTSGTVGANNCKIVVVLTLEPTTLSWQDSASRIT
FT                   QLTQDVFFQSAL"
FT   gene            complement(338863..340182)
FT                   /locus_tag="AMED_0328"
FT   CDS_pept        complement(338863..340182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0328"
FT                   /product="N-acetyl-glucosamine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42151"
FT                   /db_xref="GOA:A0A0H3CXV2"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXV2"
FT                   /protein_id="ADJ42151.1"
FT                   /translation="MSAAFVLYVCGIIVPYLRHRPTWPGDPTLFRWHFFVPCRDEELVI
FT                   GDTVRYLRTRFRAAHVWVIDDHSDDRTLDIVRRMQGRGDSQLHVVARRRPHARTGKSDA
FT                   LNAAYRALRAWVGRHDDGANTIVVVVDADGRPAGNCMYVCTAPHLFGDPAMGAVQIDVR
FT                   MGNRGTAPGSGNRVRRRFGRALVRMQDLEFRTAIAAIQMSRGHTGTIAMGGNGQFTRLS
FT                   ALDSIAGPQRRPWRGSLLEDFELGVHLLTEGWKTGFSVDTHVDQEGLYSMRRFLAQRTR
FT                   WSQGTMQCARYARRIWKSPHLSTFGAAEMLYYLAQPWMQLLGSVVYPIPLVLLTIHAIT
FT                   EPAVAWAWFTSGAWKFLLAYGVAGMLPFLIWGPVYRKHCEPKSGPLRGIAYGLGYACYI
FT                   YTFYITVWRAVFRLVRGRNGWAKTRRNTERANTKVVALDR"
FT   gene            340765..344421
FT                   /locus_tag="AMED_0329"
FT   CDS_pept        340765..344421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42152"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CU39"
FT                   /protein_id="ADJ42152.1"
FT                   /translation="MHPWAKRGLQSAMLAGGLMMLGTGIASAEEQVNPDLAPSPLDGGA
FT                   SVPIQIRKINLGTPAGEAPLPLDTDTDVTTGTVLHDTSKPLAGALLGNVVKPDVSAPVQ
FT                   ITGWAVGAGGDSHVVNDSQQVHRQGGPITTTGEGKPIAGNVVTTPVTAPIGVNNLAFGT
FT                   LSNATVDGFANQDSTVGGPVTTNGDNGVVSGTIAAVQGALPIGVNNTAAGWGGTGTVNT
FT                   TTTQGAHSPGQLTTSGRDGVVSGTVAGVPVALPAQVDGTAAAWGGKATANTVNTVLAEA
FT                   GTSESVLRGAPESGPYVTTAGAGSLVGGTALTPGVAAPVAVNGTSGPWGGLTHADSVNN
FT                   LNANAGGGTITDGVKSVGGGTAAGAPVALPVNVLGTAGAWGGESFATSENNVGSVAGGE
FT                   LVTDGAGALAAGSVVHPQVAGPAEVNCTTGPWGGITGTTCTNDYSVQAGGGDATDGTKS
FT                   VASGTVADAPVALPVTGNHNSAAWGGLADAMGASVVDSTAGGDVYTGGGGSLVGGTVAH
FT                   PQVAEPVVASCNTGAWGGITSTHCTHENTAHAGGGQVTNGDNSIVGGTVADVPATLPAQ
FT                   VCGTAGDWGGISTAECYTTVDSVVGGNTYDHGDNSVGGGNIVGPSLAGDADVICNAGAW
FT                   GGIPTSSCSNAENVVAGGFQGTSGNNAVAAGNIVDAPLATPVEVLNGAYAWGGIPTSTM
FT                   TEHKCLTSGGDNNTDDDGGVVSSNIVTAPEAIGAQVMNIAGAWGGNPTSHGDFITHVHT
FT                   GGADAATGKGGAVAGNVVDQASSLPVQVNTIGATWGGNAEAIGTNVTEFTSGGPNYADG
FT                   DRGAVAGNVVEAPIGGAGQVSSWAVSWIGGAVTDADNDVSSHAGGTTYTSGVDGAIAGD
FT                   AVAAPIQPLVQATGQSISLMANTANHTENTYDLVSGGPIVTDGTGGALSGDILSADPQA
FT                   MPQVYGLGISAIGSATNDVQNDLTATDGGDETTAGSGALSGALLDVPVAADPEVFRWGI
FT                   GALSTVNNHVDSTVDSHVSGTPTAKPAVQIPVGLVPQVKNVTIPILAEVLNTGTDTTEV
FT                   MVGRTEAAHIPVELDLTGVLGGVSPLARDDVSSRTDTPGLGADGVGGAMSLLGSGSADA
FT                   IGKATGALGSVSGRTLGGLPASVAGATGHQARSDVPSLPDLLGGGLLPQLKPPHVALPG
FT                   VPSAPRADSPVPSVPSLPSVPVVPVLTGLAGSSLLSPVKQPQVALPGVPTQQ"
FT   gene            344491..345000
FT                   /gene="sixA"
FT                   /locus_tag="AMED_0330"
FT   CDS_pept        344491..345000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sixA"
FT                   /locus_tag="AMED_0330"
FT                   /product="phosphohistidine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42153"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV22"
FT                   /protein_id="ADJ42153.1"
FT                   /translation="MDATRWLIVVRHAKSDWSEGLPDHERPLAARGLRDAPRLGRWLVD
FT                   EGHVPELVVCSTARRTRETWLRVSDELPAPTPIEYDDDLYGGDVPELLNAVRRTPPEVT
FT                   TLALVAHEPGVSDVTLHLAGHGEETLPVQAKFPTGAAAVLATTDPWDALRTARLVAFFR
FT                   PRDFTG"
FT   gene            345109..346080
FT                   /locus_tag="AMED_0331"
FT   CDS_pept        345109..346080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0331"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42154"
FT                   /db_xref="GOA:A0A0H3CW43"
FT                   /db_xref="InterPro:IPR008397"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW43"
FT                   /protein_id="ADJ42154.1"
FT                   /translation="MVFRHTVVAAVAALGLVASFATPAEAASRPTGCTVPVIGPVCAPA
FT                   TAVLDGNQLLRTKFAALVGERTSRTALNNLLTAARSDLTAGPWSVTSKKQVPPSGDKHD
FT                   YLSLAPYWWPTTQPTAENPWGCPFVQRDGQRNPIVDEITDHAYRGEAFAAIYRLALAWY
FT                   YTGDARYARRAALDLRTWFLDAATKMNPNMNFAQGIPCKVDGRGIGIIEFSYTLSQVVD
FT                   ATAILATGAPGWTKADQAGMTGWYTQFLDWLRTSKNGTDEAKAQNNHGSFYDMLVAALA
FT                   LGTGQRDVAAAIARDAGPQRIAPQIQAKGLQTQETSRTRSWH"
FT   gene            346121..347545
FT                   /locus_tag="AMED_0332"
FT   CDS_pept        346121..347545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0332"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42155"
FT                   /db_xref="GOA:A0A0H3CVT3"
FT                   /db_xref="InterPro:IPR008397"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVT3"
FT                   /protein_id="ADJ42155.1"
FT                   /translation="MMAGRGRSKVELVLSEDERATLLRWERRAKSAQALALRCRIVLAC
FT                   AEGLSNMEVAERLGINRMTVGKWRSRFVAQRVDGLVDEDRPGRPPSITLEKVEDVIVAT
FT                   LEQTPRNATHWSRASMAQRSGLSKSTIGRIWQDFGLKPHLADTFKLSTDPLFVDKVVDV
FT                   VGLYHHPPERAVVLCTDEKSQVQALDRSQPVLPMMPGMPERRSHDYVRHGITTLFAAFN
FT                   TADGTVISELHRRHRAAEFKKFLTTIDKTVPAGLDIHLICDNYGTHKTPAIKAWLAKHP
FT                   RVHMHFTPTGSSWINQVERWFAFLTDQLIRRGVHRSVAALEKDIREWIKDWNEDPRPFV
FT                   WRKTAEEIIDSLARYCQRISGAGHYSAFNLVALTRLAQIGKHVGVDLWHYTAPSGATLF
FT                   GAVDFLIPGATQGQSAWPYPELDFRPYAALDVLHAAADAGDRAARTALPRVPVEPGGDL
FT                   YPVRPAPEQLDDISTS"
FT   gene            complement(347594..348310)
FT                   /locus_tag="AMED_0333"
FT   CDS_pept        complement(347594..348310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0333"
FT                   /product="putative trypsin-like protease"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42156"
FT                   /db_xref="GOA:A0A0H3CXV7"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXV7"
FT                   /protein_id="ADJ42156.1"
FT                   /translation="MKFGKFILLAASTALAVVGLGGPAAADNTPQAQPSIIGGSTATSG
FT                   PWAARLFVNGQQNCTATIIAPQYILTAKHCVSSSGTYTFRIGSLDQSSGGTTATGSTIT
FT                   RYPGSADLAIVRLTTSVNATYSPLGSVGDVSVGQNVSVYGWGATSQCGSEINCQSRYLK
FT                   VATVRVNSISCSDYTGGVAVCANRVNGITAGGDSGGPMFASGRQVGVASTSDRSNNTAY
FT                   TNITRYRSWISQVAGV"
FT   gene            complement(348482..348853)
FT                   /locus_tag="AMED_0334"
FT   CDS_pept        complement(348482..348853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0334"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42157"
FT                   /db_xref="GOA:A0A0H3CU45"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CU45"
FT                   /protein_id="ADJ42157.1"
FT                   /translation="MLVAVYAIFALAATSRAGVQIGTKFHEAPLAYLLSAFAAAVYIVA
FT                   TIALARRGDGWWRVALVACSTELLGVLTIGTLSLVDAAAFRHPTVWSVYGEGYLFIPLV
FT                   LPVIGLYWLRKTAPVKIAA"
FT   gene            complement(348876..349241)
FT                   /locus_tag="AMED_0335"
FT   CDS_pept        complement(348876..349241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0335"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42158"
FT                   /db_xref="GOA:A0A0H3CV26"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV26"
FT                   /protein_id="ADJ42158.1"
FT                   /translation="MIFGFAVTVAVAATLVALWSFVQSARNRLPDNPLLVALAVIELLL
FT                   VVQLVIGIVLLAGGDRPGSLATYLAYLIGCLVVLPVGAAWALAERSRSSTAVLGIACLA
FT                   IPVMVLRLNEVWSGATA"
FT   gene            349686..352253
FT                   /locus_tag="AMED_0336"
FT   CDS_pept        349686..352253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0336"
FT                   /product="serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42159"
FT                   /db_xref="GOA:A0A0H3CW47"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR007822"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW47"
FT                   /protein_id="ADJ42159.1"
FT                   /translation="MDLRYEAFCFADPLFYDELQENGAPVEDFTPALPASVAGWVTTDR
FT                   GVWRARHPDGRVLPAQGWQVHVSAGLGNASRVLAQVSESCTEHAVAHKHLRSPLTLLAR
FT                   NSKYASGDSEVELATIYPADDNELERVLMDLSTRLEGEHGPGIPSALQYGDGPLYVRYG
FT                   GFAEQWVEHDGNRVPAVRKPDGRLVPEKREPTSSMPDWVKLPTCLRSSITARKGGARTQ
FT                   FPYRMVRPLHVSNGGGSYLADPKAGGDQVVLKEARPYAGLDEARIDAVERLRREHEVLG
FT                   RLAGIPGVPRAVEWFTVSERHYLAAEYLPGIPLAGWLTRNYPLTRRSTTTVDLADYTRR
FT                   ALDIVEGVEKAIGEAHARGIVLGDLHPQNILVDEDHHDRISLTDFGTAFDAESADRPTP
FT                   GTPGFRAPADRTGFAVDEHALAALRLWLFLPLSPVAELAPAKLRRIADFVERRFPLPEG
FT                   YADAAVAVLAPREVPVEPTLAHTELDHDKPDWSLVRKQIAEAILASATPSRQDRLFPGD
FT                   IEQFRVGGACFGVGAAGVLHALNVAGAGRFPEHERWLIEAVRREPPTRPGFYDGSSGIA
FT                   YVLENFGHHDEAAKLLATSTRLVEQTTDHSLESGLAGIGLTMLHFATVRQDNEFGRQAL
FT                   TTAVRLAEALETAAPPGNSARAGLLAGWAGPALLFIRLFERTGESAWLSFADQALCRDL
FT                   EECVEADDGSLQVRDGAARTLPYAGVGSAGILLAAEQLARHRPDAEAVDSLPALREACL
FT                   GEFVAQPGLLNGRCGLAVALAANPGPGQPSRAAAIDRHLAWLAWYAVPYKNGLAFPGNR
FT                   LLRLSMDVKTGGAGILLSLASLFDGNEVLPFLGGTPIAPATGR"
FT   gene            complement(353100..353513)
FT                   /locus_tag="AMED_0337"
FT   CDS_pept        complement(353100..353513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0337"
FT                   /product="thioesterase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42160"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVT7"
FT                   /protein_id="ADJ42160.1"
FT                   /translation="MVSEYPHWQTIPLRWKDNDVYGHANNVVHYSLMDTVINTWLIEQG
FT                   GLDIEAGAVIGLCVESHCAYHSSVSFPGSLRVGLRVAHLGKSSVRYEIGMYAADESLVA
FT                   EGHFVHVFVDRESRRPTPVSGKLREALEALQPG"
FT   gene            complement(353507..354787)
FT                   /locus_tag="AMED_0338"
FT   CDS_pept        complement(353507..354787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0338"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42161"
FT                   /db_xref="GOA:A0A0H3CXW4"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXW4"
FT                   /protein_id="ADJ42161.1"
FT                   /translation="MAATEHETVFTYGAPALKYGTGASDEIGYDLTQYGAHRVLVVTDP
FT                   QVAATAWPRRIADGIAGYGIETEIFDGVHVEPTDVSMQKAVDFARGTGPYDAFVAVGGG
FT                   SAIDTAKAANLLTSNDGELMDYVNAPVGGGRAPARSLKPLVAVPTTTGTGSESTTVCVL
FT                   DVLSLRVKSGISHLRLRPTLAVVDPRLTVSQPPGVTAASGMDILCHAAESYTAKPYTEF
FT                   ERKRPEQRVPYCGSNPLADMFAEQSLRLLSWALPAAVRDGADLKAREAMALAATFAGLG
FT                   FGNAGVHIPHANAYPIAGQVRDFHPDGYPGEEPMVPHGMAVSLTAPAAFRFTFDAAPDR
FT                   HLRVARLLAPDFEWPGDFADHLPAVLIDLMRQIGIPDGIGAVGYTESDVDSLVEGTLKQ
FT                   QRLLATAPREASADDLSGILRESVSLW"
FT   gene            354950..356581
FT                   /gene="ilvB"
FT                   /locus_tag="AMED_0339"
FT   CDS_pept        354950..356581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvB"
FT                   /locus_tag="AMED_0339"
FT                   /product="acetolactate synthase I/II/III large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42162"
FT                   /db_xref="GOA:A0A0H3CU50"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CU50"
FT                   /protein_id="ADJ42162.1"
FT                   /translation="MRILTEARVRRVYAVVGESFLELLDALQREREITLVSARHDAGAA
FT                   FMAEAEGKLTERPAVLLASRGPSAASLAIGVQTAYQDETPMVVLLETPAAEPVPSSSGE
FT                   LPTSDLTAMFESIAKSTLRVTDPDGLPGLLAHALTTSQEGRPGPVVLGVPCDVWGMPYD
FT                   AAKPMARVRPPASGTLGRSADAVAQLVDEAKYPVVIVGGRARSARDELIAVADELALPV
FT                   YNAFRRQDAFPENHARYAGHLGLGIPARQLDALERADLVLALGTQLDEVTTQAYRYPTA
FT                   QQTLVMVGTGIDVSPKRRGLTFRVDSEVEPFLRELREVASPRTRRASAANAAVHTFMTP
FT                   PDTSGNTRVHPVDVVRALRKLAPEDTIVTSDAGNFAQFMHRYWCFTAPRSQLGPSNAAM
FT                   GYAVPAAVAAKLTEPRRTVVAMVGDAGTLMTGQEIETAVRYRAPVMVVVFQNGVHGALA
FT                   MHQARTYGRLTGVSIPLTDFASWARGLGAAGYTVDDREELEPIIASALVRQRPCVIDVR
FT                   TDPDVVTPDVRISALLGQARPQPPAQ"
FT   gene            357166..357369
FT                   /gene="cspA"
FT                   /locus_tag="AMED_0341"
FT   CDS_pept        357166..357369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspA"
FT                   /locus_tag="AMED_0341"
FT                   /product="cold shock protein CspA"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42163"
FT                   /db_xref="GOA:A0A0H3CV31"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV31"
FT                   /protein_id="ADJ42163.1"
FT                   /translation="MTQGTVKWFNSEKGFGFITPDNGGGDVFVHYSEIQGNGFKSLEEN
FT                   ARVEFEIGQGQKGPQATSVTVI"
FT   gene            357434..357649
FT                   /locus_tag="AMED_0342"
FT   CDS_pept        357434..357649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0342"
FT                   /product="Cu(2+)-exporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42164"
FT                   /db_xref="GOA:A0A0H3CW53"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW53"
FT                   /protein_id="ADJ42164.1"
FT                   /translation="MIEHGYAVSGMSCAQSVTEEITVLPGVAEVDVDVATGRVLVRAET
FT                   TLTEDDVRAAIEEAGFTYEGVADLVP"
FT   gene            357852..358886
FT                   /locus_tag="AMED_0343"
FT   CDS_pept        357852..358886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0343"
FT                   /product="ATP-NAD kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42165"
FT                   /db_xref="GOA:A0A0H3CVU1"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR011391"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="InterPro:IPR039065"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVU1"
FT                   /protein_id="ADJ42165.1"
FT                   /translation="MGETVAGIVANPASGRDIRRLVAQASVFPTAEKANMVQRLLAAFA
FT                   VTGLDRALVSTDLGGISAAVLRALGRGGSWPKVDFCEDDALTGTAADTTNAVRRMVEAG
FT                   AGVIVVLGGDGTARVAAAACEDVPLLALSTGTNNAFPQMREATVAGLAAGLIATGQIDP
FT                   DLVTHRVSVLEVVTKARREIALVDVCVSLSRHIGARALWDPSSLTELYCTFAEPDGIGL
FT                   SSVPGQLCPSPRSSPDGVALQLGPVGETPYVVHAPIAPGLVRPVGVRGWGLLRPGVRVE
FT                   LAAAGGVIALDGERELELKTGESAFVELKPDGPWVVDVRAAMAEAARKGLLRADTELGK
FT                   ERRR"
FT   gene            358883..359626
FT                   /locus_tag="AMED_0344"
FT   CDS_pept        358883..359626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0344"
FT                   /product="pyruvate/2-oxoglutarate dehydrogenase E1
FT                   component subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42166"
FT                   /db_xref="GOA:A0A0H3CXX1"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXX1"
FT                   /protein_id="ADJ42166.1"
FT                   /translation="MTDALRGAYRVMRTIRAVEERVRATGGNRYVGGEALAAGVCLHLD
FT                   SRDAIAGTHRRHGHRIAKGVDVRAVLAEIQQHRLITTDTLGGVPLLICGAAIAAKQQDT
FT                   GGVGVAFLGDAPGTTLEALTLASAWHLPVIFVTENPGYADRVAGLGVPGVVIDGSDFFA
FT                   VHEAAGEAVGRARDGGGPTLLEAGFPRHVGDCLHRFRTRVTDSGELREQVLDAIDAEVA
FT                   QLVEDSVAAPKSAPDALETDVYVSY"
FT   gene            359724..360986
FT                   /locus_tag="AMED_0345"
FT   CDS_pept        359724..360986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0345"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42167"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CU55"
FT                   /protein_id="ADJ42167.1"
FT                   /translation="MGQRDLEAALPAGVDPRRYARVLAQVHEAALNGQALPSRLRPVIG
FT                   ASWQRMRRLGLDPDSRAAAPVLTFEQLEARRRASGLAEALPILRGGLLSLAEQAAHIMV
FT                   IADAGGAVLWRDGSAAVRRRADGLGFVEGVDWQEESVGTNAIGTALVARSPIQVYSAEH
FT                   YVRTQHSWTCAAAPLHDPRDGRLLGVVDLSGPASTIHATTLALVDAVTRLAEAQLRTTH
FT                   LTELERLRGFAVPVLAKVGGRAMVADKHGWIAAAAGLAPVDRVALPTGLGPGRAWLPAY
FT                   GGCSVEPVPGGWLLRLTENEAAPPTRVVLDLRSPREPELTVASAAGTWTHRLSPRHAEV
FT                   LYVLASRRDGRSASELSADLFGDAGRTVTVRAEMSRLRRHFGGILGAKPYRFADDVEVV
FT                   VRRPPDPEAVLPHSLAPAIRG"
FT   gene            361442..362860
FT                   /locus_tag="AMED_0346"
FT   CDS_pept        361442..362860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0346"
FT                   /product="secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42168"
FT                   /db_xref="GOA:A0A0H3CV37"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV37"
FT                   /protein_id="ADJ42168.1"
FT                   /translation="MTSTATAPGPAAPAPAPPPSPPDGRDRTGSRSGLLGLLDLPGQGI
FT                   RAIVRSAATTPGRLTVIAVGLVLLALVAGLVATLSVQDRDDTISGVIDHREPLAAASQQ
FT                   VYRSLSDADATAASAFLSIGTEPPQLRQRYERDIAEAGAALAKAASDAADVADAATPVD
FT                   TLNQQLPVYTGLVETARANNRLGYPVGASYLREASELMRAKLLPAAQDLYRVDTERLIE
FT                   EQDSATGFPWLATILVVALLAALIVTQVYLTRRTNRLLNVGLVVATAAVVVSLLWGGVA
FT                   LIFQGSLVGSGQDDGSHRVDVLVRARIAALQARADETLTLVARGDGGAYEKDFTAKAVQ
FT                   LLGQDGQGGLLGEARGLIKDGDGAAKVEAASKAAGDWLKAHGQVRDQDNAGAYQEAVDS
FT                   AVQEDAKGGSAPAFRQLDDSLQAAIDVGRQAFLDDTHNGDRALTLLAPGLAVLAVVAAA
FT                   GVTMGIRERLREYR"
FT   gene            362992..363936
FT                   /locus_tag="AMED_0347"
FT   CDS_pept        362992..363936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0347"
FT                   /product="ABC transport system substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42169"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW58"
FT                   /protein_id="ADJ42169.1"
FT                   /translation="MLAVVALLAASCGSAGKPVDPAPVGNAAWPQPAHVGGPDATAGGG
FT                   SDTSCNPLASLVPASSSTTVPDSSTMSDIRKRGKLIAGVDQTTYLFGFRNPTSGNLEGF
FT                   DIDMVNAVAKAIFGSADGHVQFRAIPSSQREEVLKKHQVDIVVRTYSITCARKKDVEFS
FT                   SVYYVAGQKILVPKESKAQKLSDLSGKRVCATKKSTSLAKIATDAAKPVPVSVDNWSDC
FT                   LVMLQQGQVDAVSTDDTILAGMAAQDSTLEVRGEPLTQENYGIGVPKDRPDLVRYVNAV
FT                   LDQIRGNGVWQDSYRRWVEARLGPASPPAPQYQ"
FT   gene            364010..365986
FT                   /locus_tag="AMED_0348"
FT   CDS_pept        364010..365986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0348"
FT                   /product="protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42170"
FT                   /db_xref="GOA:A0A0H3CVU6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR031634"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVU6"
FT                   /protein_id="ADJ42170.1"
FT                   /translation="MSEEPRRPRHAAPDDQQQVAPPSWQPPPPVRWDTPEPSISGRLDD
FT                   GEPSGGEETVFHAPVRRPPTPPRGQPFPARGPIPGAEDPTRPPGSMNPVTPPVEPTQAV
FT                   RPDPGAPQPTSVLAAPAPETQSIMPPVPRPETGPGTPLPDPGTESVLPERTSEGRHTGT
FT                   GTGTGAGSGSGSVSGSFPGTSRRTSSRTSRSRRGRLGAGLVEVPPVPARDPASAVLTNP
FT                   VVSEEKRFCGTCNAKVGRGKDGQPGSPEGKCENCGAPFSFVPKLQPNELVGGQYEVLGA
FT                   IAYGGLGWIYLAQDHNVSDRWVVLKGLIDTGDATAMAAAANEQRFLAEVEHPNIVKIHN
FT                   FVQHPDAHSGTTTGYIVMEYVGGQSLRQLALAHHRESRRPEPLPIGQVIAYGLEILPAL
FT                   GYLHSQGLLYCDLKPDNVIQTNEQLKLIDLGAVRRTDDYESPLFFTTGYSAPELPTQGA
FT                   SVASDLFTVGRTLAVLSFEFTGYTSKYKTTPTASNNIERFRTGECHTEGRPIARARSAR
FT                   GENRTTLEAEREAPWGVRGARPPGSAHRNDWPRRRAKPERAKKWRTPAPGGGTRGSEGI
FT                   STGADRGCVSTSIVARVGWLGEWRAGNFPVWCHFATGVTFVRVGFFFDRADCAALSGVW
FT                   PQVHSPGGCVWWPALVSLAAKLL"
FT   gene            366003..366257
FT                   /locus_tag="AMED_0349"
FT   CDS_pept        366003..366257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0349"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXX7"
FT                   /protein_id="ADJ42171.1"
FT                   /translation="MSGSVEVRQFLLRYEGADGGSAPFAGALPAQRSGAADAQRVSDDQ
FT                   VRRARLAVANGALGVEDCVQLLEMLGLNLDEEGQAPVQR"
FT   gene            366417..367193
FT                   /locus_tag="AMED_0350"
FT   CDS_pept        366417..367193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0350"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42172"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CU59"
FT                   /protein_id="ADJ42172.1"
FT                   /translation="MTAIEGAADLANRIRPVVQVLGGKFMTSPELAAVEAEVGLPPRSL
FT                   YVRGRSAVLGDVPPKVAAELFGIFPHWLFEFVLPPATAALDASAAVRAYAESSARWSRV
FT                   SLSAVPEPGRLAELVFRVVDAADASGLALFAGWKNAERPAGDVERLGFALMVFRELRGG
FT                   LHFAALRALGLSVPEAVIADPEGGRERLLRTAWPEDAADELVASAERKPDLRERWHRAE
FT                   ALTDDRIGELLTSALSGPEQAEFARRLAELSEFAQV"
FT   gene            367311..367383
FT                   /locus_tag="AMED_R09"
FT                   /note="tRNA-Glu-TTC"
FT   tRNA            367311..367383
FT                   /locus_tag="AMED_R09"
FT                   /product="tRNA-Glu"
FT   gene            367406..367482
FT                   /locus_tag="AMED_R10"
FT                   /note="tRNA-Asp-GTC"
FT   tRNA            367406..367482
FT                   /locus_tag="AMED_R10"
FT                   /product="tRNA-Asp"
FT   gene            367511..367587
FT                   /locus_tag="AMED_R11"
FT                   /note="tRNA-Phe-GAA"
FT   tRNA            367511..367587
FT                   /locus_tag="AMED_R11"
FT                   /product="tRNA-Phe"
FT   gene            complement(367674..369020)
FT                   /locus_tag="AMED_0351"
FT   CDS_pept        complement(367674..369020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0351"
FT                   /product="integrase/recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42173"
FT                   /db_xref="GOA:A0A0H3CV42"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV42"
FT                   /protein_id="ADJ42173.1"
FT                   /translation="MARSQRPEGTKNPDGQGSFYYSEYDGYWHARVTVGVKDNGDPDRR
FT                   HIKRRNEDDARDAYRELLNQVDQGLVPKQGESWTVEAWLVHWVETIAPMTARYKTVVGY
FT                   KTAVYRHLIPGLGRHKLSPGRGKGRPIEPEHFEKLYRKMLAAGLKPGTVHQVHRTARTA
FT                   FQVAFVRGKIFRNVVAMAQAPRVEEEEVEPFEPEDAQAIIEAALKRRNGVRFVIALALG
FT                   VRQGECLGFKWPMLNRERRTLRIRKAIQRQKWLHGCDDEHACGAAYHKRAPCRQPCKRH
FT                   QRPCPPPCPPDCVEHARKCPRRHGGGLVEVDVKSKAGRRTWPLPDQIFELLMRHEERQA
FT                   RERERAADLWEEGGWIFTQENGRPIDPRADYETWRQLLTEAGVREARLHDARHTAATVL
FT                   LLLGVDPRVVMELMGWSTEAMRRRYQHVTDSIREEVASQINTYFWKGTT"
FT   gene            complement(369036..369338)
FT                   /locus_tag="AMED_0352"
FT   CDS_pept        complement(369036..369338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0352"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42174"
FT                   /db_xref="GOA:A0A0H3CW64"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW64"
FT                   /protein_id="ADJ42174.1"
FT                   /translation="MATPDDITTLVTTLAQLASRLTAANEADTQPPPRPMPPRVLFTVQ
FT                   EAGAQLGIGRTTAFTLVASGELESVQIGRLRRVHIDAINDYAARLVARSKNTDAA"
FT   gene            complement(369659..371008)
FT                   /locus_tag="AMED_0353"
FT   CDS_pept        complement(369659..371008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0353"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42175"
FT                   /db_xref="InterPro:IPR022081"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVV1"
FT                   /protein_id="ADJ42175.1"
FT                   /translation="MPDLDTALSAIDAAIADPDSGTRTVCGHCGTALAGSPSDDFCTEE
FT                   CQTAWLAEHAAGPDPVDNGAGPDRDLAEQDPARPMPYMPAPPPPPSGAQILDKVAAFVS
FT                   RFNVFPSEHCAATLALWYAHTHAAEHFYVTPRLILDSAEPGSGKTRVLEVAQFLVRSAE
FT                   MTLSATTAALFRLVSDGPITILFDEVDAIFNPAKGGNTEDLRAMLNAGYKRSATIPRCV
FT                   GDARAMKVERFKVYAPVALAGIAGHMPDTITTRAITFHMRRRAPGETVEPFKERVVERQ
FT                   AAPLRDKLATWVASVGNQVGDAEPEMPEGVTDRAAEIWEPLLAIADAAGEHWPATARAA
FT                   CAYFVASNSNRGGSFGIQLLADMRRIFAQRNTDRLPSTFIIAELLEMEESDWTDVKGKP
FT                   LNPRMMAKELARYDVKPTTFKYDGDSVKGYTTTGETGLADAWSRYLPTAG"
FT   gene            complement(371064..372689)
FT                   /gene="dcm"
FT                   /locus_tag="AMED_0354"
FT   CDS_pept        complement(371064..372689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcm"
FT                   /locus_tag="AMED_0354"
FT                   /product="DNA (cytosine-5-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42176"
FT                   /db_xref="GOA:A0A0H3CXY2"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031303"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXY2"
FT                   /protein_id="ADJ42176.1"
FT                   /translation="MTYTTYHEFAGFGGDATGVLAVPGTHGVLGANHNPDAIATHALNF
FT                   PGMDHYEGDIAKADIGTFPRVDFFWASPSCPPWTDARGVKRDFDQSTQGVLFDPATGPR
FT                   ATDPSVARARALMEEVPRYLQAMNRRGRPVLGGVTENVVQVVKWDQFKRWRREIEEEGY
FT                   RTRLIALNAMHVTGPTLGKVAQSRNRFFLAYWLEALGRDPDWDKWLRPRAYCPDCDVMV
FT                   SAVQAFKKPAAVPGTEMGVYGIRHGQYVYRCPNRSCRRRIIEPGVLPASEIIDWSLDPG
FT                   QRIGERVDKKGRPDPLEPTTIDRIEAGLARHVGALLAPAGGTWREHATSLAVPLPTRTT
FT                   RETDGLVCPPLLVSCAARAGVDTATTVAVPLRTQTCRRETAVVVPPFVSLQRGGGSATA
FT                   AYPIAGPIPTVSAQGNHHGLVGPPAGDELALLVAYYGNGGTQTTDRPVGTLTTRDRYGL
FT                   LGSTGTHHATPPPVEACTFRMLEPHEIAAGMGFPSGYKVPPKVAKSKRKQVRGWGNAVP
FT                   PAMAEVLASALIETFSGEPLEPAA"
FT   gene            complement(372689..373042)
FT                   /locus_tag="AMED_0355"
FT   CDS_pept        complement(372689..373042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0355"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42177"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CU64"
FT                   /protein_id="ADJ42177.1"
FT                   /translation="MTTSHTDPDTPVTVCFCGSMRFMPAMLEASIDESLAGRIVVLPLV
FT                   NMKAPDARWSTDEQRERIKTALDTLHLAKIARADEVLIINPGRYIGESTRREIAYAHQL
FT                   GKPVRYLVPMEAS"
FT   gene            complement(373039..373539)
FT                   /locus_tag="AMED_0356"
FT   CDS_pept        complement(373039..373539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0356"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42178"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV47"
FT                   /protein_id="ADJ42178.1"
FT                   /translation="MARRNPWVLAAVPWSQDLEFTRGRWCGKPLLSYNIAPRHLLATRH
FT                   QLRAENMRPGGQDPVAFLYFRCHKAAKLVYANLYLIAEAKPVRPMTPARAAALAKAMAA
FT                   RRTCRECGETGWAELPKAHRTCEACLYTAGLPADSYLHDYLIGEPTLTAAEHAALTEVS
FT                   RTR"
FT   gene            complement(373648..373848)
FT                   /locus_tag="AMED_0357"
FT   CDS_pept        complement(373648..373848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42179"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW69"
FT                   /protein_id="ADJ42179.1"
FT                   /translation="MKIRIMGTRAETDDAVKVLRLAFDVLEVSDFRPNRRRESRDGRVY
FT                   VSRLGRVYVEANPPADPLPGT"
FT   gene            complement(373880..374836)
FT                   /locus_tag="AMED_0358"
FT   CDS_pept        complement(373880..374836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0358"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42180"
FT                   /db_xref="InterPro:IPR015330"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVV5"
FT                   /protein_id="ADJ42180.1"
FT                   /translation="MTSSAQSAALRAAAMEMAGRGWKVFPCRPGSKAALWHRQEHCRGG
FT                   GVCADGHVTPESLATSDVERVAARWSDGVAYNIAVYPGPSGLFILDCDIPKAARPGQPP
FT                   ARGEHDPDGWTQLQALAGQRGGPLPDTFTLATPSGGRQLWFTAPPGTLLRGTVKHVATN
FT                   IDSRGWGTYGLAPGCVLLNGAYELIDDTDPVELPGWLVQANVERASGAISGRPEKPVAA
FT                   PDAYTARAVRAECDRVASEPPGRRNKVLSTAAYALGQLVGAEVLDREHARAELETAVAA
FT                   WNTPASWAKDTGVIATSLAAGEGNPRRINRRGPGRAA"
FT   gene            complement(374833..375129)
FT                   /locus_tag="AMED_0359"
FT   CDS_pept        complement(374833..375129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXZ0"
FT                   /protein_id="ADJ42181.1"
FT                   /translation="MAEKAKYRATDITAWLTAAGIDDDAARRAGRVIAGAWNQREFYAS
FT                   ATGLPLAAALTASGLPLARLDTTADGLARRFGVHLHDVAAWDREPHWRKEIST"
FT   gene            complement(375145..375618)
FT                   /gene="ssb"
FT                   /locus_tag="AMED_0360"
FT   CDS_pept        complement(375145..375618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="AMED_0360"
FT                   /product="single-strand DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42182"
FT                   /db_xref="GOA:A0A0H3CU68"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CU68"
FT                   /protein_id="ADJ42182.1"
FT                   /translation="MPEITMAGTLTADPEMRFTPSGAGVCSFTLVANDRRLDKESGEWR
FT                   DMGATFLRCTVWRRQAENVADARKGDRLLIVGELKQSEWQDKNTGEKRYGFDVQVREAA
FT                   LSLLWHPAKSARPDRSGGEHTGGTGGGGGGARDPWTAPPATGSAGGFSDEPPF"
FT   gene            complement(375895..376281)
FT                   /locus_tag="AMED_0361"
FT   CDS_pept        complement(375895..376281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42183"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV53"
FT                   /protein_id="ADJ42183.1"
FT                   /translation="MPEFLPAPEPAATDMYACLCVHAPTVLTDPSGAIVAVGVTRPAVA
FT                   AAMIRAAAPGLQLPVPDRADAQTFRLRWFAYTHPATPGDPVLRPAGPGEDGAFPVVIWR
FT                   AADQTRARATRDAAHALTVMGVAA"
FT   gene            complement(376415..376861)
FT                   /locus_tag="AMED_0362"
FT   CDS_pept        complement(376415..376861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42184"
FT                   /db_xref="GOA:A0A0H3CW72"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW72"
FT                   /protein_id="ADJ42184.1"
FT                   /translation="MGLFTSAGDPDNPAHLAIAAHELGHAWAWSDGGLQILSITFTPRG
FT                   GHVRTRNPSGHPPQLIAEAVGLWAGFEAEDRWLREHRLGKASRGNSSHDIRAFRSIQRI
FT                   MHREYRQTLTERSVRASARAAVNRHWAQIQHAAPALVKRGRITL"
FT   gene            complement(377158..377385)
FT                   /locus_tag="AMED_0363"
FT   CDS_pept        complement(377158..377385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0363"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42185"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVW1"
FT                   /protein_id="ADJ42185.1"
FT                   /translation="MAEVIAGADVKATDVGARLRKLAPGYEPYANLTAEKVKEALEAVG
FT                   VPVRLKQGIITVRARHVANAIADREEQVSD"
FT   gene            complement(377373..379469)
FT                   /locus_tag="AMED_0364"
FT   CDS_pept        complement(377373..379469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0364"
FT                   /product="DNA segregation ATPase FtsK/SpoIIIE"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42186"
FT                   /db_xref="GOA:A0A0H3CXZ6"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CXZ6"
FT                   /protein_id="ADJ42186.1"
FT                   /translation="MNPTDHTNNNQTTPETTRQSGTESTAGSAAELATIHPLRARPDQQ
FT                   RSTAAGAVESGPEVIEGEIVTDEQWRLYTSQKAQMEWRLAEYKRQALWLSTHAVTAVTH
FT                   ETTVSTLKFVGRNVLVYPTLGAVTAVKRWRDTHGSSRYERMMRAAELAGDHEKLAEWEA
FT                   RDVTEKQRRHDRAMDWIQSPVQLAKAVALSTLSVAVLLLVLGIILAIAGHGGVLDPIIG
FT                   VIDAIGFCIWFVITYGVFLTVAGTAGALTYLWNLGRHSQSVPQLFRPASARLVDDVIIT
FT                   PSIVVTALRDLRISELRRKIEQMEDGGAAMLSPIRLAGCGVEFDVHLPSGVDTEEVKRK
FT                   RRKLAENMGRHEHEVFITTPPSPRTIRVWAADSGALDQPIGPSPLVTDPTITADLYTGR
FT                   APWGVDLRGDAVLMALLQCHLLMTGLSKQGKTASLRALALWLVLDPSVGLHIADLKGIG
FT                   DWRMFKPVAETLIEGPSDSHCIAATELLEWGVEEMERRLLAFDGDKYRNGVPRELTKPG
FT                   GPFAPIVILVDEAQNAFMNPQVDDQKNPYGGQTNKSRYFMAARKIQNQGRAVNVVLWQG
FT                   TQDPTDQNLPKLVREGAHIRAALALGTESQSRMAVGDKAVDGGAAPHELRSGLDKGTLV
FT                   VAGEGVPLPAGQSSMTVRTHFIDGDDAATVIERAVAIRGGAKAEPAQVEAAPQVRDLLE
FT                   TWPR"
FT   gene            complement(379576..380748)
FT                   /locus_tag="AMED_0365"
FT   CDS_pept        complement(379576..380748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0365"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42187"
FT                   /db_xref="GOA:A0A0H3CU75"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CU75"
FT                   /protein_id="ADJ42187.1"
FT                   /translation="MSTTKIAGDDHDDDGGEVGRGLAALERHLAAVAPPAPAGHAAADA
FT                   PEPPRDPEPASQRAGRGVTRRVRRRVAEHAEAHQLLALETDTAPFQVTTDKVRTRRKAV
FT                   EQAAALWRLDRDPRVLAYRDARMRRLILAVALVSLTLALAWSTAGVQAFAAEGAAAGSP
FT                   RWWFAWLAEPFCSLALLMVVSGRAYLTTRGHPLNDRAVDRTEWVFLGLTLGMNAWPHLP
FT                   GVAASFTVSGLVLHLLGPVVAVAVVRCLPRLLAAFAGLALPTGAEAGTAPVTARGEGRT
FT                   EAAPDEPNQPAATLLSSSPAPITAPTTPADRPAATRRTTRVRRTARATIPEPKRRSFAQ
FT                   LAEEFAAAVADPPAGFDPSNGESIRKTLQCGKTAARELKARYLAESGGSD"
FT   gene            complement(380745..381077)
FT                   /locus_tag="AMED_0366"
FT   CDS_pept        complement(380745..381077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42188"
FT                   /db_xref="GOA:A0A0H3CV60"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV60"
FT                   /protein_id="ADJ42188.1"
FT                   /translation="MRELNDTPPAAAPRRRTRTDVAVAWTSAHAIELTGVGAPLVAGQI
FT                   WSPWLDLISAVLAGVWAANEIRLHRRTRPARQIAVTTTPPARQLSSTASSAPAPAAGTD
FT                   RKEAKA"
FT   gene            complement(381070..381384)
FT                   /locus_tag="AMED_0367"
FT   CDS_pept        complement(381070..381384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42189"
FT                   /db_xref="GOA:A0A0H3CW77"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW77"
FT                   /protein_id="ADJ42189.1"
FT                   /translation="MSTPDGFPPNPGAALLGRLLERNGTWALLRVFAALALFLVLHLIR
FT                   IPLVVAARILAGVMAPLDAYATRHVSTPPRGPVNQFFDPHNTHPSPGPPGRMHWEVVHA
FT                   "
FT   gene            complement(381384..381614)
FT                   /locus_tag="AMED_0368"
FT   CDS_pept        complement(381384..381614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42190"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3DCG0"
FT                   /protein_id="ADJ42190.1"
FT                   /translation="MTGPEHYKIAEKLIAGGIQRVTPWGDTDWVAPTPEVVARAQVHAT
FT                   LALAAATASGAWAEMSNDESRSWDQAIGVER"
FT   gene            complement(381781..381975)
FT                   /locus_tag="AMED_0369"
FT   CDS_pept        complement(381781..381975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0369"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42191"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CY01"
FT                   /protein_id="ADJ42191.1"
FT                   /translation="MPAKDDDDRFTFGLVVDVADVLARHRYPELTSGDDFVALQQALFR
FT                   FLYTTSTEPYRLDPTTEES"
FT   gene            complement(382083..382463)
FT                   /locus_tag="AMED_0370"
FT   CDS_pept        complement(382083..382463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0370"
FT                   /product="sporulation and cell division protein SsgA"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42192"
FT                   /db_xref="GOA:A0A0H3CU80"
FT                   /db_xref="InterPro:IPR006776"
FT                   /db_xref="InterPro:IPR038658"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CU80"
FT                   /protein_id="ADJ42192.1"
FT                   /translation="MELIYPADAVVNGRGPVPVALLYDPADPWAVTLLIAGHEWLFARE
FT                   LLATGLSEPAGDGDVVVRPDIGGTFGHVLLTLTAPAGCADVALPRGTVESLLDAAEALV
FT                   PRGCEGIDWDREWARLANGPAA"
FT   gene            complement(382454..382978)
FT                   /locus_tag="AMED_0371"
FT   CDS_pept        complement(382454..382978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0371"
FT                   /product="DNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42193"
FT                   /db_xref="GOA:A0A0H3CV65"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV65"
FT                   /protein_id="ADJ42193.1"
FT                   /translation="MSWIGSLAAKVAARLDDRDPVFYAADVTLFAMHEGVWHVLLIERG
FT                   WAPDKGKLALPGGHVDAGESSEQAARREAAEETGLDLSGVVLDRIGVYDAPGRDARGRY
FT                   VSVAYGAVLEDAIAPVAGDDAASAAWMPLPTAARVAHRGGFAFDHADILFDAARRYGFG
FT                   PDSPGSWDLWS"
FT   gene            complement(383019..383705)
FT                   /locus_tag="AMED_0372"
FT   CDS_pept        complement(383019..383705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42194"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW84"
FT                   /protein_id="ADJ42194.1"
FT                   /translation="MSRTLTTVTAARFRDLADTLTRNATLLATAGLPEIVTGVRATVYG
FT                   DVAAQLRLLAEAEPVVAEGNPLVLVREDGPAVVARRFEMLAGLLAANARVLTRGTRDVV
FT                   MHRRAGVYRDVAAQVRLLAEVEREAAEARRTQTSRPPLSNTTPDSPVVAKAAVRAPRVR
FT                   PEFLDALVAAIAKRRAQGWSVARLTLWLRTTLRDPQTGAVHPCAERSFVSYVTALLAGP
FT                   AVRAAA"
FT   gene            complement(383812..384048)
FT                   /locus_tag="AMED_0373"
FT   CDS_pept        complement(383812..384048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42195"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVX1"
FT                   /protein_id="ADJ42195.1"
FT                   /translation="MTDRLFVPAAFVHLLATMPPVSATAWEREHWLDVAYSTVRVEFSG
FT                   PHSMEAMRLARVFLTELDATRVEIEDAYLALAA"
FT   gene            complement(384050..384307)
FT                   /locus_tag="AMED_0374"
FT   CDS_pept        complement(384050..384307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0374"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42196"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CY07"
FT                   /protein_id="ADJ42196.1"
FT                   /translation="MSTPARTARRKIEMDAAELDFDYFADTTSLAGDGVLVDDFDNVAE
FT                   LVDLYAEIAEIEEALAELERPVAQVIALPTATPRPLGEVA"
FT   gene            complement(384772..384975)
FT                   /locus_tag="AMED_0375"
FT   CDS_pept        complement(384772..384975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42197"
FT                   /db_xref="GOA:A0A0H3CU85"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CU85"
FT                   /protein_id="ADJ42197.1"
FT                   /translation="MAKNNGGLIIPTSKRGGLLKGALVILGIGALVLVIKHPVDAASMT
FT                   TAAVSGIGDAFDSVATFLRSLH"
FT   gene            complement(387030..387692)
FT                   /locus_tag="AMED_0376"
FT   CDS_pept        complement(387030..387692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42198"
FT                   /db_xref="GOA:A0A0H3CV70"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV70"
FT                   /protein_id="ADJ42198.1"
FT                   /translation="MSCNDATTIERVSEHPRLDKTPDTSEPEDLPVRSQRDHVWCLNRK
FT                   HRWALANGGSGYHHALRLSTQVCARCWARRQPRARWLVVDHRTPMPADQADQLDDRGAR
FT                   ILVVARRPAVRAGAGRLEVRVRGIVVAITELQLCGIDHRGVVRHIQVDPAHRRRGFGTL
FT                   LLDAAQARGPGYHWSTVRLDQSEDSQDFWAYQDPAEPLHLGEPHYCTHMREANGEWV"
FT   gene            387980..388507
FT                   /locus_tag="AMED_0377"
FT   CDS_pept        387980..388507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0377"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42199"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW89"
FT                   /protein_id="ADJ42199.1"
FT                   /translation="MLAAVVAGLVLMVTSTTMLAVNAAEQAAIERQQQAQAHEQAVARI
FT                   LPRTPASMVNFLAERIARPTPTAVADACFVFSPAAQRQLADAHGGEDCPGAIQALAAQV
FT                   VDPSGYVNHLWLPGRATQPGPAGTLTVDACVLDFGGIAGWSGPDPGPQIGHLTLTQQHG
FT                   EGQLITRYTRCS"
FT   gene            389270..389455
FT                   /locus_tag="AMED_0378"
FT   CDS_pept        389270..389455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42200"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVX5"
FT                   /protein_id="ADJ42200.1"
FT                   /translation="MHGNLRGALSITSASVFAFDPVAYQQLTAASPPGSAGTLAVDACS
FT                   LDHEHQLTPSVAYFAD"
FT   gene            390984..391571
FT                   /locus_tag="AMED_0379"
FT   CDS_pept        390984..391571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0379"
FT                   /product="SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42201"
FT                   /db_xref="GOA:A0A0H3CY12"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CY12"
FT                   /protein_id="ADJ42201.1"
FT                   /translation="MSPVTQNVWDAEAATFDEQPDHGLRDPVVRAAWAELLLPLLPPAP
FT                   AGVVDLGCGTGSLTLLLAEAGHEVCGVDLSERMLDAARAKTAGLQVELRLGDAADPPCP
FT                   DHSCDVVLVRHVLWAMPDPAAAVGRWVRLLRPGGLLLLVEGRWSTGAGITAAECRELVR
FT                   AHREEATVRQLTDPALWGAEIEDERYLVVSRS"
FT   gene            391715..392065
FT                   /locus_tag="AMED_0380"
FT   CDS_pept        391715..392065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0380"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42202"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CU90"
FT                   /protein_id="ADJ42202.1"
FT                   /translation="MRYLLTLHMNPTLWATLTDEQKNGVYEGHGAFIKLVTESGEMVET
FT                   KALAEPAETTTVQVKDGVAHTKTGGFVESDAFLCGYYIVDVESEARAVELAAKIPDAQY
FT                   TAVEVRKIVHEG"
FT   gene            392099..392890
FT                   /gene="nat"
FT                   /locus_tag="AMED_0381"
FT   CDS_pept        392099..392890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nat"
FT                   /locus_tag="AMED_0381"
FT                   /product="arylamine N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42203"
FT                   /db_xref="GOA:A0A0H3CV75"
FT                   /db_xref="InterPro:IPR001447"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV75"
FT                   /protein_id="ADJ42203.1"
FT                   /translation="MTTEGEWGIGAVDLDAYLARVGQPRRAPSEAALTDLMRAHVKAIP
FT                   FENVDVVLGQHQGISLDVVSAKLVGRRRGGYCYEHSGLFAAVLEQLGYTVHRLSARVQP
FT                   RRPGPYTHMTLVVDVDGRQFLADVGFGAGILDPMPLVDGHEVDQAGWPHRIKQNDGWWT
FT                   LQKGDEDILEFRLNEMHPIDYEVYHHYTSTHPKSPFTGRLVIMTIEPGVSRTLLGRELT
FT                   VEKPGGSREAATVAPDELDTTLKELGIELTADELERLKNVY"
FT   gene            complement(392884..395205)
FT                   /locus_tag="AMED_0382"
FT   CDS_pept        complement(392884..395205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0382"
FT                   /product="signal transduction protein containing EAL, PAS
FT                   and GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42204"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW94"
FT                   /protein_id="ADJ42204.1"
FT                   /translation="MQADSLAELVELSPDAICVHEHGVLTYANRAALETFAARSADEVV
FT                   GRRFTEFVAEDAQAVLVEKLVQLTEPGQASEPVEALMSRLDGSKFAVETVLVRLGEAAY
FT                   QVVMRDITAKKAAADALRYQAALVSHVSDALIATTGEGVVTSWNPAAEAVYGWTAAEAV
FT                   GRRASELVGAPLDLPAIRRGGGVAEAVHRHRDGAPLAVRVSAAEMNDGYVLVCADETAR
FT                   RRAEQNYRTVVASLDEGVLVMGPGGLIEAANPAACRILGVAEADLIGVPCHTLTLFTES
FT                   GKWIPPEEMPSVQTRRTGVTHNGLVVRLRRPDGRDVWVSLTSRLLAPDDPAAMAVVTSF
FT                   TDITETRAISAQLAYDATHDPLTRLANRTLVLGGLDARERGAVTVLFLDLDKFKVINDS
FT                   LGHSVGDQVLRIVGERLRRSSGRDDLVGRLGGDEFVVVTAEVTDPVEVHALAEHLRAAL
FT                   AEPIGVLGRQLHLDASIGVVLVGRDDRRSAEDLLRDADVAMYQAKSLGRGRHHFFDVGL
FT                   RERMQRRLRMEQDLRYAVHDGQLWPAYQPVVDLRTGEMVAVEALLRWTHPRHGAISPAE
FT                   FIPLAEESDLINVIGKEMLRATTRELAARRVQQGLDLTLKVNLSARQLDDPHLVPAVQD
FT                   ALAATGLPAGALCLEVTESALMRDQEAAAEVLASLRSLGVLLAIDDFGTGYSSLAQLRR
FT                   LTLDTLKIDRSFITGIAESRDAEAIVTSIIAMAHAVDLTVIAEGVESAEQLELLRALGC
FT                   DQAQGYHLGRPVSAAELFDQ"
FT   gene            complement(395271..395975)
FT                   /locus_tag="AMED_0383"
FT   CDS_pept        complement(395271..395975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0383"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42205"
FT                   /db_xref="GOA:A0A0H3CVY0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVY0"
FT                   /protein_id="ADJ42205.1"
FT                   /translation="MLLRAERPIPSIAVARRSPWALLRYVPNPKTTPFTFGYLVVLLAT
FT                   TLLLEFADPALTTRLLQLSSTDAHNLWRRPLTSLLSSAIWLPGENWLVYALIFAIAVAP
FT                   LERRFGARRTALVFLAGHIVATLVTELPVMALISAHVLPNSAGHWLDIGVSYGFFTTAG
FT                   ALVFLLPGRARLLALAATEAFIAAIWLSDDPTSLDSIVTLLGHAFAAHFGLLVCGPWLR
FT                   ERIRRPSPDFAG"
FT   gene            396166..396726
FT                   /locus_tag="AMED_0384"
FT   CDS_pept        396166..396726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42206"
FT                   /db_xref="GOA:A0A0H3CY19"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CY19"
FT                   /protein_id="ADJ42206.1"
FT                   /translation="MNDEVSVAELLVREGWGDRPGPGQSRWRVVAVMLAVIVGCGAAAA
FT                   LVAFGGKEREDASPVDQIQVIPFPQRTTGLGGADQATDSPPDGGIGGGTGGDVVTASNE
FT                   HRGTVTEVPGRNPATETAGIGSGPGSATPTATPSGSAPATTGGASTTPPPTGNPTSPGG
FT                   RPPTPTPTSAPPRPTTCFLVICW"
FT   gene            complement(396727..397173)
FT                   /locus_tag="AMED_0385"
FT   CDS_pept        complement(396727..397173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0385"
FT                   /product="pyridoxamine 5'-phosphate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42207"
FT                   /db_xref="GOA:A0A0H3CU95"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CU95"
FT                   /protein_id="ADJ42207.1"
FT                   /translation="MARKMTKDEREAFLAEPQVGVLSVAAEPGRAPLTTPIWYRYEPGG
FT                   DVVVMTSPGLRKARLIEAAGRFALCVQQQDGVYKYVSVEGPVVESWPMTKAERHEMAAR
FT                   YLPPGVSEAYTDATDEAHGSNIAIVMRPERWNTSDFSDLAERLA"
FT   gene            397261..397836
FT                   /locus_tag="AMED_0386"
FT   CDS_pept        397261..397836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0386"
FT                   /product="TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42208"
FT                   /db_xref="GOA:A0A0H3CV80"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV80"
FT                   /protein_id="ADJ42208.1"
FT                   /translation="MTRPGGRSARVRDAVHDAVVELLAAGEIDAAIPKIAERAGVNPTS
FT                   IYRRWGSRDALLLDAAVTRLRSTSPIPDTGSLRGDLLGWAEGVERAMRDRHGQILLRAL
FT                   VATLRPDEKPLEYLRARGDDLQATLDKAEARGEPVPSVDEVLDFVLAPLYLRVLFRRAV
FT                   EPGTGTVLVDRLLRVPRADPAPSDGRGG"
FT   gene            complement(397787..399118)
FT                   /locus_tag="AMED_0387"
FT   CDS_pept        complement(397787..399118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0387"
FT                   /product="xanthine/uracil permease"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42209"
FT                   /db_xref="GOA:A0A0H3CW98"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW98"
FT                   /protein_id="ADJ42209.1"
FT                   /translation="MTESAVHPVDQGLPAGRLALLGLQHMSIMYAGSVAVPLIVGSALK
FT                   LDPATIGLLVNADLLVAGVATLIQAIGIGKLLGIRLPVVAGATFTVVNPMILIASQYGL
FT                   TAVYGAMIASGVFGLLIARPFAKLIRFFPPLVTGTLLLVIGVSLLGPGAAMIAGHDPAS
FT                   PDYAAPSHIGLAFGVLALLVLFTRVLRGFANQVGPLLALAIGLVVAIPMGLVHWDGLRA
FT                   AGWFGLASPFHFGAPTFPVAAILSMCVVMLVTFTESTADMIAVGEITGRPPTDADLARG
FT                   LATDGVSAVLGGVMNSFPDTAFAQNVGLVRMTGVRSRWVVAVTGGILVLMGLVPKVGAF
FT                   IAAIPEPVIGGVAVVMFAMVAAVGAQNLRTVEFSGNHNTFVVAVALGVGLLPAFAPDIF
FT                   KHFPAWLQTICGSSITVAAVLAFALNLLFNHLGRRSEPDLLEAP"
FT   gene            399278..400342
FT                   /gene="metE"
FT                   /locus_tag="AMED_0388"
FT   CDS_pept        399278..400342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metE"
FT                   /locus_tag="AMED_0388"
FT                   /product="5-methyltetrahydropteroyltriglutamate-homocysteine
FT                   S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42210"
FT                   /db_xref="GOA:A0A0H3CVY5"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVY5"
FT                   /protein_id="ADJ42210.1"
FT                   /translation="MLRDARRRHESGEINAEQLRAVEDDAIRDVIKMQKAAGLSSATDG
FT                   EFRRASWHMDFIYALGGISKSDQRLHVKFHNLAGDLEFSPPGLQVDGKVRLDEPIFADH
FT                   FRFLQSHVDPGVTPKLTIPSPSMVYYRGGRAAVSESVYPDLEEFFADLSAAYSAQVRAM
FT                   SDLGCRYLQLDDTSLAYLNDPAQRELVARMGGDPDTQHLRNIATMNAALEGRPEGLTVT
FT                   THLCRGNFRSSWAAEGSYEFVAEALFGELAVDGFFLEYDDERSGGFEPLRFVPKDKKVV
FT                   LGLVTTKRPELEDPDVLVRRIEEASQYVDIDRLCLSPQCGFSSTEEGNDLTPDDQLRKL
FT                   ELLVATADRVWGGH"
FT   gene            400342..400662
FT                   /locus_tag="AMED_0389"
FT   CDS_pept        400342..400662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0389"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42211"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CY23"
FT                   /protein_id="ADJ42211.1"
FT                   /translation="MITCVVDYVIDPAKLPDFERFAAAWMRLVQREGGIHHGYFLPAEG
FT                   ASDEARALFSFESLAAYERYRTLFGVDPDFIEADKIRDESGCVVRYRRTFMRPLLPDDE
FT                   EG"
FT   gene            400659..401450
FT                   /locus_tag="AMED_0390"
FT   CDS_pept        400659..401450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0390"
FT                   /product="IclR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42212"
FT                   /db_xref="GOA:A0A0H3CUA1"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUA1"
FT                   /protein_id="ADJ42212.1"
FT                   /translation="MRHSARRPPSVVDRVLDLLGAFTAERPRLTLSELSRRAGLPLSTT
FT                   HRLAGELTRRGALVRDETGAYRVGLWLWEVASLAPHGAELRESAMPFLEDLYEATHQNV
FT                   QLAVLDGPEVVFVERISGRGAVNVLTRVGGRLPAHATGVGLVLLAHAPAEVQEEVLAGP
FT                   LKTFTPKTIASPVLLRRVLADVRRDGHVISDGQVELVALSVAAPVRDATDEVVAAISVV
FT                   VPAEGTDPRTLVPAVRAAARGISRVLGAPRAVRPADGSSTA"
FT   gene            401504..402718
FT                   /gene="hcaD"
FT                   /locus_tag="AMED_0391"
FT   CDS_pept        401504..402718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hcaD"
FT                   /locus_tag="AMED_0391"
FT                   /product="ferredoxin--NAD+ reductase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42213"
FT                   /db_xref="GOA:A0A0H3CV87"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV87"
FT                   /protein_id="ADJ42213.1"
FT                   /translation="MTTVLVVGAGQSGFQAVASLRDRGFAGRVVLVGDEPGVPYQRPPL
FT                   SKAYLAGTAGLEQLHLRGEDFFAEKDIELVAGRVAGIDRAARKAELEDGRELDYDFLIL
FT                   ATGARNRTLPVPGADLPGVLTLRTRDDADRLRESLSRAENVVVAGGGFIGLEFASHAGR
FT                   PVTIVEAQDRLLNRVATPEISAYFAGLHRNAGHTVVLGQGVTAMHGDSRVREVELSDGT
FT                   RLPADLVVVAVGVVPETTLAEAAGLPVRNGVVVDAHLRTADETIFAIGDCANFPCVQAG
FT                   AETRLESVQNAVDQARCVAAAITGTAEPYASLPWFWTDQAGAKLQIAGILAGADRTVVA
FT                   GDPAEGKFSVLSFRDDVLIAVESVNRPADHIAARRLFTAEPKPAYADLEASAFDLKAHL
FT                   KSRAA"
FT   gene            402849..403646
FT                   /gene="pobA"
FT                   /locus_tag="AMED_0392"
FT   CDS_pept        402849..403646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pobA"
FT                   /locus_tag="AMED_0392"
FT                   /product="p-hydroxybenzoate 3-monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42214"
FT                   /db_xref="GOA:A0A0H3CWA4"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWA4"
FT                   /protein_id="ADJ42214.1"
FT                   /translation="MNLSDVDSDRPRVRHRDGEGNVKTIECDAVAGCDGFHGICRPSIP
FT                   DSALTVYEREYPFVWLGVLARTPPSHHELIYTHHERGFALHSMRTPEITRLYLQVDPAE
FT                   SLEAWSDDRIWAELTARLEVEGDFTLRDGPILDKGITPMRSFVAEPLRHGRLFLAGDAA
FT                   HIVPPTGAKGMNLAIADVRALARALEALLRGDDTLAAAYSDTCLRRVWRAEHFSWFMTT
FT                   MLHTDPHADGFARQLQLSQLRYTTSSRAAATSLAENYVGLPFA"
FT   gene            403699..404436
FT                   /locus_tag="AMED_0393"
FT   CDS_pept        403699..404436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0393"
FT                   /product="Clp domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42215"
FT                   /db_xref="GOA:A0A0H3CVZ1"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVZ1"
FT                   /protein_id="ADJ42215.1"
FT                   /translation="MTLPTNVKLDDLINAIKSNNDKDALAQLTDAVYVGQHLGEVADHL
FT                   IGHFVDQARRSGASWTEIGASMGVTKQAAQKRFVPKVDPGGDPSGAIERLYGRYTDRAR
FT                   HVVVEAQKAAVDHASPEIDTVHIVLGLLTEPAALAAGAILAQGVSLDAVREAAEARLPE
FT                   PTDPVPNVVPFSGAAKKTLELTMREGLRLGHNYIGTEHLLLALLEQGEGSGFEVLDGLG
FT                   VKKDKAEAKILEVLAELLAARGQ"
FT   gene            complement(404560..405999)
FT                   /gene="gnd"
FT                   /locus_tag="AMED_0394"
FT   CDS_pept        complement(404560..405999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gnd"
FT                   /locus_tag="AMED_0394"
FT                   /product="6-phosphogluconate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42216"
FT                   /db_xref="GOA:A0A0H3CY30"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CY30"
FT                   /protein_id="ADJ42216.1"
FT                   /translation="MSKKASIGVTGLAVMGRNLARNLARHGHTVALHNRSEERTRALVE
FT                   QFGDEGDFIPAYSAQDFVNALERPRQVVIMVKAGGPTDAVIEEFAPLLEEGDVIIDAGN
FT                   AHFADTRRREKALRERGLHFVGSGVSGGEEGALHGPSIMPGGSKESYESLGPLFEDISA
FT                   KVDGEPCCTHIGADGAGHFVKMVHNGIEYADMQLIAESFDLLRHAGGYAPAEIADVFRT
FT                   WNTGRLDSYLIEITADVLAHVDSSSGKPFVDVVEDAAEQKGTGRWTVQIGLDLGVPISG
FT                   IAEAVFARSLSGSKSLRAAARGLGGPSAAPLSGASLERFADDVEQALYASKVVAYAQGF
FT                   NQIQAGATEYGWDIDLGKVASIWRGGCIIRAKFLNDITAAYADEPELPTLLTSGDFRKA
FT                   VEDAQDSWRSVISTAVKLGIPTPGFSTALAYYDGLRADRLPAALVQGQRDFFGAHTYRR
FT                   VDREGSFHTAWAADGRPESGA"
FT   gene            complement(406085..407005)
FT                   /locus_tag="AMED_0395"
FT   CDS_pept        complement(406085..407005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0395"
FT                   /product="beta-lactamase class B"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42217"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUA7"
FT                   /protein_id="ADJ42217.1"
FT                   /translation="MTDRSPAAAAVTRLADRVHGYVQPDGSWYINNCGFVDAGDHTVLI
FT                   DTCSTERRTRALLETVEAATGSPVTTLVNTHHHGDHTNGNYLVGGATIIGHRKTRELMV
FT                   AEGIQTFDGIFVGNDWGELESRPPEVVFDDRLTVHAGDVTLELIHPGHAAHTTNDVLVW
FT                   LPEQRVLYAGDLVFNGGSPFALMGSVAGWRKGLDVIRELSPEVILPGHGGPCGLDVVDT
FT                   VDRYLAFVQKTAERGKAAGLSPLEVAKETDLGEFASLSEQERLPGNLHRAYAELDGAEW
FT                   GADIDLVAAITDMLAINRGPIRCFS"
FT   gene            407241..408104
FT                   /locus_tag="AMED_0396"
FT   CDS_pept        407241..408104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0396"
FT                   /product="XRE family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42218"
FT                   /db_xref="GOA:A0A0H3CV92"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV92"
FT                   /protein_id="ADJ42218.1"
FT                   /translation="MASTVTSRRKQLGNELRHARTAARMTQQQVAEVLGCTQGKVNKIE
FT                   SGAVGVKLGDVRSMLNAFGINGEEADTLMNLARAAAGQRGHWSGYRSVVPHWFRTFTDL
FT                   EPAAAEILTWHGERIPGPLQSEHYMLKQFTEAGATDVTSLVRNRLDRKAVFEQQQPPYY
FT                   RFIISEGALRRAPGGYAPAVMLDQVEHLLSLEKHPRVYVHVLPFGARLAAVPNDFTIMR
FT                   FPDRTRDFVYIEHSAGGLYLDDVKDFNIFVDSWDRLRGAALERQETRQFLKELAEGYRA
FT                   QMQQLQ"
FT   gene            408205..409056
FT                   /locus_tag="AMED_0397"
FT   CDS_pept        408205..409056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0397"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42219"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWB0"
FT                   /protein_id="ADJ42219.1"
FT                   /translation="MDPDFLPDAIDLDRPNIARIYDWALGGSANWAIDRQYGEQAVQAF
FT                   PLAKALARGNRDFLGRAVRYCLAEGITQFLDLGSGIPTAGNVHEVADDYADDSRCVYVD
FT                   HEPVAVAHGRMLLEEAGDPERHAVLHADLRDAEEVWEAALATGVLDPDRPICLLTVAVL
FT                   HFLPDVTGVRQAIRDYRTLLAPGSAYVLSHATESGVEGEELEQIRKLVKLSERSSSPAV
FT                   SRSLDEIAAFFGTFDVVEPGIVPVGEWRPEPGAATVRLASVVGGVGRKPGGRNDDAGPR
FT                   SA"
FT   gene            409028..409876
FT                   /locus_tag="AMED_0398"
FT   CDS_pept        409028..409876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0398"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42220"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVZ7"
FT                   /protein_id="ADJ42220.1"
FT                   /translation="MTTQDPEAPEGVDLDRPNAARIYDWFLGGDANWAIDRQFGEQAVR
FT                   TFPMIKTVARVGRDFLGRGVRYLARNGIDQFLDLGSGVPTVGNVHEVAAAVNPDARCVY
FT                   VDNEPVAVAHSQILLEREGVADRHAVLQGDLRDPADIWKRALDTGVLDPNRPIGLIMVG
FT                   VLYFLGPDEPVAQTIQRYLSLLPSGSYFLSSHLTRDGLEEMGDAESRESIMKQYNQSST
FT                   PLHLRSRAEFTTFFEGLELVEPGIVYLPEWHPEEMESRATKKLANNPAFVGHVCGLGRK
FT                   P"
FT   gene            409873..410481
FT                   /locus_tag="AMED_0399"
FT   CDS_pept        409873..410481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0399"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42221"
FT                   /db_xref="GOA:A0A0H3CY34"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CY34"
FT                   /protein_id="ADJ42221.1"
FT                   /translation="MTAAAYDAVAVRYAEFVRGAWDDHPLERAVWTAFADSVRGRGPVA
FT                   DLGCGPGHLTAHLRSLGLEAFGVDLSPAMIELARAAEPSVRFEVGSMAALDLPDASLAG
FT                   ILSWYSVIHTPPVDVPRYFAEFARTLASGGHVLLGCFESRGGPLTSFDHKVTTAYCWPL
FT                   DELAGFAAAAGFTEVGRMYREPGAGERPMRHGSLLLRKP"
FT   gene            complement(410588..410842)
FT                   /locus_tag="AMED_0400"
FT   CDS_pept        complement(410588..410842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42222"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUB1"
FT                   /protein_id="ADJ42222.1"
FT                   /translation="MAVRVNSLFRREDEEHRGRRGIGNELRNRFGFSLIQAPLRKTTTW
FT                   ATDQDLPLRRHADGVRTTRPLEAAIDLTPLMRGRIGSSA"
FT   gene            411313..411567
FT                   /locus_tag="AMED_0401"
FT   CDS_pept        411313..411567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0401"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42223"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV98"
FT                   /protein_id="ADJ42223.1"
FT                   /translation="MADYPSFADYDPNTAVTLFEEAAWEKSFASEPNGGSCVEVNLGSQ
FT                   GVIGVRDTKLATSPVFVFDTAEWEAFLIAVKAGQFDLPA"
FT   gene            complement(411679..412224)
FT                   /locus_tag="AMED_0402"
FT   CDS_pept        complement(411679..412224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0402"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42224"
FT                   /db_xref="GOA:A0A0H3CWB5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWB5"
FT                   /protein_id="ADJ42224.1"
FT                   /translation="MRKTLLALAAVAGLLFATAAPANAYEPVNIVHTERVQAGPYGLTV
FT                   GFSTWPLKAMQSLDFTFIPDGGIEDKSGTLAMLGPGGAQRRAQPLVRHPRKREVWGLDV
FT                   RSLPRPGDWTLRFTVNGPAGSGTGELRALPVLEQPGPPMGVSWAISTLPLIGLVVLVVV
FT                   AWRRTRGRLRGGELPAIG"
FT   gene            complement(412217..413359)
FT                   /locus_tag="AMED_0403"
FT   CDS_pept        complement(412217..413359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0403"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42225"
FT                   /db_xref="GOA:A0A0H3CW02"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW02"
FT                   /protein_id="ADJ42225.1"
FT                   /translation="MDLTASGVRSTSVTQQARTGLLPANVVLGGSLLSLVGLTWDIQWH
FT                   DDVGPDTFFTLPHLFLYAGSAVVGLASLAVVLLTTAARRAGRPVDPRIGGRVVNVFGRT
FT                   FAAPLGYLVSGVGAATFLLYGLWDQWWHGLYGFDAVIDSPPHIGLLLSITVSLIGTTAV
FT                   FAAAREHRWGRLGTLASLTVLLTFGPVLALGLQQVPDDYADAVAIGTSMMAVLLVSVGA
FT                   GFARRPGGAAGTAALVAVVQAVFWWFSPWAAKAYADLVGLPLRDAVSGVPAMPSLAPMA
FT                   LLPVAALMELVYLAGRRRGWRPGRVSVVAGGIAGLLLGLSLPVQRFLLYTGAHLPPVWY
FT                   LTTTAVLSAALGLLGGFAGWRFGGMLCLLAPAKKGETADA"
FT   gene            complement(413371..413763)
FT                   /locus_tag="AMED_0404"
FT   CDS_pept        complement(413371..413763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0404"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42226"
FT                   /db_xref="InterPro:IPR032693"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CY39"
FT                   /protein_id="ADJ42226.1"
FT                   /translation="MKRPTLLIAVVALVVAAGAAWLLWGGNGAKSTTQQAVSGPYTVQF
FT                   SAEQPRIGGNTFAVAVTGPAPEAVTVAPVMAQMGHALTPVPAGPDGPGRFRAADVGLPM
FT                   AGQWEITVSLRGPGGPAQVVFPVLVK"
FT   gene            complement(413760..415127)
FT                   /locus_tag="AMED_0405"
FT   CDS_pept        complement(413760..415127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0405"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42227"
FT                   /db_xref="GOA:A0A0H3CUB7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUB7"
FT                   /protein_id="ADJ42227.1"
FT                   /translation="MLLAALGIAAGSGTAHADGAPTGADIQVAQTLGARELTVIIRRVD
FT                   TTPSPLRVDVVTHQGTAPGTLHLAVAAGGVPSSRADVVLGATPGVYAGNLQVDKPGPWE
FT                   LSLDDGAGPRATIPFIVPARVVPPWEKATYGGFVAAGAFLLLALIVGVRAKRTAFALIP
FT                   AGGVVAALAVAVTGALLSASTPAPPAPGSQLDPTFDNVTDPYANARLSTVDYSRPPVNL
FT                   AVEARQGDLTLRLTDGATGRPVDDLLVHDNALVHLVLVSPSGRLSHLHPVRVGPGDYRV
FT                   RLADPEAGTYAVAAELARRGGGVQLARSTVDMKGTAAPAPEPPGPGPRTIDGTPVGLTI
FT                   SPGTPATITAHFPAQDLQPWLGMLGHLIVTGPFTGPAGEGAAKAPTWAHVHAMVPPVAG
FT                   QADRPDETVAAYGPDVSFTYTFAEPGRYRIWLQAERGYRVLTVPAVVDVPTTGAAR"
FT   gene            complement(415253..416104)
FT                   /locus_tag="AMED_0406"
FT   CDS_pept        complement(415253..416104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0406"
FT                   /product="alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42228"
FT                   /db_xref="GOA:A0A0H3CVA3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVA3"
FT                   /protein_id="ADJ42228.1"
FT                   /translation="MNRLENMATVNGIRMHYRRAGDGPPLFLLHGWPQTSHCWRQVMAP
FT                   LAETHTVIAPDLRGYGHSDKPKSGYDKRTMAADIAALADHLGFAKTAVAGHDRGGRVAH
FT                   RWALDRPDQVDRLAVLDIVPTRAMWQRLDVIAKPSWHWLFHLQPDLPELLAGQNIAAYL
FT                   GYFFERWTYQRHALDADTQAEYVRAFSQPGALRAGFDDYRASFPDDAELDDADFEAGKR
FT                   VTQPLLALWGANGLVGTLPTLEIWREYAADVTGEALAECGHFLPEEQPGEVVAHLRKFL
FT                   DP"
FT   gene            416150..416710
FT                   /locus_tag="AMED_0407"
FT   CDS_pept        416150..416710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0407"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42229"
FT                   /db_xref="InterPro:IPR010852"
FT                   /db_xref="InterPro:IPR021005"
FT                   /db_xref="InterPro:IPR023286"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWC0"
FT                   /protein_id="ADJ42229.1"
FT                   /translation="MLGMEWVFDGGRPCLDLVNTMRSRHEEGVELLTGPDALAEWLALA
FT                   GFTTGPVPVTAGNVLAAKALREAIDRVLLPPEVPSKMDVDLVNNAAASAPAPPPRLALV
FT                   DGVLRREVPAAKDPVAAAFAALAADAIDLATSDAEVRICAADDCGQRFCDASPRRNRQW
FT                   CSMARCGNRAKARAHYARTLTRD"
FT   gene            complement(416833..417699)
FT                   /locus_tag="AMED_0408"
FT   CDS_pept        complement(416833..417699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0408"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42230"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW07"
FT                   /protein_id="ADJ42230.1"
FT                   /translation="MARPIVRGTAAWKYFGDFRDALLAEQVLVLQVAHPVVAAGVRDHS
FT                   DYTADPWTRLMRTVASLSIYVYGGTAGARVEAARLRALHRTFTGVADGRRYSALDPAAY
FT                   AWVHATLVKAPVDAQRFFGQPLSTSELSEYYAQMRGIGLVLGIRERDLPRDWADFERYY
FT                   DAMVAGFGANSTIETLFETIRTAPKPVRFLPDSWWRRLQRGQMLLVRATLPPSLRETLG
FT                   LQWTDADQRRFERFAACVRIACTPIPAWVRTAPMRWVGKLNVWLRAHPKVYRALVRHDG
FT                   PGAQPRP"
FT   gene            complement(417699..418274)
FT                   /locus_tag="AMED_0409"
FT   CDS_pept        complement(417699..418274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0409"
FT                   /product="TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42231"
FT                   /db_xref="GOA:A0A0H3CY44"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041583"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CY44"
FT                   /protein_id="ADJ42231.1"
FT                   /translation="MAGAASREKLVSTRDAILRGALTVVGEHGVGGLTNRRIVAAAGVS
FT                   LGTLTYHFASQTALLREAMLLFVEEETAKLGAIVDGHRAEGLSVEQAASVVEHVIAQLP
FT                   FGADELGAHELYLQSARDPELREASSRCFAAYDELAVTILEALGVPEPRRLAGPVVALI
FT                   AGLQLRRLATGETDTPVAEPLMMLIRGA"
FT   gene            complement(418241..419617)
FT                   /gene="amiE"
FT                   /locus_tag="AMED_0410"
FT   CDS_pept        complement(418241..419617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amiE"
FT                   /locus_tag="AMED_0410"
FT                   /product="amidase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42232"
FT                   /db_xref="GOA:A0A0H3CUC3"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUC3"
FT                   /protein_id="ADJ42232.1"
FT                   /translation="MTATSLDFTGLADQAARLAAGEVTSAELTAAALGRAHASQATLNA
FT                   FRHLRDEEALAEAADADRRLTAGDRAPLLGVPLAIKDDVDLTGLPTAFGCAGEFPFATA
FT                   DAPAVALLREAGAVIIGKTNTPELGQWPFTEGPAFGVTRNPWHPGHTPGGSSGGSAAAV
FT                   ASGVIAAALGSDGAGSVRIPAAWTGLVGIKPQRGRIPTDGELFHGLTVLGPLARTTEDA
FT                   ALLLDAAAGTPGVFRAAAAREPGKLRIGLSTRIPFTATKTRLDPVVEASVRRLAESLAG
FT                   LGHEIVEVEPDYGLIGLTFLPRSLTGVRDWTLRVPDRTGLDPRTRSNAGHGRLLAGPAL
FT                   RLARALEPGLHRRIGSVFGRVDVLLTPTTATPPPPVGTFDGLSGWETDQAMIAACPYAW
FT                   PWNVLGWPGVNVPAGLTAGGLPLGAQLLGPSHAEERLISLAAQLEEVERWPERHPEKSW
FT                   "
FT   gene            419744..420301
FT                   /locus_tag="AMED_0411"
FT   CDS_pept        419744..420301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0411"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42233"
FT                   /db_xref="GOA:A0A0H3CVB0"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVB0"
FT                   /protein_id="ADJ42233.1"
FT                   /translation="MATVHAGMSMSLDGFVADRHGGTARLSDPAASSGSEWMTDLIRET
FT                   GAVVLGRRSFAMAEDPDWYAGNYEFQVPIFVVTHTPPAVLPAQNENLTFTFVTDGIASA
FT                   VKQARAAAGDRAVKVIGASVVRQAVRARVADELHVLLAPVLLGAGLPLFGDPDLDGVAL
FT                   RRLGVREVGPITELRFTLLNPL"
FT   gene            420330..421358
FT                   /gene="dcyD"
FT                   /locus_tag="AMED_0412"
FT   CDS_pept        420330..421358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcyD"
FT                   /locus_tag="AMED_0412"
FT                   /product="1-aminocyclopropane-1-carboxylate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42234"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR027278"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWC6"
FT                   /protein_id="ADJ42234.1"
FT                   /translation="MTFDFAGFPDAALAAVPRVDLGGWPTPLHGAPRLGEALGLRNLWL
FT                   KRDDVHPLGAGGNKLRKLEYHLGAAEKAGADTVITFGALQTNHGRQTAAACAKLGLRCE
FT                   LVLTAKVPRDGEAYERGGNLPLDRLFGATVHICADGEETGRTYDRLVAEAAADGRKVAT
FT                   IPVGGSNDLGALGYVRATYELAKQLEERGIERAHLVVPHASGGTAAGVALGTALLGNLG
FT                   VGIACVSHPLDEATENLRDLVDGAAKLLGVEPPSLTHTRMGDSTLGPGYGIPTDAVWNA
FT                   LRLFGRTEGVVLDPVYTGKVAAALVEWAGHFAPDDHVVFLHTGGMPGLYGYAPEFAAAV
FT                   EG"
FT   gene            complement(422038..422826)
FT                   /locus_tag="AMED_0413"
FT   CDS_pept        complement(422038..422826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0413"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42235"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW12"
FT                   /protein_id="ADJ42235.1"
FT                   /translation="MMPEIAIAERAGVGADGHPRPTEDHVVVLDNAVLVLDGATSSEPS
FT                   QPPGGWYAERLARRLAEDLHVAPEADLTEVLTSAIAALTAEHRLQPQRSPSSTVAAVRW
FT                   LEDRVDALVLADSPVVGFGGFGVDVVSDDRLARLRRRGMLQTGADVRRRRNAHDGFWVA
FT                   EADPGAAAHSVRRSWPRADVEAVLLASDGVSIGVDQYELFDWREVLAVSRADGPDAVLA
FT                   AVRTAEKQDPDGERWPRPKRHDDQALVVVDFESGVIQGLP"
FT   gene            422915..423124
FT                   /locus_tag="AMED_0414"
FT   CDS_pept        422915..423124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0414"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42236"
FT                   /db_xref="GOA:A0A0H3CY78"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CY78"
FT                   /protein_id="ADJ42236.1"
FT                   /translation="MTEATDLAARAGDRDPRVGLRAVAALRRLLEQLEAVQVRSARVHG
FT                   WSWQEIAAELGVSRQAVHKKYGRH"
FT   gene            423124..423651
FT                   /locus_tag="AMED_0415"
FT   CDS_pept        423124..423651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0415"
FT                   /product="ATPase with chaperone activity"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42237"
FT                   /db_xref="GOA:A0A0H3CUF7"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUF7"
FT                   /protein_id="ADJ42237.1"
FT                   /translation="MFERFTTDARMTVVEAQIVARESGSVEIGPAHLLAGLVKTGVQVL
FT                   TELGVSTDDIAAELARTRRRGGVSDADAEALTEFGIDVEQIVERVEQTHGEGALAGRLG
FT                   PAKRGHIPFTAQSKKTLELSLKEAVRLGDKHLGQEHILLALAQQRGTDDVLARRGADYQ
FT                   TLRRAVQQRKAG"
FT   gene            complement(423648..424289)
FT                   /locus_tag="AMED_0416"
FT   CDS_pept        complement(423648..424289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0416"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42238"
FT                   /db_xref="GOA:A0A0H3CVE1"
FT                   /db_xref="InterPro:IPR038750"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVE1"
FT                   /protein_id="ADJ42238.1"
FT                   /translation="MAQTDLRPVRISRDPARRSVQLLAGLALYGTSVALVTRAGLGLEP
FT                   WSVLAEGVLKHTGLSFGTVTGLISVAVLLLWIPLRQRPGIGTIANVVVISVMVDVVRAV
FT                   LPDQHDLVWQIVLLVGGVTLNGVATATYVGARLGPGPRDGLMTGLAGRTGWSVRLVRTG
FT                   IEVTVVAAGFLLGGTVGIGTVLYAIAIGPLTQALLPRTTWREEQEPQQGH"
FT   gene            424396..425799
FT                   /locus_tag="AMED_0417"
FT   CDS_pept        424396..425799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0417"
FT                   /product="GntR family transcriptional regulator fused with
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42239"
FT                   /db_xref="GOA:A0A0H3CWF5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWF5"
FT                   /protein_id="ADJ42239.1"
FT                   /translation="MAVMLGSWRQGGSRQGAADLAAAIELQVLDGQLPLGTRLPAEREL
FT                   ADALGASRTLIGAALDRLRENGFVASRRGAGSWIAAPGRRRRGPLAPVGDGSIDFTHAS
FT                   SPAIPGTAAAVDAARGRLADHLGDHGYQERGLPGLREQIARRYTERGLPTTPAQVMVTN
FT                   GAHHAFVLVLRMLAGPGDRVLVEQPTYPNALEAIRAAHALPVPVALDPTGARGWDIAGV
FT                   DAALRQASPRFAYLVVDFQNPTGLRLDAEGRSRLGTVLARARTPVVVDETLVELDLEGD
FT                   PLHGPPPLAAFAGDLAICVGSASKTHWGGLRLGWIRASEDLLGRLVAARYAVDLGSPVF
FT                   EQLVLTELMADETLLGRRREELRGYRDALAAAVHRHLPDWTFTLPDGGLSVWCRMPEPV
FT                   SSRLAVAAASHGVQVAPGSRFGVHGGLERWIRLPFSLPPDRIDEAVRRLSAAEASVRGT
FT                   PASLDAPIA"
FT   gene            complement(426311..427984)
FT                   /locus_tag="AMED_0418"
FT   CDS_pept        complement(426311..427984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0418"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42240"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW42"
FT                   /protein_id="ADJ42240.1"
FT                   /translation="MVVAVSSTADARRDAPVRSALGTPVRSALDTSVRPALDTPVRPAP
FT                   TPDAAVPPALTPGEAEASYARVRAPRPWAASLQRPAAKILVAGGLTLAGWLLGAALSGS
FT                   TASAAERPACPDAPVVSTVDHAAKPLWHARHRKSHHETGAATCEGQPKTDSAEPPAADE
FT                   TQADETTKDSSADGQPAATTPDGSPAGAPAAGDPAEGPAATAPDGGAAEGPAATPDSAS
FT                   ESAGTTPDGSTAGQPTATTQDSDPAAASSESSSTEEPAATTSDSSAATPTKTTTKATTA
FT                   EAPKATSSSGNLLGNLVGSTLKVVSVATTGATTEATTKDTADQPAAPAKPTSSGGDLLG
FT                   GLLGGVLDVVGGTLSTVTDTVGAVTDTLSHTVLAPLTQPLGGNPGGPVLLPLDDILGPV
FT                   FGGGSNSGGVIAVVPGVTTAAVVTQAPATVLETVPGAVPTTAADPQQQTTRVAVTPRLV
FT                   VVRHAEPLPAVHEQPRDSGTHATTGGGDSTPGLPGGTTAPSAPAPTAAPGHDGPGGARH
FT                   AFAVHTDDVTTTQLKLIGTSRDHEVDGAGREAALPTTSPD"
FT   gene            complement(428723..429889)
FT                   /locus_tag="AMED_0419"
FT   CDS_pept        complement(428723..429889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0419"
FT                   /product="aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42241"
FT                   /db_xref="GOA:A0A0H3CY83"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CY83"
FT                   /protein_id="ADJ42241.1"
FT                   /translation="MREPALVPRLRPFTSTIFAEMTALAVRHDAVNLGQGFPDTDGPAG
FT                   MLEAAKNALFGGANQYPPGPGRPELRAAIARHRLRYGTDYDPDTEILVTAGATEAIAAA
FT                   LLALTEPGDEVIVIEPYYDSYAAAVAMAGAERRVVGLVEGPDGRFGLDVDGLRAAVTPR
FT                   TRAILVNSPHNPTGTVFTRAELEALAALCVEHDLIAICDEVYEHLVFDDAAHIPLVTLP
FT                   GMRPRTVSIASAGKTFNCTGWKIGWVCSTPELVSAVKAAKQFITFVSGGPLQPAVAHAL
FT                   DHELPWVDGLRASLQEKRDRLSAGLADAGFAVRPTAGTYFVCVDVRPLGFTDAADLAWE
FT                   LPGRVGVAAVPVKVFTDHPDEWNHLLRFAFCKRNEVIDEAITRLRKLV"
FT   gene            429919..431217
FT                   /locus_tag="AMED_0420"
FT   CDS_pept        429919..431217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0420"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42242"
FT                   /db_xref="GOA:A0A0H3CUG2"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUG2"
FT                   /protein_id="ADJ42242.1"
FT                   /translation="MEQLTPAKVTPADPPGGAAGEEEKRRALRKMKLVALSFLLGATLV
FT                   FLLTSWAQSAGWPGWVGYVRAAAEAGMVGALADWFAVTALFRHPLGLKIPHTAIIPNKK
FT                   DALGNSLGDFVGSNFLSEEVVRDKLKRVEIARRLGAWLAEPDNAERVTSELATVVRAAV
FT                   KVLRDEDVQAIMEQAVARRIIDKPWGPPLGKILQGVFADGAHHKLVDLMCDRGYEWVRD
FT                   NHTTMLRVVSDRAPSWSPKFVDEMLADKVYGEVLSFAWAVKTDVNHPMRLALDKFLGEF
FT                   AQDLQTDPDVMARAEQVKGQLVHHEEVQRLIGSAWSTAKEMLLTAAEDPSSELRRRVRL
FT                   GLTSLGQRLSTDDQLRAKADGWVEGAAAYLVKNYSREITTIITDTVERWDAEETSRKIE
FT                   LQVGRDLQFIRINGTVVGALAGLVIYAVAELLF"
FT   gene            complement(431431..431892)
FT                   /locus_tag="AMED_0421"
FT   CDS_pept        complement(431431..431892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0421"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42243"
FT                   /db_xref="InterPro:IPR010852"
FT                   /db_xref="InterPro:IPR021005"
FT                   /db_xref="InterPro:IPR023286"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVE6"
FT                   /protein_id="ADJ42243.1"
FT                   /translation="MHTDASLVVEFLNTVNVEEGTDLLEDPGQWREWAAAHALAANQAG
FT                   EARAARDALRAAIGDPRLPGGRVDVGTRISLTADGPTLVADDVVGAVFAACTRLVVRGD
FT                   WIRLKICPADTCLWAFYDESRNRSRTWCSMRVCGNREKARGWRARAAAG"
FT   gene            431976..432344
FT                   /locus_tag="AMED_0422"
FT   CDS_pept        431976..432344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0422"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42244"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWG0"
FT                   /protein_id="ADJ42244.1"
FT                   /translation="MSAVPTLGVVALDCPDPVALAEFYRSVLEWAAPEVAEDGHWVTLA
FT                   NPAGGAGLAFQRVPDYRPPAWPSAENPQQLHLDLNVTDLEAAHERVLGLGAKLLDDTPE
FT                   TFRVYADPVGHPFCLCAC"
FT   gene            432397..432714
FT                   /locus_tag="AMED_0423"
FT   CDS_pept        432397..432714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0423"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42245"
FT                   /db_xref="InterPro:IPR027392"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW46"
FT                   /protein_id="ADJ42245.1"
FT                   /translation="MRTVDKNGIHIDQCDGCRGIFLDRGELEAIVGAESSFYGRQPPPY
FT                   QGGHGRPDSPRPYRGGYPDSPRPHRGYSDSPRPYRGGHPDSPRPYGQGHRKRSFLENLF
FT                   D"
FT   gene            432716..433327
FT                   /locus_tag="AMED_0424"
FT   CDS_pept        432716..433327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0424"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42246"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CY88"
FT                   /protein_id="ADJ42246.1"
FT                   /translation="MGLDLRICPACGELAEQPIVEGAVITCPKCGHERPFRKLPLFALT
FT                   GPSGAGKSTMGPLLAARFAGDVVLLEQDILWIDALRGDVTSFRSVWLRMAAMVQQNGRP
FT                   VVLCGTVAPPEFEALPERAFFSDIHYLALVGSPESLRARLRARPAWREWDEPRIEEMLE
FT                   FNDWLRNSAPGLGVDVFDTTDVSREATADHVEQWIRARLP"
FT   gene            complement(433324..434505)
FT                   /gene="pcm"
FT                   /locus_tag="AMED_0425"
FT   CDS_pept        complement(433324..434505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcm"
FT                   /locus_tag="AMED_0425"
FT                   /product="protein-L-isoaspartate(D-aspartate)
FT                   O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42247"
FT                   /db_xref="GOA:A0A0H3CUG6"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUG6"
FT                   /protein_id="ADJ42247.1"
FT                   /translation="MTRSARLRRRLVEHLLDEDVLHAPEWIAAFRAVPRHVFLPRFFMP
FT                   AGGLWAAVERGDPGWLETVYSRDVLVTQLDDDPGRWELARRTGPVAGTPTSSSSMPSIM
FT                   AIMLEELRVRDGQCVLEIGTGTGYNAALLSHRCGAGRVSTVDIDPAIVAAARERLAAAG
FT                   YHPACAVGDGALGFPAGTIFDRVLCTASVSSIPPAWLAQTAPGGLIVTTLNRPIGAGLV
FT                   RLVVGEDGDAQGRVLARDGRFMPLRAHRLPETGPLSMPSRGDWEQTRLPMSTVLQPRKQ
FT                   FEFFAGLALPGVRPVREGGDETPGVALVHPDGSWVRHRKRGGADEVAQGGPRALWELAE
FT                   AAFVEWCELGKPDRDRFGVTVTGDRQEFWLDSPDGRTWPLEHNDRPPAPGAAS"
FT   gene            434653..435072
FT                   /locus_tag="AMED_0426"
FT   CDS_pept        434653..435072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0426"
FT                   /product="XRE family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42248"
FT                   /db_xref="GOA:A0A0H3CVF1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVF1"
FT                   /protein_id="ADJ42248.1"
FT                   /translation="MEKVADIASDIGEYIRQQRNTAKISLRQLSKLAGVSNPYLSQIER
FT                   GVRKPSAEILQQIAKGLRISAEALYVQAGILDLPTGGPVGDAIRADAELTERQKQVLLD
FT                   VYESFRRENAAARPAASPAPEAPDTTPAAKTEESA"
FT   gene            435069..435758
FT                   /locus_tag="AMED_0427"
FT   CDS_pept        435069..435758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0427"
FT                   /product="membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWG5"
FT                   /protein_id="ADJ42249.1"
FT                   /translation="MTTPKTEDVKKAVTTALDQVRTPLLAALGAGNLATHAVTDAVAKA
FT                   KENVTKSGEVARKNLQELPTDVESLREKLDPAELRKVIDEYTEAALKLYNKLAESGEQA
FT                   WDKIATQPQVKKAIEQLEEALTTAQGQAEVVSTEVRERVDGVLAKVTKRTRSAGEKTAR
FT                   KVSKVADDAAEAVEELGDDLAHETRSVSRKVANKTAPKTAAPARRTTTTTTTSAAVKKP
FT                   AAPKTDK"
FT   gene            435843..436136
FT                   /locus_tag="AMED_0428"
FT   CDS_pept        435843..436136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0428"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42250"
FT                   /db_xref="GOA:A0A0H3CW51"
FT                   /db_xref="InterPro:IPR019662"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW51"
FT                   /protein_id="ADJ42250.1"
FT                   /translation="MLVAIWILNVIHWGSALVGLFAFVHALLQRADAYSAADRKTKPIW
FT                   MLITGGATLAMVLFPVMGPGMIFYVPAMAAALVYIVDVRPKLIEVQRGGSSW"
FT   gene            436351..436893
FT                   /locus_tag="AMED_0429"
FT   CDS_pept        436351..436893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0429"
FT                   /product="YbaK-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42251"
FT                   /db_xref="GOA:A0A0H3CY92"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CY92"
FT                   /protein_id="ADJ42251.1"
FT                   /translation="MTWTIAGSLTVVPAPTRTDLLAEPVAKALAALADPDAVGVAEIDP
FT                   ALADTAAFCETYGSPLEASANCVVVAGKRAGEVRFAAALVLATTRADVNGVIKRRLDVR
FT                   KASFAPMDEAVSLTGMEYGGITPVGLPADWPILLDRRVADAPELVIGSGIRGSKLLISG
FT                   AALAALPGAEIIEDLAR"
FT   gene            436890..437897
FT                   /gene="ocd"
FT                   /locus_tag="AMED_0430"
FT   CDS_pept        436890..437897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ocd"
FT                   /locus_tag="AMED_0430"
FT                   /product="ornithine cyclodeaminase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42252"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUH2"
FT                   /protein_id="ADJ42252.1"
FT                   /translation="MTSVWLRYLTGADIDALGVTDADIVGAVEDVLADHGRGQVVFEPR
FT                   THLVPDNGGKGHFNILRGHLSAERVSGVKVVGDFVGNFERGLPSEMALILLLDPDTGMP
FT                   RAIVDGTMITEARTGAMTAVGAKYLARPDSRVLGHIGARGTAWWNVVLLDSLFDFAEIR
FT                   VTSKRPESREDFGRRLSERLGKDVRVCATAEETLDGADIQVEASRLVEPEALVRREFLR
FT                   PGTFLVPYGTISALELTLLDDIDKVVVDDWRESRSGNPRFGALRPQLNAGLLTADNVHA
FT                   EIGDIVAGSKPGREHDAERILFWHRGLSTTDVAVANMILARAEASGVGTMLPYR"
FT   gene            437894..439342
FT                   /gene="hutH"
FT                   /locus_tag="AMED_0431"
FT   CDS_pept        437894..439342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutH"
FT                   /locus_tag="AMED_0431"
FT                   /product="histidine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42253"
FT                   /db_xref="GOA:A0A0H3CVF5"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVF5"
FT                   /protein_id="ADJ42253.1"
FT                   /translation="MIVSDSEFADSERLILDKPLVEALKRRRAEVLTALAEPGNPVYGV
FT                   TTGMGRLAGVVLDPRQQAEHQRNLLIGRAVGGPPWLPPEDVRALLVVRLRDFLRPWSGV
FT                   SPELVQFLVDRLNDGFTPAVPRFGLGSSGEIIALSHAFQTFLGLGTVLEDGVEVPAAAA
FT                   LAARGAAPYVLGPKEGASLLQGSPLAVMHAARGWTEAQQLVDLQTLTAAMAIDVLGAPR
FT                   AVFSPVLAGGDDHLRAVLHELTELVGIGPVRPGVVQAPLSVRVAPRALAHASRVNGDLH
FT                   ETRRRWETMPGDSPSFVDGSFVPGTGYHAVDLGLRMDAVTAALVHLGEISVQRTHRLLD
FT                   ERFSGLPPQLTADPGPRAGLVPLHKRAAGELHALRRLATPATLGSIDTSAGQEDVQAFA
FT                   SAAGEQLRAAASHLFAITACELITASQARYLAGGEGVPGLRAGYGWVRSVVPPLDEDRS
FT                   LGPEVERLVAVCRAAFFDDLATLT"
FT   gene            complement(440111..440305)
FT                   /locus_tag="AMED_0432"
FT   CDS_pept        complement(440111..440305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42254"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWG9"
FT                   /protein_id="ADJ42254.1"
FT                   /translation="MPAVTRRGYTGPAGLRAMQSPAQRIWSKASSLHGGDLAWQRFQHA
FT                   GREAGWPTALWEAGGEVVA"
FT   gene            440367..440930
FT                   /locus_tag="AMED_0433"
FT   CDS_pept        440367..440930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0433"
FT                   /product="cadmium resistance transporter"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42255"
FT                   /db_xref="GOA:A0A0H3CW56"
FT                   /db_xref="InterPro:IPR004676"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW56"
FT                   /protein_id="ADJ42255.1"
FT                   /translation="MDVGLLGRAAAMFAVTNVDDLVLLAVFFGQAAGRRGELKVVAGQF
FT                   LGFAAILAVSVAGALGAGLLRHGAVRWLGVLPVLLGIRAAWQAWRQENDEPPPAAGVLG
FT                   MATVCVANGGDNVGVYVPAFAATGPAGLVGYVAVFLAGVAVWCAAGRLLATRPGVARLL
FT                   ARWGHVALPAVLIALGVLILIGAF"
FT   gene            441012..441758
FT                   /locus_tag="AMED_0434"
FT   CDS_pept        441012..441758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0434"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42256"
FT                   /db_xref="GOA:A0A0H3CY97"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR039561"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CY97"
FT                   /protein_id="ADJ42256.1"
FT                   /translation="MAYPTSTQPIGRARRVVIMNLRTRVLAIITFTFAAVGAVAVPAPA
FT                   ATTAQTVEVAAPAGSGLAPYVAVIKPVTAERLGNSWHAGCPVGPDQLRLINLGFLGFDG
FT                   AVHRGELVVNADRATEVARTFADLYFGRFPIERMETVEKYNSDDDASMAANNTSAFNCR
FT                   AITGGTAWSNHSYGRAIDINTVQNPYISGSGAVYPPNGAPYVDRTQNLPGMIHAGDVTE
FT                   RAFVSRGWTWGGSWDTPIDYQHFEKP"
FT   gene            complement(441942..442652)
FT                   /gene="proW"
FT                   /locus_tag="AMED_0435"
FT   CDS_pept        complement(441942..442652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proW"
FT                   /locus_tag="AMED_0435"
FT                   /product="permease component of ABC-type proline/glycine
FT                   betaine transport system"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42257"
FT                   /db_xref="GOA:A0A0H3CUH8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUH8"
FT                   /protein_id="ADJ42257.1"
FT                   /translation="MSFLDQLNAWLADPNRWSWTDKAGVPYRTLEHLRFSLLALAIAAV
FT                   LTIPAALWLAHYRRGAFLASSAVNIGRAIPSFGLIILFWFLASRWELDTTFWPLLLALV
FT                   ALAMPPLFTNTYAGVVTLEQETIDAARGTGYREWQIMLRLELPLASPVILAGARVAFLQ
FT                   LIATVAIGAIVNDGGGLGRYIVDGFAVGAQGYGAIFAGGLAAVLLALVCDGAFALITRV
FT                   ATPRGLALQNARRD"
FT   gene            complement(442649..443347)
FT                   /locus_tag="AMED_0436"
FT   CDS_pept        complement(442649..443347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0436"
FT                   /product="permease component of ABC-type proline/glycine
FT                   betaine transport system"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42258"
FT                   /db_xref="GOA:A0A0H3CVG0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVG0"
FT                   /protein_id="ADJ42258.1"
FT                   /translation="MHVNTVTPLAADSGPPIFQWKWVDRNADAIVQRLVEHISLTGAAL
FT                   GIGLVVSIGLAVVSLRYRWSYPVILGTAGALYVIPSLGAFAVLVPFFGLTFVSAMIPLA
FT                   TYTLLILIRNIVTGVDQVPNEVREAAVGMGYTRGKLLWQIELPLALPVVIAGLRVAAVT
FT                   TIGLVTVTSMLGLGGLGYFIRAGIQTATPNPTMIIVGVGLSVVLAVVVDLVLWLSERVL
FT                   APWSRKVRAR"
FT   gene            443487..444407
FT                   /locus_tag="AMED_0437"
FT   CDS_pept        443487..444407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0437"
FT                   /product="periplasmic substrate-binding component of
FT                   ABC-type glycine betaine transport system"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42259"
FT                   /db_xref="GOA:A0A0H3CWH4"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWH4"
FT                   /protein_id="ADJ42259.1"
FT                   /translation="MRWFRNASVVAAALAATLGLAACGGSDSGDKPAAQGKGGAPIVVA
FT                   SFNFTDSQILAEIYAQALEAKGYPVTRKLNLGSRELIYPSLKSGELQFIPEYQGAAITT
FT                   GFGKEAGKTAQEEHEQLAKLFEPSGIGLLNFAAAEDKNTYIIKSDLAKEKGIASISDLK
FT                   KLDKVVMAGPPECEKRLPCFKGFTDVYKLTNITFQTIQEAGPRVEQLKSGAVTVIPVDS
FT                   VSPLTGDSKYTVLKDDLNIVPTENVVPAVTKKVLDERGADFANAVNAVSGKLTTDVMRD
FT                   LNKRVDSDGERAADVAKDWLGQAGL"
FT   gene            complement(444409..445188)
FT                   /locus_tag="AMED_0438"
FT   CDS_pept        complement(444409..445188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0438"
FT                   /product="putative methyltransferase,
FT                   S-adenosyl-L-methionine (SAM)-MTase protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42260"
FT                   /db_xref="GOA:A0A0H3CW60"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW60"
FT                   /protein_id="ADJ42260.1"
FT                   /translation="MWQSGDAYEAYIGRWSRRIAATFVRQLGAPASRRWLDVGCGTGAL
FT                   TSAVLAAADPAEVVGADPSEGFLKTARASVTDPRATFTLADARSLPFPDARFDVVVSGL
FT                   VLNFVPDPDRAAAEIARVTAPGGLAATYLWDLAEGMELIRRFWDAAGELDPEAVAELDE
FT                   GRRFTLCRPEPLGRLWTDAGFTAVSVGEIRIPTVFADFDDYWQPFLGAQGPAPTYLATL
FT                   PPAHRDRIRELLRSRLPMDPDGSIPLTARAWVVSGIA"
FT   gene            complement(445218..445688)
FT                   /locus_tag="AMED_0439"
FT   CDS_pept        complement(445218..445688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0439"
FT                   /product="MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42261"
FT                   /db_xref="GOA:A0A0H3CYA2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYA2"
FT                   /protein_id="ADJ42261.1"
FT                   /translation="MSAGARRRSTAAVKDALRELRNQLSLLNHQVSAQLALKDVDLDCL
FT                   ELIARHGPLSPSALARRAGLHPATMTGILDRLQKGGWIVRERDPEAADRRSVAVRAVRG
FT                   RNAELFRLYAGMNTAMDELCAGYTEDELALIAGFLRRTTSAGHDATGALSGG"
FT   gene            445802..446236
FT                   /locus_tag="AMED_0440"
FT   CDS_pept        445802..446236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0440"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42262"
FT                   /db_xref="InterPro:IPR014488"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUI3"
FT                   /protein_id="ADJ42262.1"
FT                   /translation="MGKVTATAERTIDAPADKVRALVADYAETRPKLLTEHYRDYQVTE
FT                   GGVGAGTKAAWKLQATSKRVRDVKATVTEPRPGTLVETDANSSMVTTWTVAEAGDRSVV
FT                   KIETTWDGAGGIGGFFEKTFAPGGLKKIYDGVLEKLAEIV"
FT   gene            446331..447338
FT                   /locus_tag="AMED_0441"
FT   CDS_pept        446331..447338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0441"
FT                   /product="putative NADP-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42263"
FT                   /db_xref="GOA:A0A0H3CVG5"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041694"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVG5"
FT                   /protein_id="ADJ42263.1"
FT                   /translation="MTTATEIRLASRPEGVPTQDNFEIVDTEVPSVGDGQILVRNLIMS
FT                   VDPAMRGRMKDVKSYAPPFQVGEVMSGGAVGEVVESRVDDVKPGDHVLHQAGWRTHAVL
FT                   DAGRYVKVDGAAAPLSTYLGVLGMPGLTAYAGLLESAEFKPGDTVFVSGAAGAVGSLVG
FT                   QLAKLKGAKRVIGSAGSAEKVRHLIDDLGFDAAFNYKDGPVAEQLHKAAPEGIDVYFDN
FT                   VGGEHLEAAIDAITVHGRIAVCGMISTYNATEPTPAPRNLAQVIAKRLTIRGLLVIDHW
FT                   HLQQQFVTEVAPLVNSGEIKYSETFVDGIRNAPEAFLGLLSGANTGKMLVRIAD"
FT   gene            complement(447335..447958)
FT                   /locus_tag="AMED_0442"
FT   CDS_pept        complement(447335..447958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0442"
FT                   /product="2-haloacid dehalogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42264"
FT                   /db_xref="GOA:A0A0H3CWH7"
FT                   /db_xref="InterPro:IPR006328"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWH7"
FT                   /protein_id="ADJ42264.1"
FT                   /translation="MLCVLDVNETLLDLAALDATIGGPELRREWFGLAIHTVLTVTATG
FT                   GYRDFAGIAGDAAIEVAARHGREIDLQAIGDGLRSLPAHPDVEPGLVKLREQGHTVVAL
FT                   TNSPLATAEAQLLNAGLAPLLDRIFSAEQVGRLKPAPEPYRQVTAAYPGERAVMIAAHG
FT                   WDIAGAQAAGLETALLTRPGVHPLPGSPAPTYTASTLPELAELL"
FT   gene            complement(447991..448602)
FT                   /locus_tag="AMED_0443"
FT   CDS_pept        complement(447991..448602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0443"
FT                   /product="TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42265"
FT                   /db_xref="GOA:A0A0H3CW65"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW65"
FT                   /protein_id="ADJ42265.1"
FT                   /translation="MIRLMGGKYHHGDLRGELVRVSLDLIAEQGLAGFSVAEVARRAKV
FT                   SPGAPYRHFADRETLLAEVACHIACQLADRVAAAAEKHDDPADALAAAAGAYTRYLIER
FT                   RAGMNVIYADGLHSPEHVGLHEQTRRLTDEFLMRCLAVAPDPATALELMEQLFTQAHGY
FT                   GTFQLDGVFVKHGYSVDLVEQKSIEAARIVIAGRTAGGRH"
FT   gene            448699..449748
FT                   /gene="adh"
FT                   /locus_tag="AMED_0444"
FT   CDS_pept        448699..449748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adh"
FT                   /locus_tag="AMED_0444"
FT                   /product="alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42266"
FT                   /db_xref="GOA:A0A0H3CYA7"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYA7"
FT                   /protein_id="ADJ42266.1"
FT                   /translation="MSTTTHAIAVPAPGAPLAPTTIERRDLRPDDVLIDIAYAGICHSD
FT                   LHQAKEDWGQAIFPMVPGHEIAGVVAAVGSDVTKYQVGDRVGVGCMVDSCGECEYCLAG
FT                   TEQFCLKGNIQTYNGVGFDGENTYGGYSNQIVVKDAFVLRIPEGIELDVAAPLLCAGIT
FT                   TYSPLHHWGAGPGKKVAVIGLGGLGHMAVKIAAAMGAEVTVLSQSLKKREDGLKLGAKD
FT                   YYATGDESTFDVLRGKFDLILNTVSAKLPVDAYLGLLRVGGAMVNVGAPGEPLSYHAFS
FT                   LIGANRVLAGSMIGGIPETQQMLDFCAEHGIGAEIETISADKVNEAYERIENSDVRYRF
FT                   VIDAKTIGA"
FT   gene            complement(449769..450635)
FT                   /gene="purU"
FT                   /locus_tag="AMED_0445"
FT   CDS_pept        complement(449769..450635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purU"
FT                   /locus_tag="AMED_0445"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42267"
FT                   /db_xref="GOA:A0A0H3CUI8"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUI8"
FT                   /protein_id="ADJ42267.1"
FT                   /translation="MTAPERRYVITFGCPDRTGIIARISGFLAEHGGWIVEAAYHTDPD
FT                   TGWFFTRQVVRADSLPFDAAELRARFGEVAAELSAESSWQVSDTGERRRAVILVSKAGH
FT                   CLYDLLGRVASGELDVDVAAVIGNHDSLADITRAHGIPFHHVPFPPGDKAGAFAQVRKL
FT                   VGEHDPHAVVLARFMQILPADLCREWAGRAINIHHSFLPSFIGAKPYHQAHTRGVKLVG
FT                   ATCHYVTADLDAGPIIEQDVIRVDHGDSVEDMVRKGRDIEKVTLARGLRWHLENRVLVH
FT                   GNRTVVF"
FT   gene            complement(450659..451168)
FT                   /locus_tag="AMED_0446"
FT   CDS_pept        complement(450659..451168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0446"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42268"
FT                   /db_xref="GOA:A0A0H3CVG9"
FT                   /db_xref="InterPro:IPR010872"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVG9"
FT                   /protein_id="ADJ42268.1"
FT                   /translation="MTHLAFVHGFAVGLAVNRPVKPAPPEDWEDVLGWWDGQRLALREA
FT                   LGRDPEAPAFSPYPGFSVTVGDWTRRMAHETAIHRLDAESALEDGPRTRFSPAFANDGI
FT                   DEFLTYLCPRLGRKADVRVTTPERTWSLGEPGAEVSGAADDVYRALWGRPHRASVTGDL
FT                   APLAAP"
FT   gene            complement(451173..451874)
FT                   /locus_tag="AMED_0447"
FT   CDS_pept        complement(451173..451874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0447"
FT                   /product="DedA-like membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42269"
FT                   /db_xref="GOA:A0A0H3CWI1"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWI1"
FT                   /protein_id="ADJ42269.1"
FT                   /translation="MELLGQVTELLRDALGSPWLWVLVFAVSGLDALLPFMPSETTVVT
FT                   VAVLFGPDPAHLTLLAAVAAIGAWAGDCLGYVVGRAAGPQAIARLQRGPEGRHRYEWAR
FT                   DQVRHHGGLLIIAARYLPGGRVASALANGSLGYPLRRFVPLDLAGAAIWAAYSVLIGLA
FT                   GGAAFADEPAKGLLLSFGLGLGLVFAIETGRRLRSAHARSDRRPRRRAQAGGAGGRTVG
FT                   PGAELSEVDCP"
FT   gene            complement(451938..452738)
FT                   /locus_tag="AMED_0448"
FT   CDS_pept        complement(451938..452738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0448"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42270"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW68"
FT                   /protein_id="ADJ42270.1"
FT                   /translation="MAHRSKLTPVGAPTRGTTNPNRLRRVDRWIASAPATSRLLRSAEA
FT                   PLVVDLGYGASPVTTVELARWLRRVRPDVRVLGLELDPVRVAAAQPAASPPLLEFRRGG
FT                   FELAGTRPVLVRAFNVLRQYAEDEVAGAWDLMLGSMPAEGLLVEGTCDEIGRLSTWVLV
FT                   SRAGPVSLTLSMRLAGLEKPSMIAERLPKALIHRNVPGERVHSLLSELDACWATAAPHQ
FT                   AFGVRSRWLETVRLLAARGRPVLGPPSRIRLGELTVPWAAVAPG"
FT   gene            complement(452717..453223)
FT                   /locus_tag="AMED_0449"
FT   CDS_pept        complement(452717..453223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0449"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42271"
FT                   /db_xref="InterPro:IPR019639"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYB1"
FT                   /protein_id="ADJ42271.1"
FT                   /translation="MGSRIEHRAEFAADVASTYAAVAGEEALRARLEELGGHSAALLSY
FT                   EVSGSDLRYELRQGISADKLPQAVRTLHKGDLLVTRTQTWRVSNDGTGRQGNATVEVGG
FT                   VPGDISARTALLANGDKTVLRISGEVTVRIPLFGGKLESVIAEQVTKLLEREAEFTAKW
FT                   LTEAN"
FT   gene            453248..454303
FT                   /gene="murB"
FT                   /locus_tag="AMED_0450"
FT   CDS_pept        453248..454303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="AMED_0450"
FT                   /product="UDP-N-acetylmuramate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42272"
FT                   /db_xref="GOA:A0A0H3CUJ2"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUJ2"
FT                   /protein_id="ADJ42272.1"
FT                   /translation="MNSARTPALPKLAAYTTLRLGGPARQFVSAVTSEDLIAAVREADA
FT                   AGEPVLLLGGGSNLVVGDAGFDGTLVEVANTGWRRDGDRVEVQAGQNWDAFVAALVEAG
FT                   LGGLECLSGIPGSVGATPIQNVGAYGCEVAESIVSVELYDRGTREVRTLKAGELGFAYR
FT                   TSVLKGTDTGVVLSVRFEVREDGLSAPIRYAELARTLGVEIGARVPAAEAREAVLELRR
FT                   GKGMVLDPDDHDTWSAGSFFTNPIVPSAEAEAVLERITAVVGAETPQYPADGGVKLSAA
FT                   WLIERAGFGKGYPGPGNRVSLSTKHTLALTNRGDATTEDLLALAREVRDGVFERFGVRL
FT                   HPEPLLINCVI"
FT   gene            454462..455643
FT                   /locus_tag="AMED_0451"
FT   CDS_pept        454462..455643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0451"
FT                   /product="Ykud domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42273"
FT                   /db_xref="GOA:A0A0H3CVH3"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="InterPro:IPR041280"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVH3"
FT                   /protein_id="ADJ42273.1"
FT                   /translation="MIERRTVFKAALAAGAALVAAACSSETGGTAKPTGANSDGEGGGA
FT                   QPVAKITAEPAADTKDVPVLKPAVLKVADGKLTECKLSADGGKEVKGDLSPDGLTWTSS
FT                   EPLGYGKTYTYAAKATGSDGKPVEFKGSFATIAPAKQVRATLNPADNQTVGVAMPISVK
FT                   FQSPVKNRAAVEKALSVKTDKGEVEGAWGWLSDSQVDYRPKEYWPQNITVNVEAKLYGV
FT                   DLGGGAYGKADVTTKFKIGRNQVVKVNTPDHQMRVYRGGSQVKSYPCANGLDAEVDRNT
FT                   PNGTYIIMTREPTAVFDNARYGYTNVNKKWACRFSNHGEYIHENQDNAANIGKNNNSHG
FT                   CVNLLEADAKDFFDSAMIGDPVEITGSKLSPPMASDVKDWNYSWAAWQGLGAK"
FT   gene            455647..456462
FT                   /locus_tag="AMED_0452"
FT   CDS_pept        455647..456462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0452"
FT                   /product="alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42274"
FT                   /db_xref="GOA:A0A0H3CWI5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWI5"
FT                   /protein_id="ADJ42274.1"
FT                   /translation="MRTEVVGHGGVRLGLQVEGAENSRPIVFVHGWAQSGGCWAAQLAD
FT                   PALTERFRLVAMDLRGHGASDVPASGYDDPQVWADDLAAVLDFAGPDAIVVAWSYGGLV
FT                   LTDHIRVHGTARLRGLVLVGAITEIGRDRPGGRVGALMREHLRAMLSDDPDIAVPALTA
FT                   FSRGMVTGPVPGAQVQALLGASLSVPPSVRSALFRRDVGSEDVLAGIDKPTLVVHGTAD
FT                   RVIEPSAAEHALGKIPGATGRWFLDGGHAPFAESAAEFDAVLRQFAEEC"
FT   gene            456599..457855
FT                   /locus_tag="AMED_0453"
FT   CDS_pept        456599..457855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0453"
FT                   /product="glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42275"
FT                   /db_xref="GOA:A0A0H3CW71"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR017814"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW71"
FT                   /protein_id="ADJ42275.1"
FT                   /translation="MLSVHTSPLEQPGTGDAGGLNVYVSQTATEMARRGVEVEVFTRAT
FT                   ASGQPPVAELAPGVTVRHVQAGPFEPLGRDELPAQLCAFTSGVLRTEAFHEPGYYDLIH
FT                   SHYWLSGQVGWLARDRWSVPLVHTAHTLAKVKNAALAEGDKPEPRVRVIGEEQVVAEAD
FT                   RLVANTAVEARQLIDLYDAEPDAVHAVPPGVDLERFMPGSQSVARAELGLAADDVVLAF
FT                   AGRIQPLKAPDVLLHAAAAMLSRRPELASRLVVLIVGGPSGTGLEQPQALRELAVSLGI
FT                   EGQVRFLPPQPGERLARVFRAADVVAVPSYNESFGLVALEAQACGTPVVAAEVGGLPVA
FT                   VPHGVSGLLVPGHGADEWADALAAVALRPDRRAELAANAVVHARRFSWRRTTDALLDIY
FT                   AQATSAFSRALDLRAEVAV"
FT   gene            457852..458364
FT                   /locus_tag="AMED_0454"
FT   CDS_pept        457852..458364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0454"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42276"
FT                   /db_xref="InterPro:IPR019660"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYB6"
FT                   /protein_id="ADJ42276.1"
FT                   /translation="MSLDELIQSTLDSAGLEYDKRGPGKYFVTLPGTKKLQTNAWLVDG
FT                   DHAFSVEAFVCRRPDESHEDVYRFLLQRNAKLYGVHYTVDSLGDIYLVGRFGKETMSAD
FT                   ELDKVLGQVLEAADGDFNTLLEIGFATSIKREWDWRVSRGESLANLQAFKHLVAPGKPH
FT                   EPGLTES"
FT   gene            458467..459303
FT                   /locus_tag="AMED_0455"
FT   CDS_pept        458467..459303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0455"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42277"
FT                   /db_xref="GOA:A0A0H3CUJ6"
FT                   /db_xref="InterPro:IPR025645"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUJ6"
FT                   /protein_id="ADJ42277.1"
FT                   /translation="MGVAFVLAGCSAAQQSKSSTADSAGSGPVPAAPQQGAGKSGPEKV
FT                   TPPQPGATERKLSRSARLELTAPKVVDVVAQARGIALGAGGYTGQESTGDELATLNLAV
FT                   PADKLDGVLDQLSHLGSGMVKRELNTQDVTEQVVDVEARLATQRASVERIRALLAKATS
FT                   VSEIASVEGELTSREATLESLEQQRNSLAGSVAMATVAMTIRSVAAPPPPAEDHGGFLG
FT                   GLAGGWHAFLVFGGGLLTVLGALAPFLLFLVPLGWLGWWLHRRRRPVAAAPEPGES"
FT   gene            459790..460539
FT                   /gene="gpm"
FT                   /locus_tag="AMED_0456"
FT   CDS_pept        459790..460539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpm"
FT                   /locus_tag="AMED_0456"
FT                   /product="phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42278"
FT                   /db_xref="GOA:A0A0H3CVH8"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVH8"
FT                   /protein_id="ADJ42278.1"
FT                   /translation="MGEIGTLVLLRHGQSTWNAENLFTGWVDVPLSEQGEGEARQGGRL
FT                   LADAGLLPDVVHTSLLRRAISTANIALDAADRHWIPVKRDWRLNERHYGALQGKDKKQT
FT                   LAEFGEEQFMLWRRSYDTPPPPIDPQDEWSQVGDPRYAGLGDQAPLTECLKDVVERLLP
FT                   YWESEIVPDLRAGKTVLVAAHGNSLRALVKHLDGISDADIAGLNIPTGIPLRYDLTEDL
FT                   QPVKPGGEYLDPDAAKEAAAAVANQGR"
FT   gene            complement(460592..461230)
FT                   /locus_tag="AMED_0457"
FT   CDS_pept        complement(460592..461230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0457"
FT                   /product="LuxR family transcriptional regulator fused with
FT                   ATPase domain"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42279"
FT                   /db_xref="GOA:A0A0H3CWJ0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWJ0"
FT                   /protein_id="ADJ42279.1"
FT                   /translation="MEKVTDVVMVRGEAELFERTAHLFELATEISCAARDLHTWSVAHP
FT                   SAPEREQQVRGMTVRKIYQPGVLFDAGLADHLRQIAAHGARIRITEREINETILLDRRI
FT                   AIVAGDQVGGVRGYTVISSPGLVQGIQSLFEAAWHAATDLESYQARFAELGAQEILEQL
FT                   ASGCKDETAARALGVGLRTYRRRVAELMELLGASSRFQAGARAREAGLL"
FT   gene            461298..462167
FT                   /locus_tag="AMED_0458"
FT   CDS_pept        461298..462167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0458"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42280"
FT                   /db_xref="GOA:A0A0H3CW76"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW76"
FT                   /protein_id="ADJ42280.1"
FT                   /translation="MTTNTLPAAAAGTWKLGSFEVNRLGFGAMRLMSTSDGGIRARETS
FT                   LAVLRRAVELGVNHIDTAAFYFAGPRSANELINRALSPYDDLVLTTKVGPGRDFEGTFH
FT                   TARPEQLRAQVEENLRALGLDHLDVVNYRIGQALDRGTGSLADGFGALAELRDAGLIRE
FT                   LGISNVGPEHLTEALAIAPVVCVQNQYGLTARREDDELVRMCAERGIAFVPFFAVASAT
FT                   GEDARVAEVARRHDATPAQVRLAWTLHQGPHVLAIPGTGDVAHLEQNVAAAALELTEDD
FT                   LATLDGNG"
FT   gene            462355..463554
FT                   /gene="senX"
FT                   /locus_tag="AMED_0459"
FT   CDS_pept        462355..463554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="senX"
FT                   /locus_tag="AMED_0459"
FT                   /product="two-component system histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42281"
FT                   /db_xref="GOA:A0A0H3CYB9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYB9"
FT                   /protein_id="ADJ42281.1"
FT                   /translation="MAGAVVGYFLARARTRREEVRPPGPTVAELLERLVRSSNNGIVVL
FT                   NRFGDMVLHNPRAYELGLVKVNQADPRARKAAEQVVETDEALEIDLSPLEARGRQPEAV
FT                   LGQVRPLGDGFTVVEAVDHSEAIRLEAVRRDFVANVSHELKTPVGAIALLTEAVLDAAE
FT                   DVAEVRRFGGKILRESTRLGQLVTELIALSRLQGAERLPDLNVVEVDAVVREALGRTTL
FT                   SAESADIRITTDNPSGLLIEGDRTLLVTALSNLLENAVAYSPAGSPVSISRRLADGMVE
FT                   IAVTDRGIGIAEDEQQRVFERFYRADKARSRATGGTGLGLAIVKHVAANHGGSVGLWSR
FT                   QGTGSTFTLRIPAHVSPEPATEPARAAKTSPAPRQEKTPERTQRLVVTGQDSPDHGGNL
FT                   "
FT   gene            463551..464240
FT                   /gene="regX"
FT                   /locus_tag="AMED_0460"
FT   CDS_pept        463551..464240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="regX"
FT                   /locus_tag="AMED_0460"
FT                   /product="two-component system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42282"
FT                   /db_xref="GOA:A0A0H3CUK1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUK1"
FT                   /protein_id="ADJ42282.1"
FT                   /translation="MTRVLIVEDEESFADPLAFLLRKEGFTAAVAGTGQAALEEFDRNG
FT                   ADIVLLDLMLPGMSGTDVCKQLRQRSAVPVIMVTARDSEIDKVVGLELGADDYVTKPYS
FT                   ARELIARVRAVLRRGGEPGSEGELAPLVLSAGPVRMDVERHVVTVDGADVSLPLKEFDL
FT                   LEYLLRNVGRVLTRGQLIDRVWGADYVGDTKTLDVHVKRLRSKIEPDPGSPRHLVTVRG
FT                   LGYKFET"
FT   gene            464364..465347
FT                   /locus_tag="AMED_0461"
FT   CDS_pept        464364..465347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0461"
FT                   /product="exopolyphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42283"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVI3"
FT                   /protein_id="ADJ42283.1"
FT                   /translation="MRLGVLDVGSNTVHLLVVDAHRGAHPTPMHSEKSVLRLAERITRG
FT                   GELSRAGADELCTAVQSAKDAATRLGCEEVMAFATSAVREAKNSVKVLARVAEETGVDL
FT                   QVLSGTDEARLTFLAVRRWYGWSAGQLLVLDIGGGSLEIAMGRDEEPVLAESLPLGAGR
FT                   TTRTRFRHDPPTRSELVATSAWLDDQLTELAHKVTKWGEPDRVVATSKTFRSLARLTGA
FT                   APSAAGPRVRRTLTDTALRQLLAFISRMPSADLAHLEGVSSSRSHQLVAGALVAQATMR
FT                   ALGVPELEICPWALREGVILRRLDHSNSADETGAALVGRFGAQEDR"
FT   gene            465822..467189
FT                   /locus_tag="AMED_0463"
FT   CDS_pept        465822..467189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0463"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42284"
FT                   /db_xref="GOA:A0A0H3CWJ4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWJ4"
FT                   /protein_id="ADJ42284.1"
FT                   /translation="MPQDSQPLPRPVPPPPARPAPGGAESGQYARPVPPQESGQYARPP
FT                   QESGQFARPAAPEPAPPRPPESAQLPVPPRAAPRRQPPPQPSQQMPVPPPSQQLPVPPP
FT                   SAEETRAVPPVRRRPGPPQPSQQMPVPPPQPSQQLPTPPPGGPLSARLDGLNGTPDADI
FT                   DVPPGPMASGTFAPPPAAPGRPRRAPTRRPEPKREDHTEQFSAVPDDEPPAPPAPKKGK
FT                   KPEPPEPTSPAGLANWRKRRQKEQMEDTEIGVMPVVPTDAPDDGYPEDDFEPDGFAPQG
FT                   SGFQAAYDEGPPTGAYPPPMPFAPGDRASRAPVPDDLEPYEREFADDYPADGPDFEQDD
FT                   YAYEQGEGYEDDEYDDAPEPVAEPEPAASPGKQWLALAGQLAMGVVGGAAVWLGFNWLW
FT                   VNLPAAALIAALLVVVALVWIVRKIRRAEDLQTTVLAVLVGLVVTVSPAALLLVGR"
FT   gene            467275..468078
FT                   /locus_tag="AMED_0464"
FT   CDS_pept        467275..468078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0464"
FT                   /product="xylose isomerase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42285"
FT                   /db_xref="GOA:A0A0H3CW82"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW82"
FT                   /protein_id="ADJ42285.1"
FT                   /translation="MTDEQPVPVGLSTASVWPLKAGTAFELAAELGYDGVEVMVWADPV
FT                   SQDVTALRRWSRRTGVPVLSVHSPSLLITQRIWSPDPVVRLRMSVDAAQELGARTVVVH
FT                   PPFRWQRRYGDAFGDLVAELEDSSGVEIAVENMFKVRPPGGSKNSRVSAFRPSIDPTDV
FT                   GFRHYTLDLSHTAAAEMDALALAQRMGDGLSHVHLADGTGLPKDEHLVPGRGGQPCAEL
FT                   LEKLVSNGFAGQIVLEINTRHAVAPAQRVRDLAEALLFARFHLGQ"
FT   gene            468211..469029
FT                   /locus_tag="AMED_0465"
FT   CDS_pept        468211..469029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0465"
FT                   /product="aromatic compounds degradation protein paaI"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42286"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYD4"
FT                   /protein_id="ADJ42286.1"
FT                   /translation="MDGTAVSFDTASAARSLGDGTFTAVLRAEWAIGSHPHGGFLIALL
FT                   ARAAIAALHERGEPHAEPLVVSAEFLHAPALGPVLLRTDVRKVGRRATVVEVRLEQRGR
FT                   SCVEARVTTGRLPMRRPEWTDVPSMPAEPPPGALAMAESTEGPFNLAKGCEVRLDPATA
FT                   GYLTGRTDEPPRMRLWVRPRHSLVDPYFSLLASDVNPPVVMNLGRIGWAPTVQLTALLR
FT                   TRPAPGWLRVVVESRSVHESWFDSDATVVDAQGRLVCQARQLGLAPAPGG"
FT   gene            469223..470035
FT                   /gene="proC"
FT                   /locus_tag="AMED_0466"
FT   CDS_pept        469223..470035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="AMED_0466"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42287"
FT                   /db_xref="GOA:A0A0H3CUK5"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUK5"
FT                   /protein_id="ADJ42287.1"
FT                   /translation="MTVIAVLGAGKIGEALLSGLLHGGHEAGDLLFTERYPARVEELTS
FT                   RYGIQGVEVEDAAKRADVLVVAVKPQDIEPVLDELAPLLGPSSLVVSLCAGLPTSLYER
FT                   RLAEGVPVVRVMPNTPMLVNEAMSAISAGRYATAEHLAVVRDLLSHVGQVVEVPEGQQD
FT                   AVTALSGSGPAYFFYLVEAMIDAGILLGLPRALAGQLIIQSAVGAAKMLAESDEHPVLL
FT                   REAVTSPAGTTINAIRELEKHGVRAALLAAIEAAKDRSVELGKAHDED"
FT   gene            470229..470444
FT                   /locus_tag="AMED_0467"
FT   CDS_pept        470229..470444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0467"
FT                   /product="excisionase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42288"
FT                   /db_xref="GOA:A0A0H3CVI5"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVI5"
FT                   /protein_id="ADJ42288.1"
FT                   /translation="MSPNKKEDLPAVGQVQFLTVAEVATLMRVSKMTVYRLVHSGELPA
FT                   VRVGKSFRVPEKAVHEYLQGAYYDVG"
FT   gene            470971..472014
FT                   /gene="galE"
FT                   /locus_tag="AMED_0468"
FT   CDS_pept        470971..472014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE"
FT                   /locus_tag="AMED_0468"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42289"
FT                   /db_xref="GOA:A0A0H3CWJ8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWJ8"
FT                   /protein_id="ADJ42289.1"
FT                   /translation="MPSNIVLVTGVAGELGGKLLARLGNNSDFERVIGVDTVPPDKTVL
FT                   QRMGHAEFVRADIRNPLIAKVISTAKVDTVVHASCTAHPAGPGRRTAIKEVNVIGTMRL
FT                   LAACQRSPLVRKLVVKSTAAVYGAGARSQAVFTEDSELIPTSTSGYAKDAVEMEGYVRG
FT                   LVRRRPDITTTLFRFANIIGPETDTVLARYFALPVVPTVFGYDARIQLLHSTDALSVLE
FT                   RATLTDKPGVFNVGAEGVLTLSQAIRRAGRVELPMPRSVVPSVGKVLRGARVVDFSADQ
FT                   VRLLNFGRVVDIAKLKQEFGYTPRWTTREAFDDYIVGRGLRPVLDGGKLAGLAGKVLVA
FT                   AATGQSR"
FT   gene            472092..473135
FT                   /locus_tag="AMED_0469"
FT   CDS_pept        472092..473135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0469"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42290"
FT                   /db_xref="GOA:A0A0H3CW85"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR016676"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW85"
FT                   /protein_id="ADJ42290.1"
FT                   /translation="MDDFESEAGTVGGAEAQVIPLHGPGREKPEAVTAEQDLREQEAAR
FT                   ADAPVVAFPGGVDQAGPDEPSVEESLSDAARSALGFIRDRLTGDYTVDEFGFDAELTEA
FT                   VFLPPLRALYKKWFRVDTHGVENLPAAGGALLVSNHSGTIPLDSLMTAVAVHDETGGRH
FT                   LRGLGADLVFQLPLVGSFARKSGQTLACHADAERLLRQGELVGVWPEGFKGVGKPFASR
FT                   YKLQRFGRGGFVSAALRAGVPIIPVSVIGAEEIYPKLGDIKVLARMLGLPYFPVTPFFP
FT                   MLGLLGAVPLPTKWSIEFGEPIATDAYGPDAVDDPMLVFQLTDQVRESIQQTLYRRLSQ
FT                   RKSVFRG"
FT   gene            473191..474423
FT                   /locus_tag="AMED_0470"
FT   CDS_pept        473191..474423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0470"
FT                   /product="two-component system histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42291"
FT                   /db_xref="GOA:A0A0H3CYE0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR025828"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYE0"
FT                   /protein_id="ADJ42291.1"
FT                   /translation="MATEDARRRHPVARARAALDALERLVGGMGTAILAVAALLWLLGS
FT                   AVLCLAGIGLLLVPLGLRLLRVVADRERARLDILPPPPVPRGLRAALADVTVRRELGWL
FT                   GCHSTFGLLLSLISLTLAVDVMHDASFPVWWWFVSPGDATPAQGFFTATDWGDAFGVCL
FT                   FGVATLVVLVLITPALAWLQEWPAKRLLAPHRGTDLALRVAELTATRAAALDAHAVELR
FT                   RIERSLHDGTQNRLVAVNVLLGAAKRALTRDPAAAEEILDRAQDAAEQALAELRGVVRS
FT                   ILPPVLTERSLPDALSALAADCPVACRIDAELPGRPAVSVQVTAYFVVAEALTNVAKHS
FT                   GASTATIRLRRERDRVHVEVTDDGRGGAHEDSGSGLTGIRRRVEAHDGSFALASPAGGP
FT                   TTLRVSLPCGS"
FT   gene            474411..475082
FT                   /locus_tag="AMED_0471"
FT   CDS_pept        474411..475082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0471"
FT                   /product="two-component system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42292"
FT                   /db_xref="GOA:A0A0H3CUK8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUK8"
FT                   /protein_id="ADJ42292.1"
FT                   /translation="MRIVIAEDDLLLREGVAMLLRAEGVDVRAAVANADDFLAAVDEHA
FT                   PDLAIVDVRMPPTHTDEGIVAAVEARRRQPGLAVLVLSAYVEQAFATELFSDGGAGLGY
FT                   LLKERVGRVEEFLEALHRVVDGGTAIDPEVVAQLLTRSRPDSRLERLSAREREVLALMA
FT                   EGLGNGAIAERLVVTDGAVHKHIRSIFAKLDLAPADRADRRVTAVLHYLRDTAGRGPVR
FT                   R"
FT   gene            complement(475072..475974)
FT                   /locus_tag="AMED_0472"
FT   CDS_pept        complement(475072..475974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0472"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42293"
FT                   /db_xref="GOA:A0A0H3CVI9"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="InterPro:IPR042150"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVI9"
FT                   /protein_id="ADJ42293.1"
FT                   /translation="MVATRVEIGEERTDGGWRDGIRRRPLTWFFVLANLLSWLAWTPYI
FT                   LSGNGLGVLPFRFPEVLGTAQFAGVLPGAYLGPIGAAFFVTAVADGRTGLRRWTARLFK
FT                   WRVSWLWYVGVVLSVPALLTIATVALSEQNPVLPAVATLVAYVPGLILQLLTTGLAEEP
FT                   GWRDFALPRLQHRYGPLGGTLILGPLWGVWHLPLFFTEWGGWPDVTWLTPLEFIATCVT
FT                   FSIIMTWVFNRTGQSLPLAMLLHTSVNNFFSLAWSEMFPGLSSRDTTHAFLLASTAVAL
FT                   VLLLATRGRLGYRRPELTA"
FT   gene            complement(476084..476893)
FT                   /gene="serB"
FT                   /locus_tag="AMED_0473"
FT   CDS_pept        complement(476084..476893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serB"
FT                   /locus_tag="AMED_0473"
FT                   /product="phosphoserine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42294"
FT                   /db_xref="GOA:A0A0H3CWK2"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWK2"
FT                   /protein_id="ADJ42294.1"
FT                   /translation="MVSEAAEPAVPPAPPDLTAAAFFDVDNTMMMGASIFYFARGLAAR
FT                   KFFTSSDLAGFVWGQIKFRLGGRENKEDIKTHRERALSFVAGRTVAELTSISEEIYDEL
FT                   MADKIWSGTRALAQMHLDAGQRVWLVTATPIELAAIISRRLGLTGALGTVAETRDGVYT
FT                   GRLVGDLLHGRAKAHAVRALASREGLNLKRCTAYSDSANDIPMLSAVGTAVAVNPDGGL
FT                   RDVARARGWEIRDFRTGRKAAKIGVPSVLGAGALAGAVAAGMAYRRR"
FT   gene            complement(477086..478159)
FT                   /locus_tag="AMED_0474"
FT   CDS_pept        complement(477086..478159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0474"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42295"
FT                   /db_xref="GOA:A0A0H3CW90"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW90"
FT                   /protein_id="ADJ42295.1"
FT                   /translation="MRFARERAESERFARALEPSPVRRDGEFADELALVGALRDLGAAG
FT                   APDLETRQRIRAEIAGRLETAAATTPRRRWRPRTADLVAAALFLFLVLSGLTLVLSRTA
FT                   LPGDPLYNVKRAGESTALGLTFGDQQKARKHLEFATNRITELGELAAEGANEADYRTAY
FT                   DDFAADLQAGVAQMFAAATSDGNGTQALSDVRLWARNQAARLGAQPLPAGAAPVFGNVR
FT                   DLLGKVQERASGLVARMNCYRITAGTSDELGPLPATGECTQRPLPSAGSQPTSASVSPS
FT                   SQDSTAPTATGTQLPPSDAAATPGIPAPTGGVTPPPVFGQPPSTTSRPPVTTTTTPSPP
FT                   LLSIPPLLPGLPPIVIG"
FT   gene            complement(478275..478967)
FT                   /gene="rpoE"
FT                   /locus_tag="AMED_0475"
FT   CDS_pept        complement(478275..478967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoE"
FT                   /locus_tag="AMED_0475"
FT                   /product="RNA polymerase sigma-70 factor, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42296"
FT                   /db_xref="GOA:A0A0H3CYE5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYE5"
FT                   /protein_id="ADJ42296.1"
FT                   /translation="MTVPTALSRGPVSMFAERVFGRTSAVPLSRQAADDERAEAAKAEA
FT                   WDLVRAAQDGDSSAFGRLYDRYVDVVYRYVLFRLGDRDLAEDVTSETFLRALRRITSVS
FT                   YQGRDVGAWFVTIARNLVLDHVKSSRFKLEVVTDEVTEPGSAPFSVGATVQVGPEQEAI
FT                   SRATRAELLRCVAELGEDQRECIVLRFLQGLSVAETAEIMNRNEGAIKALQHRAVRRLA
FT                   QLLPTGLR"
FT   gene            479282..480793
FT                   /gene="fadD"
FT                   /locus_tag="AMED_0476"
FT   CDS_pept        479282..480793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD"
FT                   /locus_tag="AMED_0476"
FT                   /product="long-chain acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42297"
FT                   /db_xref="GOA:A0A0H3CUL1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUL1"
FT                   /protein_id="ADJ42297.1"
FT                   /translation="MSAPEGTQPGVGGLLTRAAGTWPEHPAVLETGTGRGLSYRQVDAA
FT                   AHAQARRLAEAGVEPGDRVGLRLPTSVDFVVAFFGALRAGAIVVPLSPQVPGPELAKLL
FT                   EHSGAKVVVQRDADEDLPDGVSGLTPVGDPDGGGEFADAGRSGEDIAVVSYTSGTTGPP
FT                   RGVMLSHRALLANLEQIGAVEGVLEHDDRVLITIPLFHVYGLGPGLLQATAVGATAVLS
FT                   ERFEAQRTLDDCAGHGVTSITGVPTMYGEFAALGADELRRGLATVRRMTSGAAPLHPKV
FT                   LTAIREATGLDVYEGYGLTECAPVVTSTLVTGYPKPGSVGRPLPGIELRLVDSDGTDQA
FT                   VPLDPDDVDDVFEADGETGLVSIRGANLFSGYWPDGGHGPDDEGWFRTGDVGYLDTDGD
FT                   LHLVDRANDLIIVNGFNVFPREVEEVIGQLPEVAEAAVVGVVDERSGEAVKAVVVPATG
FT                   AALSEQQVADHCAAHLAGYKVPHLVEFAESLPHSATGKLRRLRLR"
FT   gene            480812..481048
FT                   /locus_tag="AMED_0477"
FT   CDS_pept        480812..481048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0477"
FT                   /product="glutaredoxin 2"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42298"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVJ4"
FT                   /protein_id="ADJ42298.1"
FT                   /translation="MAHEVTVMGRDGCHLCEVAEAEVARICGELGVTWKAEDVDTDPEW
FT                   RAEYGDRVPVILVDGAEHGYWRVEEDRLRRALA"
FT   gene            481124..482680
FT                   /locus_tag="AMED_0478"
FT   CDS_pept        481124..482680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0478"
FT                   /product="molybdopterin binding domain-containing
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42299"
FT                   /db_xref="GOA:A0A0H3CWK6"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWK6"
FT                   /protein_id="ADJ42299.1"
FT                   /translation="MSTLQDAPPEAPRRLSLPVATLIGLLALAAALGVGHLIAGFVGYT
FT                   ASPFIAVANYVIDHSPTAVVKWAERTLGTWDKPVLKLGLGVVLVLFALVAGQLSRRTPR
FT                   AGQVLVAVLGVAGVAAVYVRSDLGQVSLLAPVAALVAGLAVFTFLHRLALPVDVVGERG
FT                   FDRRKFLRAGVGVAAGSGIAAVVGQVAGTSKNAEDSRAAVGPLVPARTAPPLPADADFA
FT                   KLGSPPFLTPNADFYRIDTALVVPQIRTEDWSLKIHGMVDREVSFSYADIRNRPLVERR
FT                   VTLTCVSNEVGGPLISNATWLGVDLVDLLDQAGVQPGAEQMFATSVDGWTCGTPANVAL
FT                   DPDRGAMLAIGMNGEPLPVEHGFPARIVIPGLYGYVSATKWVESLEFTRWDARQAYWLS
FT                   RGWAEQAPIKTESRIDTPHGFAGVTAGKVRLTGTAWAQHTGIAKVEVRLDQGPWQPATL
FT                   AAEVSKDTWRMWWIELDVPKGTHQASVRATDQDGYTQTENRADPVPDGATGWHSVTLDA
FT                   R"
FT   gene            483042..483965
FT                   /gene="rex"
FT                   /locus_tag="AMED_0479"
FT   CDS_pept        483042..483965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rex"
FT                   /locus_tag="AMED_0479"
FT                   /product="AT-rich DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42300"
FT                   /db_xref="GOA:A0A0H3CW95"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW95"
FT                   /protein_id="ADJ42300.1"
FT                   /translation="MVTQRGRRDAADSPGRAPRRPRRPAGLDADNAPTAEMPAVPTGEP
FT                   GRNGDAPEAVRAKSIPEAAVARLAVYLRVLSAMSEQGATTVSSEELSQAAGVNSAKLRK
FT                   DLSYLGSYGTRGVGYEVGVLVSQIERILGLTRQHKVAVVGIGNLGHALANYGGFPGRGF
FT                   PVEALFDLDADLIGVPVGGLPVSHMDDIPRICAERGISIGVIATPPTAAQSVCDRLVAG
FT                   GVQCILNFAPVVLQVPAHIEVRKVDLAVELQILSFHVARRADSEGPAAGSQGNSGLPGA
FT                   VVPSENGNGRRNGAGPDGGREMVVRS"
FT   gene            484039..485346
FT                   /gene="hemA"
FT                   /locus_tag="AMED_0480"
FT   CDS_pept        484039..485346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemA"
FT                   /locus_tag="AMED_0480"
FT                   /product="glutamyl-tRNA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42301"
FT                   /db_xref="GOA:A0A0H3CYF0"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYF0"
FT                   /protein_id="ADJ42301.1"
FT                   /translation="MSVLAVGLSHRSAELSTLERVAVPAPEIGKVLDELQQAEHVSEVV
FT                   LVSTCNRIEVYAVVETFHGGLNDVSEVLARQAGMAPAELYETLYVHYAGAAVEHLFSVT
FT                   SGLDSMVVGETQILGQIRSAYATAREAGTVGRTLHELIQTALRVGKRVHTETGLDQLGA
FT                   SVVSEALAAAGDVTGKHAVIVGAGSMGALSASQLRKAGIGEISVANRTDARARRLAANV
FT                   TEQGVPARAIPLSAVAGTVRDADIVICCTGAQDAVFGPGHVLPRGGRDLVVCDLGLPRD
FT                   VDPEVGELAGVRVVDLATIQRRMREAGTPTTERQTAKATGIVLDEVRDYLAGQRSAEVT
FT                   PTVTALRRRAAEVVDAELLRLDNRLPDLDGAVREEVGRTVRRVVDKLLHAPTVRVKQLA
FT                   AETADTDYANALRELFCLDPQAPAAVTSPKPPPEKK"
FT   gene            485367..486296
FT                   /gene="hemC"
FT                   /locus_tag="AMED_0481"
FT   CDS_pept        485367..486296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="AMED_0481"
FT                   /product="hydroxymethylbilane synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42302"
FT                   /db_xref="GOA:A0A0H3CUL7"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUL7"
FT                   /protein_id="ADJ42302.1"
FT                   /translation="MGTRGSKLALTQTGTVADALRATGVEVEIVKVTTPGDKSLAPIAT
FT                   IGVGVFTSALREALLRNEVDVIVHSYKDLPTAPEPGITLAAVPPREDPRDALIARDGLT
FT                   LGELPPGSTVGTGAARRTAQLRALGLGLEIVPIRGNIDTRMRKVTDGELDAVVLARAGL
FT                   ARVGLVEAITETLDPIQMLPAPAQGALAVECRSADVDLEHLLRSTLDDEGTRAAVTAER
FT                   ALLAALEAGCSAPVGALAEIVEDLDAEGKVVERISLRGTAAIEGEEGAVDMVRAIALAD
FT                   KDQAAQLGKDLAAELLDLGAGALSGPAQ"
FT   gene            486415..487947
FT                   /gene="hemD"
FT                   /locus_tag="AMED_0482"
FT   CDS_pept        486415..487947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemD"
FT                   /locus_tag="AMED_0482"
FT                   /product="uroporphyrinogen-III synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42303"
FT                   /db_xref="GOA:A0A0H3CVJ9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVJ9"
FT                   /protein_id="ADJ42303.1"
FT                   /translation="MTPARKTTGRVAFVGSGPGDAGLLTVRAQELLTKAEVVVTDPDVP
FT                   QSVLAMAAEGAEVRPAVGEATEVAKDLTTEAKAGRLVLRLVAGDPLTTPAVVAEVQAVA
FT                   RTSAVFDVIPGVSPAAAVPAYAGVALGGTHTEVDVRGDVDWAALAAAPGPLVLHATSAH
FT                   LAEAASALTGNGVPASTPVAVTANGTINTQRTLDTTLEKVANDAGELVGPLIVTIGQAA
FT                   GQRSKLSWWESRSLYGWKVLVPRTKEQAGEMAERLRGHGATSHEVPTISVEPPRSPAQM
FT                   ERSVKGLVDGRYQWIVFTSTNAVRAVWEKFEEFGLDARAFSGVKIACVGESTAAKVRSF
FT                   GIIPELIPSGEQSSEGLLAEFPPYDDVLDPVDRVLLPRADIATETLSAGLRERGWEIDD
FT                   VTAYRTVRAAPPPAETREMIKTGGFDAVCFTSSSTVRNLVGIAGKPHTRTLVACIGPKT
FT                   AETAVEFGLRVDVQPEKADVPHLVDALAEHAARLRAEGALPPPRKAKRARRS"
FT   gene            complement(488000..488872)
FT                   /locus_tag="AMED_0483"
FT   CDS_pept        complement(488000..488872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0483"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42304"
FT                   /db_xref="GOA:A0A0H3CWL0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWL0"
FT                   /protein_id="ADJ42304.1"
FT                   /translation="MILVTGGLGMIGAHTARALLDLGHDVVVTSHRRGEVPSFLEGRVT
FT                   VEQLDVTDREAFLALGERHAITDIVHLAGSIPGEDPVEFFRTDTTGLLNALAAARTWGV
FT                   RRFAVASSLGVYIGRPEIPWTEDLSLPTASLPHLIIAFKKAVEPLTTHALAGSGVQPVL
FT                   LRIGTIWGPLVDPQSPFCPIPSLVNTGTSHMHADDGGDVCYAPDAGRAIALLTTAATLN
FT                   HEVYNVSSGRPFTYGEFAAALGTTLQLGGRNGPYLDISLLTEDTGFKPEFDVPASVADY
FT                   LKWREDNAR"
FT   gene            complement(488869..489675)
FT                   /locus_tag="AMED_0484"
FT   CDS_pept        complement(488869..489675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0484"
FT                   /product="AraC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42305"
FT                   /db_xref="GOA:A0A0H3CWA0"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWA0"
FT                   /protein_id="ADJ42305.1"
FT                   /translation="MRKVYVERLPVPALAGHVRTVWVQRAGDAPYVQRHLPTGGIELHF
FT                   PIGGRPRLLGPLTAARLEIIPPRTTLVGVRFRPGAAPPLPVPLDDLVDLVDQHVDLADD
FT                   RLAEAVATAGSPERALEVVQARLPVKAVDPLVNEAVRRLMPWHPVDIDTLAGHLALSPS
FT                   QLRRRCLQAVGVSPKVLQRTLRFQGFLALAQAGAGSPAGLAADTGYADQAHLSRECLRL
FT                   TGLTPRALLGGSVEECACGHDHSASYLPFLRDSFKNSPPGVPSLAR"
FT   gene            489799..490725
FT                   /gene="hemB"
FT                   /locus_tag="AMED_0485"
FT   CDS_pept        489799..490725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="AMED_0485"
FT                   /product="porphobilinogen synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42306"
FT                   /db_xref="GOA:A0A0H3CYF5"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYF5"
FT                   /protein_id="ADJ42306.1"
FT                   /translation="MRRLVGETTLRPRQLILPMFVAEGIDSPRPISSMPGVVQHTRDTL
FT                   RKAAVDAVNAGVGGLMLFGIPATRDAEGSGAVDEKGILNVALRDLRHELGDATVLMADT
FT                   CLDEFTDHGHCGVLDADGGVDNDATLRIYAQMAIAQVEAGAHVLGPSGMMDGQIGVIRR
FT                   ALDEVGHKEAAILAYSAKYASAFYGPFREAVDSQLKGDRKTYQQDPGNGREALREIELD
FT                   LAEGADMIMVKPALAYLDVIKAAADISPVPVAAYNISGEYAMVEAAAANGWLDRERTVL
FT                   EVLTSIRRAGADLILSYWAAEAAAWLD"
FT   gene            490743..491279
FT                   /locus_tag="AMED_0486"
FT   CDS_pept        490743..491279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0486"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42307"
FT                   /db_xref="GOA:A0A0H3CUM1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUM1"
FT                   /protein_id="ADJ42307.1"
FT                   /translation="MEDKEDLTGLTDDERRKRGRSPDPVLPGERAPKAAPPRPVAVSFW
FT                   LWLAGGVVLILGYVQLLTGKSAVIDRYVKGTTDPKITPQMIADGVTAMLWFLLVGSAVF
FT                   SLLFLLFAYKAREGTRSARTVLTVLPIVMLLLIFTFAPVLTYLTLVAVLLFVIALVLLY
FT                   LPSVSGYFPKVGKKP"
FT   gene            491276..491722
FT                   /locus_tag="AMED_0487"
FT   CDS_pept        491276..491722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0487"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42308"
FT                   /db_xref="GOA:A0A0H3CVK4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVK4"
FT                   /protein_id="ADJ42308.1"
FT                   /translation="MSDRLYAESGVSWAAIGWGPLFALVGALAELATGGPVHGVGWLMV
FT                   GFALAVITLPWVYARRRFLSLEVTTEQLRQGREQVPAAQIAEVTDVGTPVGARVLGGGW
FT                   SVPRKYDSLPVKLADGTVVLAWAKDVEALQDALDRLVRATPREA"
FT   gene            491736..492074
FT                   /locus_tag="AMED_0488"
FT   CDS_pept        491736..492074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0488"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42309"
FT                   /db_xref="GOA:A0A0H3CWL4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWL4"
FT                   /protein_id="ADJ42309.1"
FT                   /translation="MIDLPQPTGAELWPPEEPGPRARLHKPWRTLVAAVEVVLAVVAGW
FT                   AAYSCWHSSVATVVTRTDDGAVLESHRYFGGLLAAAIGLGTVAALLLVDAVRQLSLAIR
FT                   ARSAKTKA"
FT   gene            492137..493453
FT                   /locus_tag="AMED_0489"
FT   CDS_pept        492137..493453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0489"
FT                   /product="RND family efflux transporter MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42310"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWA3"
FT                   /protein_id="ADJ42310.1"
FT                   /translation="MTRVRASKAWVINGALVVLLAGAGFGIYQAFTPEPSSAQAQSRST
FT                   PVRRATVTETVSAAGTLASSYTGAANFATAGKVTSIDVKVGDVVSAGQKLATVDSTQAA
FT                   KQLQVAKANLAVAQNALNTAETAEATPATGQNSQNSQNAQNSAQAAANNVTSAQAKLDQ
FT                   AQLDVQTAQQTLDNTTLYAPGAGTVTAINGAVGQQSSSGSSATSQSSSSGSGQGGQGSS
FT                   SNSGAAASSSSSSGSGFITITNLTGLVVNTSVAEIDVSKVKAGQKATVTLNALPDKPVQ
FT                   ATVSSINLTPTTSGSVVSYGAQLALTSPPDGLRPGQSASVVITVAEADNALSVPAAAVQ
FT                   TVGSTNLVTVQENGQNVPRQVQVGLRGEATVQITSGLTEGENVVLTGTASTGATGGTGR
FT                   TGGTGGFPGGGTGGFPGGGQRGTGTGTGTGAGGGFGGRG"
FT   gene            493450..494154
FT                   /locus_tag="AMED_0490"
FT   CDS_pept        493450..494154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0490"
FT                   /product="ATPase component of ABC-type antimicrobial
FT                   peptide transport system"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42311"
FT                   /db_xref="GOA:A0A0H3CYG1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYG1"
FT                   /protein_id="ADJ42311.1"
FT                   /translation="MNPVIAVSGLRKTYGAGETAVHALRGVDLTVWPGEYVAIMGASGS
FT                   GKSTLLNMLGCLDVPTSGQYLLDGFGVGKLNERQLSLLRNRKIGFIFQSFNLVPRTSAL
FT                   SNVELPLVYSGLRRSERRRRALAALEMVGLSDRAKHLPSELSGGQIQRVAVARALVTGP
FT                   AMLLADEPTGNLDRRSTEDVLGVFDRLNRLGRTIVVITHEDEVAAHAHRVVRVDDGLIV
FT                   SDEVTRAVGAVS"
FT   gene            494151..495353
FT                   /locus_tag="AMED_0491"
FT   CDS_pept        494151..495353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0491"
FT                   /product="permease component of ABC-type antimicrobial
FT                   peptide transport system"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42312"
FT                   /db_xref="GOA:A0A0H3CUM6"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUM6"
FT                   /protein_id="ADJ42312.1"
FT                   /translation="MNLLEILRFAVRGLTANKLRSALTTLGITIGVAAVILLVAVGNGA
FT                   SAAIAASIQGLGTNVVNVSPARGGGQGATARPLTVQDAHALVDPVGAPDVKAASPVVNT
FT                   TATATYGQTSYDISSVAGTEPAYFSTTNRELAQGQLFTGEDVTAARKVVVLGPTTAQSI
FT                   FGTADPVGKNVLLNSIQFTVIGVLQAKGSTGLQNADDVAIAPISAVQNSLAGYGSLSQI
FT                   AVQATSADSVSLAQSEITAILNARHGIRLGGTPDYQIQNSEQLLATRTSATETFTVLLA
FT                   AVAAISLLVGGIGVTNIMLVTVTERIREIGIRKAIGAPRAAILGQFLAEATMLSLFGGL
FT                   LGVAIGLIGSRFTISGIKPVVVPSSILLAFAVSALIGLFFGSFPANRAAKLRPIDALRH
FT                   E"
FT   gene            495365..495952
FT                   /locus_tag="AMED_0492"
FT   CDS_pept        495365..495952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0492"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42313"
FT                   /db_xref="GOA:A0A0H3CVK8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVK8"
FT                   /protein_id="ADJ42313.1"
FT                   /translation="MSTPTTTPPGDEPTAILPAVEPTAEQIVASPAVDGDLNAEMRRAA
FT                   KPFSRTTLVLAGLVAFAIAFGGGAWTHAAFGSATPARPGGTAGGAQARGQGGTGQPSGT
FT                   SQPGGTGQQGGGYRGGRGTTGTIDHVDGTTVYVKTAQGADVKVSTSDSTTVGVTQQGKL
FT                   SDLKPGATVVVQGQAGDDGTVAAQAITQQAAR"
FT   gene            complement(495961..496437)
FT                   /gene="tspO"
FT                   /locus_tag="AMED_0493"
FT   CDS_pept        complement(495961..496437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tspO"
FT                   /locus_tag="AMED_0493"
FT                   /product="tryptophan-rich sensory protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42314"
FT                   /db_xref="GOA:A0A0H3CWL7"
FT                   /db_xref="InterPro:IPR004307"
FT                   /db_xref="InterPro:IPR038330"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWL7"
FT                   /protein_id="ADJ42314.1"
FT                   /translation="MTERAPHRNQWLVLAGFLGVVAVVAVVGALAATSAKEVYARLDQP
FT                   SWAPPASLFGPVWTVLYVTIAVAGWLYWRTDGETRGFAAYGIGLLFNLLWTPLFFEGGA
FT                   AGLALADIVLLDVVVVVTIVLFGRRSKAAAALLVPYLAWILYATALNTAVLVLN"
FT   gene            496498..497799
FT                   /gene="hemL"
FT                   /locus_tag="AMED_0494"
FT   CDS_pept        496498..497799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="AMED_0494"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42315"
FT                   /db_xref="GOA:A0A0H3CWA8"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWA8"
FT                   /protein_id="ADJ42315.1"
FT                   /translation="MSTGTEQSKAWFDRAKAAIPGGVNSPVRAFNSVGGTPRFMVRGEG
FT                   PHLWDADGNRYVDLVSSWGPMILGHAHPAVVEAARRAATSGLSFGTPTIGEVELAEEII
FT                   GRVEPVERVRLVNSGTEATMSAIRLARGFTGRSKIVKFAGCYHGHVDALLAQAGSGVAT
FT                   LGLPTSPGVTGAQAADTLVLPYNDLDAVRKSFVDNPGEIAAVITEAAAGNMGAVAPDAG
FT                   FNEGLRDLAHEHGALLIMDEVMTGFRVSAAGWFGLEGVAGDLYTFGKVMSGGLPAAAFG
FT                   GRADVMAKLAPGGPVYQAGTLSGNPVAVATGLATLRAADHAVYAALDANAKRLGNLFHA
FT                   ALSEAGVAHNVQYAGNLVSVFFGETPVRDYAGAQASETWRFPPFFHALLDGGVYAPPSA
FT                   YEAWFVNAAMDDEAFSVIEAALPAAARAAAGAVQ"
FT   gene            497796..498422
FT                   /locus_tag="AMED_0495"
FT   CDS_pept        497796..498422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0495"
FT                   /product="fructose-2,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42316"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYG6"
FT                   /protein_id="ADJ42316.1"
FT                   /translation="MTTVVHMLRHGEVHNPEKILYGRLPGYRLSERGQRQALTVAEAVA
FT                   GHDLVHVVASPLQRAQETAAPIAAAHRLDIATDEGLIEAGNQFEGLHVAVGDGALREPQ
FT                   HWPKLVNPFKPSWGEPYLEIAHRMLGAVHRAREAADGHEALCVSHQLPIWTLRRFLEGK
FT                   RLWHDPRRRQCSLASLTSLVFDGDELREIVYSEPAGTTDPKVTGA"
FT   gene            498419..498985
FT                   /locus_tag="AMED_0496"
FT   CDS_pept        498419..498985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0496"
FT                   /product="putative cytochrome c biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42317"
FT                   /db_xref="GOA:A0A0H3CUM7"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUM7"
FT                   /protein_id="ADJ42317.1"
FT                   /translation="MKRLVAAVVLAVLTLAGCSAGKDAVVPGSSFSFVSPGGKVDIAYD
FT                   AAQRQTAPVLAGEDLMNEGKQLSLADYAGKVVVLNLWGQWCGPCRTEAPEMESLAKQGV
FT                   QVVGIDVRDPAREVAQDFVRDRQLTYPSIYDPDGRVLLKLTGYPRNIIPSTIVLDKQHR
FT                   VAAVFLRPVLAQDLLPVAQRLTAEA"
FT   gene            499402..500175
FT                   /gene="ccdA"
FT                   /locus_tag="AMED_0497"
FT   CDS_pept        499402..500175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccdA"
FT                   /locus_tag="AMED_0497"
FT                   /product="cytochrome c-type biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42318"
FT                   /db_xref="GOA:A0A0H3CVL2"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVL2"
FT                   /protein_id="ADJ42318.1"
FT                   /translation="MNSVTELAISGPLLLAAGVALLAGAISFASPCVVPLVPGYLAYLA
FT                   ALVGAEAPAVSADEERKQGRWAVLGAALLFVLGFTVVFVGTFGTLVWLTATLTLNQDLL
FT                   QRLGGVLTIAMALVFLGWIPGLQRDVRSHHVPRGGIWGAPLLGAIFGLGWTPCIGPTLS
FT                   AVTTLASATGGAEARGYLLIAVYCLGLGLPFLLIALGARWAVRATDWVRRHGRQVQIFG
FT                   GVLLLIVGLLLVTGVWGDLMGWIRNELAIDLRLPL"
FT   gene            500172..501767
FT                   /gene="resB"
FT                   /locus_tag="AMED_0498"
FT   CDS_pept        500172..501767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="resB"
FT                   /locus_tag="AMED_0498"
FT                   /product="cytochrome c biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42319"
FT                   /db_xref="GOA:A0A0H3CWM1"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWM1"
FT                   /protein_id="ADJ42319.1"
FT                   /translation="MTTTEAPPKTPQGPTPAKRTFAFARNTWRGLTSMRTALVLLFLLA
FT                   LAALPGALLPQRKLNAPKVAEYITAHGWWGTLLDKLEFYDVYSSIWFSAIYLLLMISLI
FT                   GCLTPRSFEYVRAMRAKPVLTPRNLARMPHYRLGRGKTDVAAEIAAVHKQLSGWRRIER
FT                   EEADGVRTISAERGFLRETGNLVFHFSMLGLIVFFAIGKLYGYEGQVIVQADGDSFCNA
FT                   GIYNYDSFNAGLRVDGTDLDPFCVKVHDFTARYTASGQPDYYHSNIEYQSGPDLETGIW
FT                   RPYGLEVNSPLRTAGDRVYLLGHGYSPKFTVTFPDGSQRTQNTQWRTVDPSTMLAEGAT
FT                   KFDQPGITDEVQRRTRQLAITGLFAPTAFLHGSVLTSSAPEADDPAVAVDVLRGDLGLD
FT                   AGRGQSVFEVDQTLVDDGRLKKVARQNLKVGQELKLDDGTKVRFDGVGQWVSLQVSHDP
FT                   TQGFVLGFAIAMFLGLGGSLLVKRRRLWVRVKPGTEDDPGTVIEVAGLARTDQAGYGEE
FT                   FHRVSERLISGQKG"
FT   gene            501771..502739
FT                   /locus_tag="AMED_0499"
FT   CDS_pept        501771..502739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0499"
FT                   /product="cytochrome c assembly membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42320"
FT                   /db_xref="GOA:A0A0H3CWB2"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR017562"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWB2"
FT                   /protein_id="ADJ42320.1"
FT                   /translation="MPINETLSTYSDWLYTTTAAIYVVALMLTLIEQGFGAKGRLATER
FT                   AKLRARELVGAGGPPVEEVPAAQREVGRPERIGRMGASLLVLGAVLQLTAIVLRGLAVH
FT                   RAPWGNMYEYGMAVTFIAVVTWIVVMWKFPVRHLTGFLLLPVVILMFVNGTLLYTIAAP
FT                   VQPALQSYWLVIHVSAAIIGSGVFLVPGVASVLFLFRAAYEKDATKFARFASKLPAADV
FT                   LDRIAYRTTIFAFPVFTFGVLCGAVWAESAWGRFWGWDPKETCAFIAWVVYAAYLHSRA
FT                   TAGWRGARAAVINIVGFAAMIFNLFFVNLVSVGLHSYAGVG"
FT   gene            502815..504152
FT                   /locus_tag="AMED_0500"
FT   CDS_pept        502815..504152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42321"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYH0"
FT                   /protein_id="ADJ42321.1"
FT                   /translation="MTGPSEESAPGHPEQAEPAAAAPQPGLFADDRTDSHPHPETSGAF
FT                   DVQPTQAVAPPPNPAVSGPHQVPNPAVSGPHQVPYGYDRNLPPLQPQYGDPAQQYQANA
FT                   QYPQQPSGPQQPSGLPQPQGGRHAAPQQPGHGHDLSTAHLVKQTRRPPQSGWRKALYVG
FT                   SGKLVNPGESPADTRRRELIARVNQPLRGCYKIAMLSLKGGVGKTTVTTTLGSTFASLR
FT                   GDRVVAVDANPDRGTLSQKIPLETTATVRHLLRDAARITRYSDVRSYTSQGSSRLEILA
FT                   SEQDPAVSEAFSEDDYRRTVNLLEHFYNIVLTDCGTGLMHSAMKGVLDVADALVVVSSG
FT                   SVDGARSASATLDWLEAHGYGELVKRSVAVINSVRPKGGSVDLDKLSAHFGAKVRAVCK
FT                   VPFDPHLEEGAEIELDRLSGDTRLALLELAATVADGFATPLSQGYR"
FT   gene            complement(504269..504454)
FT                   /locus_tag="AMED_0501"
FT   CDS_pept        complement(504269..504454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42322"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUN2"
FT                   /protein_id="ADJ42322.1"
FT                   /translation="MLALLAAVGALVVALLLWRSFAGQRIGVPSTPRRAPLAPDDDPDF
FT                   LRQLAEQQRKRRDEDL"
FT   gene            complement(504601..504813)
FT                   /locus_tag="AMED_0502"
FT   CDS_pept        complement(504601..504813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0502"
FT                   /product="MerR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42323"
FT                   /db_xref="GOA:A0A0H3CVL7"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVL7"
FT                   /protein_id="ADJ42323.1"
FT                   /translation="MTATMGGRLLTPGEVAALFRVDPKTVTRWATAGRIGSIRTPGGHR
FT                   RFRESEVNELLAELTTDASEPARNA"
FT   gene            505099..505563
FT                   /gene="lrp"
FT                   /locus_tag="AMED_0503"
FT   CDS_pept        505099..505563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lrp"
FT                   /locus_tag="AMED_0503"
FT                   /product="Lrp/AsnC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42324"
FT                   /db_xref="GOA:A0A0H3CWM7"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWM7"
FT                   /protein_id="ADJ42324.1"
FT                   /translation="MDRKIIAALRINGRATYADLGRAVGLSASSVHERVGKLEAAGVIT
FT                   GYHAVVDPSSVGLGVTALVSIHPTDTATEDDVADALAELDEVESCYAVAGDEAFVVKVR
FT                   VSTVDELERTLGRLRRIAGVGRTNTTVVLSTRFEGRPNNAGLQKDRPAGA"
FT   gene            505575..505856
FT                   /locus_tag="AMED_0504"
FT   CDS_pept        505575..505856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0504"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42325"
FT                   /db_xref="GOA:A0A0H3CWB6"
FT                   /db_xref="InterPro:IPR025323"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWB6"
FT                   /protein_id="ADJ42325.1"
FT                   /translation="MSDVKADHLPRDLTLYLLARFVLVGVIAWALSLTGVPLLVALVIG
FT                   LVVGLPLGLLLFRPLNARVTAGLAKRNEKRARARAELRAQLRGEGQPE"
FT   gene            505853..506935
FT                   /gene="cysK"
FT                   /locus_tag="AMED_0505"
FT   CDS_pept        505853..506935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysK"
FT                   /locus_tag="AMED_0505"
FT                   /product="cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42326"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYH3"
FT                   /protein_id="ADJ42326.1"
FT                   /translation="MTRPHNRSWVREAVRIIEADANRSADTHLHVFPLPPEWGIDLYLK
FT                   DESVHPTGSLKHRLARSLFLYGLVNGQIGPDTVLVEASSGSTAVSEAYFARMLGLRFIT
FT                   VVPRRTSKEKIALIEFYGGECHYVDQAPAMYPEAERLAAESGGHYLDQFTYAERATDWR
FT                   GNNNIAESVFAQMRSERHPIPAWIVVGAGTGGTSATFGRYVRYKRHTTKVCVVDPENSS
FT                   FYGAWETGALDYGTGMPSRIEGIGRPRCEPSFVPGVIDEMFRIPDAGSLAAIRLLRERT
FT                   GHWAGGSTGTNLYGAFRLISRMVEDGQAGSVVTLLCDGGERYAHTYYNDEWLAEQNLDL
FT                   APHTALFEEFLTTGKFVPES"
FT   gene            complement(506932..507831)
FT                   /gene="menA"
FT                   /locus_tag="AMED_0506"
FT   CDS_pept        complement(506932..507831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menA"
FT                   /locus_tag="AMED_0506"
FT                   /product="1,4-dihydroxy-2-naphthoate octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42327"
FT                   /db_xref="GOA:A0A0H3CUN6"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR004657"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUN6"
FT                   /protein_id="ADJ42327.1"
FT                   /translation="MITMALNGAMASLSEWIEGARPRTLPNAVAPVVAGVGAAIALDAF
FT                   SWWRSVLALLVSLSLIVGVNYANDYSDGIRGTDENRVGPLRLVGSGVAAPKAVLTAALI
FT                   ALGLAGVLGLVLVAVSGHWWLLAMGALCIVGAWFYTGGKKPYGYYGFGEIAVFVFFGLA
FT                   GVLGTVYVQAGRVSWAALACAVAVGCFSTAVLTANNLRDIPTDIEAGKRTLATRLGDKG
FT                   TRRLYLTLVAVPVLVSLVFAATDYRLTALAGLTVGLLLPAVGVVHGGKTGRELIPALRD
FT                   TGFAMLAWAVCTAVLMNL"
FT   gene            complement(508091..509092)
FT                   /gene="menE"
FT                   /locus_tag="AMED_0508"
FT   CDS_pept        complement(508091..509092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menE"
FT                   /locus_tag="AMED_0508"
FT                   /product="O-succinylbenzoic acid--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42328"
FT                   /db_xref="GOA:A0A0H3CVM2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVM2"
FT                   /protein_id="ADJ42328.1"
FT                   /translation="MAPDEPAEPGTAVVIATSGSTGAPKGVLLSARALTASAEATHARL
FT                   GGPGHWLLATPAHYIGGLQVLVRSLLAGTDPVLLTGTGFRPDDFAAAAARLEGGPRYTA
FT                   LVPTQLVRLLDDGGAGLAAAKTFDAIVVGAAATSAALRERAADAGVRIVPAYGMSETAS
FT                   GCVYDGFPLDGVRVDLSGDRIRIAGDVLAHGYRRRPDLTEESFADGWFTTSDRGVRHGD
FT                   GRIEVLGRADDMINTGGVKVSANAIERCLCAQPGVRDACVVGVPDPEWGEAVVALVVSR
FT                   GEHGDLRAAVRAELGAAATPKRIEFGAELPLRGPGKVDRAAVKARLEPRPTG"
FT   gene            complement(509217..510140)
FT                   /gene="menB"
FT                   /locus_tag="AMED_0509"
FT   CDS_pept        complement(509217..510140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menB"
FT                   /locus_tag="AMED_0509"
FT                   /product="naphthoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42329"
FT                   /db_xref="GOA:A0A0H3CWN1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR010198"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWN1"
FT                   /protein_id="ADJ42329.1"
FT                   /translation="MDDARVSELFDPAAWTGVEGFAFTDITYHRSAENRGGKRVVRIAF
FT                   DRPEVRNAFRPHTVDELYRALDHARMSADVGCVLLTGNGPSPKDGGWAFCSGGDQRIRG
FT                   RSGYQYASGETSDTVDPARAGRLHILECQRLIRFMPKPVIAVVPGWAAGGGHSLHVVCD
FT                   LTLASAEHAKFKQTDADVGSFDGGYGSAYLAKMVGQKFAREIFFLGREYSAEQMHRMGA
FT                   VNAVVPHAELEKEALTWAWEITRKSPTAQRMLKYAFNLTDDGLVGQQLFAGETTRLAYM
FT                   QDEAVEGRDAFLQKRDPDFKDVPYYY"
FT   gene            510192..511874
FT                   /gene="menD"
FT                   /locus_tag="AMED_0510"
FT   CDS_pept        510192..511874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="menD"
FT                   /locus_tag="AMED_0510"
FT                   /product="2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42330"
FT                   /db_xref="GOA:A0A0H3CWB9"
FT                   /db_xref="InterPro:IPR004433"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWB9"
FT                   /protein_id="ADJ42330.1"
FT                   /translation="MPVNPSTAQARVIVDELVRNTVSHVVLCPGSRNAPLSIALYDAAA
FT                   AGKLRLHVRIDERGAGFLALGIAARTGRPVAVLCTSGTAAANFHPAVLEADRAGVPLIV
FT                   MTADRPPELRAAGASQVIDQHQLYGDAVRYFDELAVAERRAGQNSYWRSQICRAWNAAY
FT                   GEWRCGPVHLNIPFREPLVPDLDDDGEWYESLDGRADGSRWTELPDFGALPSFVVPSAR
FT                   HGLVIACDTGVQAASEWAEQHGWPVVSETGGLGLSGGTAISSGVWLLAVEEFISRHKPE
FT                   QVLCLGRPTVFRQIQQVLSDAEVEVLLVRPDSDWPAPAHNVRQVGQWFDEPTKPADPEW
FT                   LASWRRADAAAASAVAATLADEPWPSGLRVATELVDALPPDSLLVVGSSNPTRDVALAG
FT                   RLRPDVLVHRNRGVAGIDGTVSTAIGAAYVHRGPSYALLGDLTFLHDASGLLTGPAEQR
FT                   PDLTIVVLNDDGGGIFSLLEQGAPEHSASFERVFGTPHGADLGALCAGYRVPHVVAETL
FT                   TEFQAALAPAPGLRVVEVRVDRSRHRDLHARLRAAVSSAVSAV"
FT   gene            511996..513516
FT                   /locus_tag="AMED_0511"
FT   CDS_pept        511996..513516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0511"
FT                   /product="metallopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42331"
FT                   /db_xref="GOA:A0A0H3CYH7"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR034019"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYH7"
FT                   /protein_id="ADJ42331.1"
FT                   /translation="MRARTRTGLGALAAGVVSVLLAGTASAAPAPGAPGVGDPYYPNAG
FT                   NGGTDVLHYDIRLTYQPATDLLSGTTTLLLTATQDLSRFDLDFALKASSVRVNNRPAQF
FT                   ANQTGNGELVVTPAQPLLKGQTATVVVAYADTPSTETVDGINAWKKGSFGALGIDEPQS
FT                   SAWWFPANDHPTDKATYDVSIEAPDDNAAISNGTLVRKTKSRAGWTRWQWRSTKPQATY
FT                   LTSFIVGKYEVVESTTPDGKPFITAYGADLGDSLYAAKASVERTPEIDEFLATQFGPYP
FT                   FEAEGGVVTSGIGFSLENQTRPTYGVRNFRAGSNTTLIAHENAHQWFGDNVSLGRWSDI
FT                   WLNEGFASYAEWLWSEHEGEGTVAELAQYTYDSNPADGDLWKLVPADPGADNQFDNAVY
FT                   DRGALTLQALRTAVGDEAFFAILQTWQAQRGGANGRILDFIALAEKISGKPLHELFQTW
FT                   LYTAGKPAVGPNGAAAVAARLAAPASVKPRSYDQIQANHRFLAAEHAG"
FT   gene            513539..513976
FT                   /locus_tag="AMED_0512"
FT   CDS_pept        513539..513976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0512"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42332"
FT                   /db_xref="GOA:A0A0H3CUN9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUN9"
FT                   /protein_id="ADJ42332.1"
FT                   /translation="MSTRGERARRVGWWTILGVASLLTVMCVCLLFAAIRNDSAISAQL
FT                   GTATATVDSVAFDRTIIHFETPDGIVHSPANGVLYPDGLAAGQLVRIEYDASDPELARV
FT                   AGRSATLTLLPLGSFVFFTWLVAGPGLWWIRRQDKRAVVSA"
FT   gene            complement(514272..515102)
FT                   /gene="suhB"
FT                   /locus_tag="AMED_0513"
FT   CDS_pept        complement(514272..515102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="suhB"
FT                   /locus_tag="AMED_0513"
FT                   /product="myo-inositol-1(or 4)-monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42333"
FT                   /db_xref="GOA:A0A0H3CVM7"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVM7"
FT                   /protein_id="ADJ42333.1"
FT                   /translation="MTLLSSRPPRPVEPGLLSRALEVAGRLANDATDVITATAGRGAHP
FT                   STLDSPFDWVTDTDRILERHTRRVLTAEFPGIPVVGHEFGADHGADIAEYRWVVDSVDG
FT                   TANYVAGVPWCAYSLALVDAAGPVVGVVADPYRAQIYAAARGRGARANGKPIKLVDRCV
FT                   TAGALVCTELARSGPWPGMGGFIERAAAAHAGVRVLGSAALSIAQVALGHAAAAVLHSY
FT                   HEWDVAGSVAMAIEAGAVVLDKHGEDTALPTDGLLVAAPGVADEVLGWWQETAG"
FT   gene            515271..516350
FT                   /locus_tag="AMED_0514"
FT   CDS_pept        515271..516350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0514"
FT                   /product="glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42334"
FT                   /db_xref="GOA:A0A0H3CWN6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWN6"
FT                   /protein_id="ADJ42334.1"
FT                   /translation="MNGVTNSVLRVVEHLRERAHDVLIIAPGPGPDSYRGAPVIRIPAL
FT                   DVPGVSSLPIGLPTRTVLNALAAFGPDVVHLASPFVVGARGLAAARRLRVPSIAVYQTD
FT                   IAGFAAAYGFGIGARAAWRWVRRLHSRADRTLAPSSDSVEQLRLHGVPRVHRWARGVDI
FT                   DRFSPAHADPVLRAELAPDGELLVGFVGRLAPEKEVDRLAALAAVPGIRVVVVGDGPEL
FT                   ENLREQLPDAAFLGAKYGKELSKAYASLDVFVHTGPHETFCQAVQEAMASGLPVLAPDA
FT                   GGPKDLVLPGRTGYLLPADRERFGPALVEKVDALRDAALRARLGEKARKVVLGRTWPAV
FT                   CHELVGHYEAVRGRAARAA"
FT   gene            516352..517455
FT                   /locus_tag="AMED_0515"
FT   CDS_pept        516352..517455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0515"
FT                   /product="glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42335"
FT                   /db_xref="GOA:A0A0H3CWC5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWC5"
FT                   /protein_id="ADJ42335.1"
FT                   /translation="MHIVQLANFYGPRSGGLRTALHHLGAGYVASGHEVTLVVPGRRYA
FT                   DEVLPTGVRRFSLPAPQIPGTGGYRAVDPHRVRAVLRQLEPDRLEVSDRLTLRGMGSWA
FT                   SRHGVPSTVISHERLDRLLEQFLLPEPVARRVADAANRRMAASYDTVVCTTAFARAEFD
FT                   RIAAPNVRRVPLGVDLTTFRPAMRDDGWRAGLAGGADVLLVHCGRLSPEKHVERSVDTV
FT                   AELTESGARVRLVVAGDGPRRRALERRARGLPVTFLGFLPGRGDVARLLASADVSLAPG
FT                   PHETFGLAALEALASGTPVVVSASSALREIVRPGCGAAVDDHAPAFAAAVTDLLGDPED
FT                   QRRAAARARAEEFTWPAAVAGMLATHG"
FT   gene            517536..518309
FT                   /locus_tag="AMED_0516"
FT   CDS_pept        517536..518309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0516"
FT                   /product="SARP family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42336"
FT                   /db_xref="GOA:A0A0H3CYI2"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYI2"
FT                   /protein_id="ADJ42336.1"
FT                   /translation="MDFAVLGPITLVSGGRAIPVPGRLRRTLLGVLLADANHFVRADVL
FT                   ADALWDGDPDRRAARKLHWHVHKLRSALPERERLGSGHGGYRLVVRPGELDAVRFEALA
FT                   GRAAGEPRPAERTALIREALALWHGTPYGGLDVPVLADEVLRLTERRLVLLEQLHQAEL
FT                   DLGRHAAVVAELTGLVRRYPLRERLHYLLMVALSLDGRRAEALDAYRGARRVLVRQLGL
FT                   EPGRALRDLERRILADGPAAWPAAGPSGGDQMTRR"
FT   gene            complement(518291..518665)
FT                   /locus_tag="AMED_0517"
FT   CDS_pept        complement(518291..518665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0517"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42337"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUP3"
FT                   /protein_id="ADJ42337.1"
FT                   /translation="MSFVKKAAAVAALTGAVVGGSLISSAPAMAGTDGVVTIQGACGDK
FT                   FNPSVGGGAAAWTITCTSGKVAVSGWVKDTDADGKAAEVYGTWEDGSNFGTVRAGGEGT
FT                   KKEFNKTHAGSHVYLYLRVI"
FT   gene            518825..519514
FT                   /gene="ubiE"
FT                   /locus_tag="AMED_0518"
FT   CDS_pept        518825..519514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="AMED_0518"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42338"
FT                   /db_xref="GOA:A0A0H3CVN1"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVN1"
FT                   /protein_id="ADJ42338.1"
FT                   /translation="MSRASLDKDPHEVAAMFDGVADGYDRANSFMTFGFDRRWRTTTAR
FT                   VLDARRGEKVLDLAAGTGVSTVEYARGGAWCLAADFSFGMLRAGKHRNVPMVAADALNL
FT                   PFADESFDAVTISLALRNFVDTKAALTEIARVVKPGGRLVICEVSTPPFAPIRFVHRRF
FT                   MLKLLTWVGKRTSSNPEAYSYLAESMLAWPDQRTLGEITASAGWADVEWLNLTFGVVAI
FT                   HRARKPA"
FT   gene            519594..520811
FT                   /locus_tag="AMED_0519"
FT   CDS_pept        519594..520811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0519"
FT                   /product="electron transfer oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42339"
FT                   /db_xref="GOA:A0A0H3CWP1"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWP1"
FT                   /protein_id="ADJ42339.1"
FT                   /translation="MATYLARAGVDVLLLEKTEFPREKVCGDGLTPRGVKQLIDLGIDT
FT                   ATDAGWVHSRGLRILTGDLTLELDWPDLTSYPPYGVSRTRHDFDDLLAKLAVKAGARLY
FT                   ERTTVMSAITDASGRVVGVEAKVGPEKTPVHYRAPLVLACDGVSARLALSVGIQKNEKR
FT                   PMGVAVRQYYKSPRHDDPFIEGHLELWDRSDPRNPKLLPGYGWAFPLGDGTVNVGLGML
FT                   STSASFRNTDYRALLRQWLDGTPEEWGYREENAIGKVGGAGLPMGFNRTPHYRDGLLLL
FT                   GDAGGMVSPFNGEGISAAMESAQIAAEVVVQALARREGPSRERALEAYPRAVGELMGGY
FT                   YQLGNVFAKIIGKPKIMHACTKYGLRVNKLLPLVYKGLSGCYDAKGGDGVDRLIAALAK
FT                   VTPSPR"
FT   gene            521291..521710
FT                   /gene="nuoA"
FT                   /locus_tag="AMED_0520"
FT   CDS_pept        521291..521710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoA"
FT                   /locus_tag="AMED_0520"
FT                   /product="NADH dehydrogenase I subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42340"
FT                   /db_xref="GOA:A0A0H3CWD0"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWD0"
FT                   /protein_id="ADJ42340.1"
FT                   /translation="MLTLLTRTDTVQLAQEAPSLKPYLPLVLLFVLALGFAVLSVLLGP
FT                   LVGPSRYNKAKLSAYECGIEPSPQPLVGAGRMPVAYYITAMLFILFDIEMVFLYPFAVQ
FT                   ADALGTFGLVEILLFIATVGFAYAYVWRRGGLDWN"
FT   gene            521715..522263
FT                   /gene="nuoB"
FT                   /locus_tag="AMED_0521"
FT   CDS_pept        521715..522263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoB"
FT                   /locus_tag="AMED_0521"
FT                   /product="NADH dehydrogenase I subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42341"
FT                   /db_xref="GOA:A0A0H3CYI7"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYI7"
FT                   /protein_id="ADJ42341.1"
FT                   /translation="MGLEEKLPNGILLASLEGLVNWARKNSLWPATFGLACCAIEMMTV
FT                   GGSRYDIARFGMERFSATPRQADLMIVAGRVTQKMAPVLRQIYDQMAEPRWVLAMGVCA
FT                   SSGGMFNNYAVVQGVDHIVPVDMYLPGCPPRPEMLLDAILKLHAKIQDEPINARRAAIR
FT                   AASGERTELVASSIKYAKK"
FT   gene            522268..523017
FT                   /gene="nuoC"
FT                   /locus_tag="AMED_0522"
FT   CDS_pept        522268..523017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoC"
FT                   /locus_tag="AMED_0522"
FT                   /product="NADH dehydrogenase I subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42342"
FT                   /db_xref="GOA:A0A0H3CUP6"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUP6"
FT                   /protein_id="ADJ42342.1"
FT                   /translation="MTENPQPGEEQSSAERAETGLTAKGPGAAEAVVTGRERQGMFGVH
FT                   GTGDTSGYGGVRLPAYSPAPAERPYGGWFDQFADEFYAALAERKIPAEAILQTTVDRGE
FT                   ITFYVAREHLPSIAKTLRDDGGLRFELLSSVSGVDYGVDVPQRLHAVYHFTSLTYRRRI
FT                   RLEVTLDVEDAHVPSLVETYPTADWQEREAWDMFGIVFDGHPALTRILMPDDWDGHPQR
FT                   KDYPLGGIPVEYKGAEIPPPDQRRSYS"
FT   gene            523014..524396
FT                   /gene="nuoD"
FT                   /locus_tag="AMED_0523"
FT   CDS_pept        523014..524396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoD"
FT                   /locus_tag="AMED_0523"
FT                   /product="NADH dehydrogenase I subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42343"
FT                   /db_xref="GOA:A0A0H3CVN5"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVN5"
FT                   /protein_id="ADJ42343.1"
FT                   /translation="MSSTENLSDVTTGTSTTEAGSDSTDNANYADSRDTTEGRVYTVSG
FT                   GDWDDVIADAAHDERMVINMGPQHPSTHGVLRLVLEMEGETVTQLRSVIGYLHTGIEKN
FT                   CEYRTWTQGVTFVTRMDYLAPLSTEMAYCLGVEKLLQIEAPRRAQLLRVMLLEINRIGS
FT                   HLVYIATGGMELGATTAMTLGFREREEVLHLLEHLTGLRMNHAFIRPGGLAQDMPADYR
FT                   EKVTEFIKTMKKRLPLYDKLFTGQPIWRNRLKGVGYLPVDACLALGVTGPVLRSAGLPW
FT                   DLRKTEPYSCYDEFDFDVPVDNGADCWSRYLIRVHEMHESLKIIEQCLEKLEPGPVMVE
FT                   DKKVAWPAQLSIGSDGMGNSLEHVKKIMGQSMESLIHHFKLVTEGFKVPPGQVYTSVES
FT                   PRGELSAHLVSDGGTRPLRVHVREPSFVNLQSMPAMAEGGLVADVIAAIASIDPVMGGV
FT                   DR"
FT   gene            524393..525250
FT                   /gene="nuoE"
FT                   /locus_tag="AMED_0524"
FT   CDS_pept        524393..525250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoE"
FT                   /locus_tag="AMED_0524"
FT                   /product="NADH dehydrogenase I subunit E"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42344"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWP5"
FT                   /protein_id="ADJ42344.1"
FT                   /translation="MTTAVPEPGPNYSATTHAAAGPDTDVVAIAPDPDVAAGIITETPL
FT                   EDIFDADIHAKAQELIARYPMSRSALLPMLHLVQSVQGYVSQEGIAFCAKQLDLSDAEV
FT                   SAVATFYTMYKRKPCGEHLVSVCTNTLCAAMGGDAIYKRLQTHLGSEAEPLGHNETAGT
FT                   PNEPGSITLEHAECLAACDLAPVIQVNYEYFDNQTEEKAVALVDALQAGKKPAPTRGAP
FT                   LTNFKGAELQLAGFFPEDERQYRTDVDGPSQAVETLRGAKLAQDRGWVAPVAQDVPLPE
FT                   VEKK"
FT   gene            525250..526545
FT                   /gene="nuoF"
FT                   /locus_tag="AMED_0525"
FT   CDS_pept        525250..526545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoF"
FT                   /locus_tag="AMED_0525"
FT                   /product="NADH dehydrogenase I subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42345"
FT                   /db_xref="GOA:A0A0H3CWD3"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011537"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWD3"
FT                   /protein_id="ADJ42345.1"
FT                   /translation="MADPITPVLTKRWLSPNSWQIGTYEALEGYTAVRKALAGTPEQLV
FT                   QLVKDSGLRGRGGAGFPAGIKWSFMPPNFDKPHYLVINADEGEPGTCKDIPLMMADPHS
FT                   LIEGCIIASYAMRSNHCFIYVRGEALHCIRRLNAAVREAEAAGYLGENILGSGFDLKIT
FT                   VHAGAGAYICGEETALLDSLEGRRGQPRLKPPFPAAAGLYAAPTTVNNVETIASAPFIV
FT                   NGGSSWFREMGREKSPGPKIYSISGHVEKPGQYECPLGTTLRELLDMAGGMKDGIPLKF
FT                   WTPGGSSTPMFTVEHLDVPLDFEGAAEAGSMLGTTAVQVFNETVSVPWAVMKWTQFYEH
FT                   ESCGKCTPCREGTYWLAQILERMVEGHGTEEDIDTLLDVCDNILGRSFCALGDGAVSPI
FT                   TSGIKYFRDEFLALCEKNRHEQTKPELVGAQA"
FT   gene            526542..529013
FT                   /gene="nuoG"
FT                   /locus_tag="AMED_0526"
FT   CDS_pept        526542..529013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoG"
FT                   /locus_tag="AMED_0526"
FT                   /product="NADH dehydrogenase I subunit G"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42346"
FT                   /db_xref="GOA:A0A0H3CYJ0"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010228"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYJ0"
FT                   /protein_id="ADJ42346.1"
FT                   /translation="MTIAPDKPETQETPVPEGHVKLVIDGEEVIAPKGELLIRTAERLG
FT                   TVIPRFCDHPLLSPAGACRQCLVEVEMGGRPMPKPQASCTMTVADGMVVKTQLTSPVAD
FT                   KAQQGVMELLLINHPLDCPICDKGGECPLQNQALAHGRTDSRFVDTKRTFPKPLPISTQ
FT                   VLLDRERCVLCQRCTRFSSEIAGDPFIELLERGAHQQIGTAETADVLDLASRTTSGQPF
FT                   QSYFSGNVIQICPVGALTSAAYRFRSRPFDLVSAPSVCEHCSSGCAERTDFRRGKVQRK
FT                   LAGDDPEVNEEWICDKGRFAFRYTTADDRIRRPLVRNRETGELEEASWTDALRIAAAGL
FT                   TEARGNGGVGVLPGGRLTVEDAYAYSKFARVALKTNDVDFRARPHSTEELAFLTSHVVG
FT                   VTPESGVTFGEIERARTVLCVAFEPEDEAPIVFLRLRKAARRNKTRIVHLGQWTTSSVR
FT                   KTFGELLACVPGAEAAAVEGIAKHAPDLDEALRGEGAVVLVGERAAAIPGLFAALHDLV
FT                   ERTGVRLAWIPRRAGDRGALETGCVPSLLPGGRRVGDDAARVAVENAWGVPLPAVPGRD
FT                   TTDILLAASAGELGGLVVGGVDPDDLPDPDLARRALDTAGFVVSLELRHSAVTERADVV
FT                   LPVAASDEKAGSYLNWEGRTRPFDVTLEGTGALPDCRVLDTLAVEMDADLFTQTPAAAR
FT                   GDFEKLGQASALRWSHVAAEVAPPATAGAGQAILSTWRQLIDNGSLQDGEPHLKGTQRT
FT                   PVARLSAKTAEGLGTTVRVSTERGAITLPVEIADLPDGVVWLPGNSDGSAVAKTLGAGH
FT                   GAVVNLAGGGQ"
FT   gene            529010..530359
FT                   /gene="nuoH"
FT                   /locus_tag="AMED_0527"
FT   CDS_pept        529010..530359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoH"
FT                   /locus_tag="AMED_0527"
FT                   /product="NADH dehydrogenase I subunit H"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42347"
FT                   /db_xref="GOA:A0A0H3CUQ0"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUQ0"
FT                   /protein_id="ADJ42347.1"
FT                   /translation="MTPLLTEAAVGSVPDAATRAALLADDPLWLILLKCVVILLIGPIL
FT                   TIFLIVWERKAVGRMQNRPGPNRVGPGGYLQSLADAIKLPFKEQIIPDTADRKVYFLAP
FT                   VVCVVPSLIALSAIPFGPVVSIFGERTVLQLLDLPVSALVILACSSIGVYGIVLAGWSS
FT                   GSPYPLLGGMRSAAQVISYEIAMGLSIVAVILQAGSLNLADIVGAQHKAWFLYLVPSFV
FT                   IYLISMVGETNRAPFDLPEAESELVGGFHTEYSSMKFAMFFLAEYVNMVIVSAFATTLF
FT                   LGGWMAPWPLSLIGNNVLNTGWWPVLWFFAKMFVLLFGFIWLRGTLPRLRYDQFMRLGW
FT                   KVLVPLNLVWIVMVTFAKVITWNTATIIIAAAAIFIVLALFFYVRASGREEDSESIPVT
FT                   GGGFPVPPLDLKVPQTTPRQKALAKAEAKAARRKPAAVGTAKEGAQDGVS"
FT   gene            530346..530870
FT                   /gene="nuoI"
FT                   /locus_tag="AMED_0528"
FT   CDS_pept        530346..530870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoI"
FT                   /locus_tag="AMED_0528"
FT                   /product="NADH dehydrogenase I subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42348"
FT                   /db_xref="GOA:A0A0H3CVN9"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVN9"
FT                   /protein_id="ADJ42348.1"
FT                   /translation="MGFLDPVKGFGVTFGMMFKKVATEEYPEAGAPAAPRYHGRHQLNR
FT                   HPDGLEKCVGCELCAWACPADAIFVEGGDNTEEARFSPGERYGADYQINYLRCIGCGLC
FT                   IEACPTRSLTMINFYELADDDRQRLIYTKEDLLAPLLPGMEQPPHPMRLGENEQDYYVN
FT                   GPELARGEGIK"
FT   gene            530867..531742
FT                   /gene="nuoJ"
FT                   /locus_tag="AMED_0529"
FT   CDS_pept        530867..531742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoJ"
FT                   /locus_tag="AMED_0529"
FT                   /product="NADH dehydrogenase I subunit J"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42349"
FT                   /db_xref="GOA:A0A0H3CWP9"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWP9"
FT                   /protein_id="ADJ42349.1"
FT                   /translation="MITALLAAAPNASAGVSTGEAIAFWVLGPVSLLGALGMIFSRNAV
FT                   HSALWLVLTMLSLGALYMIQSAPFLGFTQIIVYTGAIMMLFLFVLMLVGRESSDSVVEV
FT                   LRGQRLAATVLGIGLAALLATGIYRALENVTPAIPLDSATPAGGGPKGLGRLIFTDYLF
FT                   PFELTSALLITAAIGAMVLAFTDRHGKGGKLSQRELVLLRFRGEHDRPSPLPGPGVFAT
FT                   ANSVATPALLPDGSIAPESLSAIIESTSAIELAKERKLVADEGPHPDAHALVGSEGASK
FT                   APEVPEGEKA"
FT   gene            531739..532038
FT                   /gene="nuoK"
FT                   /locus_tag="AMED_0530"
FT   CDS_pept        531739..532038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoK"
FT                   /locus_tag="AMED_0530"
FT                   /product="NADH dehydrogenase I subunit K"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42350"
FT                   /db_xref="GOA:A0A0H3CWD6"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWD6"
FT                   /protein_id="ADJ42350.1"
FT                   /translation="MTPTYYLLLSALLFALGAVGVLVRRNAIVVFMCIELMLNAVNLSL
FT                   VTFARINGGLDGQIMAFFVMVVAAAEVVVGLAIIMAIFRTRRSASVDDTNLLKY"
FT   gene            532050..533951
FT                   /gene="nuoL"
FT                   /locus_tag="AMED_0531"
FT   CDS_pept        532050..533951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoL"
FT                   /locus_tag="AMED_0531"
FT                   /product="NADH dehydrogenase I subunit L"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42351"
FT                   /db_xref="GOA:A0A0H3CYJ4"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYJ4"
FT                   /protein_id="ADJ42351.1"
FT                   /translation="MTASSWLLVAFPALGALILLLAGKRAKAWGHLLGCATVTLAFVYG
FT                   LILFFTADTGTTTDTKVYSWIPVGQLQVDFGLRIDALSLTFVLLITGVGMLIHYYSIGY
FT                   MADDEGRYRFFAYLNLFVASMLILVLGNSFVTLYLGWEGVGLASYLLIGWYQGRPSAAT
FT                   AAKKAFLMNRVGDVGLALAIFIMFKYAGSTGYAQVFQAVGDGKFSPGAITAMAILLLLG
FT                   ACGKSGQFPLQAWLPDAMEGPTPVSALIHAATMVTAGVYLVARSKDIFNATEDGRLIVT
FT                   LVGTVTLLLGCIIGCAYDDIKKVLAYSTVSQIGYMMLAVGLGPIAYALGIMHLVAHGFF
FT                   KAGLFLGAGSVMHGMNDEVDMRKFGGLRKHMPITFITFGLGYLALIGIPPLSGFFTKDA
FT                   IIEAAFGQGGWRGWVMGGAALLGAGLTAFYMTRLMMMTFFGKERWKDIKSSDGRDFHPH
FT                   ESTAVMWIPMAVLAVGSVGAGAFFALGDRFSEWLTPSVGKLEEAHHAPFDAWVISVAAI
FT                   VFSVLGVVIAYLIFRRDVPVEQPQRVSFVTRAARKDLYGNALNETLVARPGTWLSRALV
FT                   FVDNRGVDGAVNGLAAGLGGGSGRLRRLQTGFVRSYALSMLGGTFLLLAALLLVRFS"
FT   gene            533951..535501
FT                   /gene="nuoM"
FT                   /locus_tag="AMED_0532"
FT   CDS_pept        533951..535501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoM"
FT                   /locus_tag="AMED_0532"
FT                   /product="NADH dehydrogenase I subunit M"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42352"
FT                   /db_xref="GOA:A0A0H3CUQ3"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUQ3"
FT                   /protein_id="ADJ42352.1"
FT                   /translation="MTWLLILILVPLAGSLVLAFLKGNDRAAVLAALGFSILEFLLVIP
FT                   FWLSYTASGPRLQMTSSFDWIPSFGVHIAFGTDGISLIMIAVIALLVPIVVGGLGTLDK
FT                   LPPGRSAGGFLSLILLQEALTIGVFAATDVFLFYVLFEIMLIPMYFLIGGYGGANRQYA
FT                   AVKFFLYSFLGGLIMLASAIGAYSLAADKLGKGTFDWATLVTVVRDAPLSTQIWLFLGF
FT                   FLAFAIKAPLVPFHTWLPDAAGEAPIGVAVLLVGVLDKVGTFGFLRYCLPMFPDASRTL
FT                   APLVLVLSVIGVLYGSILAAGQRDMKRFIAYVSIAHFGFISLGIFAFNEQAMVGSATYM
FT                   LNHSLATGMLIVVIGLVIARGGSSRISDYGGMAKVTPLLAGLFLLAGLSTLSLPGTNSF
FT                   VSEFLVLIGSFVDQPVYTILATVGMVLAAAYVLWLYQRVFQGPVRGDALVGVGGGPGTA
FT                   IAPELGAKKAIRDLNGREIAILAPLVVLILVLGFYPKPVLDTVTPTVQQTLSAVQGGK"
FT   gene            535504..537072
FT                   /gene="nuoN"
FT                   /locus_tag="AMED_0533"
FT   CDS_pept        535504..537072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoN"
FT                   /locus_tag="AMED_0533"
FT                   /product="NADH dehydrogenase I subunit N"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42353"
FT                   /db_xref="GOA:A0A0H3CVP3"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVP3"
FT                   /protein_id="ADJ42353.1"
FT                   /translation="MLDILLTQAQPPIVTPSVDYNAVLPVLIIFGAACVSVLVEAFASK
FT                   RSRFGVQVGLSLLAIVAAGAWLIKYAVSDSPAGGVTTFSGAISIDRPALFLWGTLLALA
FT                   VGAVLLISDRVVEPGGALVAQAGIRPGTVQDRAQTATVMQTEVFPLTLFALGGMMAFCA
FT                   SNDLLTMFIALEVLSLPLYLMCGLARRRRLLSQEAAVKYFLLGAFSSAFFLYGLALLYG
FT                   YANSVKLGDIAAAAAGSDRSDTLLFAGLGLLVVGLLFKGSVGPFHTWTPDVYQGAPTPV
FT                   TAFMAACTKVAAFGGILRVLSVAFSSTSWEWRGVLWGVAIISMVIGAVLGLTQTDVKRM
FT                   VAYSSIAHAGFLLVGAIAMTKDGLSSTLFYLLAYGFTTLAAFGVISLVRDSSGEATHLS
FT                   AWAGLAKRSPLVAGVFTFLLLALAGIPLTSGFVGKFVVFSAALSDGMAPLVVIALVFSA
FT                   VAAFFYLRVIVLMYFSEPAADGPSVSVPGFGTGTAIFLGTAVTLVLGLVPAFALGWAGS
FT                   GGFAF"
FT   gene            complement(537118..537786)
FT                   /locus_tag="AMED_0534"
FT   CDS_pept        complement(537118..537786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0534"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42354"
FT                   /db_xref="InterPro:IPR025734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWQ5"
FT                   /protein_id="ADJ42354.1"
FT                   /translation="MIADFSLTTLLTAMRNVGCGDPHPVLAKGLRYIPPSAAKQINREA
FT                   FEELSPHGFIQGDGFTPEFEDLLHVLGDPAQECFAYARDITEQIGVLVAVKGGDKVCVV
FT                   CRGDQVELTDVRTHPADALVAHLPGCRPADIKPFSLPQEDFRQHPESDIFDDAPARSRE
FT                   AQELDALFQQPHYGVGQLHTEDKTVSYLDLDAGRVGIALADGYISVLPGDPRALSRKLK
FT                   "
FT   gene            complement(539728..540141)
FT                   /locus_tag="AMED_0535"
FT   CDS_pept        complement(539728..540141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42355"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWE0"
FT                   /protein_id="ADJ42355.1"
FT                   /translation="MAEGPVYDPSGDWQLPGPNGVRGAGSYGDGGGAGAGFEYDEETLR
FT                   ELMHEWHDLAREFQEDREQARAIATTHGPGLEYASAGNAERIRASGDALDTALQQRAEY
FT                   CRAMAEKFAKALGKYAATEETQASEIKQTGGTL"
FT   gene            complement(540313..540669)
FT                   /locus_tag="AMED_0536"
FT   CDS_pept        complement(540313..540669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0536"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42356"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYJ9"
FT                   /protein_id="ADJ42356.1"
FT                   /translation="MTATGKDFELSALVRAGGPRVKLASFTVTCERASTQTSANWTFGG
FT                   MSGIANPPNPVPVGYVSPLRKSDGTVLANAVFNIQDVPGDGSVGLTMLRIDFLPESGLT
FT                   GAVKLGATSCSPTP"
FT   gene            541163..542215
FT                   /locus_tag="AMED_0537"
FT   CDS_pept        541163..542215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0537"
FT                   /product="trans-hexaprenyltranstransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42357"
FT                   /db_xref="GOA:A0A0H3CUQ7"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUQ7"
FT                   /protein_id="ADJ42357.1"
FT                   /translation="MPSPAPGAGSLPAAPGGALDDLRASVGLQIADETLLRSIAGGLTE
FT                   VEKLLREVVRSDVQAVNDAALHLVEAGGKRFRPLFTLLAAQFGPKQDDHVIVAAAAVEL
FT                   VHLATLYHDDVMDEATMRRGAESVNARWDNTIAILTGDFLFAHASRLVADLGTDAARII
FT                   AETFGELVTGQMRETVGPGPGDDAVAHYLTVIAQKTGSLIATSGRFGGMMSGAAEEHIE
FT                   ALRRFGDIIGTAFQISDDIIDIASPSDELGKAQGTDLREGVRTLPMLYALADPETDPRL
FT                   IELLSGPIADDALVQEALELLRVSSGLDRARVTLSDYAQRARAELTALPASPARDACES
FT                   VADYLVARTR"
FT   gene            542239..543504
FT                   /locus_tag="AMED_0538"
FT   CDS_pept        542239..543504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0538"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42358"
FT                   /db_xref="GOA:A0A0H3CVP7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVP7"
FT                   /protein_id="ADJ42358.1"
FT                   /translation="MSIFGQVWLWSLAAFFVGVLLTWLVLVLPLRKSVRRLESSLAQAH
FT                   ADAARTPANATAMGGHENFRRPEPRPEPEPSRQETSYPGTLVAAPPIHRDDVHDDIDED
FT                   FAELDAQVPSRMPPEPEPVRAPEPEPEEDDPYRNAATQFLTPDDEPEPEPDRATATQYL
FT                   APVGNSFDDEFGAEFDDEAEPESPALSRLEQKLDPGPPGSLFQPPSGEATPDWFDHELP
FT                   SERSAFEEPVERTRYIGEHPGSVRAEERDADTEPPQYAFGGDVAESELDVPPETPAEAT
FT                   QVLPKRQPREAVRGGFDAPQPIQPSMRTVERREPDLSGGHSGSLFEPSVQPNQAAAGVA
FT                   APEPPPARQAAGDSVPPGPFGPGSAMPRPGGGAPSDSFAVKASVTALRYCTEESAQFPK
FT                   MVAEVWFRTAEDAERVGFRPLS"
FT   gene            complement(543497..543817)
FT                   /locus_tag="AMED_0539"
FT   CDS_pept        complement(543497..543817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0539"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42359"
FT                   /db_xref="GOA:A0A0H3CWQ9"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWQ9"
FT                   /protein_id="ADJ42359.1"
FT                   /translation="MFFDVRTADPEGSKRFFAELLGWEANDTLLTAGGAPWGGLTELPP
FT                   GDDRAPQWLPYAPVSDVDAAAAKALELGGTLVRERTDLPFGSLVVVTDPGGAALVLFQE
FT                   LS"
FT   gene            complement(543935..544999)
FT                   /gene="korB"
FT                   /locus_tag="AMED_0540"
FT   CDS_pept        complement(543935..544999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="korB"
FT                   /locus_tag="AMED_0540"
FT                   /product="2-oxoglutarate ferredoxin oxidoreductase subunit
FT                   beta"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42360"
FT                   /db_xref="GOA:A0A0H3CWE2"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWE2"
FT                   /protein_id="ADJ42360.1"
FT                   /translation="MTAIDLGIPNLGGLDLVPTTDEPQKAKDYKSDQEVRWCPGCGDYV
FT                   VLNAVQSFLPTLGLKRENIVFISGIGCSSRFPYYLNTYGMHSIHGRAPSIATGLATTRP
FT                   DLSVWVVTGDGDALSIGGNHLIHALRRNVNIKILLFNNRIYGLTKGQYSPTSGQGMVTK
FT                   STPMGSVDTPFNPLSLAIGAEASFVGRAMDSDRKGLTEVLEAAAQHRGSALVEIYQNCP
FT                   IFNDGAFDVLKDADEAAARLIPLRAGEPIRFGPNQEFGVKRGDWGGLDVAKVADIGEDD
FT                   IVVHDPSITDTSYAFALSRLGDQNLNHVPTGILRQVERPTYDDGARAQVEEARAARKPD
FT                   LQGLLRGKDTWTVA"
FT   gene            complement(544996..546921)
FT                   /gene="korA"
FT                   /locus_tag="AMED_0541"
FT   CDS_pept        complement(544996..546921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="korA"
FT                   /locus_tag="AMED_0541"
FT                   /product="2-oxoglutarate ferredoxin oxidoreductase subunit
FT                   alpha"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42361"
FT                   /db_xref="GOA:A0A0H3CYK4"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR022367"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYK4"
FT                   /protein_id="ADJ42361.1"
FT                   /translation="MSTSANGNGAGHGSLAATRPTEVSKLDRVVIRFAGDSGDGMQLTG
FT                   DRFTSEAAAFGNDLSTMPNFPAEIRAPQGTIPGVSSFQVHFADYDILTPGDRPDVLVAM
FT                   NPAALKANLADVPHGGTIILNTDDFIKRNLTKVGYASDPLEDATLEAYQVHRVAMSTLT
FT                   QGALADTGLGKKDAERCKNMFALGLLSWMYHRPTEGTERFLREKFAKKPDIAEANILAF
FT                   RAGWNYGETTESFATTFQVAPAKLTRGTYRQITGNTALAYGIVAAGQRSGLQILLGTYP
FT                   ITPASDILHELSKHKHFGIITFQAEDEIAGIGAALGASYGGALGVTSTSGPGVALKSEA
FT                   VGLGVMVELPLVVIDVQRGGPSTGLPTKTEQADLLQAMFGRNGESPVPIVAPLSPADCF
FT                   DAAVEATRIALKYRTPVLLLSDGAIANGSEPWLIPDVETLPDLRVEFATEPNADNDSGE
FT                   FWPYVRDPETLARAWAVPGTPGLQHRIGGLEKADKTGHISYDPANHDKMVRLRQAKIDG
FT                   IDVPDVVVDDPSGGKARVLALGWGSSFGPIGAACRRVRKLGLPIAQAHLRHLNPLPANL
FT                   GDILRSYDKVVVPEMNLGQLSLLLRAKYLVDIHSHTKVAGMAFKAEELQNLFSEIITGV
FT                   ATEAAK"
FT   gene            complement(547181..547945)
FT                   /gene="paaG"
FT                   /locus_tag="AMED_0542"
FT   CDS_pept        complement(547181..547945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paaG"
FT                   /locus_tag="AMED_0542"
FT                   /product="enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42362"
FT                   /db_xref="GOA:A0A0H3CUR1"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUR1"
FT                   /protein_id="ADJ42362.1"
FT                   /translation="MTDRIVSEHSGGVALLTVDAPASRNALTLDLSAQLAAAVEAAERD
FT                   ESVHAVVVTGTPPVFCAGADLSALAAADEPGLRAIYEGFLAVARCELPTIAAVGGAAVG
FT                   AGLNLALAADVRLAGPRAKFVARFLELGLHPGGGMTWMTQRLAGPQQAAAMTLFGQPLD
FT                   AEAAVRAGLALRVVDGGHDELLTAARELAHPAVAAPREALVATKRSLRATASLAEHSAA
FT                   VDVEIRPQLASLASPEFAQRLSLLQDRIRSRP"
FT   gene            complement(548233..548643)
FT                   /locus_tag="AMED_0543"
FT   CDS_pept        complement(548233..548643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0543"
FT                   /product="Lrp/AsnC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42363"
FT                   /db_xref="GOA:A0A0H3CVQ2"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVQ2"
FT                   /protein_id="ADJ42363.1"
FT                   /translation="MANARSSYAEIGKVVGLSAPAVKRRVDRLLETGILRGFTAVVDPE
FT                   ALGWGTEAFVEVTCQGNITPARIRARLEPLPEVVAAYTVSGAADAIVHLRAADIHHLET
FT                   ALERLRGLEIVDRTVSTVVLSRLLERPPTPEQ"
FT   gene            548753..549598
FT                   /locus_tag="AMED_0544"
FT   CDS_pept        548753..549598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0544"
FT                   /product="amidinotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42364"
FT                   /db_xref="GOA:A0A0H3CWR6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWR6"
FT                   /protein_id="ADJ42364.1"
FT                   /translation="MQGSLATRVPTTRRYLMCPPRFFAVDYVINPWMDPTQPVSADVAV
FT                   AQWTELRDTYRRLGHTVEEIEPQPGLPDMVFAANSGTVVDGRVLGSRFRAPQRAAEAEH
FT                   FRRWFVEHGYRDITMPEKINEAEGDFAWTGAVLLAGTGFRTDPAAHAEAQEVLGVPVVS
FT                   LQLVDPRYYHLDTALFVLAEATDSTRAQIVYYPEAFSAGSRRVLERVFPDAVLATKEDA
FT                   ECFGLNGVSDGRNVVLPVEATRLGELLSARGYEPVYVDISELRKAGGGPKCCTLEIRKG
FT                   "
FT   gene            549680..550336
FT                   /locus_tag="AMED_0545"
FT   CDS_pept        549680..550336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0545"
FT                   /product="glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42365"
FT                   /db_xref="GOA:A0A0H3CWE6"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWE6"
FT                   /protein_id="ADJ42365.1"
FT                   /translation="MGVVTVILAVHGVGRPARQLDPGEDERWLTVAQFERVLDVAADRE
FT                   DVRLTFDDGNESDVEIVLPRLADRGLTAEFFPLAGRLGQRGYLDRDGLRELARAGMEIG
FT                   SHGWEPRDWRRLDDRHADRELKDAPKLLGDLCGRPVRRYSLPFGAYDRRVLARLRQAGA
FT                   TRVYSSDGGEARRDGWLQARTELPHDLDGDWLDGVLAGSRRAAHWANRFFRRALR"
FT   gene            550657..551352
FT                   /locus_tag="AMED_0546"
FT   CDS_pept        550657..551352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0546"
FT                   /product="secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42366"
FT                   /db_xref="GOA:A0A0H3CYK9"
FT                   /db_xref="InterPro:IPR009939"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYK9"
FT                   /protein_id="ADJ42366.1"
FT                   /translation="MRKLILLATLALASAVMPSALASASPAPAAQPATAEAAPTAAQLL
FT                   AKTSGCKQISNGKYKTDEDVSSKTVAICDANGAVFWKADMDIDCDGQRTSQCNENTDCC
FT                   YQDDTAFHQSDGKPLNAAKLPYIVVPSSSSIWKYSSSGLKGGGSCAVIYNGKVEYAVIG
FT                   DTGPTQIIGEASYATAKDLGINPDPSNGGTDSGVTYICFKNSTVSPIENHSNAVSKGQS
FT                   LATTFVNNN"
FT   gene            551559..552869
FT                   /gene="algD"
FT                   /locus_tag="AMED_0547"
FT   CDS_pept        551559..552869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="algD"
FT                   /locus_tag="AMED_0547"
FT                   /product="GDP-mannose 6-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42367"
FT                   /db_xref="GOA:A0A0H3CUR5"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028358"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUR5"
FT                   /protein_id="ADJ42367.1"
FT                   /translation="MKISVFGLGYVGCVSAACLAGQGHRVVGVDVNPVKIDLITQGNAP
FT                   VVEERIGELTAEVVASGALRATTDVAEAVADSEISLVCVGTPSASNGSLSTVYLERVAE
FT                   EIGEAIANKSERHTVVFRSTMLPGTCLDLLVPILEKASGRTAGVDFGVAVNPEFLREGT
FT                   SVRDFFDPPKTVIGEIDEASGDAVAALYEGLPGPVFRVPIPVAEMTKYADNSFHGLKIG
FT                   FANELGSVCRALGLDSHQVIDVFLADTKLNISPAYLKPGFAFGGSCLPKDLRGLVYAAH
FT                   RADVSVPILSHVLASNAEHLQRAFDLVARTGKRKVGLFGLSFKPGTDDLRESPLVELAE
FT                   KLLGKGYDLKIYDANVSLSRLMGANREYIEGRLPHLGQLLAGTVEEVMDHAEVLLVGTK
FT                   DPDVLAALPHGREIVDLVRLPDAAERRLEEGYAGLAW"
FT   gene            552964..554040
FT                   /locus_tag="AMED_0548"
FT   CDS_pept        552964..554040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0548"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42368"
FT                   /db_xref="GOA:A0A0H3CVQ6"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVQ6"
FT                   /protein_id="ADJ42368.1"
FT                   /translation="MICPQGTKRDTEAEAVVDGVHIYRYPLKAATGGPAGYLQEYGSAL
FT                   WHTLRLARKVGPVDVVHACNPPDLLYLVAKYLKRQGAKFIFDQHDLCPELYLSRFDRGQ
FT                   DLLYRGVCALERATYRAADVVISTNESYQQVARIRGGKKPEDVFVVRSAPVVERFHEVP
FT                   AEPELKKGKPYLLAYLGVMGPQDGVDYALRALAKLRDEVGRTDWHAVFVGSGDAFDDMV
FT                   ALSAKLGLANQVEFTGRISDEDLVRYLSTADVCLSPDPLNPLNDVSTMNKVMEYMAMSK
FT                   PIVSFELREARVSAGDAAVYAPANDETEFAALVSRLLDDPEERIRMGKLGQARVAGPLS
FT                   WANSARNLLAAYEHAVKS"
FT   gene            554165..555508
FT                   /locus_tag="AMED_0549"
FT   CDS_pept        554165..555508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0549"
FT                   /product="exopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42369"
FT                   /db_xref="GOA:A0A0H3CWR9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWR9"
FT                   /protein_id="ADJ42369.1"
FT                   /translation="MTDDTVRLALVGQVLRRRWRLLAVLAVLGALVGAGASILFSPGYK
FT                   TTSGVLLQGPRQADELLTQAEIATASVVLDRAAAVLPWHPSGIDLKKQVSASVAQSNVV
FT                   TITVSADTAEHAQQLADQVAQQYVKYSTQLASNSADASVQLAQEQRESLRQQVKLTTDK
FT                   ISDLAKNVGGGLTVESVQVRTQLEGLKTSLEQAINDLNQADLATGVGNTVVLGPSQRPT
FT                   SPAAPTMTQFVAGGAVLFFLVGVFGHLFTARTDRRLRGEPEIASALGAPILAGVDVTTP
FT                   PGERSPATGFVGKVRHLLGGDRPWVLPPVATSADEVNRDIRYRRVLARLATGPADVLLL
FT                   VADDDETGRLAAAQLAELADRLSVPLRIFEFSPDRPTVPDATASSGVLVVLGAGTRTAW
FT                   QLVQLAEACTDGGQEIVGAVLTHAVRPGEPEKPGPAAEAPEKALAGSA"
FT   gene            555505..557460
FT                   /locus_tag="AMED_0550"
FT   CDS_pept        555505..557460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0550"
FT                   /product="exopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42370"
FT                   /db_xref="GOA:A0A0H3CWF0"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWF0"
FT                   /protein_id="ADJ42370.1"
FT                   /translation="MTTPPSQAPAAPLVDLQRLFVAIRRRKRVWLATALLGLIAGAALA
FT                   FLLPAPPTAVAKVIVVHQDDSPTDSGTLMRTDVAVLQTAQIAGAALKKLGSTDSPEDFM
FT                   KNYAGLGVTNNVLQITVKAKSNEEAVARAQALAETFIADHVKRSQAAAAAQSQAILDQR
FT                   KNAQDELSKVEQQIVAEEGKGRQASQPALENLYSRRAALTAQITDFTSRAQQAGIGSPQ
FT                   VAAGTQVVDAARALPKAFLKTTATNAGIGFALGLALGLALVAVGAVSRDRPVLRREIST
FT                   HLGASVIAQLPSKLRGPARLWRRSRAVSERKRVATTLVRLIKQEPRGVSLLELGAPKVA
FT                   AALGLDIAEELAADGAASVVDDLPGEDVRKLAQETKSDVSVVGAGDPPGTPEERRVGIG
FT                   TVSPGTAWTDLEHLGKETVLVVKSGHANTLWLHTVARQLADQEIPIIGVVLVDPDPRDK
FT                   SDGTLWDGLHTALRGRGRPAAAAQPAPAEREDHLDELVARVVERVTTTEHPTRRFTPIR
FT                   PVLPPALATPRPPASPLPPPGSVSVPDHLNAPTKKFAPVKPPKRPSPFKRDHAEPNHKG
FT                   ELNADLEPEKSTVTTGASPRAGGSATRTPEKSTVTTGALPRAGGSATQTPEKSAVTTGA
FT                   SPRAGGSATQTPEKSA"
FT   gene            557503..559413
FT                   /gene="asnB"
FT                   /locus_tag="AMED_0551"
FT   CDS_pept        557503..559413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnB"
FT                   /locus_tag="AMED_0551"
FT                   /product="asparagine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42371"
FT                   /db_xref="GOA:A0A0H3CYL4"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYL4"
FT                   /protein_id="ADJ42371.1"
FT                   /translation="MCGIAGTYLWPDGGPLTDRLTKTLAHRGPDGSGRYEHGAGPGEVH
FT                   LGHRRLSIIDLSETGAQPMVLDGLALSYNGELYNAPELRAELAGAGVRFRGTSDTEVLL
FT                   QAWRRWGTDCLPKLRGMFAFAMFEEGTGELFLVRDQLGIKPLFFVQRNGGVAFASELKA
FT                   LAGELGGSLQIDSGALIASLLYYWVPDSRCAYQGAEKLQPGTWLRCRPDGQVDRGRFWS
FT                   LREVAEEGAAFDGEVDLHAVIAESTAKHLLSDVPVATFLSGGLDSSYLTALAARSQPGI
FT                   SAYTIGFRPEDAKFEAMPDDLKYARIVAQQFGVDLHEIEIAPQVLDLLPKMTYHLDEPI
FT                   GDPAAINSFLICSAAREAGVKVMLSGMGADELFAGYRKHLANLIALRYHKVPGAVRKPV
FT                   ESLVDRLPVASAKRGYRSVRFAKRFLSFAGLPEETAFRRSYTMYDRTELLGLVNPDLAS
FT                   VVDDVLTEHADTYNDQALDDFVNRMCLADSRLFLPGLNLTYTDRSTMAASTEVRTPFVD
FT                   VEVVRAAFKIPGDKKIVGRAGKVALKNAALNILPSEIVHRPKGLFSAPLRAWMSRDLAP
FT                   LVREVVNEGVLVSSGFLQREALQRMVAEDAAGQEDRGKHLWHVLTLEYWYRNAMSGAGA
FT                   K"
FT   gene            559410..561587
FT                   /locus_tag="AMED_0552"
FT   CDS_pept        559410..561587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0552"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42372"
FT                   /db_xref="GOA:A0A0H3CUS0"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUS0"
FT                   /protein_id="ADJ42372.1"
FT                   /translation="MKQVVQNYKSGELALLEVPEPACKPGGVLVRTVYSLISTGTEMMK
FT                   VSEASLSLVGKAKARPDQVAKVMQSVATNGLSATYRKVTSKLDSYTPLGYSLCGIVEQV
FT                   GDGITDVSVGDLVACAGNEHALHSELNWVPKNLYSRVPNGVDPRHAAFGTVGSIAMQGV
FT                   RRGEPQIGDVALVIGLGLIGQLVVQLLTSSGVRVVGVDPDPERCKLAESLGALTCAHPA
FT                   SGIVDTAVAELTHGAGVDQTYLAAGGNTNDPVELAAKLSRDRGRVIDIGKCKLDLPWNA
FT                   YYEKELDVRFSRSYGPGRYDPSYELEGRDYPIGQVRWTERRNLECVLDLIARDRLDVEP
FT                   LITHVSDFSDAVTTYQSLNEGSLKAVAVLFRYPDAVARTEPVVTSARVGLVSSSAAALP
FT                   AGQPVRLGFIGAGNYASSMLLPHLVEREDVQLEHVATTSALSGANARRKFGFAAASTDI
FT                   DNVLGNSSIDAVFVVTRHSSHAELTRQALLAGKAVFVEKPLALSPEELQKVLDAIEESG
FT                   NDRLQVGFNRRFAPLLHEAREQFGPRVGPASVRYLVNAGRLDHGSWYNQTASEGSRFAG
FT                   EGGHFIDTVSWLLDADPVSVYATGDLQVTLGYPDGSTAVITYAETGSSGFPKETLDVVA
FT                   DGKVLKFDDFVRASVYSRKKWASSRLPKGRDKGQAAEVDAFLSAVRTGSPMPISIASLA
FT                   ATTLATLAAQTSVANAAPVRIELPRKAGAPA"
FT   gene            561685..563817
FT                   /locus_tag="AMED_0553"
FT   CDS_pept        561685..563817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0553"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42373"
FT                   /db_xref="GOA:A0A0H3CVR1"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="InterPro:IPR031680"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVR1"
FT                   /protein_id="ADJ42373.1"
FT                   /translation="MMGPGWYLRRLSRMGPAEVVGRARHAVVQRQWRSALPTPPDWPSH
FT                   PRFTATLPAGVLGKVSGEAVKRLLATADELMAGRAEYFGVERTDFEAPDWFLDPKTGRR
FT                   APSDEYAFDVPYRSEDTVGDIKQIWEPSRHQHLTVLAAAYALTGSSAYAVRVAEHLRSW
FT                   WAANPPLRGPHWVSGIELGIRLLSWVWTRRLLDGWAGAAELFEENPDFQLQLWHHQNWL
FT                   ETLRSHGSSANNHVIAEDAGLLAAACAFGWFPESAGWRAAAMRSLDVQLARNTFASGLN
FT                   AELASEYHGLVLELGLAAAIEADAAGTPVPDSTWEVLLRMTDALASIVDNRLRPPRQGD
FT                   ADDGFGLIVDGAATDRWASLLGSGEALFGRLDWWPPVPGDDVRTPLLASLVSRTPRASG
FT                   VRPGRRPAHLRDAGMTILRSGPLWVRCDGGPHGFLSIAAHAHADALSLEVRHDGVDVLA
FT                   DPGTFCYHGEPQWRSYFRSTLGHNTLELAGRDQSVSGGPFLWTRHAVTKVLEVHTPDNG
FT                   PARWSAAHDGYAPAIHRRTVELDGEVLKIVDDVLGGGSPGAARLAFHFGPTVTVMLDGT
FT                   TARLRWTVAPDGPDSFAEEGSSGGSSADGGRAAGSLVADPLVAGGGHEPGSAAAGGRAG
FT                   SVAADPLVGRVSGSLAGVVRTAVMELPAGLSWTVHRGAAEPPLGWYSAGFGRKEPATTL
FT                   IGSGSPGHLTTLLRFS"
FT   gene            563827..565353
FT                   /locus_tag="AMED_0554"
FT   CDS_pept        563827..565353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0554"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42374"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWS3"
FT                   /protein_id="ADJ42374.1"
FT                   /translation="MTARRFRLGRAAPLLGVLLTVAACSGGPDTDGGPAQATAAPSGSV
FT                   AAVCDKQPAGPAAAPAGAVVVDPAVPGDLAAKTRSAGSGTTFWLKAGKHILGDDKYDQV
FT                   SPKDGDVYIGAPGAVVDGRKINQYAFTGHAVDVKITYVTVQGFAAPHDEGVVNHDSGDG
FT                   WVIEHSTIQDNDGAGLMAGARQQVRGNCLRRNGQYGMNAYSGGTPITALVVEGNEIAGN
FT                   NTGDWEAKIDGCGCSGGVKFWDVDGADVRGNWVHDNHGTGLWADTNNNDFLIEGNLIEN
FT                   NDSAALIYEISYNAVIRDNTIRKNNWADGRRYADKSDNFPTSAVYISESGGEPRIKART
FT                   AKIEISRNYLENNWSGITLWENADRFCNSPANTSSGDCTRLVPSVKQCAAPAITSGALL
FT                   ADCRWKTQHVDIHDNKFVLDPAVVGCQASCGRMGLLSNFGSYPDWSPYRGDAVQESITY
FT                   KQDNRWHDNSYAGPWTFIAYSADRVIEIGEWEGAPYSQDSGSTFTAQGGG"
FT   gene            565463..566650
FT                   /locus_tag="AMED_0555"
FT   CDS_pept        565463..566650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0555"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42375"
FT                   /db_xref="GOA:A0A0H3CWF4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWF4"
FT                   /protein_id="ADJ42375.1"
FT                   /translation="MAWALLILNTLGSTGAKTVLPLPRSVSQLVTMGSLMTAFVIALAL
FT                   NKHLRIRPSAYLLLLTALLGTSILSSADLQEGLGALFRCFRLTMFVSTLWLLTRWWDGG
FT                   FAFVRYHIRTYAVVLASVAVGLVISPGKAMPEEYGGRLSGAIWPLTPPQIGQYAAVIAG
FT                   LTLLLWFGRRTTWRSALVIVVPVLGLLMLTHTRTATLGLVAGLAVAFLSMMLTSARARK
FT                   VFAWTVGVGGVAGVVLAGALQTWFLRGQSADNFSSLTGRAKVWDALLEAPRSTADYIFG
FT                   VGLTDKSYDGLPIDNSWLAIYHEQGFVGIALVAAFLLTLVVVAVLRPPSLARACAIFLI
FT                   TYCISASYTEAGLGDASPYLLHLAVAASLLVRGVPQSDEQAFIPTKGADVRGAGA"
FT   gene            566647..567816
FT                   /locus_tag="AMED_0556"
FT   CDS_pept        566647..567816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0556"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42376"
FT                   /db_xref="GOA:A0A0H3CYL6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYL6"
FT                   /protein_id="ADJ42376.1"
FT                   /translation="MKVLVVHNRYRSEQPSGENNVVDAEVTLLADGGHQVSLFERRSDD
FT                   IAAMPLPRKAAVPLMVPWNPAVRKELAARLRASRPDVVHIHNTFPLLSPSVVAACADAG
FT                   VPAVATLHNYTMVCPPGTLHRDGRICTECVGGSPLPAVKHGCYRGSSAATLPMAASMVA
FT                   NRRRWWTGVSRFFCISAAQRDLLVSAGMPGERMAVKHNFVTDPGVRRTGAGRHVLFLGR
FT                   ITEEKGVGLLMRAWERLGGALGVPLVIAGTGPMQDEVAAWAAGRPDVSYVGLQNKAECR
FT                   ALTADAVAVVAPSTWLEAFGLVVVEAMAAGVPTVAAAHGAFPELVDDGVTGLLHVPDDE
FT                   ASLADRLRAVVGDHNREMGDAARVRYEKDFTPAVGLDRLIAGYEAAIKA"
FT   gene            567813..568460
FT                   /locus_tag="AMED_0557"
FT   CDS_pept        567813..568460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0557"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42377"
FT                   /db_xref="GOA:A0A0H3CUS5"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUS5"
FT                   /protein_id="ADJ42377.1"
FT                   /translation="MRQLVRTAPPALPAVLRAPLSISAALATAVLVALGILHFHDSGLT
FT                   GFDAALLPSIDGVRPPWRYVALVFDFGGEPVGSAILIALLAGVCWLVHRVRAAVLTVLG
FT                   VVVTVAVTTVLKPLVGRTIHGEFLSYPSGHTAMATALALVIGLVLTERWALGRAAGVSL
FT                   ALGVALVAGLAMGWAEVALGAHYPTDAVGGFCAALAAVPATAWALDRVADRL"
FT   gene            568776..569390
FT                   /locus_tag="AMED_0558"
FT   CDS_pept        568776..569390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0558"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42378"
FT                   /db_xref="GOA:A0A0H3CVR6"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVR6"
FT                   /protein_id="ADJ42378.1"
FT                   /translation="MIQDLIAAERRELAALFESLPPSAWTSPSLCAGWRVAEVVAHMTM
FT                   PFRFSTGRFVRELAKSGGRFNAMADRVARREAAELSREALVASLRDNADHPWRPPGGGA
FT                   EGALSHDVIHGLDITTALQLERRVPPVRLEVIFAAMKPKQIKYFGTDLTGIALRADDLD
FT                   WSYGTGTPLTGAAQDLLLVLGNRRLPAGRLRGEPSARFTRA"
FT   gene            complement(569602..570933)
FT                   /locus_tag="AMED_0559"
FT   CDS_pept        complement(569602..570933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0559"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42379"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWS8"
FT                   /protein_id="ADJ42379.1"
FT                   /translation="MEPAVDGDLAAKTAANPAGTTFWLGPGTHTLGNDEFGQVVPKDGD
FT                   VYLGAPGSVVDGRGVNRAAFTQRARNVEIRGLTVRGFAALQDQGVVNHDSGDGWLIENT
FT                   TIEDNAGAGLMAGAGQVVRHSCLRDNGQYGLNAYQAGDGITGLVLEGNEITGNNTGDWE
FT                   AKVPGCGCSGGAKFWAVNGADIRGNWVHGNHGAGLWADTNNNDFLVEDNLFEANDAEAL
FT                   FYETSYNLVLRGNTFRGNTLVQGRAFAARGDNFPVATVYLSESGGDPRVRARTSAVDIS
FT                   GNTFEDNWAGITLWENADRFCNSPANTSTGYCTKAAAKPSCAAGTIEQAPAYDDCRWKT
FT                   QRVEVHGNTFRFDTGRVGCTSLCGRMALLSNYGTFPDWSPYKGTVIEEAITFHQANRWH
FT                   DNSYSGPWTFVAHDTSKTVDAAGWQAKPYSQDECSSFGGGPAGC"
FT   gene            complement(571177..572493)
FT                   /gene="hemL"
FT                   /locus_tag="AMED_0560"
FT   CDS_pept        complement(571177..572493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="AMED_0560"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42380"
FT                   /db_xref="GOA:A0A0H3CWF9"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWF9"
FT                   /protein_id="ADJ42380.1"
FT                   /translation="MGTNLPRSTQVDERLHRVIPGGAHTYAKGSDQYPEGMAPVISHGR
FT                   GGHVWDVDGNEYVEYGAGLRAVSLGHAHPRVIEAVRGELEKGSNFIRPSIIEAEAAERF
FT                   LENVPTADMVKFTKNGSDATTAAVRLARATTGRKLVAKCADHAFFSTDDWFIGTTPMNA
FT                   GIPDETTEQTVSFPYGDLQAAEQLLQRHDGEIACMILEAAAAAEPPPGYLQGLRELTTR
FT                   HGVVLIFDEMITGFRWSAHGAQGLYGVTPDLSTFGKALGNGFAVSALAGKRELMEIGGL
FT                   RTGRERVFLLSTTHGAETHSLAAAMAVMDVYRDEDVIGRMHALGDRLAAGVREVAAGIG
FT                   VEDHVVVRGRASNLVFGTLDEQGHPSQPYRTLFLRELISGGVLGPSFVVSAALTEADID
FT                   KTIDVVAQACTVYRKALDANDPAPWMGGRPVQPVFRKYA"
FT   gene            complement(572502..573050)
FT                   /gene="rfbC"
FT                   /locus_tag="AMED_0561"
FT   CDS_pept        complement(572502..573050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbC"
FT                   /locus_tag="AMED_0561"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42381"
FT                   /db_xref="GOA:A0A0H3CYM1"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYM1"
FT                   /protein_id="ADJ42381.1"
FT                   /translation="MKAIPVPEIDGAYLFEPTPHADQRGFFSRTFDRDVVASVGIDPDG
FT                   FVQDSLSRSRKGVVRGMHLRGGAGEAKLVRCSHGAIFDVVVDLRPDSPTFRNVKTFELS
FT                   GENQVSVYIPAGCAHGFQSLTDPSDVSYRIDRAHDPEEDITISYKDPELDISWPLSVTM
FT                   VSDRDERAPSLEEALKPTR"
FT   gene            complement(573047..574231)
FT                   /locus_tag="AMED_0562"
FT   CDS_pept        complement(573047..574231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0562"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42382"
FT                   /db_xref="InterPro:IPR007345"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUS8"
FT                   /protein_id="ADJ42382.1"
FT                   /translation="MKRAPRVGVFGLLGSGNLGNDGSLEAVLGYLRAEYPDAVLSALVG
FT                   GPELVRERYGLDATPLHWNQSEYETASGLRSVALKGFGKLVDIARTAAWVRKQDVVIVP
FT                   GMGVLEATLPLRPWGFPYSLFLLSATGRLFGTKVALVCVGANHIGARATRTLVRWSGRL
FT                   AAYRSYRDDISRDAMRAMGVDTSADQVYPDLAFSLPTPAAVAKPGTVGVGVMAYYGGND
FT                   DRAEADRIYRHYVDTMNRFVAWLVDQDRPVRLFIGDRIDRQVVDEIIEKTASPLVTAAP
FT                   AETLDELMHEMAAVDSVVATRYHNVLCALKVAKPTVAIGYAPKNDVLMAEMGLDGFTQR
FT                   AKTVGFDRLVEQFTELENRSAELRRTLQERNEMNAQRLKDQFAALSAALFGGGR"
FT   gene            complement(574228..575172)
FT                   /locus_tag="AMED_0563"
FT   CDS_pept        complement(574228..575172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0563"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42383"
FT                   /db_xref="GOA:A0A0H3CVS0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVS0"
FT                   /protein_id="ADJ42383.1"
FT                   /translation="MTTVPRLSLGLPVYNGEEYLAESLDALLGQTYEDFELIISDNAST
FT                   DGTDEICRRYAEKDSRIRYVRQPKNVGATPNHNFVFDVSRTELFKWVSHDDLYARDLLK
FT                   RCVEALDERPDVILAHCDQAIIDGDGRIVQPLQYTLDTASRHAPDRFRSILFEPGGDDF
FT                   YGVIRADVLRRVKPLDSYHHADRTYSAEMAMHGPFHQVPELLYFRRDHPGRAERANPTI
FT                   RSRCANLDPRRANRLRNPTVRLLGEYVYGFADLIRRAPISAADKRECFGHLGAWLTNRA
FT                   RSGHGERVEDRAPTASDVATVNEIVAGREGRLA"
FT   gene            complement(575180..576505)
FT                   /locus_tag="AMED_0564"
FT   CDS_pept        complement(575180..576505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0564"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42384"
FT                   /db_xref="GOA:A0A0H3CWT2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWT2"
FT                   /protein_id="ADJ42384.1"
FT                   /translation="MANHRRAPRSIFRSGAARAMAGRLSWGLGDQAVSSLTNFAVGLYV
FT                   ARSLGTFAFGIFSLAWVTYGVVLNISRGLATDPLMVRFSAVPEDRWRSGVASASGTAIG
FT                   VGCVTGVVSLLAGLAAGGPLGNAFVALAVVLPGLLLQDAWRFAFFARGAGKKAFVNDCV
FT                   WGVAMLPALYVAAQIHTVVAFVLAWGLSGAVAALYGGFQTGILPHPREMAGWLRTQRDL
FT                   SVRYLVENVSNSGASQLRAYGLGAIAGITAVGAVRGAEQLLGPFLALLMGLSLVTVAEG
FT                   ARVLQRAPHRLKHFCVILGGGQAGAALCWGLGLLLLVPDRAGRWVMGSVWDSSSPLILP
FT                   VTLAVVGASFATGAAAGLRALGAAKRSLRSQLIASLFYVTFGITGAFLGGAAGSAWGVA
FT                   TATLGGSVVWWLQLRIGLREYVPPGADEPTVVFEPIKEPIKE"
FT   gene            complement(576511..577791)
FT                   /locus_tag="AMED_0565"
FT   CDS_pept        complement(576511..577791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0565"
FT                   /product="aminopeptidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42385"
FT                   /db_xref="GOA:A0A0H3CWG3"
FT                   /db_xref="InterPro:IPR012353"
FT                   /db_xref="InterPro:IPR032589"
FT                   /db_xref="InterPro:IPR032610"
FT                   /db_xref="InterPro:IPR032622"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWG3"
FT                   /protein_id="ADJ42385.1"
FT                   /translation="MAGPQLRTGAELHALVERLYPICRSITGDGVRQTLDIIGEHISLE
FT                   RHEVPTGTQVLDWTIPQEWNIRDAYVAAPDGSRVIDFQELNLHVVGYSVPVSRRMPLSE
FT                   LREHLHTLPEQPSWVPYRTSYYAPAWGFCLAQEKLDALPDGDYDVVIDSTLSDGSLTYG
FT                   EHVVPGRVTDEVIVSCHVCHPSLANDNLAGIAVAISLAQQLALAQPHYTYRFLFMPGTI
FT                   GSITWLARNASRIEKVRHGLVLACAGDPGSLTYKKSRRDDAEIDRVMQHVLRSREHRIA
FT                   DFSPYGYDERQFCSPGFNLGVGSLTRTPYAGYPEYHTSADNPDFVSPAAMEDTLGVLKD
FT                   AFGVLDRNRRYVNLSPYGEPQLGKRGLYDSLGGRSDAKQAQMAMLWVLNLSDGEHSLLD
FT                   IAERAGLPFDIVDVAARALHDAGLVKE"
FT   gene            complement(577791..578810)
FT                   /locus_tag="AMED_0566"
FT   CDS_pept        complement(577791..578810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0566"
FT                   /product="epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42386"
FT                   /db_xref="GOA:A0A0H3CYM4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYM4"
FT                   /protein_id="ADJ42386.1"
FT                   /translation="MRVLLTGHKGYLGTVMAPVLAAAGHEVTGLDSGLFEDCLLGPAPA
FT                   DPAGHAVDLRDVEAKHVEGFDAVIHLAALSNDPLGSLAPDLTYDINHHASVKLAKLAKD
FT                   AGVQRYVYASTCSVYGAGGDNLVDEDAPLRPVTPYAESKVRVEADVHELADDDFTPVYM
FT                   RNATAFGYSPRLRGDIVLNNLTAHAHLSGEVLVLSDGTPWRPLVHAQDIARAFAAALTA
FT                   PKEAVHNKAFNIGTEENNVTVAEIAQEVVEAVPGSTLNITGEAGADPRSYRVDFSRFRA
FT                   AIPGFACDWSVKDGAVELIEAYRKFGLTRDSFQQLFTRLAWLKSEGEAGRVDTTLRRK"
FT   gene            complement(578816..579463)
FT                   /locus_tag="AMED_0567"
FT   CDS_pept        complement(578816..579463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0567"
FT                   /product="LmbE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42387"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUT1"
FT                   /protein_id="ADJ42387.1"
FT                   /translation="MIGLRPDRLDRVVALGAHCDDIAIGAGGTLLTLCTGRPGLRVDAL
FT                   VLSGGGTPREDEERAALAAFCPGADVDVTVLKLPDGRFPANWEEAKNALEDLRRRTDPD
FT                   LVLAPRTDDAHQDHRGLAKLVPTTFRDHLALGYEIVKWDGDLGSPSVYQPLSDELAEEK
FT                   VRLLQEHYASQRQRPWYDREAFLGLARIRGIEAAAKYAEAFFVKKLTLDLKG"
FT   gene            complement(579460..580251)
FT                   /gene="rfbF"
FT                   /locus_tag="AMED_0568"
FT   CDS_pept        complement(579460..580251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbF"
FT                   /locus_tag="AMED_0568"
FT                   /product="glucose-1-phosphate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42388"
FT                   /db_xref="GOA:A0A0H3CVS4"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVS4"
FT                   /protein_id="ADJ42388.1"
FT                   /translation="MKVVLFCGGYGMRMRNGAADDVPKPMAMVGPRPLIWHVMRYYAHF
FT                   GHTEFILCLGYGAAHIKNFFLNYQETISNDFVLRNGQAELLSTDIADWTITFVQTGIES
FT                   PIGERLRRVRPYLDGDEMFLANYADVLSDVPLPDMIERFSNSDSGASMMVVPPQSSFHC
FT                   VEMDEGGKVGSITAVSEMPLWENGGYFVLRPEVFDHIPENGDLVADGCGELAKRGRLLA
FT                   YPYRGFWKPTDTVKERAALDYAYSHGDRPWALWERAAASIA"
FT   gene            complement(580253..581464)
FT                   /locus_tag="AMED_0569"
FT   CDS_pept        complement(580253..581464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0569"
FT                   /product="methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42389"
FT                   /db_xref="GOA:A0A0H3CWT5"
FT                   /db_xref="InterPro:IPR013630"
FT                   /db_xref="InterPro:IPR013691"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWT5"
FT                   /protein_id="ADJ42389.1"
FT                   /translation="MPAEQLDEPEATFPLHLKVCTDCWLAQIPPLIDPDDTFTEYAYFS
FT                   SFSTSWVEHAKRFVDGAVDRLGLGEKSFVVEVASNDGYLLKHVVGHGIRCLGVEPSVNV
FT                   GQAARDAGVPTLTAFLSEETGLKVREEHGPADLVAANNVYAHIPDVLGFTKGLRALVAD
FT                   DGWVSIEVQHLLTLIEKNQYDTIYHEHFQYYTVESARRALATGGLTVVDVELLPTHGGS
FT                   IRLWARPTEAFGGFRVAEPPARGGAPVVTVAGEPSERMTDVLEREKAAGLHELSGYTEF
FT                   AERVTRVRLDLLKFLIEARNDGKTVVGYGAPGKGNTLLNHCGIRTDLLQYTVDRNPYKH
FT                   GRFTPGTRIPVLPPERIEADRPDYVLVLPWNLREELTEQLSYIGAWGGKLVFPIPHLEI
FT                   VEVQ"
FT   gene            581786..582112
FT                   /locus_tag="AMED_0570"
FT   CDS_pept        581786..582112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0570"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42390"
FT                   /db_xref="GOA:A0A0H3CWG8"
FT                   /db_xref="InterPro:IPR021214"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWG8"
FT                   /protein_id="ADJ42390.1"
FT                   /translation="MVLTVRFLTELALLGGLALAGTRLGGGVALAIVDAVLLPVAAAAL
FT                   WGLFVAPRARRRLPEPARFLLEFALFAVTGVVLALVGWLVVGIVLAVAGIGVATLTRVA
FT                   AKDG"
FT   gene            complement(582158..583033)
FT                   /gene="ssuD"
FT                   /locus_tag="AMED_0571"
FT   CDS_pept        complement(582158..583033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssuD"
FT                   /locus_tag="AMED_0571"
FT                   /product="luciferase-like monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42391"
FT                   /db_xref="GOA:A0A0H3CYM8"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019952"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYM8"
FT                   /protein_id="ADJ42391.1"
FT                   /translation="MKLGLQIPDFTWPNGASALGADLAAVVRAGDQAGFDSIAVMDHFF
FT                   QIGAVGPTENDMLEAYTTLGFIAAHTERAKLLTVVTGVLYRHPGLLAKAITTLDVLSGG
FT                   RAILGIGAGWNEEESRGLGFPFPSVAERFELLEENLQYVLQMWADGDAPFKSKHFDATR
FT                   LLNVPQALSEPRPPIMIGGGGEKKTLRLVAKYADLCNLFNGPDLERKLDVLKRHCETEG
FT                   RDYDSITKTVYHILDVGENGEKSGELLAELERLNGLGIQVALGVVPHVHKPAVLEKFAT
FT                   DVIPAASKIG"
FT   gene            complement(583074..584042)
FT                   /locus_tag="AMED_0572"
FT   CDS_pept        complement(583074..584042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0572"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42392"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUT5"
FT                   /protein_id="ADJ42392.1"
FT                   /translation="MRGGRLPRRTLFALVTAGAGALVLPGTARAEDVRSLDLGGAPGGV
FT                   AVNPVTGLGYVIDAQAGTVSVVDPRSASVVDVIQVGGAPGDVAADPKAGRIYVANPPAG
FT                   TVVVLDSRTHDLVSVIGAGAGASALAVDEEANRVYAASGTTGTLAVLDGVSCTLAALVP
FT                   GPKQGFAGIGVDPGRKLVYCASTATDSVEVFSIDSGKFVASVKVGRDPTGVAVHHASGT
FT                   VYVANSGIHHMSIVDAATRTERKTVLLRSESSALTVHQGTNTVYTNGGQNGLTRVDGTA
FT                   GTLSGELSLGVNPGAVAVDQRTRTVWVTDPLHGRVFLVRDF"
FT   gene            584177..585028
FT                   /gene="htpX"
FT                   /locus_tag="AMED_0573"
FT   CDS_pept        584177..585028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpX"
FT                   /locus_tag="AMED_0573"
FT                   /product="Zn-dependent protease with chaperone function"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42393"
FT                   /db_xref="GOA:A0A0H3CVS8"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVS8"
FT                   /protein_id="ADJ42393.1"
FT                   /translation="MHGHQNGLKTALLLGLLSAIIVAISGLFGRGALLIGLVVALGMNA
FT                   FAYFSSDKLALRAMRARPVSEVEQPAMYRIVRELAQVARQPMPQLYLSPTVAPNAFATG
FT                   RSPRHAAVCCTTGILELLDERELRAVLGHELSHVYNRDILISCVAGALASVISVLANIA
FT                   LFFGGNNRDGNPLLSLLLIFVGPIAAAIIRMGVSRSREFQADASGAELTGDPLGLASAL
FT                   RKLDAGTRARPLVAEPQLVSQSHLMIANPFRPGEGLSKLFSTHPPISDRIARLEEMARR
FT                   PF"
FT   gene            585081..586166
FT                   /locus_tag="AMED_0574"
FT   CDS_pept        585081..586166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0574"
FT                   /product="putative FMNH2-utilizing monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42394"
FT                   /db_xref="GOA:A0A0H3CWU0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWU0"
FT                   /protein_id="ADJ42394.1"
FT                   /translation="MVSAQLHLGVAIDGAGYHPAAWRISAVEPAALFTAGHYLRYAKLA
FT                   EAASLDFVTLDDSLALQPGGEGVVRGRLDALLTLSAIAPVTSRIGLVPTVTTTHTEPFH
FT                   VSTSVATLDYASRGRAGVLAVPSLTAAEAAHFARRPAPSPEDGDAETAEVLEVSTRLWD
FT                   SWEDDAIVRDAATGRFIDRDKLHYVDFEGRFFSVKGPSITPRPPQGHPVTAVYGDSPHA
FT                   RAADVVVTRADHLDAVRATAARHPGAKVLATVSIVLAETEQGARDRQRELDALMPFEPA
FT                   GLSFTGTPAQLAAELPRWAAETGVAGFHLRPAVLPDDLDLLAGEVVPALRAAGAFRSGY
FT                   AGTTLREHLGLGVAVNQYQGA"
FT   gene            586168..587478
FT                   /locus_tag="AMED_0575"
FT   CDS_pept        586168..587478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0575"
FT                   /product="nitrilotriacetate monooxygenase component A"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42395"
FT                   /db_xref="GOA:A0A0H3CWH2"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWH2"
FT                   /protein_id="ADJ42395.1"
FT                   /translation="MTKQIKLAAHFPGVNNTTVWSDPASGSQIDFASFEHLARTAERGK
FT                   FDFLFLAEGLRLREHAGKILDSDVVGRPNTTTVLAALSAVTTHLGLAGTLSSTFNEPYE
FT                   VARQVASIDHLSGGRAAWNVVTSPDAFTGQNFRRGGFLKREDRYARAEEFLATVRELWD
FT                   SWAPGTLVGDKENGVFARDPGRFVHSGPQFDIAGEFTLPRTPQGQPIVIQAGDSDEGRE
FT                   FAAKTADVIFSRHGTLEDGQAFYHDVKRRLAAYGRDHGELLIMPAATFVLGDTDAEAEE
FT                   NAREIRLQQVRPATAIQFLEQVWSRDLSDYDVDGPLPEVDPDPDAEPLTWGRVRHEKDP
FT                   LETARRWRAVAEEKKLSIRELVIEATARQQFVGTPSTVAATIDEYVQSDAADGFVLVPH
FT                   LTPGGLDEFVEKVVPHLQERGVFRTEYAGPTLREQLF"
FT   gene            complement(587475..588356)
FT                   /gene="rfbA"
FT                   /locus_tag="AMED_0576"
FT   CDS_pept        complement(587475..588356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbA"
FT                   /locus_tag="AMED_0576"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42396"
FT                   /db_xref="GOA:A0A0H3CYN1"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYN1"
FT                   /protein_id="ADJ42396.1"
FT                   /translation="MKGIVLAGGSGTRLHPITQAVSKQLLPVYDKPMVYYPISVLMLAG
FT                   IREILVISTPTDLPMFRRLLGNGDQFGVSFSYAEQASPNGLAEAFVIGADFIGDDDVAL
FT                   VLGDNIFYGQGFSSRLQQAVRELDGCVLFGYPVKDPERYGVGEVDAAGKLVTIEEKPLK
FT                   PRSNKAITGLYFYDNQVVEIARALRPSTRGELEITDVNLTYLRQDRATLVELSRGFAWL
FT                   DTGTHDSLLEAGQFVQVLEHRTGVRIACLEEIALRMGFITPYECYALGEKLAKSGYGDY
FT                   VKAVAVAAGASA"
FT   gene            complement(588390..589550)
FT                   /locus_tag="AMED_0577"
FT   CDS_pept        complement(588390..589550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0577"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42397"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUU0"
FT                   /protein_id="ADJ42397.1"
FT                   /translation="MEGVELRRSLVFVLTLAAVASLLTPARAAERKQLVPGFGAYARLI
FT                   RLEHGHGRIIATLTSEDADGKFTPVLESTDEGESFHEIGAIHDPDGRAGMCCGTVYELP
FT                   ERVGKLRAGTLLWAASYRQDAGPRRRIGIRIWASKDGGRSWSFLSEAARSHNIDGIWEP
FT                   EFTVDAGGTLWLHFADETQAPKYAQVLNRVASTDGVNWGTKQLTLAIPPDRVRPGMPII
FT                   RRLPDGRYYFAYEICNFRDRYCDPYFKISADGANWGDPADPGTRVDTATGNYFQHAQTI
FT                   ALFPGGPNGVRIVMVGQIYTDAKGVPQPQNGQVLLANDDFGSGHWYELPAPVHITGIWN
FT                   NFCPNYSSTLLPVDDGRNVLEIATEDDAGCKAYFGKGSAFEERPVG"
FT   gene            589678..590352
FT                   /locus_tag="AMED_0578"
FT   CDS_pept        589678..590352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0578"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42398"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVT2"
FT                   /protein_id="ADJ42398.1"
FT                   /translation="MKIRLGGLLPLLVLASACAPATGYGEIVAQSAPALPASPPSPTSS
FT                   APPVPRDVPTETHTGKESGEFQTSWPADQLGFLTFECPKCTSNVIVDTDGGEHGLVNAI
FT                   GAYKGTKWMNTEPDRPVKRVTVHANAPWTATISDYRSIPTAESGKDTPGKSEAVLKLPA
FT                   GVTRIRFTVKTRGNVALWVMSPKDRDLILNQIGDLQVERDVRGPAYLQVEGYETSWTLT
FT                   PS"
FT   gene            complement(590387..590878)
FT                   /locus_tag="AMED_0579"
FT   CDS_pept        complement(590387..590878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0579"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42399"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWU5"
FT                   /protein_id="ADJ42399.1"
FT                   /translation="MADPSFDVVSKVDRQEVDNALNQASKELGTRFDFRGTGTTINWAG
FT                   EEALTIESETEERALAAVEVFKEKLIKRNISLKAFEAGEPALSGKIYKISGKILQGIAS
FT                   DKAKQIAKYIRDEGPKGVQAQIQGDQLRVSGKKKDQLQEVIALLKGKDFEIALQFTNYR
FT                   "
FT   gene            591008..591090
FT                   /locus_tag="AMED_R12"
FT                   /note="tRNA-Tyr-GTA"
FT   tRNA            591008..591090
FT                   /locus_tag="AMED_R12"
FT                   /product="tRNA-Tyr"
FT   gene            591779..593524
FT                   /locus_tag="AMED_0580"
FT   CDS_pept        591779..593524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0580"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42400"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWH6"
FT                   /protein_id="ADJ42400.1"
FT                   /translation="MLIDVTELEQQVVDTARRGEVAKPAITMTVEELAVTDDPDLRVRA
FT                   DLIRELLRGLRGGLDPRGVRIEGVRVVGQLDLIQVTAVTGLNLSRCALPDGIRCEQAHL
FT                   RYLSLNRSLLAYLSADGLRVDGGLFLRGATITGAGELGALRLLSAHIGGPLELERATIT
FT                   NTAGPALNADGLRADDNLLMGGVTFSGAGARGAVRLLGAHIGGAFELDQAAITNTTGPA
FT                   LNADGLRADSELFMRAATITGAGELGALRLSGAHIGGAFELDQAAITNTTGPALNADGL
FT                   RADSELFMRAATITGAGELGALRLSGAHIGGQASLWSFRLYNSSGPLLELPEAQITGAL
FT                   LFPPEVVCPASPHGTSRRGCPYSDRTITVHGLTYSTLREISWRQWLHLLVHHTPTYWPQ
FT                   PFQQLAATERAAGHDNNAREVLITQQDELRRRTPEALGNRLAQWRHGLWGWLGRYGYRA
FT                   HRLVAALVVILTLAAGLSLLAGQVTTHPGHHAAERVPPATANPNAPGTPCSPVELIGLG
FT                   IDRGLPSAPPASAPTATSTPPPAGDKPSPPPSGYSKPSSGAWPPSPSPPTPDSSANPPD
FT                   RHRLT"
FT   gene            594014..594844
FT                   /locus_tag="AMED_0581"
FT   CDS_pept        594014..594844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0581"
FT                   /product="methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42401"
FT                   /db_xref="GOA:A0A0H3CYN5"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYN5"
FT                   /protein_id="ADJ42401.1"
FT                   /translation="MSIPVTSRPVREELVRVQYAEPALVAGYADDHAGWGPTARYHHSR
FT                   RYAIDQVLAGCPGGDLLDVGCGPGMMVRHLLDTRPGDFRITACDQSPAMIDAVAARVDA
FT                   DAGVKLAVGDIQEMPFGDREFDVVLAMGVLEYADAAQALHEVARVTRPGGLVVTTMLNP
FT                   KSPYRLFEWGVFWPARRTLGALERVVGVPPSRRHGARRTGIVALTPRRLRELLWRAGLQ
FT                   PGAVIAYDVTAWVPPVDRLVRRRDRSWRERPETTIARGAKRWLGTGYLVAAQRL"
FT   gene            complement(594913..597315)
FT                   /gene="lon"
FT                   /locus_tag="AMED_0582"
FT   CDS_pept        complement(594913..597315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lon"
FT                   /locus_tag="AMED_0582"
FT                   /product="ATP-dependent Lon protease"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42402"
FT                   /db_xref="GOA:A0A0H3CUU4"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUU4"
FT                   /protein_id="ADJ42402.1"
FT                   /translation="MSDTRLLPVLPLDDDVVLPGMVVPLDLTDTETRAAVESAQAKTPS
FT                   QASFPGIRSSAATKAEVLIVPRVHGEYAEFGTVATVERIGRVPGGKAAVLLRGTARALV
FT                   GRIADGPGAARWVHAEDAPETTNDRTAQLAAEYKAVVISILQQRGGWQLIDAVQQVEDA
FT                   SAIADLSGNAPYLSTEQKLELLSTLDVAARLEKSLEWSKEYLAELEVTDTIRKDVAEGM
FT                   EKQQKEFLLRRQLEAIRKELGELDGTAQDDDYRARVEAAELPDAVKKAALAEVDKLDRT
FT                   SEQSPEGGWIRTWLDTVLELPWNERTEDSYDIAAARAVLDADHAGLDDVKERIIEYLAV
FT                   RKRRAESGLGPVGGRRSGAVLALAGPPGVGKTSLGESVAKAMGRKFVRVALGGIRDEAE
FT                   IRGHRRTYVGALPGRIVRAIKEAGSMNPVVLLDEIDKVGADYRGDPTAALLEVLDPEQN
FT                   HTFRDHYLEVELDLSDVVFLATANALETIPGPLLDRMELVTLDGYTEHEKVTIARDHLL
FT                   PRELERAGLSTSDVVLTDAAFSRIAAEYTREAGVRDANRTIAKVLRKIATKVALDEVSL
FT                   PLTVDAPSLETYLGRPRHIPESSLPASTQRTATPGVATGLAVTGAGGDVLYIEASLADQ
FT                   ESGASGLQLTGQLGDVMKESVQIALSYLRSHGAELELPVGDLKNRGIHVHVPAGAVPKD
FT                   GPSAGVTMTTALASLLSGRVVRADVAMTGEVSLTGRVLPIGGVKQKLLAAHRAGMKTVI
FT                   IPQRNEPDLDDVPAEVLAQLDVHAVANVREVLDLALTPASTPVSQAA"
FT   gene            complement(597416..598267)
FT                   /locus_tag="AMED_0583"
FT   CDS_pept        complement(597416..598267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0583"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42403"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVT6"
FT                   /protein_id="ADJ42403.1"
FT                   /translation="MTDQRDSAPRAPEGVDTEKPSAARIYDWYLGGTQNWAVDREFGRR
FT                   MEQQWPLVRPGSKQNREFMNRAVRAALRAGIRQFIDLGSGVPTAGNVHEVVEAELPEDH
FT                   DAKVVYVDYEPVAAAHATLILEEEFATDWAGIVQADMRDAKSVLRASETQRLIDFSQPV
FT                   CLIMAAVLHFVGPDDDPDGLLAAYRDALAPGSWLAISQMSEGDGDGPYLDGLRWFVEQY
FT                   RKTSNPVWLRNREEIEPLFGDWPLLEPGIVHLPDWRPDRKINALEAEARPFAWCAVAEK
FT                   PA"
FT   gene            complement(598339..599286)
FT                   /locus_tag="AMED_0584"
FT   CDS_pept        complement(598339..599286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0584"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42404"
FT                   /db_xref="GOA:A0A0H3CWV0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWV0"
FT                   /protein_id="ADJ42404.1"
FT                   /translation="MGLMHSDVIATEHAARLAAVDSLLPGSSPFEAAENAVVLEVATGG
FT                   SAASGLASRVQVDRDAPNAPWRALTEHRLDLQLAGPQPAAVLDALLTRWDEHLRAVAEP
FT                   GDTETAAIVPRASRDAAGAREMLHHGFAPLRVVAVRPAQRLVPATPLGTPGVKIRRAEP
FT                   GDLETAVALGMELHSYDAQYGTVNWRTGVEEILAKDLAEQLKRPEPPLWIAELYGRPLG
FT                   MVSVQHPGETGWISGRVAASRVGYLSSLAVAEAARSSGVGTALATHAHHVLDEEGADVV
FT                   LLHHAAANPLSTPFWYAQGYRPLWTYWQRRPAVR"
FT   gene            599515..602160
FT                   /locus_tag="AMED_0585"
FT   CDS_pept        599515..602160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0585"
FT                   /product="signal sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42405"
FT                   /db_xref="GOA:A0A0H3CWI2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWI2"
FT                   /protein_id="ADJ42405.1"
FT                   /translation="MPDTNAHGDAVAQAQPGPGAASGTPPVSAEARTDERRFRVYTFAV
FT                   LSLGLVAAFAVGSWLPFHWDDRLLWIGPVLAVAFLLAEQLGINVDVRSGISWTISFTEI
FT                   PLVIGFFIAPFEVVLVAHLIAGIGTLLARKVAGRVLYNAGAFLLEITGAFAVAGLVKYL
FT                   VGAGTADKIPWLAALAGTLTAPLVSTLLALAAVRVLRRRMRVSTAVRLTGRILVVGFVN
FT                   ASVGLSGYLVISSTPQAWPLVLAVFLGLTALYWAYSDLLREQRDMEALSDVSLMVARSG
FT                   QQAAARPASRADELVGGVDVREWATIAERIKDQLAAGRVVLRLRLEPKDTMRIVVAGDD
FT                   LPAADPAADDPLLRLPGAHVRHFRITEANPDVRAALLDRGAQEALVVPLRSANRLLGVV
FT                   EAHDRLSRWRGFGKYDVQLLGTMASHLATSLDNRRLLATLRHDAYHDPLTGHLNRPGFR
FT                   QVAKEPLRDFANAVVLRIDLDVFSTVSDALGYAWADRMVVAAGRRIRDALGPDVPLARL
FT                   EGASFAALLVGLPPEDAHRAAERLREELSAPYPVDRLSVEANAMIGYATTSAEEPGDVV
FT                   DIEGLLQRADVAVRATKGGEEVRGYVPSMGQIFLRRFQMVTQFRQSLEDGQVSVHYQPK
FT                   ITLPNRQVQGVEALVRWVHPEFGRLGPDEFVPAIEAAGLIGVLTGFVLGEALKRCRKWL
FT                   DEGLRISVAVNLSVRNLADEDFPNKVARELEHYGIPPELLTFELTESGVMSDPQKALPI
FT                   LRELHSLGITLAVDDFGTGYSSLAYLRQLPVDQVKIDKSFVLGMGTDLGDLAVVRSIVE
FT                   LGHSLGLTVVAEGVEEDVARDQLEAMGCDVAQGYLISRPLPEDRLEAWLQARTARSPGR
FT                   HSETVLTLLT"
FT   gene            602241..602316
FT                   /locus_tag="AMED_R13"
FT                   /note="tRNA-Thr-GGT"
FT   tRNA            602241..602316
FT                   /locus_tag="AMED_R13"
FT                   /product="tRNA-Thr"
FT   gene            602442..602514
FT                   /locus_tag="AMED_R14"
FT                   /note="tRNA-Met-CAT"
FT   tRNA            602442..602514
FT                   /locus_tag="AMED_R14"
FT                   /product="tRNA-Met"
FT   gene            602565..602729
FT                   /gene="rpmG"
FT                   /locus_tag="AMED_0586"
FT   CDS_pept        602565..602729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="AMED_0586"
FT                   /product="large subunit ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42406"
FT                   /db_xref="GOA:A0A0H3CYN9"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYN9"
FT                   /protein_id="ADJ42406.1"
FT                   /translation="MAATDVRPKITLACEECKHRNYITKKNRRNNPDRLEMKKFCPNCG
FT                   THRTHKETR"
FT   gene            602869..603261
FT                   /locus_tag="AMED_0587"
FT   CDS_pept        602869..603261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0587"
FT                   /product="acyl dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42407"
FT                   /db_xref="InterPro:IPR016709"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUU8"
FT                   /protein_id="ADJ42407.1"
FT                   /translation="MSREKIREFADAIGDANPVYRDPEAAREAGHPDVIAPPTFLTIIN
FT                   LASINAIVTDPELGLDYSRMVHGDQGFTHMRPVFAGDVLEVTTHIDAIMVRAGNDFINL
FT                   RAEITDAAGQKVCTTRAQLVVRGENA"
FT   gene            603258..603698
FT                   /locus_tag="AMED_0588"
FT   CDS_pept        603258..603698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0588"
FT                   /product="MaoC-like dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42408"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVT9"
FT                   /protein_id="ADJ42408.1"
FT                   /translation="MNTADGGPGGGAPHVTVGDELPALEVRITREQLVRYAGAALDFNP
FT                   IHWNEAFAKDVGLPDVIAHGMLTMAVAGRVVTDWLGDPARLIDFSARFTRPVVVPNTPE
FT                   GALVEITGKVADVKDDGVTRIDLVVKFDGKTVLGKPQALVRR"
FT   gene            complement(603711..604616)
FT                   /locus_tag="AMED_0589"
FT   CDS_pept        complement(603711..604616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0589"
FT                   /product="GDSL family lipase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42409"
FT                   /db_xref="GOA:A0A0H3CWV4"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR037460"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWV4"
FT                   /protein_id="ADJ42409.1"
FT                   /translation="MAKKSGGGGCLAVVLVVGLLAFGYYKWQHGSSSAPPEGVDTGGGS
FT                   GRYVALGDSYTSSPRTGRQAGTPAGCDRSDDNYPHLVSAKLKPAQFADVSCSGATTDHL
FT                   SQAQKTGNGTNPPQLDAVTAETTLVTLGIGGNDIGLIAFASSCATTHQNSAPCRDRLTA
FT                   GGHDQLAERIDATAPKVGALLDRIHEKASKAKVVVVGYPTVLPDGNGCWPSLPFGAGDI
FT                   EYFRGTLGKLNKMLEDQADAHRAGYADTATPGKGHDVCSASDTRWVEGLLPASPAIPLH
FT                   PNARGEQGMADAVLAVLKLP"
FT   gene            complement(604652..605611)
FT                   /locus_tag="AMED_0590"
FT   CDS_pept        complement(604652..605611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0590"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42410"
FT                   /db_xref="GOA:A0A0H3CWI7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWI7"
FT                   /protein_id="ADJ42410.1"
FT                   /translation="MTKLIRVLLATAVLPGAALAVAGVLENAWAHRLPDPVATHWSSAP
FT                   NGHNSLAAFTGISLGLGAVAILLLATSAVTALRRGRPLPRPTVGVGAGFAALPAAVLLS
FT                   VVVANLDAPDWHAARSGVVVVPFLLGAAVIGVVAALVGALPAPPPGETPGHRPTVGLRP
FT                   GERAFWSGRAVNPAMLWALALIPVAIALLPAGLPWPTGAWIALVGLLVTALTYRLSATV
FT                   DAKGVTVRFGLLGVPWRHWALAAIREATTRELTTFGDGGLGLRFNPVTGTTAYKVRGGP
FT                   ALALTLENGRTVLVSVDDPETGAGLVNDLLAQRITRID"
FT   gene            complement(605608..605958)
FT                   /gene="ytrA"
FT                   /locus_tag="AMED_0591"
FT   CDS_pept        complement(605608..605958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ytrA"
FT                   /locus_tag="AMED_0591"
FT                   /product="GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42411"
FT                   /db_xref="GOA:A0A0H3CYP3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYP3"
FT                   /protein_id="ADJ42411.1"
FT                   /translation="MLVQIDPSSTVPLFEQVAASLRRSLADGRPAAGQQLPPARELAAA
FT                   LEINVHTVLRAYALLRDEGLIDLRRRRGAVVIGGAPSRARLAELAEDLVREAKRAGVGL
FT                   DELTGVLKEKYS"
FT   gene            complement(606020..606946)
FT                   /locus_tag="AMED_0592"
FT   CDS_pept        complement(606020..606946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0592"
FT                   /product="putative monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42412"
FT                   /db_xref="GOA:A0A0H3CUV3"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019921"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUV3"
FT                   /protein_id="ADJ42412.1"
FT                   /translation="MTTTPRPAGVPMRLGLALPQYGALAEPAAVARFATAAEDLGFTSL
FT                   WVGDRILTPLEPSDLYPGGGTPEHPYPREFDTFADPFTTLAAAAAVTRTARLGMSALTG
FT                   PVYSPVLLARALTSLDLASSGRLDVGFGLGWLREEYFATGVPWAGRGKRLEDLLDALEA
FT                   LWTGDPAEHEGPQWRIAPSTVGLRPAQDPHPPVLLGGFSPPALARVGRRADGWLAGWMP
FT                   KEYLTGLWSVALDAAGKAGRDPDTLRRVLRINPRPGTAVEAAADVLPCLDVARELGITE
FT                   VLVDLHYVAKDVDHALDLAGDLITTAN"
FT   gene            607153..607225
FT                   /locus_tag="AMED_R15"
FT                   /note="tRNA-Trp-CCA"
FT   tRNA            607153..607225
FT                   /locus_tag="AMED_R15"
FT                   /product="tRNA-Trp"
FT   gene            607252..607692
FT                   /gene="secE"
FT                   /locus_tag="AMED_0593"
FT   CDS_pept        607252..607692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="AMED_0593"
FT                   /product="preprotein translocase SecE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42413"
FT                   /db_xref="GOA:A0A0H3CVU3"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVU3"
FT                   /protein_id="ADJ42413.1"
FT                   /translation="MVVSDSDASGGEQDQDGAGQKPESPSRPVTAAARRERRATARPAG
FT                   KSAARADDKTRPAGKSGEKTAPDAKGAPTPKRDQKPKKTSVFARLMRFIREVWAELRKV
FT                   IWPNRKQMVTYTVVVLAFVVFMVGLVSVLDLAFKWGIGKIFG"
FT   gene            607766..608632
FT                   /gene="nusG"
FT                   /locus_tag="AMED_0594"
FT   CDS_pept        607766..608632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="AMED_0594"
FT                   /product="transcription antiterminator NusG"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42414"
FT                   /db_xref="GOA:A0A0H3CWV9"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWV9"
FT                   /protein_id="ADJ42414.1"
FT                   /translation="MTSDNGTAAGHDLTELSDEQVHAALGDEESAHLEPVDVSDSEVDD
FT                   AESGADAAASADEGDDVVDEAAADEASADEAEPAADDEDPVAKLRSELLAAPGEWYVVH
FT                   SYAGYENKVKTNLETRTQTLDVEDYIFQIEVPTEEVTEIKNGQRKQVQRKVLPGYILVR
FT                   MDLNDASWSAVRNTPGVTGFVGATSRPSPLTVDEVLKFLAPKVESEAPAKSGKGESTAT
FT                   AAPLGGPAVEVDFEIGESVTVMDGPFATLPATISEVNIDGQKLKVLVSIFGRETPVELS
FT                   FNQVSKI"
FT   gene            608707..609141
FT                   /gene="rplK"
FT                   /locus_tag="AMED_0595"
FT   CDS_pept        608707..609141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="AMED_0595"
FT                   /product="large subunit ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42415"
FT                   /db_xref="GOA:A0A0H3CWJ1"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWJ1"
FT                   /protein_id="ADJ42415.1"
FT                   /translation="MPPKKKKLAAIIKLQIKAGAANPAPPVGPALGQHGVNIMEFCKAY
FT                   NAATESQRGDVVPVEISVYEDRSFDFKLKTPPAAKLLLKAAGVEKGSGEPHKTKVAKVT
FT                   WDQVREIAKTKETDLNAHDIDQAAKIIAGTARSMGITVVD"
FT   gene            609334..610053
FT                   /gene="rplA"
FT                   /locus_tag="AMED_0596"
FT   CDS_pept        609334..610053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="AMED_0596"
FT                   /product="large subunit ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42416"
FT                   /db_xref="GOA:A0A0H3CYP6"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYP6"
FT                   /protein_id="ADJ42416.1"
FT                   /translation="MTKHSKAYRQAAELIDKTRFYAPLEAAKLAKETSKTKMDATVEVA
FT                   MRLGVDPRKADQMVRGTVNLPHGTGKTARVIVFAVGDKAAEAEAAGADAVGTDELIERI
FT                   QGGWLDFDAAIATPDQMAKVGRIARILGPRGLMPNPKTGTVTPAVEKAVKDIKGGKINF
FT                   RVDKQANLHLVIGKASFDTEKLVENYAAALDEILRAKPSSAKGRYLKKVTFTTTMGPGI
FT                   PVDPLRTRNLLSDEAAV"
FT   gene            610124..610897
FT                   /locus_tag="AMED_0597"
FT   CDS_pept        610124..610897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0597"
FT                   /product="alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42417"
FT                   /db_xref="GOA:A0A0H3CUV7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUV7"
FT                   /protein_id="ADJ42417.1"
FT                   /translation="MPTFASFDGLRLHYTVWEGDGARRPVLLQHGFAADTNANWISTGV
FT                   VAALRSAGFTVISLDARGHGRSEKPHDESRYTEDAMARDVSALLDELGLDEVSMVGYSM
FT                   GAIIALTVTAADKRIRSLATGGVGSGIVDFGGVDLRVVKPADIASALLAEDPASVPPSG
FT                   VPFRLLADAVGGDRRALAAVASASREGRLDLSAIGVPTLVLAGEQDQLAAQPERLAAAI
FT                   AGARLVRIPGDHMTAVMSPAFAEALVSFLAAPQPR"
FT   gene            complement(610894..611754)
FT                   /locus_tag="AMED_0598"
FT   CDS_pept        complement(610894..611754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0598"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42418"
FT                   /db_xref="GOA:A0A0H3CVU5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVU5"
FT                   /protein_id="ADJ42418.1"
FT                   /translation="MAEQRDDGKPGSDIEPAGPNTPTPGSPPQPPVDPAQLEQFRQFQQ
FT                   FQDYLRFTQAQQGNQPAPTPDAGMVQAPASQPATQQGGQPPAIPPGYQLVPTERRRAPR
FT                   WLSWLGKKVLAWALAIVILGVAGTWLYNHFFPNDSGKTSAQLAQEGGGKYQTNHILSTS
FT                   PYEAVREVYDAIAQNLVPQACGRMDEPIQQKFAQDLGYADCQVAVHELNRKVTNKNQYA
FT                   ESMPSYVSEPIPGDRFTISSCRFGIEGGPALGAFTVAKVPKGQWLIVEHTNEPTPCPLP
FT                   TPTSR"
FT   gene            612067..612621
FT                   /gene="rplJ"
FT                   /locus_tag="AMED_0599"
FT   CDS_pept        612067..612621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="AMED_0599"
FT                   /product="large subunit ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42419"
FT                   /db_xref="GOA:A0A0H3CWW2"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWW2"
FT                   /protein_id="ADJ42419.1"
FT                   /translation="MAKPDKVAAVAEIAESFRTSSATVVTQYTGLSVSQLSQLRRALGT
FT                   SAKYRVAKNTLVKRAAEDAGIQGLEDLFVGATAIAFVEGEAVDAAKAIRDFAKDNNALV
FT                   IKGGYMDGRALSVDEINRIADLDSREVLLAKAAGAFKAKLSQAAALFQAPASQVARLAA
FT                   ALEEKQRNAAGTEAAEAPAES"
FT   gene            612671..613054
FT                   /gene="rplL"
FT                   /locus_tag="AMED_0600"
FT   CDS_pept        612671..613054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="AMED_0600"
FT                   /product="large subunit ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42420"
FT                   /db_xref="GOA:A0A0H3CWJ6"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWJ6"
FT                   /protein_id="ADJ42420.1"
FT                   /translation="MAKLSTAELIDAFKELTLLELSEFVKEFEEVFDVTAAAPVAVAAG
FT                   PAAAAAAPVEEQDEFDVVLEGAGDKKIQVIKVVREVVSGLGLKEAKELVEAAPKALLEK
FT                   VDKEAAEAAKEKLEAAGAKISIK"
FT   gene            613459..614631
FT                   /locus_tag="AMED_0601"
FT   CDS_pept        613459..614631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0601"
FT                   /product="ABC transport system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42421"
FT                   /db_xref="GOA:A0A0H3CYQ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030296"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYQ3"
FT                   /protein_id="ADJ42421.1"
FT                   /translation="MGAEVVIEGLTKSFGKQAIWRDVTLTLPPGEVSAMLGPSGTGKSV
FT                   FLKSMIGLLKPDRGRCMINGVDIVTCSEHKLYEIRKLFGVLFQDGALFGSMNLYDNVAF
FT                   PLREHTKKSETEIRRIVLEKLDMTGLNGADKKLPGEISGGMRKRAGLARALVLDPEIIL
FT                   VDEPDSGLDPVRTTYISQLFLDVNAQIDATFLIVTHNINLARTVPDNLGMLFRKELVMF
FT                   GPREVLLTSEEPVVKQFLNGKMQGPIGMSEEKDSAQMAAEQAMFEAGHHAGGVEDVSGV
FT                   PPQMQPTPGVPTRMGAVRRKDRVMEIMHRLPPAAQESIIESLSPEEQRHYGVRPHRGQP
FT                   QQVGARPQGDGVPNQHHGQLPADQVARIPGGQPPRTGTHRMPPNNGPGGR"
FT   gene            614670..615422
FT                   /locus_tag="AMED_0602"
FT   CDS_pept        614670..615422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0602"
FT                   /product="ABC transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42422"
FT                   /db_xref="GOA:A0A0H3CUW2"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUW2"
FT                   /protein_id="ADJ42422.1"
FT                   /translation="MLRETGNLFALGLDIVRGLFQRPFQLREFIQQSWFIASVTILPTA
FT                   LVAIPFGAVISLQFGSLARQLGAQSYTGAGSVLATVQQASPLVTALLVAGAGGSAVCAD
FT                   IGARTIREEIAAMEVLGVSAVQRLIVPRTLAMMLVALLLNGMVSVIGVLGGYFFNVVLQ
FT                   GGTPGAYLASFSALAQLPDLWVGELKALIFGFIAAVVASYRGLNPSGGPKGVGDAVNQS
FT                   VVITFLLLFVVNFVITLIYLQIVPGKLD"
FT   gene            615427..616263
FT                   /locus_tag="AMED_0603"
FT   CDS_pept        615427..616263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0603"
FT                   /product="ABC transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42423"
FT                   /db_xref="GOA:A0A0H3CVV0"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVV0"
FT                   /protein_id="ADJ42423.1"
FT                   /translation="MTFLQGAKRVVNRPLQTLDTLGDQMSFYGRALLWTPRTLRRYTKE
FT                   VLRLLAEVSFGSGSLAVIGGTVGVMVGLTLFTGVLVGLQGYSALNSIGTSAFTGFLTAF
FT                   FNTREIAPLVAGLALSATVGAGFTAQLGAMRISEEIDALEVMGVPSLPYLVTTRIIAGF
FT                   VAVIPLYIIGLLSSYLASRLVVIYIYHQSAGTYDHYFDLFLPPQDVLYSFIKVLLFSVL
FT                   IILSHCYFGYRATGGPAGVGVAVGKAVRLSIVTVSIMNFFIGFAIWGTDVTVRIAG"
FT   gene            616260..617585
FT                   /locus_tag="AMED_0604"
FT   CDS_pept        616260..617585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0604"
FT                   /product="ABC transport system substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42424"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWW7"
FT                   /protein_id="ADJ42424.1"
FT                   /translation="MRTLRRRLLGLLLIAVMVGGVALSIALYDKAFTPVVTVRLQADKI
FT                   GNQLIKQSDVKVRGLIVGSVQDIVATDHGAELTLALQPESAKLIPENVSARFLPKTLFG
FT                   ERFVSLEIPKDPSAKTIADGDVIPQDRTSSAIELDQAFEHLMPVLQAVQPQKLSATLTA
FT                   ISTALQGRGDQLGDTLSQLGTYIGELNPHEPELQHNLKALAEFSDHLKDAAPDLVQSLD
FT                   NLSTTTRTVVDERQNLSNLYGSLTQASVDLQTFLQNNKDNIISLVDTARPTAELLAKYA
FT                   PEYPCVISQMAKNVPLIDQALGKGTNQPGLHATIEIIVPRAPYQAGKEEPRFDDKRGPR
FT                   CYDIKDIPKPFPSEPPDGAFKDGTLHQAAPKSVGEGLNPAKFKADSAGNGGSGGDLAYS
FT                   TAEQGFLADLLGPQLGMSAADVPGWSSLLVGPLYRGAEVTVK"
FT   gene            617582..618610
FT                   /locus_tag="AMED_0605"
FT   CDS_pept        617582..618610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0605"
FT                   /product="ABC transport system substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42425"
FT                   /db_xref="GOA:A0A0H3CWK0"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWK0"
FT                   /protein_id="ADJ42425.1"
FT                   /translation="MRGLLAPLIKLGIFVVVTVLFTTILGISIANINTTSTNAYNARFT
FT                   DATLLLPNDDVRIAGVRVGQVKDVHIVDKRQAEVEFEVDAGRTLPAGVTAQIKFRNLVG
FT                   QRYVSLGEGDDSAGKTLPPGGTIPLERTTPALDLTELFNGFKPLFTALNPEDVNKLSYE
FT                   VIQVLQGEGGTVESLLSHTASLATTIADKDQVIGEVIDNLNSVLDTVNAHTPQLNDLIV
FT                   KLQQLVSGLAADRKPIGDAIESLGNLAQTTSGLLGEVREPLKNDIDALGNLTSALNKNE
FT                   PELEHFIQFLPTKVSTLTRTADYGSWFNFYACEFSGSVSLPPLINDVALPLIPANRARC
FT                   QG"
FT   gene            618607..619593
FT                   /locus_tag="AMED_0606"
FT   CDS_pept        618607..619593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0606"
FT                   /product="ABC transport system substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42426"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYQ8"
FT                   /protein_id="ADJ42426.1"
FT                   /translation="MKSFQKRNPVPIALVGIVVLALAFTAALNSDDLPVIGGGTTYSAE
FT                   FSEASGLQKDNDVRIAGVKVGKVSDIALDGASVKVSFKVKDAWLGDRTSAAIKIKTLLG
FT                   QKYLSLDPQGETALNPGTGIPRDRTMAPYDVLDAFRGLSQTVDNIDTKQLAQSFDTISQ
FT                   TFANTPQDVKGALSGLSKLSDTIASRDQQLSNLLANTRQVSQTLVDRDAEVQKLLDDGN
FT                   DLLAELAKREDAITALLDGSRELATQLQGLIDDNGKQLDPVLTQLDQLTSMLQRNQDSL
FT                   AEGLKKFAPFIRVFTNTIGNGRWFDNYICGLLLPSFGPINEEGCYTK"
FT   gene            619590..620774
FT                   /locus_tag="AMED_0607"
FT   CDS_pept        619590..620774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0607"
FT                   /product="ABC transport system substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42427"
FT                   /db_xref="GOA:A0A0H3CUW6"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUW6"
FT                   /protein_id="ADJ42427.1"
FT                   /translation="MSDTRFGLALTRGFTIAIVLALVVAGGIWWTLKDAGRNHLTAYFA
FT                   GAVGLYEGNSVRMLGVDMGTVTKITPMGNQVKVDFEYDRSVAVPADAKALIVAPSLVSD
FT                   RYVQLAPAYTGGPRISDGAVIGLDRTEVPLEVDQLAASLARVSETLGPNGANKSGSLSN
FT                   LLNTAAANVDGNGKALHDTITKLGQAAGTLSGNKDDLFSTVENLGKFSQTLADSDKQVR
FT                   SFESQLAGVSGYLASEKDNLAATVQQLGTTLTAVQAFIDANHDRLKSNVDKLAGITKVL
FT                   VDQRSSLAEILDVAPVGLSNLVNTYNGAAGTLDARPNLNELTQPPLVMICRLLKQVGSK
FT                   GIPDVLGNACESIAGVVDKVIPLPSVAQTVQALQSGQLPPLPLPIAGQLYGGGQ"
FT   gene            620771..621943
FT                   /locus_tag="AMED_0608"
FT   CDS_pept        620771..621943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0608"
FT                   /product="ABC transport system substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42428"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVV4"
FT                   /protein_id="ADJ42428.1"
FT                   /translation="MKKLLTVGVLATVSALALSGCAFKGIYDLPLPGGADLGDHPYTVN
FT                   VEFRDVLDLTPQAGVKVDEVPVGRVENVGLTKDGWHALVTLRVNGDVKLPANAIANVKQ
FT                   SSLLGEKYVELASPGADQAHGKLADNATIPLARTNRSVEVEELLGALSLLLNGGGVDQL
FT                   NTITKELNNATSGREPDIKALLDNANQLVTNLDRQSKNITRAIDGLNRLSSTLNDQKDK
FT                   LVGAVDNLGPGLGVLEQQRGQLVTMLQALDNLSGVATDTVNKSQKDLVADLKALTPTLQ
FT                   KLGEAGNDLPKALEILLTFPFSDQAVNGVKGDYFNLFAKVDLNLKTVVENLGNSRQNAL
FT                   SGQLPLAGLTGGVQGTPANQPPPLPIPGTGQQQSKPGLGNLFGLLPGGAG"
FT   gene            621943..623208
FT                   /locus_tag="AMED_0609"
FT   CDS_pept        621943..623208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0609"
FT                   /product="ABC transport system substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42429"
FT                   /db_xref="GOA:A0A0H3CWX3"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWX3"
FT                   /protein_id="ADJ42429.1"
FT                   /translation="MLIRRTKIQLIAFVVISVVAIVYALIRFAGLGSVFGNDGYTVKLQ
FT                   LNESGGIFTNAEVTYRGYNIGRVGEMRLTATGLEADLNIDPSAPKVPADLDAVVANRSA
FT                   VGEQYVDLKPKADQGPYLAAGSVIPATKTTTPVSTDRLIGDLDSLAASVPVDSLRTVVD
FT                   ESYDAFRGTGGDLQKLLDTARSFTTTAQQYLPQTIQLLDAGGQVLDTQNAEAANFASFS
FT                   KSLNELTGTLKNSDGDLRKLIGITPQVASQISQVLAESGPGLGALTANLLTTANLTVTR
FT                   LDGIEQGLVTYPALAGAASSVAPGDGTAHLGLVLNLFNPPACTKGYLPYSKYRTGNDLS
FT                   AKPAKEDAYCAEPKGSPINVRGAQNAPYGGVPVAPSDSDVSANANRPAQELAEERDTRG
FT                   VPGIVGSPGVSLTSLGSLLGLT"
FT   gene            623246..623821
FT                   /locus_tag="AMED_0610"
FT   CDS_pept        623246..623821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0610"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42430"
FT                   /db_xref="GOA:A0A0H3CWK4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWK4"
FT                   /protein_id="ADJ42430.1"
FT                   /translation="MSTDEPAATSVAEESSAAPPKDASRTLVLGAAALALAALIAAAIF
FT                   GVQWWMAANDDNAGLAASREAVVKAGTNALKAYTEVDYTDLDGFFTRQKAVSDEKMSQQ
FT                   IDQSAPTFRKALADAKTKVTTDVQDVAVEELDDHEGKASFLAAIATTVTQGDKSSAKPL
FT                   RLEVSMSKVGEDWKLSGIDSVPLVAAGQ"
FT   gene            623904..624881
FT                   /locus_tag="AMED_0611"
FT   CDS_pept        623904..624881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0611"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42431"
FT                   /db_xref="GOA:A0A0H3CYR3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYR3"
FT                   /protein_id="ADJ42431.1"
FT                   /translation="MAGLRKPPTDETAAERTGQLPAVPPAKPRPRPAPRPAPRPAAKPA
FT                   EPVESTSGQLDDLAPAEDTQVFAAVGTEVEEEPRVDALTGEPSADEEEAPARPAPRRKK
FT                   RDTGIAKPTEESEVPVSAADPEPEKRAGAKVPKTYLVAGALVLVALILGGLAFWFKSEE
FT                   VKVSSATSNTALLDVAKTAQVKDAVSKAAEALFSYDFNNIKKTEDAANDLLANDDVKNK
FT                   YNSLMGEVKRLAPAQKMIVTCKVTRAAVIMLNGDLAKVMVFVDQTSTRTDTKKTTAGTA
FT                   QLHLNAQLQGDKWKITDMDTYNAPKVPAASQAPASAPASPTPSK"
FT   gene            complement(624898..626142)
FT                   /locus_tag="AMED_0612"
FT   CDS_pept        complement(624898..626142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0612"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42432"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUW9"
FT                   /protein_id="ADJ42432.1"
FT                   /translation="MCQECELDVDALPALPPVRLPSPAEAQAAAERSAALADLRRYVAE
FT                   LDGTAKPGLTLLPRWAEACGLVRVLKGTHVPVKKNAKLLTRPVELWARAFETLGDAGYG
FT                   IATEDDEVPFEFGMLFPDFLGGLQMTLYSAGGTPMPLELLYGLADQMPSLVAGLELRED
FT                   SQWRYALRATLAVLDRLGAIERTEADAVELAKIAELTGRPEPDPTLVSLTPLALWALNR
FT                   MLRDEGADAPVVGELATAPLETLCAHVADAPPEIAEAEVAAWVAHRSPADAAAEAVDFL
FT                   REAEGPAQRLFALLTLGAAGDAGVADARTVREEGGIAGAVMAAWLAERSETTAESLTSE
FT                   ELCLSMTDHLAAMDELGVLFDELAALGDPSSIVGVIAAADHPARLRLLDVIAQEHPDRK
FT                   IAKRARKARFTLRQG"
FT   gene            626181..627209
FT                   /gene="rifS"
FT                   /locus_tag="AMED_0613"
FT   CDS_pept        626181..627209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rifS"
FT                   /locus_tag="AMED_0613"
FT                   /product="NADH-dependent dihydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42433"
FT                   /db_xref="GOA:A0A0H3CVV9"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVV9"
FT                   /protein_id="ADJ42433.1"
FT                   /translation="MAPTGGVGESRYVKTLRQLEVALIGAGLIARLHLEAWLGAGAAVR
FT                   VYSDDGRSRELAAEFGAKAAGSLEEALDGADAVDICTPTASHHEIALTAIAAGVGVVCE
FT                   KPLAASAEEAEEIVTAAERAGVRLYAAHDVRFAAPYARLHELVASGRLGEGALGRFSFS
FT                   AYHPRPWTGHASARSGGILTDQLLHGADLAHWVFGDVVRVHACYQGDIATPAPEGAVAT
FT                   GTAVLTHASGAISQVVSRWTATPRPPVRVAFHVSGTGGSVSYDSEWPQEVRVVDGGAGN
FT                   FAYGGPSVFDTEMREFATAFAGGPEPRIGAKDALAAVRIIHAAAESAWTGRAVELPVRG
FT                   AA"
FT   gene            627206..627973
FT                   /gene="rifT"
FT                   /locus_tag="AMED_0614"
FT   CDS_pept        627206..627973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rifT"
FT                   /locus_tag="AMED_0614"
FT                   /product="NADH-dependent dihydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42434"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWX9"
FT                   /protein_id="ADJ42434.1"
FT                   /translation="MKVAILSSTPQAYAGALRGLPDVEVVAAASWDAFEPVRQAAEAGA
FT                   RVLCEYPPAAKETDLKAMIDAAGDRLTFASPACHGEAFAVVRKGIADGGIGELTTVLGS
FT                   VATSVDGVLGAAAPYLLDLADAVLGGEPAQQVYAQTNIVLSGRIGESAAVLTVRYRSGQ
FT                   VASFDCRRHGSATGLPAVTFIGDQGSVQYDAGPQLLGGERPELGGEDLEALMLKDFLGA
FT                   GDGPGPDGQAALRTFRIIQAAYESAHTGQPVDL"
FT   gene            628150..628377
FT                   /locus_tag="AMED_0615"
FT   CDS_pept        628150..628377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0615"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42435"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWK8"
FT                   /protein_id="ADJ42435.1"
FT                   /translation="MEAAMSVTQVKIALSGGPAELAPAHRSVDSGALENTLKIRHGAGY
FT                   EHFVHGGEFQAVDGCDIAVFRWSHRTKIAE"
FT   gene            628410..629600
FT                   /locus_tag="AMED_0616"
FT   CDS_pept        628410..629600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0616"
FT                   /product="cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42436"
FT                   /db_xref="GOA:A0A0H3CYR9"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYR9"
FT                   /protein_id="ADJ42436.1"
FT                   /translation="MTDAISFEVPWDRTDKFDPPAVFDSLREERPLAKMVYPDGHVGWI
FT                   VSSYELVREVLSDLRFSHSCEVGHFPVTHQGQVIPTHPLIPGMFIHMDPPEHTRYRKLL
FT                   TGEFTVRRASRLIPRAEAVAAEQIEVMRAKGAPADVVMDFAKPLVLRMLGELVGLPYEE
FT                   RDRYVPAVTLLHDAEADPAEAAAAYEVAGKFFDEVIERRRQRPQDDLISSLVTEDLTQE
FT                   ELRNIVTLLLFAGYETTEGALATGVFALLHHTDQLAALRAEPEKLDAAIEELLRYLTVN
FT                   QYHTYRTALEDVKLEGELIKKGDTVTVSLPAANRDPAKFGCPAELDIERDTSGHVAFGF
FT                   GIHQCLGQNLARIELRAGFTALLRAFPELRLAVPADEVPLRLKGSVFSVKKLPVSW"
FT   gene            629641..643848
FT                   /gene="rifA"
FT                   /locus_tag="AMED_0617"
FT   CDS_pept        629641..643848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rifA"
FT                   /locus_tag="AMED_0617"
FT                   /product="rifamycin polyketide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42437"
FT                   /db_xref="GOA:A0A0H3CUX4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR041618"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="InterPro:IPR042104"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUX4"
FT                   /protein_id="ADJ42437.1"
FT                   /translation="MRTDLIKPLHVALLENATRFAGKPAFADDHRTVTYGDLEARTRRL
FT                   AGHLAGLGVRHGDRVAICLGNRVSTVESYFAILRAGAVGVPLNPGSATAELEHPLTDSG
FT                   ATVVVTDAAQAARLRLAPHVELLVTGDDVPEGAHSYDELALSEPAEPAADDLELDEPAW
FT                   MFYTSGTTGRPKGVVSTQRNCLWSVASCYVPFPGLSDQDRVLWPLPLFHSLSHIACVLS
FT                   ATVVGASVRIADGSSADDVMRLIEAESSTFLAGVPTTYHHLVRAARQRGFSAPSLRIGL
FT                   AGGAVLGAGLRSEFEETFGVPLIDAYGSTETCGAITMNPPDGARVEGSCGLAVPGVDVR
FT                   VVDPDTGLDVPAGEEGEVWVSGPNVMLGYHNSPEATAAAMRDGWFRTGDLARRDDAGYF
FT                   TICGRIKELIIRGGANIHPGEVEAVLRTVDGVADAAVGGVPHDTLGEVPVAYVIPGPTG
FT                   FDPAALIEKCREQLSAYKVPDRILEVAHIPRTASGKIRRGLLTDEPAQLRYAATEHEEQ
FT                   SRHADESVAAALRARLSGLDERAQCELLEDLVRTQAADVLGQPVPDGRAFRDLGFTSLA
FT                   IVELRNRLTEHTGLWLPASAVFDHPTPAALAARVRAELLGITQAVAEPVVAADPGEPIA
FT                   IVGMACRLPGGVASPEDLWRLVAERVDAVSEFPGDRGWDLDSLIDPDRERAGTSYVGQG
FT                   GFLHDAGEFDAGFFGISPREAVAMDPQQRLLLETSWEALENAGVDPIALKGTDTGVFSG
FT                   LMGQGYGSGAVAPELEGFVTTGVASSVASGRVSYVLGLEGPAVTVDTACSSSLVAMHLA
FT                   AQALRQGECSMALAGGVTVMATPGSFVEFSRQRALAPDGRCKAFAAAADGTGWSEGVGV
FT                   VVLERLSVARERGHRILAVLRGSAVNQDGASNGLTAPNGLSQQRVIRRALAAAGLAPSD
FT                   VDVVEAHGTGTTLGDPIEAQALLATYGQERKQPLWLGSLKSNIGHAQAAAGVAGVIKMV
FT                   QALRHETLPPTLHVDKPTLEVDWSAGAIELLTEARAWPRNGRPRRAGVSSFGVSGTNAH
FT                   LILEEAPAEEPVAAPELPVVPLVVSARSTESLSGQAERLASLLEGDVSLTEVAGALVSR
FT                   RAVLDERAVVVAGSREEAVTGLRALNTAGSGTPGKVVWVFPGQGTQWAGMGRELLAESP
FT                   VFAERIAECAAALAPWIDWSLVDVLRGEGDLGRVDVLQPACFAVMVGLAAVWESVGVRP
FT                   DAVVGHSQGEIAAACVSGALSLEDAAKVVALRSQAIAAELSGRGGMASVALGEDDVVSR
FT                   LVDGVEVAAVNGPSSVVIAGDAHALDATLEILSGEGIRVRRVAVDYASHTRHVEDIRDT
FT                   LAETLAGISAQAPAVPFYSTVTSEWVRDAGVLDGGYWYRNLRNQVRFGAAATALLEQGH
FT                   TVFVEVSAHPVTVQPLSELTGDAIGTLRREDGGLRRLLASMGELFVRGIDVDWTAMVPA
FT                   AGWVDLPTYAFEHRHYWLEPAEPASAGDPLLGTVVSTPGSDRLTAVAQWSRRAQPWAVD
FT                   GLVPNAALVEAAIRLGDLAGTPVVGELVVDAPVVLPRRGSREVQLIVGEPGEQRRRPIE
FT                   VFSREADEPWTRHAHGTLAPAAAAVPEPAAAGDATDVTVAGLRDADRYGIHPALLDAAV
FT                   RTVVGDDLLPSVWTGVSLLASGATAVTVTPTATGLRLTDPAGQPVLTVESVRGTPFVAE
FT                   QGTTDALFRVDWPEIPLPTAETADFLPYEATSAEATLSALQAWLADPAETRLAVVTGDC
FT                   TEPGAAAIWGLVRSAQSEHPGRIVLADLDDPAVLPAVVASGEPQVRVRNGVASVPRLTR
FT                   VTPRQDARPLDPEGTVLITGGTGTLGALTARHLVTAHGVRHLVLVSRRGEAPELQEELT
FT                   ALGASVAIAACDVADRAQLEAVLRAIPAEHPLTAVIHTAGVLDDGVVTELTPDRLATVR
FT                   RPKVDAARLLDELTREADLAAFVLFSSAAGVLGNPGQAGYAAANAELDALARQRNSLDL
FT                   PAVSIAWGYWATVSGMTEHLGDADLRRNQRIGMSGLPADEGMALLDAAIATGGTLVAAK
FT                   FDVAALRATAKAGGPVPPLLRGLAPLPRRAAAKTASLTERLAGLAETEQAAALLDLVRR
FT                   HAAEVLGHSGAESVHSGRTFKDAGFDSLTAVELRNRLAAATGLTLSPAMIFDYPKPPAL
FT                   ADHLRAKLFGSAANRPAEIGTAAAEEPIAIVAMACRFPGGVHSPEDLWRLVADGADAVT
FT                   EFPADRGWDTDRLYHEDPDHEGTTYVRHGAFLDDAAGFDAAFFGISPNEALAMDPQQRL
FT                   LLETSWELFERAAIDPTTLAGQDIGVFAGVNSHDYSMRMHRAAGVEGFRLTGGSASVLS
FT                   GRVAYHFGVEGPAVTVDTACSSSLVALHMAVQALQRGECSMALAGGVMVMGTVETFVEF
FT                   SRQRGLAPDGRCKAFADGADGTGWSEGVGLLLVERLSEAQRRGHQVLAVVRGSAVNSDG
FT                   ASNGLTAPNGPSQQRVIRKALAAAGLSTSDVDAVEAHGTGTTLGDPIEAEALLATYGQN
FT                   RETPLWLGSVKSNLGHTQAAAGVAGVIKMVMAMRHGVLPRTLHVDRPSSYVDWSAGAVE
FT                   LLTEARDWVSNGHPRRAGVSSFGIGGTNAHVVLEEVAAPITTPQPEPAEFLVPVLVSAR
FT                   TAAGLRGQAGRLAAFLGDRTDVRVPDAAYALATTRAQLDHRAVVLASDRAQLCADLAAF
FT                   GSGVVTGTPVDGKLAVLFTGQGSQWAGMGRELAETFPVFRDAFEAACEAVDTHLRERPL
FT                   REVVFDDSALLDQTMYTQGALFAVETALFRLFESWGVRPGLLAGHSIGELAAAHVSGVL
FT                   DLADAGELVAARGRLMQALPAGGAMVAVQATEDEVAPLLDGTVCVAAVNGPDSVVLSGT
FT                   EAAVLAVADELAGRGRKTRRLAVSHAFHSPLMEPMLDDFRAVAERLTYRAGSLPVVSTL
FT                   TGELAALDSPDYWVGQVRNAVRFSDAVTALGAQGASTFLELGPGGALAAMALGTLGGPE
FT                   QSCVATLRKNGAEVPDVLTALAELHVRGVGVDWTTVLDEPATAVGTVLPTYAFQHQRFW
FT                   VDVDETAAVSVTPPPAEPIVDRPVQDVLELVRESAAVVLGHRDAGSFDLDRSFKDHGFD
FT                   SLSAVKLRNRLRDFTGVELPSTLIFDYPNPAVLADHLRAELLGERPAAPAPVTRDVSDE
FT                   PIAIVGMSTRLPGGADSPEELWKLVAEGRDAVSGFPVDRGWDLDGLYHPDPAHAGTSYT
FT                   RSGGFLHDAAQFDAGLFGISPREALAMDPQQRLLLETSWEALERAGVDPLSARGSDVGV
FT                   FTGIVHHDYVTRLREVPEDVQGYTMTGTASSVASGRVAYVFGFEGPAVTVDTACSSSLV
FT                   AMHLAAQALRQGECSMALAGGATVMASPDAFLEFSRQRGLSADGRCKAYAEGADGTGWA
FT                   EGVGVVVLERLSVARERGHRVLAVLRGSAVNQDGASNGLTAPNGPSQQRVIRGALASAG
FT                   LAPSDVDVVEGHGTGTALGDPIEVQALLATYGQEREQPLWLGSLKSNLGHTQAAAGVVG
FT                   VIKMIMAMRHGVMPATLHVDERTSQVDWSAGAIEVLTEAREWPRTGRPRRAGVSSFGAS
FT                   GTNAHLIIEEGPAEEAVDEEVASVVPLVVSARSAGSLAGQAGRLAAVLENESLAGVAGA
FT                   LVSGRATLNERAVVIAGSRDEAQDGLQALARGENAPGVVTGTAGKPGKVVWVFPGQGSQ
FT                   WMGMGRDLLDSSPVFAARIKECAAALEQWTDWSLLDVLRGDADLLDRVDVVQPASFAMM
FT                   VGLAAVWTSLGVTPDAVLGHSQGEIAAACVSGALSLDDAAKVVALRSQAIAGELAGRGG
FT                   MASVALSEEDAVARLTPWANRVEVAAVNSPSSVVIAGDAQALDEALEALAGDGVRVRRV
FT                   AVDYASHTRHVEAIAETLAKTLAGIDARVPAIPFYSTVLGTWIEQAVVDAGYWYRNLRQ
FT                   QVRFGPSVADLAGLGHTVFVEISAHPVLVQPLSEISDDAVVTGSLRRDDGGLRRLLASA
FT                   AELYVRGVAVDWTAAVPAAGWVDLPTYAFDRRHFWLHEAETAEAAEGMDGEFWTAIEQS
FT                   DVDSLAELLELVPEQRGALSTVVPVLAQWRDRRRERSTAEKLRYQVTWQPLEREAAGVP
FT                   GGRWLAVVPAGTTDALLKELTGQGLDIVRLEIEEASRAQLAEQLRNVLAEHDLTGVLSL
FT                   LALDGGPADAAEITASTLALVQALGDTTTSAPLWCLTSGAVNIGIQDAVTAPAQAAVWG
FT                   LGRAVALERLDRWGGLVDLPAAIDARTAQALLGVLNGAAGEDQLAVRRSGVYRRRLVRK
FT                   PVPESATSRWEPRGTVLVTGGAEGLGRHASVWLAQSGAERLIVTGTDGVDELTAELAEF
FT                   GTTVEFCADTDRDAIAQLVADSEVTAVVHAADIAQTSSVDDTGVADLDEVFAAKVTTAV
FT                   WLDQLFEDTPLDAFVVFSSIAGIWGGGGQGPAGAANAVLDALVEWRRARGLKATSIAWG
FT                   ALDQIGIGMDEAALAQLRRRGVIPMAPPLAVTAMVQAVAGNEKAVAVADMDWAAFIPAF
FT                   TSVRPSPLFADLPEAKAILRAAQDDGEDGDTASSLADSLRAVPDAEQNRILLKLVRGHA
FT                   STVLGHSGAEGIGPRQAFQEVGFDSLAAVNLRNSLHAATGLRLPATLIFDYPTPEALVG
FT                   YLRVELLREADDGLDGREDDLRRVLAAVPFARFKEAGVLDTLLGLADTGTEPGTDAETT
FT                   EAAPAADDAELIDALDISGLVQRALGQTS"
FT   gene            643882..659064
FT                   /gene="rifB"
FT                   /locus_tag="AMED_0618"
FT   CDS_pept        643882..659064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rifB"
FT                   /locus_tag="AMED_0618"
FT                   /product="rifamycin polyketide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42438"
FT                   /db_xref="GOA:A0A0H3CVW3"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR041314"
FT                   /db_xref="InterPro:IPR042104"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVW3"
FT                   /protein_id="ADJ42438.1"
FT                   /translation="MSAPNEQIVDALRASLKENVRLQQENSALAAAAAEPVAIVSMACR
FT                   YAGGIRGPEDFWRVVSEGADVYTGFPEDRGWDVEGLYHPDPDNPGTTYVREGAFLQDAA
FT                   QFDAGFFGISPREALAMDPQQRQLLEVSWETLERAGIDPHSVRGSDIGVYAGVVHQDYA
FT                   PDLSGFEGFMSLERALGTAGGVASGRVAYTLGLEGPAVTVDTMCSSSLVAIHLAAQALR
FT                   RGECSMALAGGSTVMATPGGFVGFARQRALAFDGRCKSYAAAADGSGWAEGVGVLLLER
FT                   LSVARERGHQVLAVIRGSAVNQDGASNGLTAPNGPAQQRVIRKALASAGLTPSDVDTVE
FT                   GHGTGTVLGDPIEVQALLATYGQGRDPQQPLWLGSVKSVVGHTQAASGVAGVIKMVQSL
FT                   RHGQLPATQHVDAPTPQVDWSAGAIELLAEGREWPRNGHPRRGGISSFGASGTNAHMIL
FT                   EEAPEDEPVTEAPAPTGVVPLVVSAATAASLAAQAGRLAEVGDVSLADVAGTLVSGRAM
FT                   LSERAVVVAGSHEEAVTGLRALARGESAPGLLSGRGSGVPGKVVWVFPGQGTQWAGMGR
FT                   ELLDSSEVFAARIAECETALGRWVDWSLTDVLRGEADLLDRVDVVQPASFAVMVGLAAV
FT                   WASLGVEPEAVVGHSQGEIAAACVSGALSLEDAAKVVALRSQAIAASLAGRGGMASVAL
FT                   SEEDATARLEPWAGRVEVAAVNGPTSVVIAGDAEALDEALDALDDQGVRIRRVAVDYAS
FT                   HTRHVEAARDALAEMLGGIRAQAPEVPFYSTVTGGWVEDAGVLDGGYWYRNLRRQVRFG
FT                   PAVAELIEQGHRVFVEVSAHPVLVQPINELVDDTEAVVTGTLRREDGGLRRLLASAAEL
FT                   FVRGVTVDWSGVLPPSRRVELPTYAFDHQHYWLQMGGSATDAVSLGLAGADHPLLGAVV
FT                   PLPQSDGLVFTSRLSLKSHPWLAGHAIGGVVLIPGTVYVDLALRAGDELGFGVLEELVI
FT                   EAPLVLGERGGVRVQVAVSGPNETGSRAVDVFSMREDGDEWTRHATGLLGASTSREPSR
FT                   FDFAAWPPAGAEPIDVENFYTDLTERGYAYSGAFQGMRAVWRRGDEVFAEVALPDDHRE
FT                   DAGKFGLHPALLDAALHTNAFANPDDDRSVLPFAWNGLVLHAVGASALRVRVAPGGPDA
FT                   LTFQAADETGGLVVTMDSLVSREVSAAQLETAAGEERDSLFQVDWIEVPATETAATEHA
FT                   EVLEAFGEAAPLELTSRVLEAVQSWLADAADEARLVVVTRGAVREVTDPAGAAVWGLVR
FT                   AAQAENPGRIILVDTDGDVPLGAVLASGEPQLAVRGNAFSVPRLARATGEVPEAPAVFS
FT                   PEGTVLLTGGTGSLGGLVAKHLVARHGVRRLVLASRRGVAAEDLVTELTEQGATVSVVA
FT                   CDVSDRDQVAALLAEHRPTGIVHLAGLLDDGVIGALNRERLAGVFAPKVDAVQHLDELT
FT                   RDLGLDAFVVFSSAAALMGSAGQGNYAAANAFLDGLMAGRRAAGLPGVSLAWGLWEQAD
FT                   GLTANLSATDQARMSRGGVLPMTPAEALDIFDIGLAAEQALLVPIKLDLRTLRGQATAG
FT                   GEVPHLLRGLVRASRRVTRTAAASGGGGLVHKLAGRPAEEQEAVLLGIVQAEAAAVLGF
FT                   NAPELAQGTRGFSDLGFDSLTAVELRNRLSAATGVKLPATLVFDYPTPVALARHLREEL
FT                   GETVAGAPATPVTTVADAGEPIAIVGMACRLPGGVMSPDDLWRMVAEGRDGMSPFPGDR
FT                   GWDLDGLFDSDPERPGTAYIRQGGFLHEAALFDPGFFGISPREALAMDPQQRLLLEASW
FT                   EALERAGIDPTKARGDAVGVFSGVSIHDYLESLSNMPAELEGFVTTATAGSVASGRVSY
FT                   TFGFEGPAVTVDTACSSSLVAIHLAAQALRQGECTMALAGGVAVMGSPIGVIGMSRQRG
FT                   MAEDGRVKAFADGADGTVLSEGVGIVVLERLSVARERGHRVLAVLRGSAVNQDGASNGL
FT                   TAPNGPSQQRVIRSALAGAGLQPSEVDVVEAHGTGTALGDPIEAQALLATYGKSRETPL
FT                   WLGSLKSNIGHTQAAAGVAAVIKMVQALRHDTLPPTLHVQEPTKQVDWSAGAVELLTEG
FT                   REWARNGHPRRAGVSSFGISGTNAHLILEEAPADDTAEADVPDAVVPVVISARSTGSLA
FT                   GQAGRLAAFLDGDVPLTRVAGALLSTRATLTDRAVVVAGSAEEARAGLTALARGESASG
FT                   LVTGTAGMPGKTVWVFPGQGTQWAGMGRELLEASPVFAERIEECAAALQPWIDWSLLDV
FT                   LRGEGELDRVDVLQPACFAVMVGLAAVWASVGVVPDAVLGHSQGEIAAACVSGALSLED
FT                   AAKVVALRSQAIAAELSGRGGMASIQLSHDEVAARLAPWAGRVEIAAVNGPASVVIAGD
FT                   AEALTEAVEVLGGRRVAVDYASHTRHVEDIQDTLAETLAGIDAQAPVVPFYSTVAGEWI
FT                   TDAGVVDGGYWYRNLRNQVGFGPAVAELIEQGHGVFVEVSAHPVLVQPISELTDAVVTG
FT                   TLRRDDGGVRRLLTSMAELFVRGVPVDWATMAPPARVELPTYAFDHQHFWLSPPAVADA
FT                   PALGLAGADHPLLGAVLPLPQSDGLVFTSRLSVRTHPWLADGVPAAALVELAVRAGDEA
FT                   GCPVLADLTVEKLLVLPESGGLRVQVIVSGERTVEVYSQLEGAEDWIRNATGHLSATAP
FT                   AHEAFDFTAWPPAGAQQVDGLWRRGDEIFAEVALPEELDAGAFGIHPFLLDAAVQPVLA
FT                   DDEQPAEWRSLVLHAAGASALRVRLVPGGALQAADETGGLVLTADSVAGRELSAGKTRA
FT                   GSLYRVDWTEVSIADSAVPANIEVVEAFGEEPLELTGRVLEAVQTWLVTAADDARLVVV
FT                   TRGAVREVTDPAGAAVWGLVRAAQAENPGRIFLIDTDGEIPALTGDEPEIAVRGGKFFV
FT                   PRITRAEPSGAAVFRPDGTVLISGAGALGGLVARRLVERHGVRKLVLASRRGRDADGVA
FT                   DLVADLAADVSVVACDVSDRAQVAALLDEHRPTAVVHTAGVIDAGVIETLDRDRLATVF
FT                   APKVDAVRHLDELTRDRDLDAFVVYSSVSAVFMGAGSGSYAAANAFLDGLMANRRAAGL
FT                   PGLSLAWGLWDQSTGMAAGTDEATRARMSRRGGLQIMTQAEGMDLFDAALSSAESLLVP
FT                   AKLDLRGVRADAAAGGVVPHMLRGLVRAGRAQARAASTVDNGLAGRLAGLAPADQLTLL
FT                   LDLVRAQVAAVLGHADASAVRVDTAFKDAGFDSLTAVELRNRMRTATGLKLPATLVFDY
FT                   PNPQALARHLRDELGGAAQTPVTTAAAKADLDEPIAIVGMACRLPGGVAGPEDLWRLVA
FT                   EGRDAVSSFPTDRGWDTDSLYDPDPARPGKTYTRHGGFLHEAGLFDAGFFGISPREAVA
FT                   MDPQQRLLLEASWEAMEDAGVDPLSLKGNDVGVFTGMFGQGYVAPGDSVVTPELEGFAG
FT                   TGGSSSVASGRVSYVFGFEGPAVTIDSACSSSLVAMHLAAQSLRQGECSMALAGGATVM
FT                   ANPGAFVEFSRQRGLAVDGRCKAFAAAADGTGWAEGVGVVILERLSVARERGHRILAVL
FT                   RGSAVNQDGASNGLTAPNGPSQQRVIRRALVSAGLAPSDVDVVEAHGTGTTLGDPIEAQ
FT                   ALLATYGKDRESPLWLGSLKSNIGHAQAAAGVAGVIKMVQALRHEVLPPTLHVDRPTPE
FT                   VDWSAGAVELLTEAREWPRNGRPRRAGVSAFGVSGTNAHLILEEAPAEEPVPTPEVPLV
FT                   PVVVSARSRASLAGQAGRLAGFVAGDASLAGVARALVTNRAALTERAVMVVGSREEAVT
FT                   NLEALARGEDPAAVVTGRAGSPGKLVWVFPGQGSQWIGMGRELLDSSPVFAERVAECAA
FT                   ALEPWIDWSLLDVLRGESDLLDRVDVVQPASFAMMVGLAAVWQSVGVRPDAVVGHSQGE
FT                   IAAACVSGALSLQDAAKVVALRSQAIATRLAGRGGMASVALSEEDATAWLAPWADRVQV
FT                   AAVNSPASVVIAGEAQALDEVVDALSGQEVRVRRVAVDYGSHTNQVEAIEDLLAETLAG
FT                   IEAQAPKVPFYSTLIGDWIRDAGIVDGGYWYRNLRNQVGFGPAVAELVRQGHGVFVEVS
FT                   AHPVLVQPLSELSDDAVVTGSLRREDGGLRRLLTSMAELYVQGVPLDWTAVLPRTGRVD
FT                   LPKYAFDHRHYWLRPAESATDAASLGQAAADHPLLGAVVELPQSDGLVFTSRLSVRTHP
FT                   WLADHAVGGVVILPGSGLAELAVRAGDEAGCTALDELIIEAPLVVPAQGAVRVQVALSG
FT                   PDETGSRTVDLYSQRDGGAGTWTRHATGVLSTAPAQEPEFDFHAWPPADAERIDVETFY
FT                   TDLAERGYGYGPAFQGLQAVWRRDGDVFAEVALPEDLRKDAGRFGVHPALLDAALQAAT
FT                   AVGGDEPGQPVLAFAWNGLVLHAAGASALRVRLAPSGPDTLSVAAADETGGLVLTMESL
FT                   VSRPVSAEQLGAAADAGHDAMFRVDWTELPAVPRAELPPWVRIDTADDVAALAEKADAP
FT                   PVVVWEAAGGDPALAVSSRVLEIMQAWLAAPAFEEARLVVTTRGAVPAGGDHTLTDPAA
FT                   AAVWGLVRSAQAEHPDRVVLLDTDGEVPLGAVLASGEPQLAVRGTTFFVPRLARATRLS
FT                   DAPPAFDPDGTVLVSGAGSLGTLVARHLVTRHGVRRVVLASRQGRDAEGAQDLITELTG
FT                   EGADVSFVACDVSDRDQVAALLAGLPDLTGVVHTAGVFEDGVIEALTPDQLANVYAAKV
FT                   TAAMHLDELTRDRDLGAFVVFSSVAGVMGGGGQGPYAAANAFLDAAMASRQAAGLPGLS
FT                   LAWGLWERSSGMAAHLSEVDHARASRNGVLELTRAEGLALFDLGLRMAESLLVPIKLDL
FT                   AAMRASTVPVLFRGLVRPSRTQARTASTVDRGLAGRLAGLPVAERAAVLVDLVRGQVAV
FT                   VLGYDGPEAVRPDTAFKDTGFDSLTSVELRNRLREATGLKLPATLVFDYPNPLAVARYL
FT                   GARLVPDGTANGNGNGNGHSEDDRLRHALAAIAAEDAGEERSIADLGVDDLVQLAFGDE
FT                   "
FT   gene            659074..664365
FT                   /gene="rifC"
FT                   /locus_tag="AMED_0619"
FT   CDS_pept        659074..664365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rifC"
FT                   /locus_tag="AMED_0619"
FT                   /product="rifamycin polyketide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42439"
FT                   /db_xref="GOA:A0A0H3CWY2"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR041314"
FT                   /db_xref="InterPro:IPR042104"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWY2"
FT                   /protein_id="ADJ42439.1"
FT                   /translation="MVSASYEKVVEALRKSLEEVGTLKKRNRQLADAAGEPIAIVGMAC
FT                   RLPGGVTGPGDLWRLVAEGGDAVSGFPTDRCWDLDTLFDPDPDHAGTSYTDQGGFLHDA
FT                   ALFDPGFFGISPREALAMDPQQRLLLEASWEALEGVGLDPASLQGTDVGVFTGAGGSGY
FT                   GGGLTGPEMQSFAGTGLASSVASGRVSYVFGFEGPAVTIDTACSSSLVAMHLAAQALRQ
FT                   GDCSMALAGGAMVMSGPDSFVVFSRQRGLATDGRCKAFASGADGMVLAEGISVVVLERL
FT                   SVARERGHRVLAVLRGSAVNQDGASNGLTAPNGPSQQRVIRAALANAGIGPSDVDLVEA
FT                   HGTGTSLGDPIEAQALLATYGQDRETPLWLGSLKSNIGHTQAAAGVASVIKVVQALRHG
FT                   VMPPTLHVDEPSSQVDWSEGAVELLTGSRDWPRGDRPRRAGVSSFGVSGTNVHLIIEEA
FT                   PEEPAAAVPTSADVVPLVVSARSTGSLAGQADRLTEVDVPLGHLAGALVAGRAVLEERA
FT                   VVVAGSAEEARAGLGALARGEAAPGVVTGTAGKPGKVVWVFPGQGTQWVGMGRELLDAS
FT                   PVFAERIKECAAALDQWTDWSLLDVLRGDGDLDSVEVLQPACFAVMVGLAAVWESAGVR
FT                   PDAVVGHSQGEIAAACVSGALTLDDAAKVVALRSQAIAARLSGRGGMASVALSEDEANA
FT                   RLGLWDGRIEVAAVNGPASVVIAGDAQALDEALEVLAGDGVRVRQVAVDYASHTRHVED
FT                   IRDTLAETLAGITAQAPDVPFRSTVTGGWVRDADVLDGGYWYRNLRNQVRFGPAVAELL
FT                   EQGHGVFVEVSAHPVLVQPISELTDAVVTGTLRRDDGGLRRLLTSMAELFVRGVRVDWA
FT                   TLVPPARVDLPTYAFDHQHFWLRPAAQADAVSLGQAAAEHPLLGAVVRLPQSDGLVFTS
FT                   RLSLRTHPWLADHTIGGVVLFPGTGLVELAVRAGDEAGCPVLDELVTEAPLVVPGQGGV
FT                   NVQVTVSGPDQNGLRTVDIHSQRDDVWTRHATGTVSATPASSPGFDFTAWPPPDGQRVE
FT                   IGDFYADLAERGYAYGPLFQGVRAVWQRGEDVFAEVALPEDRREDAARFGLHPALLDAA
FT                   LQTGTIAAAASGQPGKSVMPFSWNRLALHAVGAAGLRVRVAPGGPDALTVEAADETGAP
FT                   VLTMDSLILREVALDQLDTARAGSLYRVDWTPLPTVDSAVPAGRAEVLEAFGEEPLDLT
FT                   GRVLAALQAWLSDAAEEARLVVVTRGAVPAGDGVVSDPAGAAVWGLVRAAQAENPDRFV
FT                   LLDTDGEVPLEAVLATGEPQLALRGTTFSVPRLARVTEPAEAPLTFRPDGTVLVSGAGT
FT                   LGALAARDLVTRHGVRRLVLASRRGRAAEGIDDLVAELTGHGAEVTVAACDVSDRDQVA
FT                   ALLKEHALTAVVHTAGVFDAGVTGALTRERLAKVFAPKVDAANHLDELTRDLDLDAFIV
FT                   YSSASSIFMGAGSGGYAAANAYLDGLMAARRAAGLPGLSLAWGPWEQLTGMADTIDDLT
FT                   LARMSRREGRGGVRALGSADGMELFDAALAAGQALLVPIELDLREVRADAAGGGTVPHL
FT                   LRGLVRAGRQAARTAATEDGGLERRLAGLTVAEQEALLLDLVRGQVAVVLGHADSSGVR
FT                   ADAAFKDAGFDSLTSVELRNRLRETTGLKLPATLVFDHPNPLALARHLRAELAVDEASP
FT                   ADAVLAGLAGLEAAIAAAGAPDGDRITARLRELLKAAEAAEARPGTSGDLDTASDEELF
FT                   ALVDGLD"
FT   gene            664444..669630
FT                   /gene="rifD"
FT                   /locus_tag="AMED_0620"
FT   CDS_pept        664444..669630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rifD"
FT                   /locus_tag="AMED_0620"
FT                   /product="rifamycin polyketide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42440"
FT                   /db_xref="GOA:A0A0H3CWL2"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR015083"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036299"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042104"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWL2"
FT                   /protein_id="ADJ42440.1"
FT                   /translation="MADEGQLRDYLKRAIADARDARTRLREVEEQAREPIAIVAMACRY
FT                   PGGVSSPEDLWRLVAEGTDAVSAFPGDRGWDVDGLVDPDPDRPGTTYTDQGGFLHEAGL
FT                   FDAGFFGISPREAVAMDPQQRLLLETSWEAIERTGTDPLSLKGSDIGVFTGVASMGYGA
FT                   GGGVVAPELEGFVGTGAAPCIASGRVSYVLGFEGPAVTVDTGCSSSLVAMHLAAQALRR
FT                   GECSMALAGGAMVMAQPGSFVSFSRQRGLALDGRCKAFSDSADGMGLAEGVGVIALERL
FT                   SVARERGHRVLAVLRGIAVNQDGASNGLTAPNGPSQQRVIRAALAEAGLSPSDVDAVEG
FT                   HGTGTTLGDPIEAQALLATYGKGRDPEKPLWLGSVKSNLGHTQAAAGVASVIKMVQALR
FT                   HGVLPPTLHVDRPSTEVDWSAGAVSLLTEAREWPREGRPRRAGVSSFGISGTNAHLILE
FT                   EAPEEEPPVAEAPSAGVVPVVVSARGALAGQAGRLAAFLEASDEPLVTVAGALICGRSR
FT                   FGDRAVVVAGTRAEATAGLAALARGESAADVVTGTVAASGVPGKLVWVFPGQGSQWVGM
FT                   GRELLEASPVFAARIAECAAALEPWIDWSLLDVLRGEGDLDRVDVVQPASFAVMVGLAA
FT                   VWSSVGVVPDAVLGHSQGEIAAACVSGALSLQDAAKVVALRSQAIAAKLAGRGGMASVA
FT                   LSEEDAVARLRHWADRVEVAAVNSPSSVVIAGDAEALDQALEALTGQDIRVRRVAVDYA
FT                   SHTRHVEDIQEPLAEALAGIEAHAPTLPFFSTLTGDWIREAGVVDGGYWYRNLRNQVGF
FT                   GPAVAELLGLGHRVFVEVSAHPVLVQAISAIADDTDAVVTGSLRREEGGLRRLLTSMAE
FT                   LFVRGVDVDWATMVPPARVDLPTYAFDHQHYWLRYVETATDAAGPVVRLPQTGGLVFTT
FT                   EWSLKSQPWLAEHTLEDLVVVPGAALVELAVRAGDEAGTPVLDELVIETPLVVPERGAI
FT                   RVQVTVSGPDDGTRTLEVHSQPEDATDEWTRHATGTLSATPDESSGFDFTAWPPPGARQ
FT                   LDGVPAIWRAGDEIFAEVSLPDDADAEAFGIHPALLDAALHPALPGDDGLTQPMEWRGL
FT                   TLHAAGASTLRVRLVPGGFLEAADGAGSLVVTAKEVALRPVTIARSRTTTRDSLFQLNW
FT                   IELPESGVVAAADDTEVLEVPAGDSPLAATSRVLERLQTWLTEPEAEQLVVVTRGAVPA
FT                   GDTPVTDPAAAAVWGLVRSAQAENPDRIVLLDTDGEVPLGAVLAGGEPQVAVRGTALYV
FT                   PRLARADAAPVSGLHGTVLVSGAGVLGEIVARHLVTRHGVRKLVLASRRGLDADGAKDL
FT                   VTDLTGEGADVSVVACDLADRNQVAALLADHRPASVIHTAGVLDDGVIGTLTPERLAKV
FT                   FAPKVDAVRHLDELTRDLDLDAFVVFSSGSGVFGSPGQGNYAAANAFLDAAMASRRAAG
FT                   LPGLSLAWGLWEQATGMTAHLGGTDQARMSRGGVRPITAEEGMALFDTALGAQPALLVP
FT                   VKLDLREVRAGGAVPHLLRGLVRAGRRQAQAASTVDNQLLGRLAGLGAPEQEALLVDLV
FT                   RGQVAAVLGHAGPDAVRADTAFKDAGFDSLTSVDLRNRLRESTGLKLPATLAFDYPTPL
FT                   VLARHLRDELGAGDDALSVVHARLEDVEALLGGLRLDESTKTGLTLRLQGLVARCNGVN
FT                   DQTGGETLADRLEAASADEVLDFIDEELGLT"
FT   gene            669678..679919
FT                   /gene="rifE"
FT                   /locus_tag="AMED_0621"
FT   CDS_pept        669678..679919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rifE"
FT                   /locus_tag="AMED_0621"
FT                   /product="rifamycin polyketide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42441"
FT                   /db_xref="GOA:A0A0H3CYS4"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR015083"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042104"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYS4"
FT                   /protein_id="ADJ42441.1"
FT                   /translation="MATDEKLLKYLKRVTAELHSLRKQGARHADEPLAVVGMACRFPGG
FT                   VSSPEDLWQLVAGGVDALSDFPDDRGWELDGLFDPDPDHPGTSYTSQGGFLRGAGLFDA
FT                   GLFGISPREALVMDPQQRVLLETSWEALEDAGVDPLSLKGSDVGVFSGVFTQGYGAGAI
FT                   TPDLEAFAGIGAASSVASGRVSYVFGLEGPAVTIDTACSSSLVAIHLAAQALRAGECSM
FT                   ALAGGATVMPTPGTFVAFSRQRVLAADGRSKAFSSTADGTGWAEGAGVLVLERLSVAQE
FT                   RGHRILAVLRGSAVNQDGASNGLTAPNGPSQQRVIRKALAGAGLVASDVDVVEAHGTGT
FT                   ALGDPIEAQALLATYGQGRERPLWLGSVKSNFGHTQAAAGVAGVIKMVQALRHGAMPPT
FT                   LHVAEPTPEVDWSAGAVELLTEPREWPAGDRPRRAGVSAFGISGTNAHLILEEAPPADA
FT                   VAEEPEFKGPVPLVVSAGSPTSLAAQAGRLAEVLASGGVSRARLASGLLSGRALLGDRA
FT                   VVVAGTDEDAVAGLRALARGDRAPGVLTGSAKHGKVVYVFPGQGSQRLGMGRELYDRYP
FT                   VFATAFDEACEQLDVCLAGRAGHRVRDVVLGEVPAETGLLNQTVFTQAGLFAVESALFR
FT                   LAESWGVRPDVVLGHSIGEITAAYAAGVFSLPDAARIVAARGRLMQALAPGGAMVAVAA
FT                   SEAEVAELLGDGVELAAVNGPSAVVLSGDADAVVAAAARMRERGHKTKQLKVSHAFHSA
FT                   RMAPMLAEFAAELAGVTWREPEIPVVSNVTGRFAEPGELTEPGYWAEHVRRPVRFAEGV
FT                   AAATESGGSLFVELGPGAALTALVEETAEVTCVAALRDDRPEVTALITAVAELFVRGVA
FT                   VDWPALLPPVTGFVDLPKYAFDQQHYWLQPAAQATDAASLGQVAADHPLLGAVVRLPQS
FT                   DGLVFTSRLSLKSHPWLADHVIGGVVLVAGTGLVELAVRAGDEAGCPVLEELVIEAPLV
FT                   VPDHGGVRIQVVVGAPGETGSRAVEVYSLREDAGAEVWARHATGFLAATPSQHKPFDFT
FT                   AWPPPGVERVDVEDFYDGLVDRGYAYGPSFRGLRAVWRRGDEVFAEVALAEDDRADAAR
FT                   FGIHPGLLDAALHAGMAGATTTEEPGRPVLPFAWNGLVLHAAGASALRVRLAPSGPDAL
FT                   SVEAADEAGGLVVTADSLVSRPVSAEQLGAAANHDALFRVEWTEISSAGDVPADHVEVL
FT                   EAVGEDPLELTGRVLEAVQTWLADAADDARLVVVTRGAVHEVTDPAGAAVWGLIRAAQA
FT                   ENPDRIVLLDTDGEVPLGRVLATGEPQTAVRGATLFAPRLARAEAAEAPAVTGGTVLIS
FT                   GAGSLGALTARHLVARHGVRRLVLVSRRGPDADGMAELTAELIAQGAEVAVVACDLADR
FT                   DQVRVLLAEHRPNAVVHTAGVLDDGVFESLTRERLAKVFAPKVTAANHLDELTRELDLR
FT                   AFVVFSSASGVFGSAGQGNYAAANAYLDAVVANRRAAGLPGTSLAWGLWEQTDGMTAHL
FT                   GDADQARASRGGVLAISPAEGMELFDAAPDGLVVPVKLDLRKTRAGGTVPHLLRGLVRP
FT                   GRQQARPASTVDNGLAGRLAGLAPAEQEALLLDVVRTQVALVLGHAGPEAVRADTAFKD
FT                   TGFDSLTSVELRNRLREASGLKLPATLVFDYPTPVALARYLRDELGDTVATTPVATAAA
FT                   ADAGEPIAIVGMACRLPGGVTDPEGLWRLVRDGLEGLSPFPEDRGWDLENLFDDDPDRS
FT                   GTTYTSRGGFLDGAGLFDAGFFGISPREALAMDPQQRLLLEAAWEALEGTGVDPGSLKG
FT                   ADVGVFAGVSNQGYGMGADPAELAGYASTAGASSVVSGRVSYVFGFEGPAVTIDTACSS
FT                   SLVAMHLAGQALRQGECSMALAGGVTVMGTPGTFVEFAKQRGLAGDGRCKAYAEGADGT
FT                   GWAEGVGVVVLERLSVARERGHRVLAVLRGSAVNSDGASNGLTAPNGPSQQRVIRRALA
FT                   GAGLEPSDVDIVEGHGTGTALGDPIEAQALLATYGKDRDPETPLWLGSVKSNFGHTQSA
FT                   AGVAGVIKMVQALRHGVMPPTLHVDRPTSQVDWSAGAVEVLTEAREWPRNGRPRRAGVS
FT                   SFGISGTNAHLIIEEAPAEPQLAGPPPDGGVVPLVVSARSPGALAGQARRLATFLGDGP
FT                   LSDVAGALTSRALFGERAVVVADSAEEARAGLGALARGEDAPGLVRGRVPASGLPGKLV
FT                   WVFPGQGTQWVGMGRELLEESPVFAERIAECAAALEPWIGWSLFDVLRGDGDLDRVDVL
FT                   QPACFAVMVGLAAVWSSAGVVPDAVLGHSQGEIAAACVSGALSLEDAAKVVALRSQAIA
FT                   AKLSGRGGMASVALGEADVVSRLADGVEVAAVNGPASVVIAGDAQALDETLEALSGAGI
FT                   RARRVAVDYASHTRHVEDIEDTLAEALAGIDARAPLVPFLSTLTGEWIRDEGVVDGGYW
FT                   YRNLRGRVRFGPAVEALLAQGHGVFVELSAHPVLVQPITELTDETAAVVTGSLRRDDGG
FT                   LRRLLTSMAELFVRGVEVDWTSLVPPARADLPTYAFDHEHYWLRAADTASDAVSLGLAG
FT                   ADHPLLGAVVQLPQSDGLVFTSRLSLRSHPWLADHAVRDVVIVPGTGLVELAVRAGDEA
FT                   GCPVLDELVIEAPLVVPRRGGVRVQVALGGPADDGSRTVDVFSLREDADSWLRHATGVL
FT                   VPENRPRGTAAFDFAAWPPPEAKPVDLTGAYDVLADVGYGYGPTFRAVRAVWRRGSGNT
FT                   TETFAEIALPEDARAEAGRFGIHPALLDAALHSTMVSAAADTESYGDEVRLPFAWNGLR
FT                   LHAAGASVLRVRVAKPERDSLSLEAVDESGGLVVTLDSLVGRPVSNDQLTTAAGPAGAG
FT                   SLYRVDWTPLSSVDTSGRVPSWLPVATAEEVATLADDVLTGATEAPAVAVMEAVADEGS
FT                   VLALTVRVLDVVQCWLAGGGLEGTKLAIVTRGAVPAGDGVVHDPAAAAVWGLVRAAQAE
FT                   NPDRIVLLDVEPEADVPPLLGSVLADGEPQVAVRGTTLSIPRLARAARPDPAAGFKTRG
FT                   PVLVTGGTGSLGGLVARHLVERHGVRQLVLASRRGLDAEGAKDLVTDLTALGADVAVAA
FT                   CDVADRDQVAALLTEHRPSAVVHTAGVPDAGVIGTVTPDRLAEVFAPKVTAARHLDELT
FT                   RDLDLDSFVVYSSVSAVFMGAGSGSYAAANAYLDGLMAHRRAAGLPGQSLAWGLWDQTT
FT                   GGMAAGTDEAGRARMTRRGGLVAMKPAAGLDLFDAAIGSGEPLLVPAQLDLRGLRAEAA
FT                   GGTEVPHLLRGLVRAGRQQARAASTVEENWAGRLAGLEPAERGQVLLELVRAQVAGVLG
FT                   YRAAHQVDPDQGLFEIGFDSLTAIELRNRLRARTERKISPGVVFDHPTPALLAAHLNEL
FT                   LRKKV"
FT   gene            679916..680698
FT                   /gene="rifF"
FT                   /locus_tag="AMED_0622"
FT   CDS_pept        679916..680698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rifF"
FT                   /locus_tag="AMED_0622"
FT                   /product="N-acetyltransferase/amide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42442"
FT                   /db_xref="GOA:A0A0H3CUX7"
FT                   /db_xref="InterPro:IPR001447"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUX7"
FT                   /protein_id="ADJ42442.1"
FT                   /translation="MNVFDVETYLQRIGCGGETGVDLETLAKLQKSHLMAIPYSSLAYE
FT                   LRDAVNVVDLDEDDVFVTSIAEGQGGACYHLNRLFHRLLTELGYDVTPLAGSTAEGRET
FT                   FGTDVEHMFNLVTLDGADWLVDVGYPGPTYVEPLAVSPAVQTQYGSQFRLVEQETGYAL
FT                   QRRGAVTRWSVVYTFTTQPRQWSDWKELEDNFRALVGDTTRTDTQETLCGRAFANGQVF
FT                   LRQRRYLTVENGREQVRTITDDDEFRALVSRVLSGDHG"
FT   gene            680718..680906
FT                   /locus_tag="AMED_0623"
FT   CDS_pept        680718..680906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0623"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42443"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVW8"
FT                   /protein_id="ADJ42443.1"
FT                   /translation="MTEKAGLLAKFAGLCKTAYEHHYIPYLHFFYGGEYLHHGSEPVSR
FT                   IADLPYVTVPEPRKKAP"
FT   gene            680903..681958
FT                   /gene="rifG"
FT                   /locus_tag="AMED_0624"
FT   CDS_pept        680903..681958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rifG"
FT                   /locus_tag="AMED_0624"
FT                   /product="aminodehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42444"
FT                   /db_xref="GOA:A0A0H3CWY6"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWY6"
FT                   /protein_id="ADJ42444.1"
FT                   /translation="MRTTIPVRLAERSYDVLVGPGVRAALPEVVRRLGARRAVVVSARP
FT                   ADWVPGTGVETLLLQARDGEPTKRLSTVEELCGEFARFGLTRSDVVVSCGGGTTTDVVG
FT                   LAAALYHRGVAVVHLPTSLLAQVDASVGGKTAVNLPAGKNLVGAYWQPSAVLCDTDYLT
FT                   TLPRREVLNGLGEIARCHFIGAPDLRGRSRPEQIAASVTLKAGIVAQDERDTGPRHLLN
FT                   YGHTLGHALEIATGFALRHGEAVAIGTVFAGRLAGALGRLDQSGVDEHLAVVRHYGLPA
FT                   ALPADVDPAVLVRQMYRDKKAITGLAFVLAGPRGAELVSDVPAPVVTDVLDRMPRDSLE
FT                   NLVGTTEAAAP"
FT   gene            681955..683280
FT                   /gene="rifH"
FT                   /locus_tag="AMED_0625"
FT   CDS_pept        681955..683280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rifH"
FT                   /locus_tag="AMED_0625"
FT                   /product="aminoDAHP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42445"
FT                   /db_xref="GOA:A0A0H3CWL6"
FT                   /db_xref="InterPro:IPR002480"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWL6"
FT                   /protein_id="ADJ42445.1"
FT                   /translation="MKRQPDFAAHGRAVDRVLAGRLSAALARPAAQQPGWPDAERAAEV
FT                   IELLHDAEPIVAPEETARLRARLASVARGEAFLLQGGDCAETFAGNTEPHLRANLGVLA
FT                   RMGEVLAEAAGLPVVKIARMAGQFAKPRSRTVDALGLPVYRGDIVNSPECTVAARTPDP
FT                   HRMLLAYAHAAGAMDLVRKLCAEGLEEPLAAQVVLAGARRASSPGGRPFPDFGRPPRPA
FT                   EIYVSHEMLLLDYERAVLRTDSSGPEPRLSSGLAHFLWIGERTRQLDGAHIAFAELLSN
FT                   PIGLKLGPSCTPEEVVEYVRRLDPHRTPGRLTLVSRMGHAQVRELLPPIVEKVAASGHE
FT                   VIWQCDPMHGNTRTSGNGYKTRHFGHVVAELAGFFAVHRQLGTHPGGIHVEVTGDDVTE
FT                   CLGGAAGIAEADLPDRYLTACDPRLNADQSVELAFAIAKMLR"
FT   gene            683300..684091
FT                   /gene="rifI"
FT                   /locus_tag="AMED_0626"
FT   CDS_pept        683300..684091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rifI"
FT                   /locus_tag="AMED_0626"
FT                   /product="aminoquinate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42446"
FT                   /db_xref="GOA:A0A0H3CYS8"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYS8"
FT                   /protein_id="ADJ42446.1"
FT                   /translation="MPISGTTRLYVVLGDPVAQVRSPGLLNPLFADLDVDAVLVPVHAP
FT                   PPHLERIVAGLQAVANLDGIFVTVPHKVAVAGLADRRSPMVEITGSANALRREADGRWY
FT                   AENFDGTGFVAGLVEAGHDPKARRVSLVGAGGAGSAIAAAVLAAGADRLALCDPDTAKL
FT                   AALKGRLDVHWPGRTSVSAEPDTAGADLVVNATPLGLRPGDPLPFRPDRLAPGRVVADI
FT                   IMKPRETRLLREAAALGHDVHYGSHMLAGQLDSYRDFFGLG"
FT   gene            684231..685397
FT                   /gene="rifK"
FT                   /locus_tag="AMED_0627"
FT   CDS_pept        684231..685397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rifK"
FT                   /locus_tag="AMED_0627"
FT                   /product="AHBA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42447"
FT                   /db_xref="GOA:A0A0H3CUY1"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUY1"
FT                   /protein_id="ADJ42447.1"
FT                   /translation="MNARKAPEFPAWPQYDDAERNGLVRALEQGQWWRMGGDEVNSFER
FT                   EFAAHHGAAHALAVTNGTHALELALQVMGVGPGTEVIVPAFTFISSSQAAQRLGAVTVP
FT                   VDVDAATYNLDPEAVAAAVTPRTKVIMPVHMAGLMADMDALAKISADTGVPLLQDAAHA
FT                   HGARWQGKRVGELDSIATFSFQNGKLMTAGEGGAVVFPDGETEKYETAFLRHSCGRPRD
FT                   DRRYFHKIAGSNMRLNEFSASVLRAQLARLDEQIAVRDERWTLLSRLLGAIDGVVPQGG
FT                   DVRADRNSHYMAMFRIPGLTEERRNALVDRLVEAGLPAFAAFRAIYRTDAFWELGAPDE
FT                   SVDAIARRCPNTDAISSDCVWLHHRVLLAGEPELHATAEIIADAVARA"
FT   gene            685625..686701
FT                   /gene="rifL"
FT                   /locus_tag="AMED_0628"
FT   CDS_pept        685625..686701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rifL"
FT                   /locus_tag="AMED_0628"
FT                   /product="oxidoreductase RifL"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42448"
FT                   /db_xref="GOA:A0A0H3CVX3"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVX3"
FT                   /protein_id="ADJ42448.1"
FT                   /translation="MSVRAAVVGLGWAGRELWLPLLREHADFEVVAAVDADPASRQAFT
FT                   KATGIPTHAAVSALTAREVDLAVVAVPNYLHTEVAGALLATGISVFLEKPVCLNSAEID
FT                   VLAAAERSGGMLLAGSAARYRGDVGALRRLLPELGEIRHVALGWIRARGVPRAGGWFTQ
FT                   REKAGGGALYDLGWHLLDTLAFLLGPAAFTQVIGVTSDDFVNAGAWRAAWRQDQLGADA
FT                   ADVEDTARGFLVRDDGVSVSLRASWASHQARDVSVIHVEGSAGTADLRCTFGFSPNREP
FT                   EPVLSVTREGTTTRLPVPLERIGVEYTRQVSDLAAMLADPGHRGRAVAEARPIVSMIEN
FT                   FYASAGSARGRGAVPAYQ"
FT   gene            686716..687414
FT                   /gene="rifM"
FT                   /locus_tag="AMED_0629"
FT   CDS_pept        686716..687414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rifM"
FT                   /locus_tag="AMED_0629"
FT                   /product="phosphoglycolate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42449"
FT                   /db_xref="GOA:A0A0H3CWZ1"
FT                   /db_xref="InterPro:IPR006351"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWZ1"
FT                   /protein_id="ADJ42449.1"
FT                   /translation="MTFPIVDRPDTGADPSAPVRHAVIFDLDGVVVDSFAVMSEAFAIA
FT                   YAEVVGDGPAPFEEYRRHLGRYFPDIMRIMDLPLEMEEPFVRESYRLAGEVQVFDGVTE
FT                   LLLTLRTRGLRLAIATGKSGPRARSLLDNLGLLPFFEHVIGSDEVARPKPAPDIVRHAL
FT                   DLLDVPPEAAIMIGDAPTDLASARGAGVASAAALWAPPDDIGELLAAGPDVVLRQPADL
FT                   LALCPSVPGR"
FT   gene            687419..688330
FT                   /gene="rifN"
FT                   /locus_tag="AMED_0630"
FT   CDS_pept        687419..688330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rifN"
FT                   /locus_tag="AMED_0630"
FT                   /product="kanosamine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42450"
FT                   /db_xref="GOA:A0A0H3CWM0"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWM0"
FT                   /protein_id="ADJ42450.1"
FT                   /translation="MGTPYHLGIDVGGTKVAFRVESGSACIEETSFSWGARHSAEDDLA
FT                   QLAGHVARLRERIGTPLEAVGVAMPGTVGADGRVATWPSRPEWTGVDLKTALHSLFPEA
FT                   AVAWADDGDLGALAESRASGCENLLYIGIGTGIGGGLVLGGVPCPGLGRGSFEIGHVIV
FT                   EMGGVRCVCGRRGCLQALASGPATLRRASLLRGADVTYYRLQRALRNGEPWAADALEGS
FT                   TRALAAAVTGVQELVHPDRVLIGGGFAAGIPEIVPSVSGFLADLVRQGQAPLPVEPAAL
FT                   GGLSSLRGAVALAGLVAAGEVP"
FT   gene            688397..689164
FT                   /gene="rifO"
FT                   /locus_tag="AMED_0631"
FT   CDS_pept        688397..689164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rifO"
FT                   /locus_tag="AMED_0631"
FT                   /product="LmbE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42451"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYT2"
FT                   /protein_id="ADJ42451.1"
FT                   /translation="MGTLVSFHAHPNDDTTTCGGVLRKAHEDGHRVVLVLATRGELGYN
FT                   PDGLLAEGETLGDRRAVEARAAADVLGVDRLEFLGYTDSGMTAAADGAGTFQTADVEEA
FT                   ARKLAAILREERADVLTVYDEKGTYGDPDHIQVHRVGTRAAELAGTAKVFQSTINREHI
FT                   KANQRVLAEQAGVDLPAGPDFGTPEAELTCRVDVSAYTEYKRKALLAHASQITPQSTLF
FT                   TDLPEDTFRTMFGTEWFIRAGQGPGITETDLMA"
FT   gene            689241..690173
FT                   /gene="aes"
FT                   /locus_tag="AMED_0632"
FT   CDS_pept        689241..690173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aes"
FT                   /locus_tag="AMED_0632"
FT                   /product="esterase/lipase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42452"
FT                   /db_xref="GOA:A0A0H3CUY5"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUY5"
FT                   /protein_id="ADJ42452.1"
FT                   /translation="MVYAFDPELATAVPALPVTDLGDLALARAGVRELRERLPRPDTAG
FT                   LRIDDVRVPGDGHEVALRVYRPVRPRTPAALYFVHGGGFVVGDLDVALVPCVELVRALG
FT                   IAVVSVDYRLAPETRYPGPLEDVYTGLCWLVGHAEELGVDPRRIVTYGISSGGCLSGGL
FT                   ALLARDRGGPPIAYQFLNAPVLDDRLETPSMREFVDTPLWNRPQAEISWDAYLGPGVRA
FT                   TDAVPYYAAPARATDLSGLPPAYVAVKQFDPLRDEGIAYAVAMQAAGVNVELHLFPGTF
FT                   HGSARCTDAAISRREQEEQFAVLRHVTGR"
FT   gene            690461..691978
FT                   /gene="rifP"
FT                   /locus_tag="AMED_0633"
FT   CDS_pept        690461..691978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rifP"
FT                   /locus_tag="AMED_0633"
FT                   /product="major facilitator transporter RifP"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42453"
FT                   /db_xref="GOA:A0A0H3CVX8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVX8"
FT                   /protein_id="ADJ42453.1"
FT                   /translation="MREMHATAAVTETRNPRRWLILAVISLAQLVVLVDNTVLNLAIPK
FT                   LTEDLGATTADIQWMINAYALVQSGLLLTAGSFSDRYGRKRSLLAGLLLFGVGSLAAAF
FT                   SLSSGQLIAARAGMGIGGALLTTTTLAVVMQVFDEKELPKAIGLWSAVSSFGYASGPLI
FT                   GGALLAHFWWGSIFLINIPVALLGCVAVAKLVPESKDPQGARPDLVGAALSTIGMAGIV
FT                   YAIISGPEHGWASATVLVAAGIGVAALAAFVRWELHVPHPMLDMGLFRNRRFNGAISGG
FT                   LLVAFGMGGSVFLLTQQLQLVLGYDPLEAGLRTAPLALVVVALNVAGLGAKLLEKLGIA
FT                   MTIAVGMTLNAVGLAMVAVLGTPDRGYGGMLAGLLVMGGGIALAMPAMANAIMTSIPAE
FT                   KAGAGAAVQGTVNQFGSGLGVAILGAVLNSRFAALLPIGLGAGAAGSLHEALLQARTPA
FT                   LQAQVRDAFAGGVRASELIGALAVVLGGLLAGLLLRRAARSEAHQAA"
FT   gene            692064..692792
FT                   /gene="rifQ"
FT                   /locus_tag="AMED_0634"
FT   CDS_pept        692064..692792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rifQ"
FT                   /locus_tag="AMED_0634"
FT                   /product="TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42454"
FT                   /db_xref="GOA:A0A0H3CWZ6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWZ6"
FT                   /protein_id="ADJ42454.1"
FT                   /translation="MGKRASQPRESVWLSPRPARKHRAGESELDREKIVATAVRVLDAE
FT                   GDAKFSMRLLAEELNVTPMSVYWYVANKDDLLELALDAVAGEIELPSLDDGNDWREDLR
FT                   ALARAWRRTMVAHPWAIRCYGEYLNIGPSSLRFTECAQAVMACSPLPLKDRSAALNVVF
FT                   QYVYGFTATESRWLEHLAETGRTAEEFAAEVTGSMAAMSSTLEQGGLLERDGDQSMEQL
FT                   RDRDFDRGLNWLFTGMVAGG"
FT   gene            complement(692799..693299)
FT                   /locus_tag="AMED_0635"
FT   CDS_pept        complement(692799..693299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0635"
FT                   /product="pyridoxamine 5'-phosphate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42455"
FT                   /db_xref="GOA:A0A0H3CWM4"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWM4"
FT                   /protein_id="ADJ42455.1"
FT                   /translation="MDLSMTEKEEQEFLAGKHIGVLAVHRRSGPPLAVPMWYGYSPGGD
FT                   VLLWTDGEDTLKGRLIKKNGAFTLVVQNEDPPYRYVSVSGPVTAWEEATVEAAYSVASR
FT                   YLPERQAREFVEAFNAGHVIIRMTPDRWRSVDYGKTSNVLTDREGTRLREHVQTARRGR
FT                   GRD"
FT   gene            complement(693384..694595)
FT                   /locus_tag="AMED_0636"
FT   CDS_pept        complement(693384..694595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0636"
FT                   /product="cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42456"
FT                   /db_xref="GOA:A0A0H3CYT6"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYT6"
FT                   /protein_id="ADJ42456.1"
FT                   /translation="MTETVAFPQDRTCPYQPAPGYEPLADRRPIAEVTLYDGRKAWAVT
FT                   GHELARKLLCDPRISSDRTNPAWPMVSAAAAVEFTDVQQKVIKLLTALVGVDGPAHRAR
FT                   RKLVQAGFTVKRIDSLRPKIQALVDRQIDEMIAEGAPVDLLKKFASPVPLIALCDLLGI
FT                   PHEDQDYFEKKAHQILFGPDAGGAYDELMAYLTKLIDKAEQNPGEEGFLQALLAERDPS
FT                   SDVDHEEILQMFLIVLVTGHDTTSSSIGLGAFTLLQHPERLAELRADPSLMPAAVDELT
FT                   RFVVVPDGLQRVAADDIEVDADTTIRKGDGVFFLFSLINRDEEAYEDGDRLDWHRPTFR
FT                   DHLTYGFGTHQCAGMNHARAIMEIAFRRLIDRLPGLRLAVPADEVRVKPGDAFQGLAEL
FT                   PVTW"
FT   gene            complement(694626..695891)
FT                   /locus_tag="AMED_0637"
FT   CDS_pept        complement(694626..695891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0637"
FT                   /product="cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42457"
FT                   /db_xref="GOA:A0A0H3CUY8"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUY8"
FT                   /protein_id="ADJ42457.1"
FT                   /translation="MTTTAETSAEPVDLFSPEVVADPWGAHAAVREAPTLQIGGFMGGP
FT                   PMYLAARYEDVRQVLMDQRFQCNPLADSPAEDIRNGVFRHLDMPEELIPWLKNLINASD
FT                   GEEHARLRKLVSYALTAHRVGKFRPRVEELTAELLDKLEAAGGDGTPIDLVESFCYPLP
FT                   VTVICELVGVDHEDRPQWRAWSDAMATLDGKRLPEEVRKTLAAARGMIERRRAEPKDDM
FT                   VTALVEAQAKNPGIATDDELVGVLFSLVTAGHQTTTYLIGNSVLALHEHPDQLARLKAD
FT                   PSLWPQAVRELQRLGPIQFGQPRFATEDIEVGGTVIPRGMPVVPLIMAANSDPRKFPEP
FT                   EKLQIDRLAVGSESHLGFGKGIHRCLGQHVAYLEAEVALRGLYTRFPDMTLAVPREEIP
FT                   WILRPGFTRTKDLPVRLARPAS"
FT   gene            complement(695965..697272)
FT                   /locus_tag="AMED_0638"
FT   CDS_pept        complement(695965..697272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0638"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42458"
FT                   /db_xref="GOA:A0A0H3CVY4"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVY4"
FT                   /protein_id="ADJ42458.1"
FT                   /translation="MVDSARSDLLTQVRDYHDAQSPGPAPFIPGQTPILSSGAVLDAAD
FT                   REALVAAALDLRIASGTIATKFESSFARKLKRRKAVLTNSGSSANLLALSTLTSPTLGD
FT                   EQLKPGDEVVTVAAGFPTTVNPILQNGMIPVFVDIELGTYNTTAERVEAAISPRTRAIM
FT                   IAHTLGNPFPVAEIAEIAQRHGCHLIEDNCDAVGSTYQGQLTGTFGRFSTVSFYPAHHL
FT                   TMGEGGMLLSSDIKLAKLAKSFRDWGRDCWCEPGEDDRCLKRFDLHLGTLPEAYDHKYV
FT                   FSEVGYNLKSTDIHAALGLSQLAKLPDFVDARKRNWRQLREGLDGLPGLILPEATPGSD
FT                   PSWFGFIITVKPDAGFDVPEVVEYLEARNIRTRRLFAGNLTRHPAYIGKPQRIAGPLTN
FT                   SDIVTERTFWIGVYPGITTEMIEYVIGTLKEFVATH"
FT   gene            697475..698620
FT                   /locus_tag="AMED_0639"
FT   CDS_pept        697475..698620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0639"
FT                   /product="dNTP-hexose glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42459"
FT                   /db_xref="GOA:A0A0H3CX00"
FT                   /db_xref="InterPro:IPR010610"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CX00"
FT                   /protein_id="ADJ42459.1"
FT                   /translation="MKVLNLAGVAPSTVFSHVPLANALRNAGHQVMTTASVDEMVDTIA
FT                   GVGLSAVRTTAPGVTPRQVIAESGLTHVPEDPAEREVMAGRWYAHMEYVTLDALLAFSK
FT                   DWRPDVIVSGVTSYSGPLLAAHLGVPYVRHAWDIHTPRLMDQGAEDQLREQLTELGLDG
FT                   LPEPAMTIEIAPPSLLPDDLKGGQPMRWIPGNSQSVLEPWMYTKSAGTRIGVTIGTGVA
FT                   NYNQYDFLQAVVEQVATLDAEVVVAVTEDAAPELRERLKNVRAGWIPLDVVAPTCDVLV
FT                   HQTGGSTMMTGLSFGVPQVLLPDPNLFRANAMARRLADTGAAVVLSPEEATSEVIAKTC
FT                   GELVADPAFKAAAGGLAREIAELPSPNEVALRIEQLVREAS"
FT   gene            698651..699271
FT                   /gene="rfbC"
FT                   /locus_tag="AMED_0640"
FT   CDS_pept        698651..699271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbC"
FT                   /locus_tag="AMED_0640"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42460"
FT                   /db_xref="GOA:A0A0H3CWM8"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWM8"
FT                   /protein_id="ADJ42460.1"
FT                   /translation="MTVQPLAIDGAHVVTSQSFGDERGDFFEVYRQDVLTEALGYRPRF
FT                   LQTNVSTSCRNVVRGVHGAMTPPGLAKFVTCLRGSLLDFVVDVRTGSPTFGQWDMIVLN
FT                   QHGGTAVYVEEGLGHAFVSLEDDTCVQYLLSDLYRPAEVLTVQPLDPEIGLPLNLPGEP
FT                   ILSERDAAAPTLREAGELGLLPRYEECLALREARVRLEVSVAS"
FT   gene            complement(699329..700633)
FT                   /locus_tag="AMED_0641"
FT   CDS_pept        complement(699329..700633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0641"
FT                   /product="aminotransferase class III"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42461"
FT                   /db_xref="GOA:A0A0H3CYU0"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYU0"
FT                   /protein_id="ADJ42461.1"
FT                   /translation="MTMTVQKAPSQLLAAKLQIPPIPYSHAAGSWVYASDGTRYLDGAS
FT                   GIVNVNIGHAHPTVVAALRDQVGICTYASPGTFAPDLMEQLAAAAARAVHRPDDRVMFT
FT                   PTGTHATESAIALARLVQRARGEEGRHKILTSTLGYHGNSAFVLALSGHRSRRPHEDDS
FT                   FGLAPAFNPPYPGQHLGCPFDACRVECVRAVRDAIVAAGPESVAAVLMEPVNGTTGGGY
FT                   VPPAGYLRALREVCDEFGVLVIHDEVLTGLGRCGLPLASHHTPGSAADIVTLSKGLGAG
FT                   YVPLAATMLSPDLAEDIMTSGKWLPLMGTMSATPLQGRAGLAVLSVLEELGALDRDEVR
FT                   GAALGRLVADAVRGRQVVTDVRGLGYFYGIELAPGTLGDVMRITRSRGLLLYPYVGFRP
FT                   DRTGEGLLVAPPLNATDGDLGFLGETLGAALDQLN"
FT   gene            complement(700652..701644)
FT                   /locus_tag="AMED_0642"
FT   CDS_pept        complement(700652..701644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0642"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42462"
FT                   /db_xref="GOA:A0A0H3CUZ1"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUZ1"
FT                   /protein_id="ADJ42462.1"
FT                   /translation="MAPLRIGIMGCASIAVRKVLPAMAASPRTEITAIASRNPGKAAEI
FT                   AHAYGCRAVEGYSALLDLDEVEAVYIPLPNAAHAGWIELALTAGKHVLAEKPLTTSVSR
FT                   TCELIAAAGAAGLVLMENVMFLHHSQHTAVRDLLAGGAIGELRAFHAAFAVPARPAGDI
FT                   RHRAELGGGALLDTGVYPVRAAMSFLGSEVDVVSAVLTRRHGRPVDSAGQALLCTADGV
FT                   SASATFGIDHAYRSGYELWGSEGRIVLDHAFTPPADHLPVVRLERRSGVDEIPLPPDDQ
FT                   VANTLTAFAAAVRSGRLPDNDDVARQAVLVDDIRTKARLYVDHAPEPVG"
FT   gene            701792..702676
FT                   /locus_tag="AMED_0643"
FT   CDS_pept        701792..702676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0643"
FT                   /product="flavin-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42463"
FT                   /db_xref="GOA:A0A0H3CVY8"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019923"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVY8"
FT                   /protein_id="ADJ42463.1"
FT                   /translation="MATGRKPFRFGVDLITPAPRQAWVESCRKAEDLGYDVIGVGDHLG
FT                   MPAPFPALVLAAENTERVRLTTFVLNAGFHNPVLLAREVTGTDQLTGGRFELGLGAGYV
FT                   EAEFEAAGIPFPTARQRLEHLERTIEQLKKSYADPAHQPRPAQPSGPPLLLGGRGNGLL
FT                   TLAAAHADTIAFIGATASHKMLLADAAELADRVGFAKAALGPRAAEVELNVFAHYIDVT
FT                   ADRRAGLEALHRRMPERTVDQLAELPTVLVGTAAQIAEQLETHRERYGFSYFTVLEHNL
FT                   EALAPVIDLLHGK"
FT   gene            702703..703773
FT                   /locus_tag="AMED_0644"
FT   CDS_pept        702703..703773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0644"
FT                   /product="luciferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42464"
FT                   /db_xref="GOA:A0A0H3CX05"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CX05"
FT                   /protein_id="ADJ42464.1"
FT                   /translation="MANRPMKFSTFHLFHQFAGMSAPEVYGYHVELVELLEELGFDGVW
FT                   LAEHHFHDFGTVPNTLTMLAHLAARTERLRLGTGIVVLPLRDPIHVAEEAAMVDLLSGG
FT                   RLELGLGRGYQSIEFENFGLDLAESRDRFDECLDVLLGLFTTDDFEYRGRFQQTTHPLT
FT                   LWPKPVQRPHPPLHVAAISPETVRKYAARGLPILADPAAPFARIAEAAETWHKTAAAHG
FT                   VDAGDAELVASRVVYVAESDERAREEQARFEAAFDRTRVFLAGNAPIDLKTGGAARSYE
FT                   YHLERLKDLSAEKDFAWNQLEVIGDPERVIGQIRSIQDMGYGNLLCDFGSTRQMPLEEM
FT                   KKLLKFFAAEVMPAFR"
FT   gene            703854..705275
FT                   /locus_tag="AMED_0645"
FT   CDS_pept        703854..705275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0645"
FT                   /product="NDP-hexose 2,3-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42465"
FT                   /db_xref="InterPro:IPR005212"
FT                   /db_xref="InterPro:IPR038153"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWN3"
FT                   /protein_id="ADJ42465.1"
FT                   /translation="MVHSAIHEDTARDGRSDAVADDAVMSMADFHSWFNARARANRFQV
FT                   DRIPFLELSGWDFEPDTGNLVHASGRFFSVEGLRVRTDRPWVSEWAQPIIVQPEIGVLG
FT                   ILVKRFDGVPHCLMQAKMEPGNINGLQISPTVQATRSNYMKVHGGAATKYMEYFRPGSR
FT                   GRVLFDGLQSEQGSWFLHKRNRNIVVETDDDVPLDEDFCWLTLDQIRRLLRLDHMVNMD
FT                   SRTVLACVPPALARPDDRTTGDGSFVEAVHRSLSGRGRAVHDPGHILSWLTEVRARQEL
FT                   VQRRVPLKEIVEDGWRLGHDVIDHRDGKYFDVVAVAVEASNREVTAWTQPLVAPRQSGL
FT                   LALLVKRIGGTLHALVQARSDAGTLNIAELTATVHCQPGNYADAPAEYRPPYLDYALAA
FT                   ATGRVRLDVVHSEEGGRFYHAQNRYLVIEVEDDFAAEPDDRFLWTTLNQLMSLLSHSNY
FT                   LTVELRSLMAGMRSF"
FT   gene            complement(705370..706875)
FT                   /gene="mhpA"
FT                   /locus_tag="AMED_0646"
FT   CDS_pept        complement(705370..706875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpA"
FT                   /locus_tag="AMED_0646"
FT                   /product="3-(3-hydroxy-phenyl)propionate hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42466"
FT                   /db_xref="GOA:A0A0H3CYU5"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYU5"
FT                   /protein_id="ADJ42466.1"
FT                   /translation="MTDTDVVIVGNGPIGATLSVLLAQRGWRVTVLERRPRPYKLPRAT
FT                   SFDGETARLLAATGIGPDLGRITAPANGYQWQTADGQTLLDIAFTTDGPYGWPDANTMH
FT                   QPALEELLAARAADLPGITVLRGHEVVAITDGDSFVQVTATGEDDVPRTISGRWVVGCD
FT                   GANSFVREHLDVPVTDLGFSYEWLLCDVRLNEPREFVPTNVQICDPARPTTLVGSGPGR
FT                   RRWEFMRLPGENAAELNKDETAWRLMAPFGVTPETATLLRSTTYIFQARWADRWRVGHV
FT                   LLAGDAAHLMPPFAGQGMCSGIRDVTNLAWKLDLTLRGLAPESLLDSYGDERREQAREA
FT                   ILASVQLGRVICVTDPAAAAERDSTVLANRRGKPAGRPEPAKPLTGGLRHESPGAGVVV
FT                   PQGRVQVGDATGLFDDVIGRGFVLLTTEETHSDFLTELGAHVVRLDEGVDVDDVYRPFL
FT                   ARFGAASVLVRPDYHVFGTAGPGGLEALVGALRDRLRAAVPTG"
FT   gene            complement(706891..708102)
FT                   /locus_tag="AMED_0647"
FT   CDS_pept        complement(706891..708102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0647"
FT                   /product="putative acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42467"
FT                   /db_xref="GOA:A0A0H3CUZ5"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR031641"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CUZ5"
FT                   /protein_id="ADJ42467.1"
FT                   /translation="MTRAAVRRALAPSESIHAVKEAYIGYTVRAEGRLDPEALTTAFEA
FT                   VTRAYPQLSACVEFTGEGAVLAESDARPEIRFADGDPGRPLEGLDLDQSRSLSALNVVR
FT                   DGDEASVCLAIQHSVADAHHATAILSALWSCYTDVIEGVPLDLGRHPYPRSLEDLLAER
FT                   GIHASVPAAPSVPPAAPPPASRPDPVIRHVVQHRLTEAETTALAELGHREKVTINGLVS
FT                   GAVLLAEAEIRDLPLTDLVYRYSVNLRSRLTPPVGATEGTNVLGGVGFKVTDGIAHDAV
FT                   AIGRAIGEQLRAGLADGSVQRSILDMFARPAAAKPWDPKLALAVVSIMNWGVAPPMRTP
FT                   DGLRLTNLHSASRMRETLALGGYVMSSFGGRVGLDVGWPEGDPSLPQRLDCLRERLARL
FT                   TRDL"
FT   gene            complement(708099..708851)
FT                   /gene="rifR"
FT                   /locus_tag="AMED_0648"
FT   CDS_pept        complement(708099..708851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rifR"
FT                   /locus_tag="AMED_0648"
FT                   /product="oleoyl-(acyl-carrier-protein) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42468"
FT                   /db_xref="GOA:A0A0H3CVZ3"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR012223"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVZ3"
FT                   /protein_id="ADJ42468.1"
FT                   /translation="MRRFERAPDARARLVCLPHAGGSASFFFPLAKALAPAVEVLAVQY
FT                   PGRQDRRHEPPVDSIGGLTNRLLEVLRPFGDRPLALFGHSMGAIIGYELALRMPEAGLP
FT                   APVHLFASGRRAPSRYRDDDVRGASDERLVAELRKLGGSDAAMLADPELLAMVLPAIRS
FT                   DYRAVETYRHEPGRRVDCPVTVFTGDHDPRVSVGEARAWEEHTTGPADLRVLPGGHFFL
FT                   VDQAAPMIATMTEKLAGPALTGSTGGNS"
FT   gene            complement(708898..710172)
FT                   /locus_tag="AMED_0649"
FT   CDS_pept        complement(708898..710172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0649"
FT                   /product="cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42469"
FT                   /db_xref="GOA:A0A0H3CX09"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CX09"
FT                   /protein_id="ADJ42469.1"
FT                   /translation="MAMTATAKPSAKPVDLFSPEVVADPFGWYARLREEPLPHTGTLNL
FT                   GTMMGGPDMWLATRYEDVLTVLTDPRFLTNPPADSPLADIRDGVFKAMNFPEDLIPWMA
FT                   NKLNTADGEDHTRLRKLVSYALTARRVNALRPRVEKITEDLLDRMAEQGKDGSPVDIVE
FT                   EFCFPLPVTVICELVGIDEPDRAAWHAWGNAMATMDGPKIPPALRECIALSRELMARRR
FT                   VEPKDDLVTALVQAQADDPGRVSDDEIVGILFSLVTAGHQTTTYLIGNSVLFLLEQPEQ
FT                   LARLKAEPALWAQAVRELQRLGPLQFTQARFPSEDVELGGVTIPRGTPVAPLLLAANTD
FT                   PRKFPEPDKLVVDRLSVANEMHLSFGKGIHRCLGQHLAYQEAEVALHGLFTRFPDLALA
FT                   VPRDEIPWILRPAFTRTKTLPLKLA"
FT   gene            710432..711250
FT                   /locus_tag="AMED_0650"
FT   CDS_pept        710432..711250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0650"
FT                   /product="methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42470"
FT                   /db_xref="GOA:A0A0H3CWN7"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR020803"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWN7"
FT                   /protein_id="ADJ42470.1"
FT                   /translation="MTKPTPNEIGKGYDAFADLLDQLWGENLHHGYWDDESATLEEATT
FT                   RLTDRLAGMLPLRAGDRLLDIGCGNGEPAIRMATANDVMVTGISISEKQVERANDRAYK
FT                   ADVDDRVVFEYADAMELPYPDASFDVVWALESLHHMPDRWHVIRQAARVLRPGGRLALG
FT                   DFLLVPSPAGLEADAERVREVGKGVVAVVSLDEYQAHLREAGLEPESAEDVSQYTRPSW
FT                   TKAAERFEGLREQALQHIEAAQFEVTLGRFRAFSEEPSLGYVLLTARKPD"
FT   gene            711265..711957
FT                   /locus_tag="AMED_0651"
FT   CDS_pept        711265..711957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0651"
FT                   /product="transketolase N-terminal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42471"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYV1"
FT                   /protein_id="ADJ42471.1"
FT                   /translation="MQMTEENLRGLFGRMTGDEKHGWAAASTLHAIWVLYERVLNVSPS
FT                   NIDDPGRDRFYLSKGHGPMAYYAVLAAKGFIEPETLDTWRQWGSPLGMHPDRNLAPGVE
FT                   ISSGSLGHGLPLGVGTALGLRAQGRDARVVVLMGDGEFDEGSNHETMAIAGRLGLGSLT
FT                   AVVIDNKTASLGWPGGIAGRFEQEGWAATTVDGRDHDALEKALTGETDGRPRAVIAEIL
FT                   PIEEGSTA"
FT   gene            711954..712865
FT                   /locus_tag="AMED_0652"
FT   CDS_pept        711954..712865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0652"
FT                   /product="transketolase C-terminal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42472"
FT                   /db_xref="GOA:A0A0H3CV00"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV00"
FT                   /protein_id="ADJ42472.1"
FT                   /translation="MTAQVTRKQMRTVFAETVIESLATDPRVVMLTADISSWFFWEVKK
FT                   DFPDRVHNFGIREQAMIDIAGGFALAGQRPVVHTYAPFLVERPFEQIKIGLGHQDVGAV
FT                   LVSVGASYDDPSWGRTHQAPGDVALLDTLPGWTVHVPGHEDEVAPLLSKAIAGDNRVYV
FT                   RLSERANSEAVPVSEKFTVLRRGKAGVVLAVGPVLDQVLAATATADVTVLYASTIRPFD
FT                   HAGLREAVAAAAPNVVLVEPYLRGTSAFEVTEALGDVPHRLRSFGTWRDREARVYGTPE
FT                   EHDRLFGVDAESLADSIARFVG"
FT   gene            complement(713126..714388)
FT                   /locus_tag="AMED_0653"
FT   CDS_pept        complement(713126..714388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0653"
FT                   /product="cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42473"
FT                   /db_xref="GOA:A0A0H3CVZ6"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="PDB:5YSM"
FT                   /db_xref="PDB:5YSW"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVZ6"
FT                   /protein_id="ADJ42473.1"
FT                   /translation="MTTKVTENAPSTESLRSPLPPEFVRREDPFHVPPALVAVSERGPV
FT                   ARATLAAGDPFWLVSGYEEARAVLSDPRFSSDRFQYHPWFKELSPEFRERLRDDKARAG
FT                   SFINMDPPEHTRYRKLLTGQFTVRRIRELGARIDEIVAGRVDAMLAGGTTADLMTEFAF
FT                   PAPSLMICELLGVRYEDRAEFQQRASALLQMNAPVAEAVKNADALRAFMQALVTDKRAN
FT                   PAGDIISGLIHHAGADPALTDDELINIANLLLIAGYDTTASMLGLGIFVLLQRPAQLAT
FT                   LRDDPSRIADAVEELLRYLSVVNPGIFRFAKEDLEFAGEHIPAGSTVVVSVVATNRDAR
FT                   HWPDPDLDLTRPRGPHLAFGHGVHQCLGQQLARMEMQAGYAELLRRLPNVRLAVPPEEV
FT                   PLRNDMLTYGVHSLPIAWDAP"
FT   gene            714576..715031
FT                   /gene="rifJ"
FT                   /locus_tag="AMED_0654"
FT   CDS_pept        714576..715031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rifJ"
FT                   /locus_tag="AMED_0654"
FT                   /product="aminoDHQ dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42474"
FT                   /db_xref="GOA:A0A0H3CX17"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CX17"
FT                   /protein_id="ADJ42474.1"
FT                   /translation="MPDVLLLNGPNLGVLGRREPEIYGTDTLADIEKAVAEEVRPRGWT
FT                   VVPVQRDGEGELVGAIHQHRDTTVGAIVNPGALMIAGWSLRDALASYEPPWIEVHLSNV
FT                   WAREQFRHDSVIAPLASGVVVGLGAFGYRLAAQALLHLSAESPNGLR"
FT   gene            715658..716872
FT                   /locus_tag="AMED_0655"
FT   CDS_pept        715658..716872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0655"
FT                   /product="LuxR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42475"
FT                   /db_xref="GOA:A0A0H3CWP2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWP2"
FT                   /protein_id="ADJ42475.1"
FT                   /translation="MQRSCDTAGFLRRSASSWFNGRLDTGLHCARAAATGNRRESDELS
FT                   QLARFWYVGLLIKARDLDAGRRVLESAEADRGGAASDRMTAVEHNVRGSLLFAMGSVDD
FT                   AMAEISTGLRIAERCGDRSLRPPSYVVLALGALRRADMRACRHFVDKLSDEALLGYFGQ
FT                   APGAWVAAQAVEARSGVESAASLIAGIVTNPVVLRQLLVSEPAAASWLVRACVKLGAHD
FT                   LAKASAAESAALAAEQPEFSVIRGSALHAAGLLEQDAAKLHEAADIHPDRWCAASARED
FT                   LASLLTVRCSERDRTIRILESVLDTYTSVSATRDSARVVNKLREYGVRRGTTRTVECEG
FT                   TVPHGLTNTEFAVAELVSQGHTNNEVGRQLFISRHTVAFHLKKVFQKMNLTSRVELAAA
FT                   WKVFS"
FT   gene            717901..721404
FT                   /gene="rpoB"
FT                   /locus_tag="AMED_0656"
FT   CDS_pept        717901..721404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="AMED_0656"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42476"
FT                   /db_xref="GOA:A0A0H3CYV6"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYV6"
FT                   /protein_id="ADJ42476.1"
FT                   /translation="MAVSPANQATAATTSAESRSEATGIPGAPKRVSFAKIREPLNTPN
FT                   LLDVQIQSFQWFTGDEAWFQRRVEEGEENPVGGLEEVLNEISPIEDFSGSMSLSFSAPR
FT                   FDEVKASIEECKDKDMTYAAPLFVTAEFVNNNTGEIKSQTVFLGDFPVMTDKGTFVING
FT                   TERVVVSQLVRSPGVYYSKDIDKTSDKDVFSVRVIPSRGAWLEFDVDKRDTVGVRIDRK
FT                   RRQPVTVLLKALGWTTEAIRERFSFSETLLATLEKDHTAGTDEALLDIYRKLRPGEPPT
FT                   KESAQTLLENLFFKAKRYDLAKVGRYKVNKKLGLSTPIENGTLTEEDIVTIIEYLVRLH
FT                   AGEDKMTAANNTEIPVETDDIDHFGNRRIRTVGELIQNQIRVGLSRTERVVRERMTTQD
FT                   VEAITPQTLINIRPIGAAIKEFFGTSQLSQFMQQTNPIDGLTHKRRLNALGPGGLSRER
FT                   AGMEVRDVHPSHYGRMCPIETPEGPNIGLIGSLCSYARVNPFGFIETPYRKVVEGRVTD
FT                   QIDYLTADEEDRFVKAQANAPISDDGTFIEDRVMARRKGGEVELIDPLDIDYMDVSPRQ
FT                   MVSIATAMIPFLEHDDANRALMGANMQRQAVPLLRSQAPYVGTGVELRAAIDSGDMLVA
FT                   EQSGVVEELSADLITVMHDDGTRKSYSLYKFRRSNHGTCFNHRPIVNEGDRIEAGQVIA
FT                   DGPSTENGEVALGKNLLVAVMPWEGHNYEDAIILSERLVQDDVLTSIHIEEHEIDARDT
FT                   KLGAEEITWDIPNVSEEVLADLDERGIIRIGAEVRDGDILVGKVTPKGETELTPEERLL
FT                   RAIFGEKAREVRDTSLKVPHGETGKVIGIRVFSREDDDELPPGVNELVRVYVAQKRKIQ
FT                   SGDKLAGRHGNKGVIGKILPVEDMPFMEDGTPVDIILNTHGVPRRMNIGQILELHLGWL
FT                   ASQGWTIEGDPDWAKNLSAELRDVAPGTNTATPVFDGAKEEELTGLLSATKPNRDGERM
FT                   VKENGKANLFDGRSGEPYPYPVAVGYMYILKLHHLVDDKIHARSTGPYSMITQQPLGGK
FT                   AQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDVVGRVKVYEAIVKGENIPEPGIPE
FT                   SFKVLLKELQSLCLNVEVLSSDGSSIEMRDSDDEDLERAAANLGINLSRNESPSVDDVV
FT                   H"
FT   gene            721503..725414
FT                   /gene="rpoC"
FT                   /locus_tag="AMED_0657"
FT   CDS_pept        721503..725414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="AMED_0657"
FT                   /product="DNA-directed RNA polymerase subunit beta'"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42477"
FT                   /db_xref="GOA:A0A0H3CV04"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV04"
FT                   /protein_id="ADJ42477.1"
FT                   /translation="MLDVNFFDELRIGLATADDIRQWSYGEVKKPETINYRTLKPEKDG
FT                   LFCEKIFGPTRDWECYCGKYKRVRFKGIICERCGVEVTRAKVRRERMGHIELAAPVTHI
FT                   WYFKGVPSRLGYLLDLAPKDLEKIIYFAAYVITGVNTELRHNDLPTLENEIGVERKNLE
FT                   TKRDADIEARAQKLEADLAALEAEGAKSDVRRKVKEGGEREMRQLRDRAGRELDRLEEV
FT                   WTTFTKLDTRQLIADELLYRELVDRYGEYFTGGMGAEAIQKLATEFDVSAEADNLRDTI
FT                   RNGKGQKKLRALKRLKVVAAFQATGNDPRGMVLDAVPVIPPDLRPMVQLDGGRFATSDL
FT                   NDLYRRVINRNNRLKRLIDLGAPEIIVNNEKRMLQEAVDALFDNGRRGRPVTGPGNRPL
FT                   KSLSDLLKGKQGRFRQNLLGKRVDYSGRSVIIVGPQLKLHQCGLPKDMALELFKPFVMK
FT                   RLVDLNHAQNIKSAKRMVERSRPQVWDVLEEVITGHPVMLNRAPTLHRLGIQAFEPQLV
FT                   EGKAIQLHPLVCEAFNADFDGDQMAVHLPLSAEAQAEARILMLSANNILSPASGRPLAM
FT                   PRLDMVTGLFHLTRLTETAEGAGNAYSSPAEAIMAYDRKALSLHAPVKIRITDRQPAKA
FT                   DEARLAEKGWEPGKAWLAETTLGRVLFNELLPADYPFINEPMPKKRQAAIVNDLAERYS
FT                   MTQVAQTLDRLKDAGFYWATRSGVTVAISDVLTPVGKKAILDEYEGKASQVEKRYQRGQ
FT                   LSHAERNNELVKVWTQATEEVHKIMETALPDDNPIAMIVKSGAAGNMTQVRSLAGMRGL
FT                   VSNPKGEYIPRPIKANFREGLSVAEYFIATHGARKGLADTALRTADSGYLTRRLVDVSQ
FT                   DVIVRETDCGTTRGIMMPIGEDIGDGKVLRDQHVETSVYARNLATDAVDAKGNVVLNAG
FT                   DDIGDPAIDKLLSSGISKVKVRSVLTCESVVGICATCYGRSMATGLLVDVGEAVGIVAA
FT                   QSIGEPGTQLTMRTFHQGGVAGDDITTGLPRVQELFEARVPKGKAPIADVDGRVRIEES
FT                   ERFWKITLIPDDGGEEIVFDKLSKRQRLANTPNGPLGDGDHVHVGQQLLEGTPDPHEVL
FT                   RVMGPREAQIHLVDEVQKVYRAQGVSIHDKHIEVIVRQMLRRVTIIDSGATDFLPGELP
FT                   ERTKFEATNRAAVAEGGEPASGRPVLMGITKASLTTDSWLSAASFQETTRVLTDAAING
FT                   RSDKLVGLKENVIIGKLIPAGTGINKYRNIQVQPTEEARVAAYAIPSYDDGYYTPDVFG
FT                   TGTGAAVPLDDYDFGRDFR"
FT   gene            725645..727348
FT                   /locus_tag="AMED_0658"
FT   CDS_pept        725645..727348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0658"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42478"
FT                   /db_xref="GOA:A0A0H3CW01"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW01"
FT                   /protein_id="ADJ42478.1"
FT                   /translation="MLTSVFAGPAAADEPTPTTTAPATSEAPSTSEAPTTAPSSTEPEN
FT                   KPAAAQPQAAADERPQVKASVVLGKEVYQSDEDVHFTFTLTNTGTVPAKGLQIAQSLSK
FT                   PTDLVVLFDDGGWGPLVRKPGVDLDPGKSFELQITGKIRDITQPETVVEGQAFDSDGRY
FT                   VTDFGGRAKVEQKILPARGTVYGDRNGNGVFDDGEQLAGIPLALQYLNGSNRYPATSGP
FT                   DGKVDFGKVPSAVYYLGGVPVGDWLIPLQHIHIGANSTDLLIRAVPPLHGALKASMAFT
FT                   QDSYQAGDLAHLTVTLSNSGPIPLTGIVAACDRFGSDFALKGGPGWGDLDTFADGVAIA
FT                   PGQTRTFDVTERVPEAARTSGIVTADCDFGYREVGTDEHPNVGAQAAVPGAKATLVGDV
FT                   AVYDDRGQVKQGIAGTKVVLVSDRHCPVVAEQTTDEKGHFEFHDVVPGPEYRVFFLPPA
FT                   GWKIKDGNPWEIFVRGPADRPVTLRVGAEQGDAPLPEVPGNPADCTAGAPATPSTGAAG
FT                   ANGGTGGGQSGGSGLASTGVDAIGLGALALLALALGGGLVFGARRRRRTI"
FT   gene            complement(727406..728191)
FT                   /gene="vanA"
FT                   /locus_tag="AMED_0659"
FT   CDS_pept        complement(727406..728191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vanA"
FT                   /locus_tag="AMED_0659"
FT                   /product="D-alanyl-D-alanine dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42479"
FT                   /db_xref="GOA:A0A0H3CX22"
FT                   /db_xref="InterPro:IPR000755"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CX22"
FT                   /protein_id="ADJ42479.1"
FT                   /translation="MPIFTRRVRALAVTLAATAGLAVPMPAQAAPSKAFVALSDVAPSI
FT                   LQDIRYDTRHNFVGRRIDGYRQPLCILTRQAAEGLRKAQAELLRQGYTLKVYDCYRPQR
FT                   AVDHFVRWAKDLADEKMKAEFYPDVAKDRLFADGYIAEKSGHSRGSTMDLTLVRLPPPF
FT                   QRPYVPGEPLQACFAPRDQRFPDNTVDMGTGYDCFDPLAHTDNPAITGTARQHRDLLRS
FT                   TMAAAGFRNLPEEWWHFTLNGEPFPDTYFDFPVSRGSLH"
FT   gene            complement(728251..728751)
FT                   /gene="lrp"
FT                   /locus_tag="AMED_0660"
FT   CDS_pept        complement(728251..728751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lrp"
FT                   /locus_tag="AMED_0660"
FT                   /product="Lrp/AsnC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42480"
FT                   /db_xref="GOA:A0A0H3CWP6"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWP6"
FT                   /protein_id="ADJ42480.1"
FT                   /translation="MTFRSEKALDDVDWRLLDLLQADGRLSFKELGRRINLSAPAVAER
FT                   VRRLEETGVITGYRAQVDARRAGQPLQAFVEMRCALSSCLLKTSKSEDYPEVVEIHRLS
FT                   GDHCTMLKIRAASLEHFEGLLERLGKHGELRSSVVLSTQFEGRPVQPPSDDFLRATTSE
FT                   GWS"
FT   gene            728847..730088
FT                   /locus_tag="AMED_0661"
FT   CDS_pept        728847..730088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0661"
FT                   /product="major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42481"
FT                   /db_xref="GOA:A0A0H3CYW0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYW0"
FT                   /protein_id="ADJ42481.1"
FT                   /translation="MGTSTVTGRTRSMGALFAGVALLNTATVGLGTAATLIVAAGSGAV
FT                   WSGLPSVANVLGTAAGALGAGRLLPVHGSRRVLAGGYGLAAAGALVAFAGALATSVVPL
FT                   LLGILLVGLGNGGAQLSRYLAADLYPQDRRGRALSTVVWGGTVGALAGPALMVPAAGAA
FT                   AGFGWPSLSGPAAVAVLATAGAALAAAFLPRHVPPPRQPGLRPGPGAPPPEPPKSPPRE
FT                   PAVAARGPVRPAGFVRPLVAMVLAQLTMSAVMTMTPVQLQAHGHDLGVVGWVLSAHLFG
FT                   MFALAPLSGRIADRWGPHVAVNAGLGVLALAAATALAAPTAHTSGLPIALFLLGYGWNL
FT                   VFVGGSAQLSRDLAPETRSRVQGTVDAVVWSASALAGLGSGALFAGGGYGLVAVVGGVL
FT                   AVLPLAFSAARDGR"
FT   gene            730162..730791
FT                   /locus_tag="AMED_0662"
FT   CDS_pept        730162..730791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0662"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42482"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV08"
FT                   /protein_id="ADJ42482.1"
FT                   /translation="MPFTDNFSDLSNTQGYQFEFRCERCGNGFRSAFQRDNVETGRSVL
FT                   RAVGSFFGGTLRDLSNSADQWRYDRATNSPAKDKALAAAVEEITPSFRQCRGCGDWMCQ
FT                   DQCWNEEIGQCLRCSPSVAEEISRAQAAAQRDQIWDKARDKDWTAGLDLDTRAKVSCPG
FT                   CGLKADGGKFCSSCGTSLAMKVTCGGCGSESNKPDALFCSDCGTKL"
FT   gene            731001..731723
FT                   /locus_tag="AMED_0663"
FT   CDS_pept        731001..731723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0663"
FT                   /product="CRP/FNR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42483"
FT                   /db_xref="GOA:A0A0H3CW05"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW05"
FT                   /protein_id="ADJ42483.1"
FT                   /translation="MAADGASGNGTEWPGGTVMSRLPGALGGELLRLGSPKPCPAGTVL
FT                   LHQGEPSTHVFLLGHGKQPRLACVKVTAAARNGTESLLGIRVSGDLVGEMGVLRDGPRA
FT                   ATVTVCRAMTVHRIPLEHFRSFLRRREEAWRVVCHMIADRLDWANRRRLDFAGYDTAVR
FT                   LARVLLELADYHGAPGEAGIRLGIQLSQPEFGKLIGAGRDAIQLAVRQLKEKNYIAYRY
FT                   RTVTILDLNGLAAFADPG"
FT   gene            731864..732571
FT                   /locus_tag="AMED_0664"
FT   CDS_pept        731864..732571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0664"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42484"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CX26"
FT                   /protein_id="ADJ42484.1"
FT                   /translation="MDVQGYGGRDDRQHASIQSGLLAVADTAAGRCGLDRTTWHRQGAG
FT                   DGELAILPPGTPEPAVVDDYVRELVTALADHNHDLAAENRMRIRIAIHHGVAMPGANGW
FT                   TGQGVVGVSRLVDSAPVRGALRAFPAADLAVLVSRQIYTDVVAQRHTSLKPGEFREVVV
FT                   RQKEFTDVAWLRVPGHDVHGAQLSADPPRVPADSAGTRVTGAAGHSYRADAITVVNGSV
FT                   DAPNAVFGIKHGS"
FT   gene            732568..734589
FT                   /locus_tag="AMED_0665"
FT   CDS_pept        732568..734589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0665"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42485"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWQ1"
FT                   /protein_id="ADJ42485.1"
FT                   /translation="MSEEEPAEKPAETPEPAPGDDYTEQLAGVVNQFNGTIYADAAQFG
FT                   IGPQRPARVKAAAGKLDDTDVRADLSHYVTPACYDTALGALRKDHVVGLHGDRGTGKRA
FT                   GAIALLREVTDGPLYLLSPMNRLKSLAERDYAAGSGYIIADRIAERKAADVDFTWRTVR
FT                   DRVRDQGAYLVVTTTTPTACGEVDAVTHVRWAQPDPRQVLRVRLAGLDGVDEIVERVLR
FT                   AWPDGGQLTDLVAVAADLGEGLTVEEALPKLDASLHDRVRTWFDEERDERDFLAATALA
FT                   FLDGARQRTFESALGKLEAKLAEAVVGDEPDLGERPQPELLRQHRLKLYAPDSLIKVER
FT                   AGSDGVARHCPRFREPRYRRFVLAELWAREEAPFWDGVSAWLDEVMPEEGLRVAAGLAE
FT                   LARYAFDEVDDILAPWADGKSGWPGQTTATHVLWLLSYDEALAPEALQLAAQWAGRGTP
FT                   AERWTGAVALSGELGARYPHEAANRLWQLILQSHTVTGDAHVALAALFVTLTRRTEDAG
FT                   VVLTLLDGKVRRLDKPGTKPEYIRAATRATLSVLAARDRISGRHAATTHLCRVGDRTAP
FT                   VQGRLWATVLRNRPTRKRALSVLRSALDDLKHLCDDPVAVATSLGLAISAALPPGEADL
FT                   LRADFFALEARTRKDSSPLVEHLLAAISHLHREAAALP"
FT   gene            734586..735977
FT                   /locus_tag="AMED_0666"
FT   CDS_pept        734586..735977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0666"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42486"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYW4"
FT                   /protein_id="ADJ42486.1"
FT                   /translation="MTEPYPIVEQRPLDPAQTKGKFFWRKEYREHGELPRPNAHQVFVY
FT                   RVDGEYVLDSAQRRLDEEQVVRATHVSLVDLTRDAEVIVELAIPSAEADDFTMRVTFVC
FT                   TVTNAVSVVREGRGDAQTLLRAYLKSHHRIFELGLEYRLLQINDVRRDVNAQVKAFTTL
FT                   KPPVISGIAVELRSVEVLTPDEYRQLMGSRRSLEYQHELNTTQQRLDHSLTAERQHHDQ
FT                   YLERDRSGHDHRQTTERLAHEQRLEWERVHHSGVVGIEQQRYELDRLADRKAFDRHQRG
FT                   QDREEMTALAEIIRNNPDSALANAYVAGSLDATEMAERLLVENRYRGEVERTERQAEFD
FT                   RRHEARLYEIEHRNEQRRWSREQSREERKWRREDHGLARAETRRKEEITLEVIRELGKH
FT                   GYLDMTNLDPNLLITKLTGAPPREQLEGGGKAEPAAGDQASSAPRAEPEDTEDDDTGVR
FT                   EEDVS"
FT   gene            736039..737307
FT                   /locus_tag="AMED_0667"
FT   CDS_pept        736039..737307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0667"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42487"
FT                   /db_xref="GOA:A0A0H3CV13"
FT                   /db_xref="InterPro:IPR025519"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV13"
FT                   /protein_id="ADJ42487.1"
FT                   /translation="MDPHRGLGRRLRALAGIREEILDWVPEERPRYTRLGAIIFNTGLL
FT                   AGLSLLVALSDLSTVPWIFLLPAGALWAYVIISFDGWLISSTHGMLGAGKTRVFVPRLV
FT                   ISLLMGAVIAEPLLLWIFQPAIHKEVLDGRQNELSAYESQYRSCNPEGAPALKTPECAN
FT                   FQLTIKNSPDAAQQELDKASKNRDAAKTEYDFLYAQWDQLEKLARAECSGARGEGLTGV
FT                   AGDGPECDRNRQVADRFRTDNQLEKRQADLTAANTNIDGLTAKLGSARQTAGQQVSDAI
FT                   TAKVTSMREHQGVIGILDEDEALGRLSDRSVLVFAAQWLVRLLLIAIDCMPVLTKLMSG
FT                   STAYDVLVSRQIEVARRLHEKHVTLRERQDTADNDVWLQRTEYNLRTRVDSIEEADRSA
FT                   RARRESDLDAEIDRLAAKLRNQQ"
FT   gene            737374..737598
FT                   /locus_tag="AMED_0668"
FT   CDS_pept        737374..737598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0668"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42488"
FT                   /db_xref="GOA:A0A0H3CW10"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW10"
FT                   /protein_id="ADJ42488.1"
FT                   /translation="MTPVTKRLTVVAVVLITAGAVLLAVGAIGFRATSDQPDANIGAGF
FT                   ALLAGPYVVGLGLVFALSAGLTHLTTRRR"
FT   gene            complement(737579..737854)
FT                   /locus_tag="AMED_0669"
FT   CDS_pept        complement(737579..737854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0669"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42489"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CX31"
FT                   /protein_id="ADJ42489.1"
FT                   /translation="MPAGPELWIGPGRPVSMPTLPPDSALDAELARRLAANPRFGQREV
FT                   VVENGSARTWGPGCATRQNLTAEASYLAELADHLPAALWNVSGGAS"
FT   gene            complement(738376..738657)
FT                   /locus_tag="AMED_0670"
FT   CDS_pept        complement(738376..738657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0670"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42490"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWQ4"
FT                   /protein_id="ADJ42490.1"
FT                   /translation="MPGEFEQLVAEYERFQAGVRHVDDRFAGLGAMQQQLTGLRASAAS
FT                   ADGGVTVVTGPGGAVLDVELTEAALAKGPHALSATLLATLREGSSTAC"
FT   gene            738815..738970
FT                   /locus_tag="AMED_0671"
FT   CDS_pept        738815..738970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AMED_0671"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42491"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYW9"
FT                   /protein_id="ADJ42491.1"
FT                   /translation="MTSTEGAAGPAEEPKSTGSHAAPEGAGVHPLIDLSRDPNPGKPDH
FT                   AKPDED"
FT   gene            739875..740249
FT                   /gene="rpsL"
FT                   /locus_tag="AMED_0672"
FT   CDS_pept        739875..740249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="AMED_0672"
FT                   /product="small subunit ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42492"
FT                   /db_xref="GOA:A0A0H3CV17"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV17"
FT                   /protein_id="ADJ42492.1"
FT                   /translation="MPTIQQLVRKGRQDKAAKQKTAALKGSPQRRGVCTRVYTTTPKKP
FT                   NSALRKVARVKLTSGIEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDT
FT                   QGVKNRKQARSRYGAKKEKS"
FT   gene            740249..740719
FT                   /gene="rpsG"
FT                   /locus_tag="AMED_0673"
FT   CDS_pept        740249..740719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="AMED_0673"
FT                   /product="small subunit ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42493"
FT                   /db_xref="GOA:A0A0H3CW16"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW16"
FT                   /protein_id="ADJ42493.1"
FT                   /translation="MPRKGPAPKRPLISDPVYASPLVTQLVNKVLKDGKRSLAERIVYG
FT                   ALEGAREKTGTDPVVTLKRALDNVKPTIEVKSRRVGGATYQVPIEVKPGRSTTLALRWL
FT                   VSFSQARREKTMIERLQNELLDASNGLGASVKRREDTHKMAESNRAFAHYRW"
FT   gene            740783..742882
FT                   /gene="fusA"
FT                   /locus_tag="AMED_0674"
FT   CDS_pept        740783..742882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="AMED_0674"
FT                   /product="elongation factor EF-G"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42494"
FT                   /db_xref="GOA:A0A0H3CX36"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CX36"
FT                   /protein_id="ADJ42494.1"
FT                   /translation="MAREVLTDLNKVRNIGIMAHIDAGKTTTTERILFYTGVNYKIGEV
FT                   HDGAATMDWMEEEQKRGITITSAATTTFWDDHQINIIDTPGHVDFTVEVERNLRVLDGA
FT                   VAVFDGKEGVEPQSEQVWRQADKYDVPRICFVNKMDKLGADFYYTVKTIVDRLGVRPLV
FT                   IQLPIGAENDFEGVVDLVRMKALTWRGEVQKGEDYSVEDIPAELAEKAAEYREKLVETV
FT                   AEADDALMEKFLEGEELTEAEIKAGIRKLTITSQVFPVLAGSAFKNKGVQPMLDAVIDY
FT                   LPTPLDVPAVEGLLPDGETVASRKASVDEPFAALAFKIAAHPFFGKLTYIRVYSGKVAA
FT                   GAQVINATKERKERIGKIFQMHSNKENPVDDAQVGHIYAVIGLKDTTTGDTLADPQNPI
FT                   VLESMTFPEPVIRVAIEPKTKADQEKLSLAIQKLAEEDPTFQVKLDEDTGQTIIAGMGE
FT                   LHLEVLVNRMKSDYKVEANIGKPQVAYRETIKKTVDKLDYVHKKQTGGSGQFAKVIVKL
FT                   EPLERTDGALYEFDNKVTGGRVPREYIPSVDAGAQDAMQYGVLAGYPLVGLKFTLLDGA
FT                   YHEVDSSEMAFKIAGSMAMKEAAKKAGPVILEPMMAVEVTTPEDYMGDVIGDLNSRRGQ
FT                   IQAMEERAGTRVVKALVPLSEMFGYVGDLRSRTQGRANYSMVFDSYAEVPANVAKEIIA
FT                   KATGE"
FT   gene            743015..744208
FT                   /gene="tufA"
FT                   /locus_tag="AMED_0675"
FT   CDS_pept        743015..744208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tufA"
FT                   /locus_tag="AMED_0675"
FT                   /product="elongation factor EF-Tu"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42495"
FT                   /db_xref="GOA:A0A0H3CWR0"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWR0"
FT                   /protein_id="ADJ42495.1"
FT                   /translation="MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITKVLHDKYPELNE
FT                   SRAFDQIDNAPEEKQRGITINISHVEYQTEKRHYAHVDAPGHADYIKNMITGAAQMDGA
FT                   ILVVAATDGPMPQTREHVLLARQVGVPYIVVALNKADMVDDEEILELVELEVRELLSSQ
FT                   EFPGDDAPVVRVSGLKALEGDEKWSEAVLELMSAVDNNVPDPVRELDKPFLMPIEDVFT
FT                   ITGRGTVVTGRVERGQINVNEEVEIVGIREKSTKTTVTGVEMFRKLLDSGQAGDNVGLL
FT                   VRGIKREDVERGQVVVKPGTTTPHTDFEGRVYILSKDEGGRHTPFFNNYRPQFYFRTTD
FT                   VTGVVTLPEGTEMVMPGDNTDITVALIQPVAMDEGLRFAIREGGRTVGAGQVTKIIK"
FT   gene            744602..744907
FT                   /gene="rpsJ"
FT                   /locus_tag="AMED_0676"
FT   CDS_pept        744602..744907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="AMED_0676"
FT                   /product="small subunit ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42496"
FT                   /db_xref="GOA:A0A0H3CYX7"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYX7"
FT                   /protein_id="ADJ42496.1"
FT                   /translation="MAGQKIRIRLKAYDHEAIDTSARKIVETVTRTGARVVGPVPLPTE
FT                   KNVYCVIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNIQ"
FT   gene            744942..745598
FT                   /gene="rplC"
FT                   /locus_tag="AMED_0677"
FT   CDS_pept        744942..745598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="AMED_0677"
FT                   /product="large subunit ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42497"
FT                   /db_xref="GOA:A0A0H3CV20"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CV20"
FT                   /protein_id="ADJ42497.1"
FT                   /translation="MSDRQMKGILGTKLGMTQVFDEQNRVVPVTVVKAGPNVVTQVRTQ
FT                   DKDGYTAVQLAFGAVDPRKVNKPRTGHFDKAGVTPRRFLAELRTTDAETYEVGQEITAE
FT                   VFAAGVEVDVTGTSKGKGYAGVMKRHGFKGQGASHGAQAVHRKPGSIGGCATPGRVFKG
FT                   LRMAGRMGNDRVTTQNLTVHAVRADDGLLLIKGAVPGPKGGVLFVRSAAKGGNSE"
FT   gene            745595..746284
FT                   /gene="rplD"
FT                   /locus_tag="AMED_0678"
FT   CDS_pept        745595..746284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="AMED_0678"
FT                   /product="large subunit ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42498"
FT                   /db_xref="GOA:A0A0H3CW20"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CW20"
FT                   /protein_id="ADJ42498.1"
FT                   /translation="MTSVELKTPAGKADGTVDLPEEIFDVQANVALMHQVVVAQQAAAR
FT                   QGTHDTKTRGEVRGGGKKPYRQKGTGRARQGSTRAPQFAGGGVVHGPTPRDYSQRTPKK
FT                   MKAAALRGALSDRARAGQLHVVTELVTGEKPNTKVAKAALAAVTLAKRVLVVLHRDDEL
FT                   SWVSLRNLPEVHILWADQLNTYDVLVNDDVVFTKAAYDAFVAGPVRGKTVKASARSGEV
FT                   TEGSDEK"
FT   gene            746281..746592
FT                   /gene="rplW"
FT                   /locus_tag="AMED_0679"
FT   CDS_pept        746281..746592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="AMED_0679"
FT                   /product="large subunit ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42499"
FT                   /db_xref="GOA:A0A0H3CX41"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CX41"
FT                   /protein_id="ADJ42499.1"
FT                   /translation="MSSVAIPDPRDILLAPVISEKSYGLLEDHKYTFIVRPDANKTQIK
FT                   IAVEKVFGVKVVSVNTANRQGKRKRTRAGFGKRKDTKRAIVTLSPESKAIEIFGGPTA"
FT   gene            746608..747444
FT                   /gene="rplB"
FT                   /locus_tag="AMED_0680"
FT   CDS_pept        746608..747444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="AMED_0680"
FT                   /product="large subunit ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42500"
FT                   /db_xref="GOA:A0A0H3CWR4"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CWR4"
FT                   /protein_id="ADJ42500.1"
FT                   /translation="MGIRKYKPTTPGRRGSSVSDFAEITRSTPEKSLLRPLSGSGGRNS
FT                   SGKITTRHKGGGHKRAYRVIDFRRNDKDGIPAKVAHIEYDPNRSARIALLHYADGEKRY
FT                   IIAPEKLKQGDTVENGPRADIKPGNNLPLRNIPVGTVIHAIELRPGGGAKMARSAGAKV
FT                   QLVAKDGPYAQLRLPSGEIRNVDVRNRATVGEVGNSEHANINWGKAGRNRWRGKRPTVR
FT                   GVVMNPVDHPHGGGEGKTSGGRHPVNPNGKPEGRTRRRKASDALIVRRRRTGKNKR"
FT   gene            747463..747744
FT                   /gene="rpsS"
FT                   /locus_tag="AMED_0681"
FT   CDS_pept        747463..747744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="AMED_0681"
FT                   /product="small subunit ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:AMED_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ADJ42501"
FT                   /db_xref="GOA:A0A0H3CYY4"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CYY4"
FT                   /protein_id="ADJ42501.1"
FT                   /translation="MPRSLKKGPFVDDHLLKKVDALNESGKKTVIKTWSRRSTIIPDFL
FT                   GHTIAVHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKSRRR"
FT   gene            747776..748195
FT                   /gene="rplV"
FT                   /l