(data stored in ACNUC30630 zone)

EMBL: CP002010

ID   CP002010; SV 1; circular; genomic DNA; STD; PRO; 2477838 BP.
XX
AC   CP002010;
XX
PR   Project:PRJNA47579;
XX
DT   01-JUN-2010 (Rel. 105, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Bifidobacterium longum subsp. longum JDM301, complete genome.
XX
KW   .
XX
OS   Bifidobacterium longum subsp. longum JDM301
OC   Bacteria; Actinobacteria; Bifidobacteriales; Bifidobacteriaceae;
OC   Bifidobacterium.
XX
RN   [1]
RP   1-2477838
RX   DOI; 10.1128/JB.00538-10.
RX   PUBMED; 20525832.
RA   Wei Y.X., Zhang Z.Y., Liu C., Zhu Y.Z., Zhu Y.Q., Zheng H., Zhao G.P.,
RA   Wang S., Guo X.K.;
RT   "Complete genome sequence of Bifidobacterium longum JDM301";
RL   J. Bacteriol. 192(15):4076-4077(2010).
XX
RN   [2]
RP   1-2477838
RA   Wei Y., Zhang Z., Liu C., Zhu Y., Zhu Y., Zheng H., Zhao G., Wang S.,
RA   Guo X.;
RT   ;
RL   Submitted (16-APR-2010) to the INSDC.
RL   Department of Medical Microbiology and Parasitology, Institutes of Medical
RL   Sciences, Shanghai Jiao Tong University School of Medicine, South Chongqing
RL   Road No.280 5#503, Shanghai 200025, China
XX
DR   MD5; e7fd000f947bc19784acde7583c022af.
DR   BioSample; SAMN02603181.
DR   EnsemblGenomes-Gn; BLJ_0015.
DR   EnsemblGenomes-Gn; BLJ_0016.
DR   EnsemblGenomes-Gn; BLJ_0078.
DR   EnsemblGenomes-Gn; BLJ_0085.
DR   EnsemblGenomes-Gn; BLJ_0175.
DR   EnsemblGenomes-Gn; BLJ_0176.
DR   EnsemblGenomes-Gn; BLJ_0197.
DR   EnsemblGenomes-Gn; BLJ_0215.
DR   EnsemblGenomes-Gn; BLJ_0237.
DR   EnsemblGenomes-Gn; BLJ_0267.
DR   EnsemblGenomes-Gn; BLJ_0283.
DR   EnsemblGenomes-Gn; BLJ_0300.
DR   EnsemblGenomes-Gn; BLJ_0301.
DR   EnsemblGenomes-Gn; BLJ_0302.
DR   EnsemblGenomes-Gn; BLJ_0387.
DR   EnsemblGenomes-Gn; BLJ_0392.
DR   EnsemblGenomes-Gn; BLJ_0393.
DR   EnsemblGenomes-Gn; BLJ_0553.
DR   EnsemblGenomes-Gn; BLJ_0589.
DR   EnsemblGenomes-Gn; BLJ_0688.
DR   EnsemblGenomes-Gn; BLJ_0722.
DR   EnsemblGenomes-Gn; BLJ_0746.
DR   EnsemblGenomes-Gn; BLJ_0757.
DR   EnsemblGenomes-Gn; BLJ_0758.
DR   EnsemblGenomes-Gn; BLJ_0762.
DR   EnsemblGenomes-Gn; BLJ_0789.
DR   EnsemblGenomes-Gn; BLJ_0886.
DR   EnsemblGenomes-Gn; BLJ_1033.
DR   EnsemblGenomes-Gn; BLJ_1049.
DR   EnsemblGenomes-Gn; BLJ_1050.
DR   EnsemblGenomes-Gn; BLJ_1051.
DR   EnsemblGenomes-Gn; BLJ_1052.
DR   EnsemblGenomes-Gn; BLJ_1053.
DR   EnsemblGenomes-Gn; BLJ_1111.
DR   EnsemblGenomes-Gn; BLJ_1127.
DR   EnsemblGenomes-Gn; BLJ_1128.
DR   EnsemblGenomes-Gn; BLJ_1292.
DR   EnsemblGenomes-Gn; BLJ_1333.
DR   EnsemblGenomes-Gn; BLJ_1334.
DR   EnsemblGenomes-Gn; BLJ_1335.
DR   EnsemblGenomes-Gn; BLJ_1374.
DR   EnsemblGenomes-Gn; BLJ_1553.
DR   EnsemblGenomes-Gn; BLJ_1584.
DR   EnsemblGenomes-Gn; BLJ_1623.
DR   EnsemblGenomes-Gn; BLJ_1642.
DR   EnsemblGenomes-Gn; BLJ_1643.
DR   EnsemblGenomes-Gn; BLJ_1646.
DR   EnsemblGenomes-Gn; BLJ_1671.
DR   EnsemblGenomes-Gn; BLJ_1696.
DR   EnsemblGenomes-Gn; BLJ_1720.
DR   EnsemblGenomes-Gn; BLJ_1766.
DR   EnsemblGenomes-Gn; BLJ_1775.
DR   EnsemblGenomes-Gn; BLJ_1776.
DR   EnsemblGenomes-Gn; BLJ_1777.
DR   EnsemblGenomes-Gn; BLJ_1804.
DR   EnsemblGenomes-Gn; BLJ_1816.
DR   EnsemblGenomes-Gn; BLJ_1817.
DR   EnsemblGenomes-Gn; BLJ_1818.
DR   EnsemblGenomes-Gn; BLJ_1823.
DR   EnsemblGenomes-Gn; BLJ_1948.
DR   EnsemblGenomes-Gn; BLJ_1984.
DR   EnsemblGenomes-Gn; BLJ_1985.
DR   EnsemblGenomes-Gn; BLJ_1986.
DR   EnsemblGenomes-Gn; BLJ_2028.
DR   EnsemblGenomes-Gn; EBG00001441225.
DR   EnsemblGenomes-Gn; EBG00001441226.
DR   EnsemblGenomes-Gn; EBG00001441227.
DR   EnsemblGenomes-Gn; EBG00001441228.
DR   EnsemblGenomes-Gn; EBG00001441229.
DR   EnsemblGenomes-Gn; EBG00001441230.
DR   EnsemblGenomes-Gn; EBG00001441231.
DR   EnsemblGenomes-Gn; EBG00001441232.
DR   EnsemblGenomes-Gn; EBG00001441233.
DR   EnsemblGenomes-Gn; EBG00001441234.
DR   EnsemblGenomes-Gn; EBG00001441235.
DR   EnsemblGenomes-Gn; EBG00001441236.
DR   EnsemblGenomes-Gn; EBG00001441237.
DR   EnsemblGenomes-Gn; EBG00001441238.
DR   EnsemblGenomes-Gn; EBG00001441239.
DR   EnsemblGenomes-Gn; EBG00001441240.
DR   EnsemblGenomes-Gn; EBG00001441241.
DR   EnsemblGenomes-Gn; EBG00001441242.
DR   EnsemblGenomes-Gn; EBG00001441243.
DR   EnsemblGenomes-Gn; EBG00001441244.
DR   EnsemblGenomes-Gn; EBG00001441245.
DR   EnsemblGenomes-Gn; EBG00001441246.
DR   EnsemblGenomes-Gn; EBG00001441247.
DR   EnsemblGenomes-Gn; EBG00001441248.
DR   EnsemblGenomes-Gn; EBG00001441249.
DR   EnsemblGenomes-Gn; EBG00001441250.
DR   EnsemblGenomes-Gn; EBG00001441251.
DR   EnsemblGenomes-Gn; EBG00001441252.
DR   EnsemblGenomes-Gn; EBG00001441253.
DR   EnsemblGenomes-Gn; EBG00001441254.
DR   EnsemblGenomes-Gn; EBG00001441255.
DR   EnsemblGenomes-Gn; EBG00001441256.
DR   EnsemblGenomes-Gn; EBG00001441257.
DR   EnsemblGenomes-Gn; EBG00001441258.
DR   EnsemblGenomes-Gn; EBG00001441259.
DR   EnsemblGenomes-Gn; EBG00001441260.
DR   EnsemblGenomes-Gn; EBG00001441261.
DR   EnsemblGenomes-Gn; EBG00001441262.
DR   EnsemblGenomes-Gn; EBG00001441263.
DR   EnsemblGenomes-Gn; EBG00001441264.
DR   EnsemblGenomes-Gn; EBG00001441265.
DR   EnsemblGenomes-Gn; EBG00001441266.
DR   EnsemblGenomes-Gn; EBG00001441267.
DR   EnsemblGenomes-Gn; EBG00001441268.
DR   EnsemblGenomes-Gn; EBG00001441269.
DR   EnsemblGenomes-Gn; EBG00001441270.
DR   EnsemblGenomes-Gn; EBG00001441271.
DR   EnsemblGenomes-Gn; EBG00001441272.
DR   EnsemblGenomes-Gn; EBG00001441273.
DR   EnsemblGenomes-Gn; EBG00001441274.
DR   EnsemblGenomes-Gn; EBG00001441275.
DR   EnsemblGenomes-Gn; EBG00001441276.
DR   EnsemblGenomes-Gn; EBG00001441277.
DR   EnsemblGenomes-Gn; EBG00001441278.
DR   EnsemblGenomes-Gn; EBG00001441279.
DR   EnsemblGenomes-Gn; EBG00001441280.
DR   EnsemblGenomes-Gn; EBG00001441281.
DR   EnsemblGenomes-Gn; EBG00001441282.
DR   EnsemblGenomes-Gn; EBG00001441283.
DR   EnsemblGenomes-Gn; EBG00001441284.
DR   EnsemblGenomes-Gn; EBG00001441285.
DR   EnsemblGenomes-Gn; EBG00001441286.
DR   EnsemblGenomes-Gn; EBG00001441287.
DR   EnsemblGenomes-Gn; EBG00001441288.
DR   EnsemblGenomes-Gn; EBG00001441289.
DR   EnsemblGenomes-Gn; EBG00001441290.
DR   EnsemblGenomes-Gn; EBG00001441291.
DR   EnsemblGenomes-Gn; EBG00001441292.
DR   EnsemblGenomes-Gn; EBG00001441293.
DR   EnsemblGenomes-Gn; EBG00001441294.
DR   EnsemblGenomes-Tr; BLJ_0015-1.
DR   EnsemblGenomes-Tr; BLJ_0016-1.
DR   EnsemblGenomes-Tr; BLJ_0078-1.
DR   EnsemblGenomes-Tr; BLJ_0085-1.
DR   EnsemblGenomes-Tr; BLJ_0175-1.
DR   EnsemblGenomes-Tr; BLJ_0176-1.
DR   EnsemblGenomes-Tr; BLJ_0197-1.
DR   EnsemblGenomes-Tr; BLJ_0215-1.
DR   EnsemblGenomes-Tr; BLJ_0237-1.
DR   EnsemblGenomes-Tr; BLJ_0267-1.
DR   EnsemblGenomes-Tr; BLJ_0283-1.
DR   EnsemblGenomes-Tr; BLJ_0300-1.
DR   EnsemblGenomes-Tr; BLJ_0301-1.
DR   EnsemblGenomes-Tr; BLJ_0302-1.
DR   EnsemblGenomes-Tr; BLJ_0387-1.
DR   EnsemblGenomes-Tr; BLJ_0392-1.
DR   EnsemblGenomes-Tr; BLJ_0393-1.
DR   EnsemblGenomes-Tr; BLJ_0553-1.
DR   EnsemblGenomes-Tr; BLJ_0589-1.
DR   EnsemblGenomes-Tr; BLJ_0688-1.
DR   EnsemblGenomes-Tr; BLJ_0722-1.
DR   EnsemblGenomes-Tr; BLJ_0746-1.
DR   EnsemblGenomes-Tr; BLJ_0757-1.
DR   EnsemblGenomes-Tr; BLJ_0758-1.
DR   EnsemblGenomes-Tr; BLJ_0762-1.
DR   EnsemblGenomes-Tr; BLJ_0789-1.
DR   EnsemblGenomes-Tr; BLJ_0886-1.
DR   EnsemblGenomes-Tr; BLJ_1033-1.
DR   EnsemblGenomes-Tr; BLJ_1049-1.
DR   EnsemblGenomes-Tr; BLJ_1050-1.
DR   EnsemblGenomes-Tr; BLJ_1051-1.
DR   EnsemblGenomes-Tr; BLJ_1052-1.
DR   EnsemblGenomes-Tr; BLJ_1053-1.
DR   EnsemblGenomes-Tr; BLJ_1111-1.
DR   EnsemblGenomes-Tr; BLJ_1127-1.
DR   EnsemblGenomes-Tr; BLJ_1128-1.
DR   EnsemblGenomes-Tr; BLJ_1292-1.
DR   EnsemblGenomes-Tr; BLJ_1333-1.
DR   EnsemblGenomes-Tr; BLJ_1334-1.
DR   EnsemblGenomes-Tr; BLJ_1335-1.
DR   EnsemblGenomes-Tr; BLJ_1374-1.
DR   EnsemblGenomes-Tr; BLJ_1553-1.
DR   EnsemblGenomes-Tr; BLJ_1584-1.
DR   EnsemblGenomes-Tr; BLJ_1623-1.
DR   EnsemblGenomes-Tr; BLJ_1642-1.
DR   EnsemblGenomes-Tr; BLJ_1643-1.
DR   EnsemblGenomes-Tr; BLJ_1646-1.
DR   EnsemblGenomes-Tr; BLJ_1671-1.
DR   EnsemblGenomes-Tr; BLJ_1696-1.
DR   EnsemblGenomes-Tr; BLJ_1720-1.
DR   EnsemblGenomes-Tr; BLJ_1766-1.
DR   EnsemblGenomes-Tr; BLJ_1775-1.
DR   EnsemblGenomes-Tr; BLJ_1776-1.
DR   EnsemblGenomes-Tr; BLJ_1777-1.
DR   EnsemblGenomes-Tr; BLJ_1804-1.
DR   EnsemblGenomes-Tr; BLJ_1816-1.
DR   EnsemblGenomes-Tr; BLJ_1817-1.
DR   EnsemblGenomes-Tr; BLJ_1818-1.
DR   EnsemblGenomes-Tr; BLJ_1823-1.
DR   EnsemblGenomes-Tr; BLJ_1948-1.
DR   EnsemblGenomes-Tr; BLJ_1984-1.
DR   EnsemblGenomes-Tr; BLJ_1985-1.
DR   EnsemblGenomes-Tr; BLJ_1986-1.
DR   EnsemblGenomes-Tr; BLJ_2028-1.
DR   EnsemblGenomes-Tr; EBT00001819058.
DR   EnsemblGenomes-Tr; EBT00001819059.
DR   EnsemblGenomes-Tr; EBT00001819060.
DR   EnsemblGenomes-Tr; EBT00001819061.
DR   EnsemblGenomes-Tr; EBT00001819062.
DR   EnsemblGenomes-Tr; EBT00001819063.
DR   EnsemblGenomes-Tr; EBT00001819064.
DR   EnsemblGenomes-Tr; EBT00001819065.
DR   EnsemblGenomes-Tr; EBT00001819066.
DR   EnsemblGenomes-Tr; EBT00001819067.
DR   EnsemblGenomes-Tr; EBT00001819068.
DR   EnsemblGenomes-Tr; EBT00001819069.
DR   EnsemblGenomes-Tr; EBT00001819070.
DR   EnsemblGenomes-Tr; EBT00001819071.
DR   EnsemblGenomes-Tr; EBT00001819072.
DR   EnsemblGenomes-Tr; EBT00001819073.
DR   EnsemblGenomes-Tr; EBT00001819074.
DR   EnsemblGenomes-Tr; EBT00001819075.
DR   EnsemblGenomes-Tr; EBT00001819076.
DR   EnsemblGenomes-Tr; EBT00001819077.
DR   EnsemblGenomes-Tr; EBT00001819078.
DR   EnsemblGenomes-Tr; EBT00001819079.
DR   EnsemblGenomes-Tr; EBT00001819080.
DR   EnsemblGenomes-Tr; EBT00001819081.
DR   EnsemblGenomes-Tr; EBT00001819082.
DR   EnsemblGenomes-Tr; EBT00001819083.
DR   EnsemblGenomes-Tr; EBT00001819084.
DR   EnsemblGenomes-Tr; EBT00001819085.
DR   EnsemblGenomes-Tr; EBT00001819086.
DR   EnsemblGenomes-Tr; EBT00001819087.
DR   EnsemblGenomes-Tr; EBT00001819088.
DR   EnsemblGenomes-Tr; EBT00001819089.
DR   EnsemblGenomes-Tr; EBT00001819090.
DR   EnsemblGenomes-Tr; EBT00001819091.
DR   EnsemblGenomes-Tr; EBT00001819092.
DR   EnsemblGenomes-Tr; EBT00001819093.
DR   EnsemblGenomes-Tr; EBT00001819094.
DR   EnsemblGenomes-Tr; EBT00001819095.
DR   EnsemblGenomes-Tr; EBT00001819096.
DR   EnsemblGenomes-Tr; EBT00001819097.
DR   EnsemblGenomes-Tr; EBT00001819098.
DR   EnsemblGenomes-Tr; EBT00001819099.
DR   EnsemblGenomes-Tr; EBT00001819100.
DR   EnsemblGenomes-Tr; EBT00001819101.
DR   EnsemblGenomes-Tr; EBT00001819102.
DR   EnsemblGenomes-Tr; EBT00001819103.
DR   EnsemblGenomes-Tr; EBT00001819104.
DR   EnsemblGenomes-Tr; EBT00001819105.
DR   EnsemblGenomes-Tr; EBT00001819106.
DR   EnsemblGenomes-Tr; EBT00001819107.
DR   EnsemblGenomes-Tr; EBT00001819108.
DR   EnsemblGenomes-Tr; EBT00001819109.
DR   EnsemblGenomes-Tr; EBT00001819110.
DR   EnsemblGenomes-Tr; EBT00001819111.
DR   EnsemblGenomes-Tr; EBT00001819112.
DR   EnsemblGenomes-Tr; EBT00001819113.
DR   EnsemblGenomes-Tr; EBT00001819114.
DR   EnsemblGenomes-Tr; EBT00001819115.
DR   EnsemblGenomes-Tr; EBT00001819116.
DR   EnsemblGenomes-Tr; EBT00001819117.
DR   EnsemblGenomes-Tr; EBT00001819118.
DR   EnsemblGenomes-Tr; EBT00001819119.
DR   EnsemblGenomes-Tr; EBT00001819120.
DR   EnsemblGenomes-Tr; EBT00001819121.
DR   EnsemblGenomes-Tr; EBT00001819122.
DR   EnsemblGenomes-Tr; EBT00001819123.
DR   EnsemblGenomes-Tr; EBT00001819124.
DR   EnsemblGenomes-Tr; EBT00001819125.
DR   EnsemblGenomes-Tr; EBT00001819126.
DR   EnsemblGenomes-Tr; EBT00001819127.
DR   EuropePMC; PMC2916372; 20525832.
DR   EuropePMC; PMC3270512; 22346255.
DR   EuropePMC; PMC3318781; 22307308.
DR   EuropePMC; PMC4908950; 27379055.
DR   EuropePMC; PMC6339635; 30661116.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01747; msiK.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP002010.
DR   SILVA-SSU; CP002010.
XX
CC   Source DNA is available from Department of Medical Microbiology and
CC   Parasitology, Shanghai Jiao Tong University School of Medicine.
CC   Email:Weiyx2007@yahoo.cn.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2477838
FT                   /organism="Bifidobacterium longum subsp. longum JDM301"
FT                   /sub_species="longum"
FT                   /strain="JDM301"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:759350"
FT   gene            210..1712
FT                   /gene="dnaA"
FT                   /locus_tag="BLJ_0001"
FT   CDS_pept        210..1712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="BLJ_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99500"
FT                   /db_xref="GOA:D6ZX54"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX54"
FT                   /protein_id="ADG99500.1"
FT                   /translation="MVNASGDPVIEAAHIWSDTLTVLKHSASLSPREKGWLEGVVPEGV
FT                   FGSTIVLCVDNNDTLQAIQGDLNDSLLQALRTVTGENMFPAFKVVPKTEPEPLSAAKPT
FT                   QPYPSEISPTVAEFGKESYGAKPVAAPREPMPATESQFPVGQQKMNRDPETHLNKNFTF
FT                   DSFVPGDSNRFARTVALAVAEGSGQDFNPLCIYGGSGLGKTHLLNAIGNYALVKDPGLK
FT                   VRYVTSEEFTNEFIDALQNPNQSQGQIAEFNRRYRQVDVLLIDDIQFLGGKEATLDQFF
FT                   HTFNALHQANKRIVIASDVAPKNLKGFEARLISRFESGLTVDVKPPDLETRIAILRMIA
FT                   SMNGSKIPSDVLDLIAERFTENIRELEGALTRVTAVASLSNQPVTRALAEQTLQDFFTT
FT                   DVEIKPTDIISQVAKYFHLTFEDLVGKSRTKNVAVPRQIAMYLAREMTSMSLMDIGQVF
FT                   GGRDHTTVMHACTRISDRMQQKQEIYNYVMELTVRLKQSNTN"
FT   gene            2448..3572
FT                   /locus_tag="BLJ_0002"
FT   CDS_pept        2448..3572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99501"
FT                   /db_xref="GOA:D6ZX55"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX55"
FT                   /protein_id="ADG99501.1"
FT                   /translation="MKVEIDTAALADAVAWTSRVIDARPSNPILAGVKLEAIDGTLQFS
FT                   AFNYEISARHHIEAGVDEAGSVLVQGKLLADITKSLRSEKTYLVTDGSTLTITSGKSKF
FT                   TLQLMPDTEYPDLPVVPAMLGQVDAPTFVQAVNQACVAVSREENRPVLTGVRMQFQGDK
FT                   VVMTSTDRFRLARATFTWTPQNPDVDTTTLVRGSLLKDVARALDEHQNIRLDFDADSPT
FT                   LLGFENAGRVSTSQLIDGEFPAVDRLFADEYPIQAVVNKQDLLDAISRVALVAERNAPI
FT                   RMTFTGQEVALSAGSVDEAQANETLDIDMDGDDITVAFNPSYLKEGLSAVTEPFVRIKM
FT                   TTPVKPVEFNGQQEADSDESMDYRYLLVPMRFNN"
FT   gene            3600..4838
FT                   /locus_tag="BLJ_0003"
FT   CDS_pept        3600..4838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99502"
FT                   /db_xref="GOA:D6ZX56"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX56"
FT                   /protein_id="ADG99502.1"
FT                   /translation="MHISRLALDHYRSWSQVVVDFVPGVNILFGKNGLGKTNLVEAVEV
FT                   LSTGSSHRTSSTLPLIERGQTTATIRANVADDAGQTTTYEASIHARGANRARINSGSSL
FT                   YLRDIIGKIPSVSFTPEDQRLVSGDPGARRVMMNQAAALLEPGYMQTLQQFTRIAKQRA
FT                   TLLKQLNANANNGQPMDAVLSGLEIWTGQFIEAGVALTRMRAHVIGLLAEPFAAIYADL
FT                   AGAGEQVTLTYAPSFDEVLMFDDPHPQISEHFQRIYPGEMARGVNLIGPQRDDMNLELA
FT                   GIPAREFASNGEMWTMALALKMALFEIVRDRLGLQPIVILDDVFAQLDDSRRTQILDFA
FT                   RKQDQVLITVAAEGDVPDYESAHRIDVATLAEPASVILPTLGNLSDSRENESLGKYDGK
FT                   PAVDSASVERKVS"
FT   gene            4835..5305
FT                   /locus_tag="BLJ_0004"
FT   CDS_pept        4835..5305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0004"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99503"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX57"
FT                   /protein_id="ADG99503.1"
FT                   /translation="MNPPIARQLNLDETKLPAEIFERLSRRGATLKDYRRRREEAIENF
FT                   GKPGRDPAELGSVMTTIAGNGVWAANMKLAQLRNHWDQVVGQAIASHSAVADFTDGVLT
FT                   IRAESTVWATQLTYLIPQLTDTIRRNLKGLTIAEIRVTGPAAGYTRKWARRR"
FT   gene            5447..7576
FT                   /gene="gyrB"
FT                   /locus_tag="BLJ_0005"
FT   CDS_pept        5447..7576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="BLJ_0005"
FT                   /product="DNA gyrase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99504"
FT                   /db_xref="GOA:D6ZX58"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX58"
FT                   /protein_id="ADG99504.1"
FT                   /translation="MTEVDPVVTEGSLLADETSKEEQLKAAAERINNAELTEGELDESM
FT                   APEHYEASDLRVLEGLEAVRIRPGMYIGSTGPRGLHHLVYEIVDNSVDEALAGYASHIE
FT                   VTILPDNGIRVVDDGRGIPVDEVPGEGVSGVETVMTKLHAGGKFGGGGYAVSGGLHGVG
FT                   ISVVNALSTRVDIEVRRQGFHWTQTYIDQHPTAPLKQGDPMTEGESTGTSVTFWADPKI
FT                   FETTIYDFETLRSRFQQMAFLNKGLKISLTDERENDQAGDEVAGDAADEPGAKHQTVTY
FT                   QYLNGIKDYVDYLVKVRKATPVEEDVISFEAEDLKLGISAELAMQWTTAYSEAVHTFAN
FT                   TISTTEGGTHEEGFRAALTSLVNRYARDKGILKDKDENLSGDDVREGLTAVISVKLTNP
FT                   QFEGQTKTKLGNSEAKTFVQRVMTDKLGDWFDAHPNEAKNIIQKAIEASRARLAAKKAR
FT                   ENTRRKSIFESAGMPDKLKDCQSSNPEECELFIVEGDSAGGSAIQGRNPITQAILPLRG
FT                   KILNTERASLDRMMKSDTIESLITAVGGGYGEDFDISKVRYHKVIIMADADVDGAHIAT
FT                   LNLTLFFRYMRPMITAGYVYVAMPPLYRLKWTKGPHDFVYTDAERDRVLAEGKANGRQL
FT                   PKGEGIQRYKGLGEMSYQELWETTMDPEHRILKQVHIEDAAAADETFSMLMGDEVEPRR
FT                   LFIQRNAKNVRWIDA"
FT   gene            7644..10295
FT                   /locus_tag="BLJ_0006"
FT   CDS_pept        7644..10295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0006"
FT                   /product="DNA gyrase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99505"
FT                   /db_xref="GOA:D6ZX59"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX59"
FT                   /protein_id="ADG99505.1"
FT                   /translation="MADENNTGDEQFTPDGSMEPLSPQEADTTDYGLMDTGERIQRKDL
FT                   QQEMRESYLAYALSVIVERALPDVRDGMKPVHRRVIYAMYDGGYRPDRGYNKCSRVVGD
FT                   VMGKYHPHGDSAIYDTLVRMAQSWSMRNMLVDGQGNFGSPGDDPAAAMRYTECRMAPLA
FT                   MEMVRDIDKDTVDFVPNYDGKTQEPTVLPARFPNLLVNGSAGIAVGMATNIPPHNMREV
FT                   ADGVHWALDHPDASREELLENLIRIIKGPDFPTGATILGHKGIEQAYRTGRGLITMRAV
FT                   VNTEEINGRMCLVVTELPYQVNPDRLVVSIREAVRDGKIQGIADMRDETSGRTGQRLVL
FT                   VLKRDAVPKVVLNNLYKHSQLQQTFGANMLALVDGVPRTLSLDAFIRHWVNHQLDVIAR
FT                   RTAYLKREAEERDHILQGYLKALDMLDEVIALIRASEDTDTARTGLMGLLDIDQVQADA
FT                   ILAMQLRTLTRMNRDKIVAEHEELQRKIADYIDILAKPERQRKIIGDELDEIVAKYGDD
FT                   RRTKILPFSGEMNVEDLIAEENVVVTVTHSGFIKRTKADEYRAQHRGGKGIKGTKLRED
FT                   DVVDHFFLTSTHNWLLFFTNKGRVYRIKAYELPEGSRDSKGQHVANLLQFAPDETIQTV
FT                   LSIPNYEVAKYLVLATRSGKVKKTPLAEYDSPRQGGLIAVRLMADENGENADELIGAAL
FT                   CNAEDDIILVSKLGMSLKFQADDEQLRPMGRQTAGVQGMKFRNDDSLLAMDVVPGDSDK
FT                   DLFVVTNEGFAKRTAISEYRLQGRNGLGIKAVQLVEGRGALVGALVVSEDDQVMAIMKS
FT                   GKVIRSNVDEVKRTGRNTQGVTFAKPDKGDTILSIARNEEKDEPEDSGDAAANGTAESA
FT                   QSGENVNNADEA"
FT   gene            10365..10931
FT                   /locus_tag="BLJ_0007"
FT   CDS_pept        10365..10931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99506"
FT                   /db_xref="GOA:D6ZX60"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX60"
FT                   /protein_id="ADG99506.1"
FT                   /translation="MSENLEDNEPRIIPPAVGNTQNDHVEPLIGTEHAPRVARSVSSDP
FT                   EESTLPSSGAATPVRPAPRRSAPRARRMSLSLTRVDAWSVAKVTFMLSIAVAIIQVVAS
FT                   AIVWVLLDVVGVFSQITQIVSSTGLDAGGFDLKNVLSLTTVVSGVTIFSIVEVVIFTLL
FT                   ATIAALIYNVVSSLVGGVHVTLGDD"
FT   gene            11936..13183
FT                   /locus_tag="BLJ_0008"
FT   CDS_pept        11936..13183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0008"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99507"
FT                   /db_xref="InterPro:IPR004256"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX61"
FT                   /protein_id="ADG99507.1"
FT                   /translation="MNLEDFSRAALSFFGMPDSTPSFGGWSDALSFVAERAAQTDERMV
FT                   FVFDEFPYAAAAEPALPSMLQIAIDHGFLATKVTMILSGSNEGFMENDVLGRKSPLYGR
FT                   RTAQIRLLPFDYADAAKFLTNTSPQELVQYYATFGGTPYYLARIQEADGFESNVLRLMF
FT                   DNLGVLREEPMMLLRQELREPASYYSILQSIAGGNSSPKLIAEHAGVGSDSIGAYLKTL
FT                   VDLRLIERKVPFGEDPSKSRKGMYVVSDPFFAYWFRFVGRNMSILDGNISEEVTSRLAF
FT                   GPAFDTYVGQQFETICLQWLIRNNAMGNLPFVATQFGKWWGNDPIAHEQTDIDVIAADS
FT                   IDKTILFGECKWRNSFNETEAIEKLHQRAGLVRGYQAGNAWLMLFTKNPVSESTRTRYM
FT                   DDERMVFVSAEELYTA"
FT   gene            complement(13528..14874)
FT                   /locus_tag="BLJ_0009"
FT   CDS_pept        complement(13528..14874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0009"
FT                   /product="Glutamate dehydrogenase (NADP(+))"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99508"
FT                   /db_xref="GOA:D6ZX62"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX62"
FT                   /protein_id="ADG99508.1"
FT                   /translation="MLTDEYIKRVYDQVVARDGDQPEFLQAVREVFETLQPVVEKHPEY
FT                   EKAGVLERIVEPERAIKFRVAWVDDEGKVQVNRGYRIQFNSAIGPYKGGLRFHPTVTES
FT                   VVKFLGFEQILKNSLTTLPMGGGKGGSDFNPKGKSDAEVMRFCQAFMTELSRHIGQFTD
FT                   VPAGDINVGGREIGYLFGQYKRIRDEYSGVLTGKGLEFGGSLARTEATGYGVCYYTQEA
FT                   LRVLRNDSFEGKTVVISGSGNVATYAAQKAEQLGAKVVTVSDSNGYIYDPNGINVEVVK
FT                   QIKEVERGRIKEYAERVPGSEYHEGSKGVWTVKGDIALPCATQNEVDGESAQKLVDNGV
FT                   TVVVEGANMPSTPEAIEVYQKNGVLYGPAKAANAGGVAVSGLEMSQNSYRLSWTFEEVD
FT                   AKLKSIMEEIVANSLAAAKEYGHEGDLMLGANAAGFVKVANAMVAQGVL"
FT   gene            complement(15264..15698)
FT                   /locus_tag="BLJ_0010"
FT   CDS_pept        complement(15264..15698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0010"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99509"
FT                   /db_xref="GOA:D6ZX63"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX63"
FT                   /protein_id="ADG99509.1"
FT                   /translation="MTAIDETDQRILTMLEADGRATLAQLAQATGLSVSAAQSRVQKLE
FT                   KRGIIKGYKAIIDQEQRGLPISAFVNVTPLDYSAESSIPDKLNNIDGIVSCYSVAGAPS
FT                   FVLVVRVASPTALEELLNLIHRTVPVSTETTMILQTYFAH"
FT   gene            15904..17250
FT                   /locus_tag="BLJ_0011"
FT   CDS_pept        15904..17250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0011"
FT                   /product="aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99510"
FT                   /db_xref="GOA:D6ZX64"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX64"
FT                   /protein_id="ADG99510.1"
FT                   /translation="MQKFSNMSLSEVASAAAPATMPAAGRVAVPTAEPASLSAEALNIP
FT                   RSGIRDVFDRVERVPDAISLTVGEPSATAAPHIVAAACEAAQAGRTRYTNVLGIPEYRK
FT                   AVADYSACVKGLTYDPETEIQAVDGATIGLFLALKAVVGTGDEVIIPSPFFTSYDAEVM
FT                   LCGGRPVTVALRPEHGMRVNAADIEAAITPRTRAVIINSPGNPTGAVTSAAELARIAEV
FT                   CKQHNIWAISDEVYHPFVFGETFGETLGGEAAVAPSIAAVPGMKERTIVVESLSKTYAM
FT                   TGWRIGYLLAPEAVIEQTGKIAELMHSSVNSLAQYAGVAALAGPQDNVAAMREEYRAKR
FT                   QIVLDGLAGCPVLRLIEPQGAFYAFVDVRLTGLDSGEFADRLLDEERVAVVPGEAFGEE
FT                   GRGFVRLSYAGDADELREGVARLRAFAERVWNPITGHHTATYHPMEVLA"
FT   gene            17500..18957
FT                   /locus_tag="BLJ_0012"
FT   CDS_pept        17500..18957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0012"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99511"
FT                   /db_xref="GOA:D6ZX65"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX65"
FT                   /protein_id="ADG99511.1"
FT                   /translation="MAYCGHCGNRVDGPARFCPACGASVDSAPVATAPVPAASPAVPPA
FT                   SIPAPAVPASAVPPSIPAAPVAPSVYAASAAPQPAPTVPLPALPIPAPAAYQATDATAV
FT                   LAPQRKSSKKLIAAFCALLATILVAALAFIIPNFTAVKAMLGFRPTNPLVVTFDAINSL
FT                   STLRSTKYELRTHSSTGDSLDARMSGMYSLGKTTNESSASFTSKTDEYATTFAWYKGAF
FT                   AGKSVWHDDDPYYIYYPADQYEDDLRNGVGSDVADLILNVKDALVKNGAWDITGAEQTF
FT                   YDQLDKMNDDGYSNDIDRVKGTKTSAEVKAEASKFIQQYFGVELEDKNVRSQLFPKTSS
FT                   AKSAGNTQLSYQIDIKALSQHFVNYWISHEAQYPHLKSWVIQQIEDAGVDDAEDEYRQA
FT                   LDNVRNWDFGTDEEPEMPTITVDLNYGRKRLMNSIAISVSGKDEYGDSYNGSLSLTLSQ
FT                   QNAVSVDDPDLTDMVSKAKDNNGLDLS"
FT   gene            19831..20553
FT                   /gene="hrf1"
FT                   /locus_tag="BLJ_0013"
FT   CDS_pept        19831..20553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrf1"
FT                   /locus_tag="BLJ_0013"
FT                   /product="Hrf1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99512"
FT                   /db_xref="GOA:D6ZX66"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX66"
FT                   /protein_id="ADG99512.1"
FT                   /translation="MALFTRYVLVGRLEDGAQVFWDTLEKTPVKRKLDFGGDSGWARAG
FT                   AAAGGAAAAAAPGLMVMIHGIARLLTPDTKTHHTHTDDVTLLAFLRPVTISRDAWNTYV
FT                   AVAVMWLAGLLLYWGFCRLVFGRPNTYVPASLEDLAFASSVPATKLRYMFGGPIVGTLF
FT                   LIAISGFPIAMTWMFWSSAQWVDTGRSTPDWIGWLAFFWAFLATCSPILLALRFVGPWD
FT                   WRGRFSPRAGAERWSRLK"
FT   gene            20418..21260
FT                   /locus_tag="BLJ_0014"
FT   CDS_pept        20418..21260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0014"
FT                   /product="histidine kinase A"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99513"
FT                   /db_xref="GOA:D6ZX67"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX67"
FT                   /protein_id="ADG99513.1"
FT                   /translation="MVGFLLGVPRHMLPDSVGLAFRRTVGLAGTFQPARGRRTLEPAEM
FT                   STLLMGAGMGLMVAISLAFILAFNMSRLRWLMDHDIHPLLEEHGLREPDDGFTSSGAKE
FT                   RMAAFHSDVAEALAAPEREREARERRRFTVFDPTVDKLPLPAGPYPFDRPTASWARDIY
FT                   EEGDWAYADAWVRGRRKPRVVREQRYDSWRNEVLARHGLTDAPSATLEHIEHAAARIRA
FT                   LHHTSPAEAYKQACKEATGNTVNDETTGEGKENGSSGFGVTRSLLHTGGFRHTIQAHL"
FT   gene            complement(21553..21625)
FT                   /locus_tag="BLJ_0015"
FT   tRNA            complement(21553..21625)
FT                   /locus_tag="BLJ_0015"
FT                   /product="tRNA-Ala"
FT   gene            complement(21668..21741)
FT                   /locus_tag="BLJ_0016"
FT   tRNA            complement(21668..21741)
FT                   /locus_tag="BLJ_0016"
FT                   /product="tRNA-Ile"
FT   gene            complement(22392..22664)
FT                   /locus_tag="BLJ_0018"
FT   CDS_pept        complement(22392..22664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0018"
FT                   /product="ATPase (AAA+ superfamily)-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99515"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX68"
FT                   /protein_id="ADG99515.1"
FT                   /translation="MQVILTQRRTTSGTQCRPSRIGNRRCYIQSAYQLPTPEKVAQEKA
FT                   SLLEIDDSFQKIVLVRDVVKPVRDEHGILTMSVYDFLLDPDSLTM"
FT   gene            22663..23469
FT                   /locus_tag="BLJ_0017"
FT   CDS_pept        22663..23469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0017"
FT                   /product="protein of unknown function DUF45"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99514"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX69"
FT                   /protein_id="ADG99514.1"
FT                   /translation="MPYRRRQSTAPKSGAPKSVRSAAAGQSLDIDGIHLHLTRKPIKNL
FT                   YLRIKPPSGRVEISAPMRMSESRIADFVKERHSWILAQQQRMAEAQRRSIMALNEGAGF
FT                   ENGGRGVAGASGHDGDVAGRPKTGDISRPRIGDAGPGQAGTNVQPYFDRSQIWTDERKR
FT                   QAAAAINAALPQLLAKWGPVIGRQPTHITLRVMASRWGSCTPRTGRIRMNLQLGLMEPQ
FT                   FLEYVLVHEMTHLWESGHGAGFQRRMTAYLPGWKTLRRDLNRRVVL"
FT   gene            23556..23921
FT                   /locus_tag="BLJ_0019"
FT   CDS_pept        23556..23921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0019"
FT                   /product="Gluconate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99516"
FT                   /db_xref="GOA:D6ZX70"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX70"
FT                   /protein_id="ADG99516.1"
FT                   /translation="MAAGHPLTDEDRWPWLDTIAAWIDERVAAGEPAVVTCSALKKIYR
FT                   DKLRRQGVVFVYMQGTFDEVMERLSHRQGHFMKPSMLQSQSDILEEPGDGEIHVNVHIG
FT                   QADPEHEAVAVAGALGL"
FT   gene            complement(24179..25492)
FT                   /locus_tag="BLJ_0020"
FT   CDS_pept        complement(24179..25492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99517"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX71"
FT                   /protein_id="ADG99517.1"
FT                   /translation="MLRRKIETQLEAWRSAPKRTALLVTGARQIGKTYIIRHFAQQHYD
FT                   HIAELNFIENPDLVALFDRPRDAKNLLMRLELAVNTPLVPGKTLIFFDEVQRCKEMVTA
FT                   IKFLVDDGRFDYALSGSLLGVELEDIRSVPVGYLTELDMYPLDFQEFCWSQHIGNDVFD
FT                   MLAECFAKHQEVDEFIHQRLMELYSKYLVIGGMPAAVDSFVANGSVADVRTIQENIKRE
FT                   YRRDISQYARKEDRLHIRAIYDLVPSELNNPNKRFTFAKIEKNMRFQSVASDFDWLVNA
FT                   DVAVAAYNVDEPCTPLEMSKERNLFKLFYNDVGLLTGSFLKKTALDVLDGNPDINYGSI
FT                   YENAVAQELRAHGFDLYYYNSKKLGELDFLIQDRNDHVLPIEVKSGKSYKRHRAMDNVL
FT                   AHPEYHLNTGYVLGPCNVSVEGNVTYLPVYMAGMFHNE"
FT   gene            complement(25727..26206)
FT                   /locus_tag="BLJ_0021"
FT   CDS_pept        complement(25727..26206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0021"
FT                   /product="Ferritin, Dps family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99518"
FT                   /db_xref="GOA:D6ZX72"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX72"
FT                   /protein_id="ADG99518.1"
FT                   /translation="MTLAFVVPGLDEAASEKAIAILQNRLSQEQEAALVLKHAHWNVTG
FT                   PNFIAVHEMLDPEVEAVLAQADETAERIATLGGTPDGRADAIVRNRTWKSFDAEGRVGT
FT                   EEYLKALIEYYDAFIADDRKAIAELDELDVISSNIIQDHVQELEKFQWFMRSHLA"
FT   gene            complement(26303..27646)
FT                   /locus_tag="BLJ_0022"
FT   CDS_pept        complement(26303..27646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0022"
FT                   /product="protein of unknown function DUF21"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99519"
FT                   /db_xref="GOA:D6ZX73"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX73"
FT                   /protein_id="ADG99519.1"
FT                   /translation="MSLGLNILLIFVFLVIGSVFSGTELALVSLRGSQIEQMEQEDARG
FT                   AKVAKIARDPNTFLSTVQIGVTLSGFLSASFGASSIAPYLIPVVESWGVHPGIAGGLVN
FT                   IILTLIISYCSIVISEMVPKRIAMQRTEQIARAVVPAIDAFAAVCRPIIWLIGKNTNGI
FT                   VRLLGFDPQQTESEVSDDELRVLVSSNTNLSKDERTILDDVFDASETIVAEVMRPRADV
FT                   VFIEGDQPLAEAAAFVRDQPYSRYPVTGKDFDDVIGFVHVRDLLDVRDPNAKIVRDVVR
FT                   EGISLPGTSKLLPSLELLRKRGIHLAVVIDEYGGTDGIVTLEDMTEELVGDIRDEYDLP
FT                   SEKGGERTTRTAFVNGVATIEASMTIEDFADLTGIELEDGPYETVAGYFLSKTGKMGAV
FT                   GDVLHSDDGYNMVITKVDGRRIETIEVRKAGAPDHAPLPAESQSDDAN"
FT   gene            27683..28426
FT                   /locus_tag="BLJ_0023"
FT   CDS_pept        27683..28426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99520"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX74"
FT                   /protein_id="ADG99520.1"
FT                   /translation="MCWLGSKKLGKGKGILITIDETQAASHDDLVAIATAVQHVIADAD
FT                   ESDTPDEDKKGVAIVFAGLPYMINDLLDNEVTTFLRRALRRELDNVPLPDVKNAFLETV
FT                   ADSGKTISGEDALEAARQSEGYPYMVQLVGYYMWQSAQRRGSDVITADDVSTGVSDALL
FT                   AFDDAVCAPALDGTTSAERLFLAAMAKDSPNPTQVGDIADRARRSRSWVSKYRAVLIKD
FT                   KLIRPAGHGQLEFAVPHLGQYLQSL"
FT   gene            complement(28611..31274)
FT                   /locus_tag="BLJ_0024"
FT   CDS_pept        complement(28611..31274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0024"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99521"
FT                   /db_xref="GOA:D6ZX75"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX75"
FT                   /protein_id="ADG99521.1"
FT                   /translation="MPPALTIHYGSATYAPNPARTTTIGRAPDCDLVIHNPYVSHHHAR
FT                   VTFTDDGWLLEDTGSANGLSINGIHTTSVLLLNSTKVTLAQGATIVCIVGTSGPSTPAQ
FT                   PPRRPAANVAQPALPPAPSAQPAQPTQLAPQQARPVVQPTPPAPQPAQPVQPQPTPAPL
FT                   APHRVSPALAHLQQQPRPTAVAPTAVSPVPVSPASPSPSPCASTSPSNAAGTVLAGSTQ
FT                   AVRLESQLTTNRVHGSFSPEHDTTGVIGRDTACLIRINDYLVSRKHCSLETTSSGILLT
FT                   DLNSANGTYVNGRRVAKIWLREDDVVTVGNTDLIVHEGVLCDRTPFVSNDAVIAENIGL
FT                   TVGKGTRLLDGINAVFAKGTLTAVIGPSGAGKSTFTSIVAGLNSPTDGRVLFDGYDVHQ
FT                   NIELLRSRIGFVPQDDVVHRKLSVDAALEYAAKLRLPGSTKAERAEIIDNVLNELELTS
FT                   RRKNRIDRLSGGQRKRVSTAIELLTEPELLILDEPTSGLDPALDLTVMTMLRQLADAGR
FT                   VVIVVTHSLSYINKLCDNVLMLAPGGHPAFFGTVQEMSQAFNGKEWADIFNDVAESPER
FT                   VYSITDSCQRTMQAESTITRHTEHEKPAKPFRIKQTITLVIRQLHLIIADPGLLIFLLL
FT                   LPLLLGLLSLVVPGSHGLGEPDFKDAATEPNQLLVLVILGACFMGSALSVRDIVSERAI
FT                   YGRERAVGLSPTSYTASKLIVMGLQTLLQAAILTTAVSLGKPGPDHGVVTDSGIPELVL
FT                   AIWLTAWTSALLGEVGSALVKSGEQTMPLLVVLVMAQLVFSGGMIPVTGRDSLELVSMI
FT                   FPGRWGFSAAASDIGLNDLLYGPTKVPMFKKDDLWEHTTDQFWFNIGILGIMVVVFTIV
FT                   LRICVSNAVAKMRRRS"
FT   gene            complement(31362..32045)
FT                   /locus_tag="BLJ_0025"
FT   CDS_pept        complement(31362..32045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0025"
FT                   /product="carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99522"
FT                   /db_xref="GOA:D6ZX76"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX76"
FT                   /protein_id="ADG99522.1"
FT                   /translation="MAQSDFEQESTANATWSRMLQGNRRFAEGKPDHPWQDKETRQTLL
FT                   DGQNPDAAVLSCSDSRVPPEIIFDQGLGDLFTVRTAGQLIDSAVIASLEYAVKKLHVSL
FT                   ICVLGHEHCGAIEAAEQELDDLMHTITSEADGSLEAADAMDDLDEHIAAAESIILRQAG
FT                   MSVWQAREAELDAHEDIERVHVAHTIETLVEQSPIIQQALAADQLMIVGARYQLDTGKV
FT                   EVLSF"
FT   gene            32318..32881
FT                   /locus_tag="BLJ_0026"
FT   CDS_pept        32318..32881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0026"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99523"
FT                   /db_xref="GOA:D6ZX77"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX77"
FT                   /protein_id="ADG99523.1"
FT                   /translation="MTLLQHELTDFKVNAFQNNEFHEVTKDDVLGHWSLFFFYPADFTF
FT                   VCPTELEDLAKNYAKFKEIGCEIYSVSCDTHFVHKAWHDANEKIAKIEYPMLADPTALL
FT                   AKDLDTYNEADGMAERGDFIVSPEGKVVAYEVISSNVGRNAEELLRRVQASQFVHEHGD
FT                   QVCPANWTPGEETIEPSLDLVGQL"
FT   gene            33054..34970
FT                   /locus_tag="BLJ_0027"
FT   CDS_pept        33054..34970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0027"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99524"
FT                   /db_xref="GOA:D6ZX78"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017561"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX78"
FT                   /protein_id="ADG99524.1"
FT                   /translation="MTQTNNLYDVVVIGGGPAGLTAGLYLARARYRVLILEKDDFGGQI
FT                   TITNEVVNYPGVGRTTGRALTQTMRQQAQDFGAEFLSAEATGLDVDGDIKTVHTSRGDL
FT                   KTFGILIATGASPRKLGFEGEAEYAGRGVAYCATCDGEFFTGKEVLVVGGGFAAAEESV
FT                   FLTKYASKVTVLVREPDFTCDAAVAAEAKNNPKIDVRYQVELKGVTAGQGGLREASILN
FT                   LATGQTETWKPADAGTFGVFVFAGYVPATDLVRGVVELDDHGYVVTHDYLETSVPGVYA
FT                   AGDLRVKNLRQVVTATADGAIAAVELERYAKQMSEKTGLVPPRPTASAYEESEAKAASA
FT                   ASAAGTTPAPAPAKRSADAAAAASAAKKPGELFSAAVKQQLGVVFGRMTRPVTLALELD
FT                   GTPLSAELQGFIGEMVALSGGKLNSVAVDAAGLITAVDGASVPTSLVVGEPLAVTLPDG
FT                   AELPTYGSLDDSGRATFDVAGVLPLARPTVRICVPAEGDGKAGKDGNGSLVFTGLAFHG
FT                   VPSGHEFNSFVLGLYNAAGPGQPLGDDLVERAKSITDPLNIMILVSLTCTMCPETVLAS
FT                   QRIASLSPAVRAEAYDVSHFPELKDQYGAMSVPCIVITHADGTQQVEFGKKSIPQMLEL
FT                   VGA"
FT   gene            complement(35087..36442)
FT                   /locus_tag="BLJ_0028"
FT   CDS_pept        complement(35087..36442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0028"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99525"
FT                   /db_xref="GOA:D6ZX79"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX79"
FT                   /protein_id="ADG99525.1"
FT                   /translation="MGDTTLVRVGRSSYTSYERIRPYMARFTENRWTSAIIPALLIHIP
FT                   IGTVYCWSVFKQLIADRLHASPASVEWGFSLAIFFLGMSAAFAGPMVEKNIKKSALVSM
FT                   VCFVVGFAGTGVSIALNFLPGVFICYGAIMGIGLGVGYLTPVKNLMLWFADNKGLATGI
FT                   AVAGFGLAKAIASPLMEYLIGTVGLVSMFFILAAVYAVMMFVGFLLIKRPAGWVYDPAT
FT                   SHVSRKTILKKPVFWGIWIAFYINITCGLALISQEKDILHDVLKAFPQYANLSPAKFAA
FT                   AISGIIGLVLAVDSVFNTAGRVGFSTLSDHLKRRETVYQVIFIMSIAVCLLQIFTNSID
FT                   NALLWAVLAMLFLVNAGYGGGFSTLPVLLDQHFGTKTVSTTHGLTLSAWAFAGLSGNQL
FT                   ASFVVAHAPDQAHRYAALIPVLTGLFVVALISISLVKYLGDRNVTKAVEDRG"
FT   gene            36754..36867
FT                   /locus_tag="BLJ_0029"
FT   CDS_pept        36754..36867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99526"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX80"
FT                   /protein_id="ADG99526.1"
FT                   /translation="MSISWFDMFSFAASVLTTVTAAFESPGRASTEGLILG"
FT   gene            36928..37926
FT                   /locus_tag="BLJ_0030"
FT   CDS_pept        36928..37926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0030"
FT                   /product="regulatory protein, LacI"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99527"
FT                   /db_xref="GOA:D6ZX81"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX81"
FT                   /protein_id="ADG99527.1"
FT                   /translation="MVTLKDVGELAGVTATTASAALRGKDYVKPETTQRVCDAARKLGY
FT                   KINLSGRSLRSGRSDTITFLTSGLEGDYFSHLAMCVAEEVHKRDSHMLIELSRYLTDDN
FT                   DLSYTFSDGIIAINAPRAVDILKRHPAVMLENYDTSLPIDTVNAPSDAGSRAAIEHLIA
FT                   RGCARIGIVGDNHDPNNPNIIPGSRDIRMRAAKETILAAGLPFDERRDFIKSSWSIDGG
FT                   IEAGRGLAKKGKCKYDGLYCLNDGIALGILRGLADDGVSVPGDVRVIGFDGLSQSMYSV
FT                   PTLTTVATDFKGMADTALTLLMRRIENLDDEFFPQTVNVGYKLIERESTAA"
FT   gene            38141..39790
FT                   /locus_tag="BLJ_0031"
FT   CDS_pept        38141..39790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0031"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99528"
FT                   /db_xref="GOA:D6ZX82"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX82"
FT                   /protein_id="ADG99528.1"
FT                   /translation="MLPTKESLTVEFKSEQKRPQSHDEIVDNVVALANTEGGTLYLGIE
FT                   DDGTVTGVCEEHRNINGLAALIFNKTVPQLPARVALLYENEVPIVSIEVDNSQQIVSTS
FT                   QGKTLQRRLKADGSPEVVPLFVSQFISRLSQQRFYDFSAQPAPEARLDDLNPDSRNKLR
FT                   SHIRSANAQNSLLSFTDEDFDRALELVVDGPYGLQPSVAGLLTIGSVDAIHRSVPAASA
FT                   VFQVMKGMSPKVNMDPFVLPLVDMFDRVGELMEPWNPSHEVMSGLIRVDLPDFDRGAFR
FT                   EAMINAFCHRDYARMGSVRFLVDDDGLTIANPGGFIEGVSEDNLLTAQPRSRNPQLALI
FT                   LKAAGYVERTGRGVDTIYAGSIAAGGSFPDYSQSSAEEVILFLRRVVPDEAFVTMIGDE
FT                   ERRRGAPLPVWSLIVLSLLREHRRLTVVQLCDFSHLEHRRIVSAVENLVEAGLVEGVGS
FT                   GSSRSYMLSARVYKRSEGLASYVRQRDIDATRRSGLVLEFAEKNDGVVTTADVMDLFGL
FT                   SYISAYRLLKKLEDAGKLRREGNGPSSRYVLG"
FT   gene            complement(39958..40182)
FT                   /pseudo
FT                   /locus_tag="BLJ_0032"
FT   gene            complement(43417..46170)
FT                   /locus_tag="BLJ_0033"
FT   CDS_pept        complement(43417..46170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0033"
FT                   /product="Phosphoenolpyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99529"
FT                   /db_xref="GOA:D6ZX83"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX83"
FT                   /protein_id="ADG99529.1"
FT                   /translation="MATPEEQITPADAAIVTTGTGRKGPEEHDLPESLKYDMDLCLEIL
FT                   RNVLGEYNPELLSTFDTVRHYAVEASAEHFAELKDPNPDQDGLKEAVNVIDNMTLHDAQ
FT                   LLARAFATYFHLANLSEENYRVSVLHERENNVSVDQAVDPINELTVAYHQLINETGPAK
FT                   AKELLNQLEFHPVFTAHPTEARRKAVEGKIRRVSELLEEYKRLGGSDKKECLRRLYNEI
FT                   DALFRTSPIALKKPTPVEEADTILDIFDNTLFNTIPKVYRRFDDWVLGDKAGLVEPACP
FT                   AFFHPGSWIGSDRDGNPNVTAKVSRAVARKFSDHVIAALEQATRTVGRNLTMEAETTPP
FT                   SAELKSLWSHQKEMSERLTDKAALISTKEMHRAVMLVMADRLHYTIERDADLMYHSCDD
FT                   FLADLKVVQRSLAAAGAKRSAYGPLQDLIWQTETFGFHMVEMEFRQHSVVHARALADIR
FT                   EHGLHGERGELQPMTHEVLDTFRALGAIQKRNGLKAARRYIISFTKSAQNIKDVYELNR
FT                   LAFSHPEDVPTIDVIPLFEQLEDLQNSVDVLEEMIKIPEVQARLKATGNKLEVMLGYSD
FT                   SSKDAGPTSATLALHSAQERIAKWAESHDIDLTLFHGRGGAVGRGGGPANRAVLAQPVG
FT                   SVKCRFKLTEQGEVIFARYGNPVLAIRHVESVAAATLLQSAPSVEKRNTEMTERYADMA
FT                   AQLDEAAHNRFLDLLNTDGFAPWFSIVTPLTEIGLLPIGSRPAKRGLGAKSLDDLRTIP
FT                   WIFSWAQARINLAAWYGLGTACEKFGDLETMRQAYEEWPLFSTFIDNIEMSIAKTDERI
FT                   ARMYLALGDREDLNEKVLNEMELTRKWVLAIVGDKWPLQHRHVLGQAIRIRSPYVDALS
FT                   VTQVLALKSLRKKVDKEELSQSQQAGFIYLILCTVSGVAAGLQNTG"
FT   gene            46456..48336
FT                   /locus_tag="BLJ_0034"
FT   CDS_pept        46456..48336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0034"
FT                   /product="protein of unknown function DUF1212"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99530"
FT                   /db_xref="GOA:D6ZX84"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX84"
FT                   /protein_id="ADG99530.1"
FT                   /translation="MRDVSEQKKKSAPEAKGATAVRKFHTHSIPLDMEDIARDWEKPVV
FT                   DAGIAAKASVIVRVGMLDLGAGTGSFRVREMMHRIAYPLGVHVRADVNLTDIEATCTDG
FT                   RNRITEVVDLPTTGVNTERIWLLEHFADWFSVNLGKGSMYHVDSQLSDGVVKHLDERDA
FT                   SQYSADLAKRLRERAKAEAEAANGSVDEALDLALKTKVLVTSVAKSLDDDNEEAHRLLA
FT                   DSAEVTSVEDKAAEEKAYDDAEVFTGDSNESVESANAANGATAESPAASSTKRKNRVPK
FT                   EYAEHFNERSDEEKAKGGITVRQAHERLDLIERRKPLYKPWFSGLASALACAAFVFLLG
FT                   GGPYDMIGAFVGAGLGQWMRRRLFAYHLNQFFVTFVCVAAAALACTGTLRLIGIFDPVA
FT                   LSHDTAYIGAMLFVIPGFPLITGGLDMAKIDFPSGIQRVAYVLCIILMATLAGWAVAVM
FT                   VHLHPEGFEPLGLDPWVNGLLRFVAAFVGVWGFSVLFNSPQRMCLAAALIGAITDTLRL
FT                   ELQDFNVAPEMATFIGAFLAGILASAWRSSVRRGWLPPHLGYPRICLTVPSIVIMVPGL
FT                   YMYRAMWYLGSFQTMNALDWAFRAFMVIICLPIGLAMARVVTDKSWRYDI"
FT   gene            48580..50220
FT                   /locus_tag="BLJ_0035"
FT   CDS_pept        48580..50220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0035"
FT                   /product="SSS sodium solute transporter superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99531"
FT                   /db_xref="GOA:D6ZX85"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR011851"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX85"
FT                   /protein_id="ADG99531.1"
FT                   /translation="MANDFWILLAMVIYFAAMLSIGFIYSKRSNSSSKEYFAGGRGVGP
FT                   WLTALSAEASDMSGWLLMGLPGLAYFTGAADPMWTAIGLALGTYLNWKLVARRLRRYSV
FT                   VAGDAITIPDFFAKRFHDKKGVVSTIAAVIILVFFSVYVGSCFVTVGKLFATLFGFDYH
FT                   VMMIIGAVVVFVYTVVGGYLSVVMTDFIQGMLMFFALAVVFIGTVASAGGIDNTVEFLR
FT                   AIPGYLSGTQVAAPKLDPATGQQLVEAGKAVFGAPSDYGIITIISMLAWGLGYFGMPQV
FT                   LVRFLSIRSVEEVRKSRIIATSWCVISLGCAVCIGLVGRAMMPTELLTSTDAETIFIVL
FT                   AQTLLPSFMCGVVVSGIFAASMSSSSSYLIIGASAMGENIFRGLLHRKATDKQVMIVAR
FT                   VTLVVMFLFGILVAYDQNSSIFQVVSYAWAGLGASFGPLMLCSLYWRRANKAGAVAGML
FT                   SGTAAVLIWHNLVKPLGGVFAIYELLPAFIISLLFIVVVSLLTAKPNERMLYEFDHYMD
FT                   DPLPGTLPSGTVLVDEPMEAMESEVRSGK"
FT   gene            complement(50550..51536)
FT                   /locus_tag="BLJ_0036"
FT   CDS_pept        complement(50550..51536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99532"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX86"
FT                   /protein_id="ADG99532.1"
FT                   /translation="MGSSTALTELTMQKYQRMQTCADVQRRSAWRPPYALTTALELLSI
FT                   EVPRISSKHRGLATTTIVAVPHANDKRHIVGVKVVVWPFPLDTVIIEGQFTCTSPACTW
FT                   AMFSAYLELEELIVLADSMMRRDRRLCRTTIDALSLYLDEAEAQVRANKENGANSYLFR
FT                   GYNKCRRALLLARAGTDSSMETRTRLVLLKYGLDCPQVNYPIFVGNNTRPIYLDLAYPE
FT                   FKVCIEYEGSHHAGQWLNDARRRQMIEDAGWKYIQVTKLDIGNEAGEEALARRVAERIQ
FT                   EVTGKTVQLTMRQTTQQISDVRKLRRIPLYKRLKFEPLLPIIPTTQE"
FT   gene            51790..53409
FT                   /locus_tag="BLJ_0037"
FT   CDS_pept        51790..53409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0037"
FT                   /product="Amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99533"
FT                   /db_xref="GOA:D6ZX87"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX87"
FT                   /protein_id="ADG99533.1"
FT                   /translation="MAGMSSLVRIVNAGVPGSQDRVDVVLRDGVVASVGPAGTVSASDG
FT                   TMQTKAHTTSLAYATNAIASGSVSIPTSASAPADETTIDADGLWVIPGLWDCHTHFTQW
FT                   AKTLGRLDLINARSAAEAMDMLRRHLDERRAAGTLDPDAFVVGMRFRHSLWADDEQPTL
FT                   AAIDAVTGEQPVALSSADMHCGWVNSAAARRLGVHVDESGLVGELEWFNAYTAFDKVPG
FT                   AAEETDRLLREAEQDAASKGVVGIRDYEMAENIDTWTNRFAAGINGLRVDAGVYPERLQ
FT                   AAIDAGWHTGNPLPGSAGLGHVGAMKLISDGSLNTRSAYCSTPYSGIEPPTYGALSYTP
FT                   QQIEDYMRLATEHGFDIACHAIGDEANTIALNAVAATHAHGSIEHAQMLKPVDIPRFAE
FT                   LGLTASIQPQHAMDDRDVITRFWANPAGIPYPFRALHDVGTTLRMGSDAPVAPLDPWLA
FT                   ISAAVFGSESSDREPFQPEQCLDVRTSLAASTATGRDRLASGDPADMVLLDADPYAADT
FT                   PEAMRAMPQHVVMTLLCGERTY"
FT   gene            complement(53802..54893)
FT                   /locus_tag="BLJ_0038"
FT   CDS_pept        complement(53802..54893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0038"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99534"
FT                   /db_xref="GOA:D6ZX88"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX88"
FT                   /protein_id="ADG99534.1"
FT                   /translation="MTDEQQLTAAGNEMSASFLAAKKRSDETLAKLEAKPSSFTMLTGD
FT                   RPTGRLHLGHYFGSIRERVAMQERGVNTNIIIADYQVITDRDTTEHIQDNVLNLVLDYM
FT                   AAGIDPNKTMMFTHSAVPAENQLLLPFLSLVTEAELHRNPTVKSEMEASGHALTGLLLT
FT                   YPVHQACDILFCKANVVPIGKDNLPHVEITRTIARRFNERYAKKNPVFPEPAAILSEAP
FT                   EIPGLDGRKMSKSYGNSIMLGATAEETAKLIKKSPTDSERRITFDPVARPQVSALLTTA
FT                   GLVTGRDPKDIAEEIGDSGAGALKAYVIESVNEFLAPHRERRAELAKDMDSIRDILHDG
FT                   NKRANAIAEETLDQVREAMGMKY"
FT   gene            55027..55428
FT                   /locus_tag="BLJ_0039"
FT   CDS_pept        55027..55428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99535"
FT                   /db_xref="InterPro:IPR021426"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX89"
FT                   /protein_id="ADG99535.1"
FT                   /translation="MGRGRQKAKQQKIARKLKYLTTDTDYDELAKELSEQEPGTGSPDP
FT                   FADMDDQYADKDVDSAADDHASGAAEAAPAAQEDDLDEYAKWAAEAAAKATSGEFPASA
FT                   PKKAVNVPKPALRKPIPMPMPSALKPKKS"
FT   gene            55443..56114
FT                   /locus_tag="BLJ_0040"
FT   CDS_pept        55443..56114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0040"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99536"
FT                   /db_xref="GOA:D6ZX90"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX90"
FT                   /protein_id="ADG99536.1"
FT                   /translation="MPDISGQDGPKPTMLIMDNDRMALMALQSILSKALPDFELLPPVS
FT                   EGSKAIQLCTATKHPPAVLLADIAMNDINGPDVVRAIRRENATTAILAITASIVGRHAQ
FT                   EMARAGAQGIMSKNDDVRLQAVAIRQVQTGKIWGDGGDVRFETAAVASARIKAEKDNRL
FT                   SAREMEVAELWSRGRTMPQIAAELSITETTVRTHLMRAADKLGAGNLKELIGAWIRMNL
FT                   H"
FT   gene            56182..57333
FT                   /locus_tag="BLJ_0041"
FT   CDS_pept        56182..57333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99537"
FT                   /db_xref="GOA:D6ZX91"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX91"
FT                   /protein_id="ADG99537.1"
FT                   /translation="MKRPIIISRHSSYSYGHADGKKHHQIDIDIELNHPLAMFGPIGVL
FT                   AVAAIVYAVTGSWLVTASAALTASVLLVLLGIALRWRKRVVNQENENEQMESALADLRH
FT                   GNQLAIELHDTLSNDLTYISTIARNNLAAPAGIDGGDWQRVLDRSQRAFAEVHGIIDFL
FT                   TEQSGMDAGFRDESLPVGGTGTSEVATAESGQVDSPTKESALARDPVGAGSCPAIANEV
FT                   VDNAVPENAGGDDRTQSTAGMPQSFVTRVKAQITDTEEFLEAQGYRGTAAVNGIVMVVD
FT                   PEAAAEALSLMTEIGTNIRRHAPAGDDSYLLFVTLSPEWIEIRETNDIRDDADAQNGLS
FT                   AQERSGRGLAMHRTRVQELGGELTTRSDDGTWMIYVRIPCVRG"
FT   gene            57501..58898
FT                   /locus_tag="BLJ_0042"
FT   CDS_pept        57501..58898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0042"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99538"
FT                   /db_xref="GOA:D6ZX92"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX92"
FT                   /protein_id="ADG99538.1"
FT                   /translation="MASDTELWRGTDYGWWLAADTSGAVGASLIAFAVPLIMLATTGSS
FT                   AAATTTESICVVVQTVLGLAGGVIQDRYDRRTLMLIWGASGVVLSAVAAAAVMLFGNAP
FT                   KTSGHGGNGANAPAFGGPYAHVLPIALLCIVVLFSVRDGLLENTSNAMLRGVVPDEQLP
FT                   HAMALNDARDSTVTLAGGPLGGLLMTVGHAVPFLTSAVLSVLGMVSAWRIRRYWKRATV
FT                   SDSGRPGNVDTGSEVGAVSDTDDADGSAPRWRDALDGMIWLLRDRFQRHLIIAAAMVTG
FT                   ASNAFLLLTALDISQGGSQLISAGFINAASAVGMLLGALMASQLVNRVPGGVLVGVMFV
FT                   LLAVGFTGAALVPSMVGKAIFVACSVLALPAGNAVLGGLSNTLVGKDKLGRVGAGSMVL
FT                   QYGAYGVAVALAGWGMQTIGYGPTCLILATVLVAAAAYALTMRSLITLPTPDRWAEHIQ
FT                   RWSIAQF"
FT   gene            complement(58931..59338)
FT                   /locus_tag="BLJ_0043"
FT   CDS_pept        complement(58931..59338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0043"
FT                   /product="conserved hypothetical protein"
FT                   /note="narrowly conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99539"
FT                   /db_xref="InterPro:IPR041629"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX93"
FT                   /protein_id="ADG99539.1"
FT                   /translation="MAVILEKDLKRGHDALVQWRAAALELADNTPHRLTTSPVLPRPVW
FT                   AMAVRYSLFLLERRAPGPGVEVRVAPWGAVKILDGPESDPHNLTPPDVIELEPEVWLRL
FT                   ACGITTWAEEKDAGHISAVGERDDLSDLLPL"
FT   gene            59557..62004
FT                   /locus_tag="BLJ_0044"
FT   CDS_pept        59557..62004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0044"
FT                   /product="glycogen/starch/alpha-glucan phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99540"
FT                   /db_xref="GOA:D6ZX94"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX94"
FT                   /protein_id="ADG99540.1"
FT                   /translation="MTEITAPKSPVTAEQFADEIREQLKYTQNVTAEQATPADVYVAAS
FT                   KAVRNHLADSWFKTQADTVNGNTKAVGYLSAEFLMGKQLENALLNAGLTDQFDKAVEAL
FT                   GFKPKDIVDAEYEPGLGNGGLGRLAACFIDSLASLGVPAFGYGIQYKYGIFKQKFDENG
FT                   KQVETPDYWLANEEPWGHTDYNRDQKVSFGGKVVENADGTKTWEPAWSVRAVPVDYMVP
FT                   GYKSQRVNTLRLWTAKSYDEFDLLAFNRSEYMDAVAPQVKAENISKILYPEDSTKVGKE
FT                   LRLEQQYFFVSASLHDAIRVFYPGQDKPDLTTFPNKIVFQLNDTHPVIGIPELMRILID
FT                   EYGYDWDTAWSITTKTFNYTCHTLLPEALEVWPASLIGELLPRHLEIIEKINAQFEAEL
FT                   KAKGVAADTIKDMAIYTGDAVRMAYLATYGGSHVNGVAELHSQLLKDVTLKNFSDVYPD
FT                   KFTNVTNGVTPRRFVKLANPRLSDLITEGLGTDKWVADLELLKGLEPLAKDDEFVKKFA
FT                   AVKKANKHAFVGFAKDHYGIDIDENTLFNTMVKRLHEYKRQSLKILAVISNYADIKSGK
FT                   VKAEDITPRTVFFGAKAAPGYYLAKMTIELINNVSRVISSDPAVKGKLAVYMLPNYNVE
FT                   MAQNLIPATELDEQISQAGKEASGTGNMKFALNGALTVGTLDGANVEIRERVGAENFFL
FT                   FGMTVDEVEKKYAEGYDPASYYEADPRLKQAIDLVADGTFSNGDRNAYSPLVADWLTKD
FT                   WFMTLADFSAYMGIQSEIEALYADELEWNRKALLNVANSGYFSSDRSMEDYLERIWHTA
FT                   PLA"
FT   gene            complement(62254..62472)
FT                   /locus_tag="BLJ_0045"
FT   CDS_pept        complement(62254..62472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99541"
FT                   /db_xref="GOA:D6ZX95"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX95"
FT                   /protein_id="ADG99541.1"
FT                   /translation="MENKSSNGWKFFALLFGGLLAALVGLYIYKQQNPDYDPWEEPWEN
FT                   SSSPVDLGLNKAEDEADGEAEAAPAEA"
FT   gene            62568..63422
FT                   /locus_tag="BLJ_0046"
FT   CDS_pept        62568..63422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0046"
FT                   /product="Rhomboid family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99542"
FT                   /db_xref="GOA:D6ZX96"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX96"
FT                   /protein_id="ADG99542.1"
FT                   /translation="MTFVGDSSTPACPRSAQHLRGAWNASETFDTVGCMHIPTQREIRY
FT                   QWERGGPVMTWALIVACVAVWLLEVLLGFIAPGLRAWLMYLGMAAPVRLVAEPWTLITS
FT                   MFLHAPNSLLHILFNMIALYSVGPVLERMIGHWRFLGLYVISGLGGSLGLMVWAAVAPG
FT                   GIGWQMAAYGASGALFGLFASLLVVYRRIGADIRSMLIWMAVNFALPFVVGGVAWQAHV
FT                   GGFVVGGILTWLLVGGVPAWRGKSLKWRMQVYGWAMVVLVVVLILLCNMANPYGWMSFG
FT                   SLH"
FT   gene            complement(64052..64528)
FT                   /locus_tag="BLJ_0047"
FT   CDS_pept        complement(64052..64528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0047"
FT                   /product="protein of unknown function UPF0233"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99543"
FT                   /db_xref="GOA:D6ZX97"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX97"
FT                   /protein_id="ADG99543.1"
FT                   /translation="MLMADEELHETDSNNQKDWQSETSSSTAADETANKDTEQNAENAS
FT                   AEEDAAYGVNMEQVQAVLNATADKATLTPQMQRMMNRQAENTKRVEETIKGTKSNPRWF
FT                   VPLFCAFMIIGLIWCVVYYLSPSGSWPIPNIGAWNLGIGFALIMIGFLMTMGWR"
FT   gene            64612..65412
FT                   /locus_tag="BLJ_0048"
FT   CDS_pept        64612..65412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0048"
FT                   /product="protein of unknown function DUF881"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99544"
FT                   /db_xref="GOA:D6ZX98"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX98"
FT                   /protein_id="ADG99544.1"
FT                   /translation="MARHVGKHGARHSLWGGVAVFVVIALTGFLLSTNVRVNRTVAATN
FT                   DTVDLVEQGVDEANQLQQDVSDLTEQVANLTDALKADGTDGTDSTQNQGKDSSNVDSSL
FT                   MLPALSGSGVTVTLDDSPLWENAVNNNGTTANINDYVIHQQDVESVVNALWAGGADALM
FT                   IMDQRVLFNSAVICSGNVLSLHGKKYSPPFTISAIGDPQRLRAALNDSEAITILKQYVT
FT                   AFGIGYKVENAEGLQFPATAALLQQLKYATVDTSKTTDEEQTQQ"
FT   gene            65409..66647
FT                   /locus_tag="BLJ_0049"
FT   CDS_pept        65409..66647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0049"
FT                   /product="sortase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99545"
FT                   /db_xref="GOA:D6ZX99"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042003"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZX99"
FT                   /protein_id="ADG99545.1"
FT                   /translation="MRHGRHNSGAPAPIDLASVSDVQPFPEDDAARMAADPANASRARS
FT                   RRAAVRGASSPQRSLIWQALGICAELLITAAVICALYIVWQMWWTGVEAERAQNETTQS
FT                   VDWSDPSNNGGTVTIAKAQEGDAPVQPKDAKYGDLIAQIYIPRFGSQWHRNIVEGTTLE
FT                   QLNRHGLGHYDTTQMPGQVGNFAVAGHRNGYGQPLGDVDKLQEGDPIIVRTKDYWYVYH
FT                   YTRYEIVLPTDVYVIAPNPEDSTANPTKRMITLTTCEPKYSTPTHRWISYGELAYWAKV
FT                   SDGVPKELATTDSSGAVKFSTTETPSIASRIGSLDKVVFGALVVWLVLFIAAAVAWRWP
FT                   VLREIRAGERRRPDASIYGGLLRLQPGVAPIRWLLLALLLFAAAAALFQWGFPWAAANI
FT                   PFLQQMSNFVAVS"
FT   gene            66698..67342
FT                   /locus_tag="BLJ_0050"
FT   CDS_pept        66698..67342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0050"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99546"
FT                   /db_xref="GOA:D6ZXA0"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXA0"
FT                   /protein_id="ADG99546.1"
FT                   /translation="MTDSAHILVVDNYDSFVYTIVGYLQTLGATVDVVRNDAIDPAAPG
FT                   VLDGYDGVLISPGPGAPAESGASEDVIRLCAASGVPMFGVCLGLQALAEVYGCTVGHAP
FT                   TIMHGKTSPVEHADDEIFEGVANPMTATRYHSLAVEPDSVPDTLVVTAWTQDDHTIQGI
FT                   KVKDKPMYAVQFHPESVMTQDGYRLLANWLSVCGQGNAVAKSVGLQPKVTK"
FT   gene            complement(67539..69638)
FT                   /locus_tag="BLJ_0051"
FT   CDS_pept        complement(67539..69638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0051"
FT                   /product="protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99547"
FT                   /db_xref="GOA:D6ZXA1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXA1"
FT                   /protein_id="ADG99547.1"
FT                   /translation="MSTSMPTALAGGRYQLGQLIGRGGMAEVHVALDTRLGRTVAVKIM
FT                   RADLANDDIFLARFRREAHAVAQMNNPNIVNIYDSGEELVSSESGDTERLPYIVMEYVK
FT                   GQTLRDIIKVNGALSQRDCEQVMLGVLNALDYSHRMGIIHRDIKPGNIMISEQGAVKVM
FT                   DFGIARALDDSATTMTQSQGVVGTAQYLSPEQARGETVDMRSDLYSAGCVLYEMLTGRP
FT                   PFTGDSAVAIAYQHVSEVATPPSAVVPGLPKMWDSICAKAMAKDRQNRYATASEFKTDI
FT                   LTYMNGGVPVAAAFNPLTDLSNMKARKEAERDLPTTPVEPQQQPTQAFNPVTGQFEQIP
FT                   PANGANSAALQSRAQQRAAAAKAKKRKKIIIGSAIAAIVAVLVIVGIMFAMNGSGNKSS
FT                   EDTVTIPEVCNASTSKDNIKLKLERLGLKMTEKQDTDSTEPEGTCTKMSPDAGSKVARG
FT                   SAVKVWFSAGPQSTQVPDVKERSQEEARSILESAGFKVNATVKTEDSADIAKDMVTRTD
FT                   PAAGQSVPKGTTITIYVSSGMTTVPSNLVGQSKDSVLQQYEGKFSFTVEQESSDTVEAG
FT                   LITRVSPDSGSSIAQGGSITIWVSTGKEKVAVPNITAGTDYATAELMLKAVGLKAQASG
FT                   PTDSTAVVVSINPGAGSQVDAGSTVTITTKAGSTGGDTGTGDGGNGNGANNGNGANNGN
FT                   GGRNP"
FT   gene            complement(69635..70516)
FT                   /locus_tag="BLJ_0052"
FT   CDS_pept        complement(69635..70516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0052"
FT                   /product="protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99548"
FT                   /db_xref="GOA:D6ZXA2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXA2"
FT                   /protein_id="ADG99548.1"
FT                   /translation="MGEVWKGYDIQLGREVAIKALRSDVTNAEAKLRRLRAEAHNSANL
FT                   AHPNIAALFEYYEHDGIGFLIMEYVPSKSLADLFHSKGAMDPIELLPILIQTARGLFVA
FT                   HSHGVIHRDVKPANIMVSDTGEVKITDFGVSYSTGQGQITQDGMVVGTAQYISPEQAQG
FT                   QQATPQSDIYSLGVVAYEGLAGHRPFTGTTPVDIAAAHVNNPVPPLPNSVDVQLREFVM
FT                   SMLAKDPLDRPKDALVVSRTLARIERRLLDQQTEMADTTMATSGNRLPRRVTSTPRIVL
FT                   EAPASRLGGNKQ"
FT   gene            complement(70582..72048)
FT                   /locus_tag="BLJ_0053"
FT   CDS_pept        complement(70582..72048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0053"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99549"
FT                   /db_xref="GOA:D6ZXA3"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXA3"
FT                   /protein_id="ADG99549.1"
FT                   /translation="MNKYLRQLFTAVVALFVILGLSSTIIMAVRANALNNDPRNARSLY
FT                   HQLGAYRGAILASDGTVMAKSEPVNDAFKYLRTYSNGPLYAPVTGFFSINQTADRGLEA
FT                   SRSMLLNGEADSLIWQRAKAMLTGTTNQGASIETSIDPKLQQVAYDQLGTRDGAAVAIE
FT                   VNTGRILAMVSTPSYDPNKLATHDAKAASQAYNELSAGQNSPLINRTTSQLYPPGSTFK
FT                   TIVASAALETGDYQTDTKIPAGSSYTLPGTATQLPNDEAQADGVNGQISLQEAVAWSSN
FT                   TAFAQLGVKLGASKVSDMATKLGFGSTITIDGTESTGTPMTATASTFPSDPTDDKLALA
FT                   SIGQGDTTATPLQMAMVAQAIANNGKLMQPTLVDRVRAADLTVLSQTKPQTMANAFSKD
FT                   SADKLTTMMESVVTEANPQLAIDGIKVAAKTGTAQIGTDNSAIDGWVIGFAPADNPQIA
FT                   VAVLVHNTDVYGSLAAGPIMRAMMQEALQQ"
FT   gene            complement(72045..73706)
FT                   /locus_tag="BLJ_0054"
FT   CDS_pept        complement(72045..73706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0054"
FT                   /product="cell cycle protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99550"
FT                   /db_xref="GOA:D6ZXA4"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXA4"
FT                   /protein_id="ADG99550.1"
FT                   /translation="MIATRLRQISLLLIAMAISALAFIQMFQRTAGEFPMQYAGMLALV
FT                   VVLFLVLWGLIVRFQPYASQSILPCVLLLTATGVTMIARIDQSEGWAVAQRQLVWLCIA
FT                   IVLSALLIIFLKDYRVLRRFSYVSMVVGLVLLLAPMLPFIGMEVNGARIWIRIPGLGQF
FT                   QPGEFAKLFLAFFFAAYLFDHRDQLAVGGKKMLGLQLPRIKDLGPIIVVWIASMGVLVM
FT                   QHDLGTSLMFFAMFVAMLYTATGRKSWIIIGLIAFAAGAVLAAGMFSHVGQRIDAWLHP
FT                   FSNEQYNKTPGGSWQLVTGIFGLASGGMLGTGLGQGHPSLVTFANSDFIYASLGEELGL
FT                   MGVLAILMLYLLIIASGFITAMKIKDGFGKLLASGLVFTMAFQVFTVVGGITLVIPLTG
FT                   LTLPYMAAGGSSLIANYILATLLIIISNSANAPEPELTSDTFQYEALAVLRNKELEARA
FT                   RATEPIVQPRSASATASQSEAESFDDPIVDITKHAPDTLEAPEVPAIVTSAGSAAAPIA
FT                   EPIVDATTPAYAGADEPYTPTGTIPPLPPVNGGTRV"
FT   gene            complement(73703..75376)
FT                   /locus_tag="BLJ_0055"
FT   CDS_pept        complement(73703..75376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0055"
FT                   /product="protein phosphatase 2C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99551"
FT                   /db_xref="GOA:D6ZXA5"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXA5"
FT                   /protein_id="ADG99551.1"
FT                   /translation="MPKSAASQPLFLYSTTVSDVGTVRANNQDSSFAGEHLIAMCDGMG
FT                   GHAGGDTASSIAIRSLAHIEQDDTGGNVETISRMMETSVMAAHDAIVGKAKRERKLAGM
FT                   GTTVTAVALVAGYWVIAHIGDSRAYLLRDGHLSRITCDHSYVQHLINTGRITPSEAKNH
FT                   PQRNVVMRVLGDFDIDPRPDISIRRAHPADRWLLCSDGLCGVLEDSTIEETMTTLSDQG
FT                   ECAQRLVQMALRAGSTDNVTAVIADATLALDADAFDLPHQTPLVGGAASRNLEPIADIV
FT                   NEPVATAPALREDDSPAQRAAALIQPASAHETEAAQTTAEPSSTRVVQPSTVREETGER
FT                   ANPDTGEIPVVQKPDGRLSADPNDPDVAKAIRDEQIEQKKATRTKKRRNKLAVIITCIL
FT                   AVLALAGAGWGVYTWSQTHYYVGDSNGTVAIYRGVPTNLFGLELSHEVQTTNIATADLP
FT                   QTWRDQLSQGITVGSLDEAQSHVGIIRTEMRKLAKQQEADAAKKAEASNSLDSSKDSSQ
FT                   SDSKDSTKDSSSQSGSSSSSDSSDKSGIGAADNAATGDSQ"
FT   gene            complement(75381..75911)
FT                   /locus_tag="BLJ_0056"
FT   CDS_pept        complement(75381..75911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0056"
FT                   /product="FHA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99552"
FT                   /db_xref="GOA:D6ZXA6"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXA6"
FT                   /protein_id="ADG99552.1"
FT                   /translation="MTELTFALLKYGFLILLWIFIWLAVRSLRKDIETFSPRPSRARRR
FT                   REREVHKAKAETPQAAAPRPHRRPSASASSVASAQPTLLVIIDGPLAGSSVPLAEADIA
FT                   LGRAASNTVVLDDEFVSSHHARVYRDTRSGQWAIEDLNSTNGTVVNQQRINRPTILPAR
FT                   IPVRIGATTFELR"
FT   gene            complement(75941..76642)
FT                   /locus_tag="BLJ_0057"
FT   CDS_pept        complement(75941..76642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0057"
FT                   /product="FHA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99553"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXA7"
FT                   /protein_id="ADG99553.1"
FT                   /translation="MSVLDRFEKSVEGAVNGVFAKFGSKDLQPVDLSSALEREIDAEAM
FT                   PVGRDRTVAPNEYRFKLSTPDFDRIEAWGSETLANELADNLTEYAKSQHYAFVGPVIVI
FT                   FEEDLDLSKGNFNLTSESVQGNAVPVTTDAQTEDSPVLEVNGNQYLLTKDKTVIGRGSG
FT                   CDIVIDDPGISRKHLEIDITDNGVIARDLGSTNGTYVEGHQVPAATLLDGNTITIGRTR
FT                   ILYWASAQAQE"
FT   gene            complement(76865..79309)
FT                   /locus_tag="BLJ_0058"
FT   CDS_pept        complement(76865..79309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0058"
FT                   /product="peptidase S9, prolyl oligopeptidase active site
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99554"
FT                   /db_xref="GOA:D6ZXA8"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002469"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR038554"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXA8"
FT                   /protein_id="ADG99554.1"
FT                   /translation="MSETNDVNDAIKHFPRLRARTLRFGCGAPRSAQTVGDGSRALFLR
FT                   SDGPEDLVTALWLSWFDESGEHHETKLADPRELLGATADSEDVPAEEKARRERAREGGT
FT                   GIVGYSADDDGNRIVFTINGRLFLTEIAWNDETGAPEPHTRELASEWLDEDPEMYTPVL
FT                   NPRIAPDGEHVLYTTGSYLMLVDIGGELGDRITAVYGVSVEDEDGNPAENTWKIGLAEF
FT                   VAGEEMDRYDGFWWAPDSQHVLFESFDTADEPTWYISDPADPEKPAAGRRYPRALTRNA
FT                   DVYLTVITLAFDENDRYAGITGNADVDWDREAYEYVAAVSWRRGHDPLVLVQNRRQTRD
FT                   QVLEVAVAADGAALGATRVLEEHANEQWIDLVHGTPAYTPDDRLVCSLNDMATDTNRLT
FT                   VDGRPFTPAGWNVRTVLAVTDEDVLAVVQRAPEIATEVPRAWAGSGAASDAESLFGGHD
FT                   ARSFDVVSMGYDGSVAPITTEPGQWTASRGARGMVVSGRDMRSARARMRHIVTRRAVGG
FT                   VTDAVIAANTSDAANTSDITAADITSTAAEPGFTPNVTFTRLGEHRLYTAIIAPSPSSP
FT                   YAHADKLPVLMKPYGGPGFQQVVASQSFYWEGQWWADQGFLVVTADGRGTTGRGPAWDR
FT                   AIFENMKGVTLADQIEAVNALPEAVSRLNADGRRPGVPAPDLDKVCMIGWSYGGFLSAL
FT                   AVLDAPNVFKAACAGAPPTDWTLYDTHYTERYLGLDPDVYYRNGIVQDAPKLERPLMLI
FT                   HGFADDNVTIAHSLRLSQALMAAGRPHTFLPLTGITHMTNDETVAENLLTLQRDFLRDA
FT                   LA"
FT   gene            79369..80460
FT                   /locus_tag="BLJ_0059"
FT   CDS_pept        79369..80460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0059"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99555"
FT                   /db_xref="GOA:D6ZXA9"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXA9"
FT                   /protein_id="ADG99555.1"
FT                   /translation="MQVTMIDENKYAETMADVVLPALEQCREEGWFDPSAAERSAGVEP
FT                   LSGIMDTGGRSGQLHYLCYDAARFDAIREQGATAVFRGAIVISHGFTEFAEKYDELVWY
FT                   FLLAGYSVCVLEHRGHGKSARDVDDHCMVWIDDWQRYVADLAGFAETIGQQYAAGMPLN
FT                   LFCHSMGGGIGAAVLERYPTLFDKAVLSAPMVAPATGMPLGVARVLVGALCGLGFGKKR
FT                   VFGQSDFTPEFSMEGNEGASEARERWYFKLRCENREYQTYCAAFEWVRQALKLNRAVLN
FT                   PSACAEVETPVLLFQSGRDIWVLNKPQNHFVQLVKDGGGEANIVRFPESRHEIFSMPNS
FT                   TYKPYLEKILGFYDDPMIASAAY"
FT   gene            80540..82237
FT                   /locus_tag="BLJ_0060"
FT   CDS_pept        80540..82237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0060"
FT                   /product="von Willebrand factor type A (vWA) domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99556"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXB0"
FT                   /protein_id="ADG99556.1"
FT                   /translation="MGIMSSLRRRAAVVAAAVCAGALALTGCTAFNNSDDGTADGNGAS
FT                   ATTQTFQPSGGKPTATLSIASGSENKEVATAIQKAADQSNVAVTMHYMGSLEIMNALKA
FT                   GGQNYDAVWPASSMWISMGDAKHIVKDAASTSTTPIVFGIAKSKAVKLGWADDSGATKP
FT                   VSTADILAAVSDGKLTFSMTSATQSNSGASAYLAFMTALRGGDGPLTEADLADDQLKTS
FT                   VTKLLSGVDRSSGSSDWLKDMVVANPDRFDAMVNYESLVIQADKALDKDGHDPLLTVYP
FT                   SDGIAVSDSPFGYVDRGQKLKSAFDSFSKALGSKDAKLEFERAGRRTGLGGTLAYATDS
FT                   QVKQSFRAEWGVNTDASALKTIPLPAATVIDSALNVYQTALRKPSWTIWVVDYSGSMSG
FT                   EGKNGVVKGLNAALDPDQAKKSYIEPASGDVNILIPFETEAHRPVKATGTSTSDLLHEA
FT                   DATDASGGTDIYEGLLSALDELPSESEASQYTTAIVLMTDGRSNSDHQDEFESAYKSRG
FT                   RDLPIFSIMFGDADPSQLKSLATLSNAKVFDGRSGDLAAVFRQVKGFN"
FT   gene            82237..82944
FT                   /locus_tag="BLJ_0061"
FT   CDS_pept        82237..82944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99557"
FT                   /db_xref="GOA:D6ZXB1"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXB1"
FT                   /protein_id="ADG99557.1"
FT                   /translation="MLQVICGFVVGLLLAGLGFGLAGGGVPGLIVAVVLAALGYIAAST
FT                   LTEPERRIGKMLVSALPNGQKAADTIDAANARLNSIAMLTKQVRDPAVKAEANDFIAAT
FT                   KDLVQYVTRDTSAYPTLRHYITVYGEQTEKLLRSYVDVESSGARDQIATARIETIEALQ
FT                   VLEQTAAGELSRAVSAKTLGITADSDAIQRLARMGGYDDVAPSPVPFSAADEGRHAPSQ
FT                   GPAHQSDQKTDAQ"
FT   gene            82941..84038
FT                   /locus_tag="BLJ_0062"
FT   CDS_pept        82941..84038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99558"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXB2"
FT                   /protein_id="ADG99558.1"
FT                   /translation="MKLSKSKIIGLIALLAVVGVVCGTLVWRQSQPAPAEPTEQVSITG
FT                   YLGGEKIGLFDDAKFKALAAKQGIAIDYRKAGSLAMMDADRKGMDYLFPSSRAAVEYGN
FT                   AKGVKAIQSDIVFNSPIVLYTHKAVADGLVNGGLMTKDDSGAYHMDMAKAVDAMVANTT
FT                   WADVGYTAGYGQFRIDSTDPVKSNSGNEYAALLATVLNGGQPATVDSVARDGKTIASIF
FT                   AKSGWMETSSEDSFNQFLTLGVGSKPMMVGYESQLLDLAVNQPDAFKQIKDDVVIVYPT
FT                   PTVWSTHTLMALDEKGGTLLNLLKTPAVQKLAWERHGFRAANFAGTDSISRFGVPGTLD
FT                   QIPAVSELPNNDAMQQLIATLQSTQ"
FT   gene            84249..85430
FT                   /locus_tag="BLJ_0063"
FT   CDS_pept        84249..85430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0063"
FT                   /product="TelA-like protein associated with cryptic
FT                   tellurite resistance"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99559"
FT                   /db_xref="InterPro:IPR008863"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXB3"
FT                   /protein_id="ADG99559.1"
FT                   /translation="MPQNITLADLTKSSATPITNPLLNTNQAAPNTTLVPTAAEAQAAA
FT                   ALTPDQQIAKLPEADQATVNQMAGQIDFTRDGIESSYGKDAQRATSTFADEILSDTRSK
FT                   DTGEAGELLNTMLVTIDEADLGGFRTIPIIGQVAVSVDKLRRRYQKVDAQIDEIIVRLE
FT                   SAQAKLVADISMYDTMYTQNAQQYRELKMTVLAGKKALADFNANQLPALEAEAAASGDA
FT                   MQAQVLKDFKSKLDRFAKRLDDLDRISVVTLQTAPQIKIIQNADQTIVDKIDTTISTTI
FT                   PVWKSQMVIALGLSNQRKALDLQNKADDVTNKLLARNAAALHKGAVDAEKANQRSVVEI
FT                   DTLEKINAELIATLKETVQIQKEGKANREAAQVKMRQIESDLKNALLENAQQM"
FT   gene            85775..86278
FT                   /locus_tag="BLJ_0064"
FT   CDS_pept        85775..86278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0064"
FT                   /product="heat shock protein Hsp20"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99560"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXB4"
FT                   /protein_id="ADG99560.1"
FT                   /translation="MAMFPALMNDTMFSDLFDDPFFEGWRNTDNTMSAAMPANMMTTDV
FT                   RETDKGYDVDIDMPGFKKEDINLELNNGYLTVSASRCSEHEDKAPAAEGEASDSKCACA
FT                   SDSGKWLRRERYMGSCSRSFYVGEDVKESDIHASYRNGTLCIQVPKMQAQPQVESKHQI
FT                   AIEG"
FT   gene            86606..87562
FT                   /locus_tag="BLJ_0065"
FT   CDS_pept        86606..87562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0065"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99561"
FT                   /db_xref="GOA:D6ZXB5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXB5"
FT                   /protein_id="ADG99561.1"
FT                   /translation="MANGAQNASGTPAPAASRSGGHVVSARATTIGLMAILLWSFMAGT
FT                   VRIVSENFGATLGSALIYTVGGILLLMFRRPAPIREFPKKYLIIGGLLFVFYESSISLS
FT                   LGLASTDASSVEVSLVNYLWPTMMVLLSAGVSHRKHAVVKVLPGAIVATAGVVLAVGGN
FT                   SGLDWHAAVQHIAANPLPYALAFAGALAWSVYAVFTPAMSHGVDGTSLFFPCVAVALWI
FT                   IHFASGQGWPAEPPSLVAWLFVLIAAAAIGGGYACWGYGILHGSMERLAIASYATPVLS
FT                   TGASAVLLGLALSLPFWCGALLVAAGSVLNYLVSARK"
FT   gene            complement(87730..88188)
FT                   /locus_tag="BLJ_0066"
FT   CDS_pept        complement(87730..88188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99562"
FT                   /db_xref="GOA:D6ZXB6"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXB6"
FT                   /protein_id="ADG99562.1"
FT                   /translation="MLVDMTHANEQRPAATGNVADNVSDAPTDPATSAAARPMTGTADG
FT                   TTATNAAASSTAKPAASTSWTRETNPRRALLTIIVTVVVVVAIVLGLGFFVNWGLAALS
FT                   VIIMIPGAISLAVLAKHPESTGGRSMFGISDPNTLLDPIRRPSERRGE"
FT   gene            88446..89978
FT                   /locus_tag="BLJ_0067"
FT   CDS_pept        88446..89978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99563"
FT                   /db_xref="GOA:D6ZXB7"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXB7"
FT                   /protein_id="ADG99563.1"
FT                   /translation="MELSLVRGIVPWTVFGLTAIAAIILIVGLALSKKRGPAADGLAPG
FT                   GLAPDGESSAQSPVDPDNQPANQSTNAAATASSAASTEETFISHGLRTPQRRHLHPLVA
FT                   SLVAAALAGAGGLLATWLMSDVFMVFGVSLGWPVILTVAGGFAGLGFVLAAAVTLRGGR
FT                   RALAVVLVPLVLASTALGVDSIYGEYQTIGSLVGYTPYPPLGSVTVRKASMSVGEWRDK
FT                   ARKGALPSMPDSGRVFAVTIPNTESKFKARKAMVYLPPAALSDRPPALPVMELLAGQPG
FT                   SPGRLIDAGNIAATMNAYAVEHDGLAPIVLAPDQNGSAMHNSLCADTTRGNAETYLTKD
FT                   VVNWARATLPVAKSARMWAMGGFSQGGTCTTQLVPRHPDIYGAMLPVDGELEPTDGSVE
FT                   TMVRRYFAGDRKAYDGQVPVNAIAATGTADQALFAGAGKGDRKSVANMRTIAAAARAAG
FT                   METTELVVPGTDHDWHAVQAVWNPGLDWFGARTGLGEMTKSLEEYPQVEVLQ"
FT   gene            89975..92659
FT                   /locus_tag="BLJ_0068"
FT   CDS_pept        89975..92659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0068"
FT                   /product="protein of unknown function DUF470"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99564"
FT                   /db_xref="GOA:D6ZXB8"
FT                   /db_xref="InterPro:IPR024320"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXB8"
FT                   /protein_id="ADG99564.1"
FT                   /translation="MSEEQQHGNARPAAMPQTRRPLRDAEPSRTKPATTSRATKPHTAR
FT                   SSHAAESWRELAGDVRQWADDHRLAVTATATLVALNLAAWLVAAMAGFAFPLRLSTSMA
FT                   AFNAGKLICSLFLARGVIQLMVDAVLWLVMLSIAEPWLGRVRTVVTALACAAGGVLAGL
FT                   TLCAAAGWMFQDSLFVSRMRFALSPLVLPVGALMAASAFCSHLWRRRIRLVGYVAILVT
FT                   LLYSGNPSGYCILAAALIGHAAGRVMAGPPAHVETEWHWLRSTSFEARRIFAAIAVVLA
FT                   LGPVIAITSHNHAGPLSTIGLLMSPVSVDDGMLAECLAGDTHSGCFLQFDLLRASMPGA
FT                   VLRSLLPTAVTLVLAWGLYRGRRFAAICTVAINLFTVAIAVAYYLVVPLSFAPDGMASL
FT                   LQHGAIVACVANVLPPLLFAIALLAAMKHFPIRIGWCRLVGGIGAIVLAWLACAAIYLI
FT                   YGIAQPATFSPRATASSLLAELPGRFLPIGFLSHMKLSFVPRTPMASIMYQGVGLVFWI
FT                   VVLAVVIHWMGDVSESNERARARAERLVETGGESMSFMTTWEGNSYWLSPTGRSAVAYR
FT                   VLNGIALTCTGPFGDPAEWMDDLNGFAQHCAERSLSPVFYGVHREQRDALLEAGWNSIE
FT                   VGSEMVVDPRGWKTTGKKWQDVRTAINKAKRDGVTDVQSTFLEASLDVREQIEDISEEW
FT                   AQLKALPEMKFTLGGVEELRDPRVRLLYAIDADGRVLGVTSWLPTWRDGRIVGWTLDFM
FT                   RHRTDSPNGIMEFLIARMAERLRDEGEADPAHAVEFMSLSAAPLAGMNPDRDNAGEDGA
FT                   PASEGTQVLQHALQIVADWMEPAYGFHSLFNFKRKFQPTEAPVYVCYPDPAALPQIGLA
FT                   VVRAYVPSVTPAEVAGMLSTLRS"
FT   gene            93196..94170
FT                   /locus_tag="BLJ_0069"
FT   CDS_pept        93196..94170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0069"
FT                   /product="methionine-R-sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99565"
FT                   /db_xref="GOA:D6ZXB9"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXB9"
FT                   /protein_id="ADG99565.1"
FT                   /translation="MSERNEHNDGNTQTAYFAGGCFWGLERYFQNVDGVTDTTVGYAQS
FT                   TVESPTYEQVCAGGTDAAETVKVEFDPAQVSLRTLTLLFLEVIDPFSVDQQGEDRGRQY
FT                   RTGMFYTDETQRAVYVAALEQLVDRQPQRPAVLVEPLRNFYPAEAHHQDYLVNNPGGYC
FT                   HVPIAAIANVKRRQKYVERIWDLTLEQFAVTQNAATERPFVNEYDEEFEPGIYVDIVSG
FT                   EPLFSSQDKFDSGCGWPAFSRPIAGDLLTEHEDHRIPGRDRIEVRTSDTQIHLGHVFAD
FT                   GPADRGGLRYCMNSAALRFVPRSRMAEEGYGDWIAVVDGDDQA"
FT   gene            94167..94766
FT                   /locus_tag="BLJ_0070"
FT   CDS_pept        94167..94766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99566"
FT                   /db_xref="GOA:D6ZXC0"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXC0"
FT                   /protein_id="ADG99566.1"
FT                   /translation="MSMENIAGARKPAKREDEHTVAGEHRMMRRADREVTDPERIAAII
FT                   AACDIVEVAYADAEGLTIVPLNFGFDYDEATGKLTLWFHSAPRGRKLDAIRAAAGGRLP
FT                   VAFTMQTDCEVVAGRTTCNWGEAFKSIVGNGTASLVEDLDECRHGLQTLMAQQAHMPNV
FT                   EFTDAQVRSVTVWKIESDYFTTKVRTKPVPAHMHQR"
FT   gene            94965..95837
FT                   /locus_tag="BLJ_0071"
FT   CDS_pept        94965..95837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0071"
FT                   /product="Glycosyltransferase for cell wall membrane"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99567"
FT                   /db_xref="GOA:D6ZXC1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXC1"
FT                   /protein_id="ADG99567.1"
FT                   /translation="MNDGSDDHASVEMLNATLDDCRHGAMDANGVAIDLIGQANAGPSA
FT                   ARNRGIAAAETPFVVVLDGDDRLRPAFIERTLSMLSADKTMVAASGWLQTFGVLESVVQ
FT                   PTGGNAAAFVSHNCCPATCMIRRVAWECCGGYDESMRGGFEDWDFFLSLLECGLTVEND
FT                   ICGAGVTGGTEHVGGFGSAWDTENPAKDAAHIGIAPEPLIEYRTAPASSNVTSMTKRLD
FT                   LMRFLIAKHRNLYAVHIADAILGVEAISMSRLTMWESLMRGDTTASQAFMTHPTYGDGG
FT                   MAAAVRLRS"
FT   gene            complement(95844..99050)
FT                   /locus_tag="BLJ_0072"
FT   CDS_pept        complement(95844..99050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0072"
FT                   /product="DNA repair helicase Rad25"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99568"
FT                   /db_xref="GOA:D6ZXC2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR021835"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXC2"
FT                   /protein_id="ADG99568.1"
FT                   /translation="MSINLVSTSDSPANTQHHDSDPTPSILEDVISGLIEPRSDAPGEY
FT                   KPTLIANRPGGLTMHEEIGNSLATSDSFDISVAFVSAEAVLSLFEDFRSHHETATRAGT
FT                   LITSTKNHFNDPRAFWELLHLQNTTGVDVRVWEGSRNTSVSAMAQGQPFHPKGYIFSRR
FT                   MKDGTPYYDLYVGSSNLTGAALTTQREWNLKVSSLADGELVGQFQDEIDSQVADSVPLT
FT                   EEWIKQYEEDFKKYAPPRHEILQSLEGHDIQPNAMQQEALANLKKIREQGEHRAIIVSA
FT                   TGTGKTYLSAFDVRECQPKRMLYIAQQQMILQTAMKSYQKVLGCDESELGLYSGTSKQQ
FT                   DRRYVFATVQTMRQPEVLAQFKSDEFDYVLVDEVHHAGAEGYQRVINHFKDADFMLGMT
FT                   ATPERTDGINIFELFGHNIAYEIRLQKALDENMLCPFHYYGVAEYLGSNDDPNGIAHRL
FT                   DVSKGLDAKDSKQLKYEIEQLATEKRVRYIIDKLQEYGQFNIPVTGLVFCSRQEEAHKL
FT                   SQLFNQQWNQQAERPYRTAAVTSTDDDGRPVSQTQRDEYVRKLIEGELDYLFTVDMFNE
FT                   GVDIPAVNQIVMLRSTESSIIFTQQLGRGLRKFPHKESVVVIDFIGNYNNNYLIPVALY
FT                   GNTGDRDRARKNLQRKSIGLSSISFDPIAKERILKSLGAADWSDMKKLSEQYRQVRYEL
FT                   GRIPMLTDIYNYDPSLPYTIASKRSNYLDFVRSREKSLGKGKHHEATFEDQLEPVTDVE
FT                   DAILKMAAELLLPGLRPHELVILAQLCHFVSERLDDDVPQHWSAGSPIGRSELLDAIRT
FT                   EFPQSDGSDTQFDSAISVLDYSYFTGPNCNRFGNQPLVEAANSTGTENGTAYRLNSRFA
FT                   DMLATNRTFRIFFADTLRTGMANCRDIFREAAARQQVFDHMFLYERKYSMADVMRLCGW
FT                   KKENTPQNVGGYLLDKETNTMPIFVKYAASQYEDEFLSTQEMKYFSKNGRTPQSPEFRW
FT                   ALNGIGPNWGQTHFVPLFVMRKAEEAEGKYYYVGHVAAFDNPQLTTKPDASGQGSVKVT
FT                   LSILRLARPIDLELYRHLVS"
FT   gene            complement(99112..99525)
FT                   /locus_tag="BLJ_0074"
FT   CDS_pept        complement(99112..99525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0074"
FT                   /product="mutator MutT protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99570"
FT                   /db_xref="GOA:D6ZXC3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXC3"
FT                   /protein_id="ADG99570.1"
FT                   /translation="MERERKIINVVGAAIVTNGTVLCAQRGPGKSLAGYWEFPGGKIEP
FT                   HETARQALHREIEEELLCEVEVAEEVCTSEYAYDFGTVRLTTFICHLIAGTPHLTEHTD
FT                   IRWLNPADMPTLNWAPVDREAVAIIANKQLTLR"
FT   gene            99503..100093
FT                   /locus_tag="BLJ_0073"
FT   CDS_pept        99503..100093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0073"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99569"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXC4"
FT                   /protein_id="ADG99569.1"
FT                   /translation="MILRSRSMNNQDTTLQDPQAIHDPRRFCNIDPDAFDYAIGRVENV
FT                   GVDAADYCGEQEKQSVSEVRFGNGPTLGSDLSTQTSQRSLAMILVTTTPSVDGYTITNY
FT                   QGIVFGEVVSGVNMFKDLGAGLRNMFGGRSQGYEEELMRARNEAIAEMQQRAEAMGAHA
FT                   VVGVDIDYEVLGADNGMLMVTASGTAVQIARTA"
FT   gene            100175..100690
FT                   /locus_tag="BLJ_0075"
FT   CDS_pept        100175..100690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0075"
FT                   /product="possible acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99571"
FT                   /db_xref="GOA:D6ZXC5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXC5"
FT                   /protein_id="ADG99571.1"
FT                   /translation="MTIRIEAYDRLPDAARAIREQVFIRERDWRPEFDEWDAASAHLLV
FT                   FDSDNDAPNRPGSSAQLASRSQPIQPDQNRPVATCRFYADPDHPDQPGRYIIARLAVLP
FT                   EAQGRHIGSRLLADAERRIAQAGGTMAAVHSENDHYKFYEQRGYRLTDEVYEGGRHGWL
FT                   VKDLSRNV"
FT   gene            complement(100720..101577)
FT                   /locus_tag="BLJ_0076"
FT   CDS_pept        complement(100720..101577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0076"
FT                   /product="Hly-III family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99572"
FT                   /db_xref="GOA:D6ZXC6"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXC6"
FT                   /protein_id="ADG99572.1"
FT                   /translation="MSVSISTPSGRNMASAATVAPSTTASQKSSASTSPTALDHASAQY
FT                   RAAQSRYRQAKAALKAIKRQIVPVDAFGNRKPRLRGWLHLATLPLCIAASIVLICIAPA
FT                   GPVKAACAVYGASAMLLFGNSALLHVVPWRSAKVTRVLCGIDYSNIFLIIAGTNTPVLF
FT                   ALSPAIRRPYLTVIWATAAIGTILHIVWLRTPNWVFTTVYVVLGLAPVTLIPQLWTAPA
FT                   VGPAPTVLIACGGAAYIAGAVCFALRKPNPVPGWFEFHEVFHLGTVIGYVCHVVSIYLI
FT                   VCAL"
FT   gene            complement(101681..101917)
FT                   /locus_tag="BLJ_0077"
FT   CDS_pept        complement(101681..101917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99573"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXC7"
FT                   /protein_id="ADG99573.1"
FT                   /translation="MNRDETNEVSGVADDQLGRTAEPYESDNWRGGVESIIRSNPKSGT
FT                   DTSRTQQTRIIRVHRLSDVFRDRTTEYHTTEEL"
FT   gene            complement(102434..102519)
FT                   /locus_tag="BLJ_0078"
FT   tRNA            complement(102434..102519)
FT                   /locus_tag="BLJ_0078"
FT                   /product="tRNA-Leu"
FT   gene            complement(102826..104139)
FT                   /locus_tag="BLJ_0079"
FT   CDS_pept        complement(102826..104139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0079"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99574"
FT                   /db_xref="GOA:D6ZXC8"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXC8"
FT                   /protein_id="ADG99574.1"
FT                   /translation="MTISLLEHPLGAQPGQPGDRSAFHFETITRLPSTASGLGRDGARY
FT                   GRTGIIHTPHGDIRTPAFVPVGTQAAMKAVLPEQMKDLGAQCLLANAFHLFERPGEDVL
FT                   DAAGGLANFMNWDGPTFTDSGGFQVMSLGVGFKKTLAMDVTGMKSDDIIAKGKERMAWV
FT                   DEDGVTFKSPLNGDAHRFSAEISMGIQHKIGADIMFAFDELTTLMNTRSYQEDSVERTF
FT                   RWARRCVDEHQRLTAERLGKPYQALYGVVQGANYEDLRRRAASQIASLDFDGVGIGGAI
FT                   EKRIIGDTCAWICDAMPENRPRHVLGIASVDDIFACVENGGDTFDCVAPARCARNGAIY
FT                   TRAGRYNIKRAQHKFDFGPLEEGCDCYTCQHYSRAYVDHLLRAREFNGFTLATIHNEHF
FT                   FVKLLDDIRASIDGGYFDEFRDEALAHFYGNGERRPGL"
FT   gene            104556..106616
FT                   /locus_tag="BLJ_0080"
FT   CDS_pept        104556..106616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0080"
FT                   /product="peptidase S1 and S6, chymotrypsin/Hap"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99575"
FT                   /db_xref="GOA:D6ZXC9"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXC9"
FT                   /protein_id="ADG99575.1"
FT                   /translation="MADEFNPQGVDQTPRNNENPNSTADTGNAEPKNPFVGGDSVDAGN
FT                   ASDSSEQQAPVSSAALAADQQPTQAATDTAATEPIPDYASAKGESTVVSSSPASPAAPA
FT                   AGQTSATTPLYRPAPEYGAYGPTPTQAQGQQGGQAGNNAQPTQQFPFGQPAQQTPQGQQ
FT                   GNRNPYYTNNPQPQGNGNPFNPPTQPQQNIGNPFASQSGQSGQNGRNGQQPQQGGLFGF
FT                   GTPGTGTPNGQGPAQPGQPGQPGPAKQGMSKTASNILIAVVAAVVSAALCLGLGYGALT
FT                   SGLITLPTSNSLSNVSSNKSGSGSATAKSGEAPDWQTVASDVSGSVVSIQTALSNGTAK
FT                   GSGAIIDTEGHIITNNHVISGAQQIQVTLANGNMYSATLVGTDTTTDLAVIKLDNPPSD
FT                   LKAVEFADSDKLAVGENVMAIGNPLGYDDTATTGIVSALNRPVTVTDDNNNEIVTNAVQ
FT                   IDATINPGNSGGPTFNAAGQVIGINSSIASTATSSDSAGSIGIGFAIPSNLVKRVADEI
FT                   IKDGKVKHVALGVVIKSDTVEADGVTRGGATITKSSATGSAVVSGGPADKAGLKEGDTI
FT                   VAFNGNAVNNNYSLLGYVRAAALGDKVTLTIVRDGKTMDVDVTLDQEESSVNGSSGANG
FT                   NSNGQNNKRNRNGDGANGNNGGDDGNGQNGNGRNDGGTGDGGGFTDPFGLW"
FT   gene            107014..109173
FT                   /locus_tag="BLJ_0081"
FT   CDS_pept        107014..109173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0081"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99576"
FT                   /db_xref="GOA:D6ZXD0"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXD0"
FT                   /protein_id="ADG99576.1"
FT                   /translation="MSALIRFFTKILDICKLVPMLPVVVIAAIPLALLGDWRPWGNAMA
FT                   IPVLGNPGFGQWLVIALVLIIVIDTVRGMIDDLRHGQVGVDVLAVVAILSTVAVAEYWA
FT                   SWAVTLMITSGEAIEEYAQAKAERSLTALMEAAPQTAHVVNLPGVGCGFATDKGDSSDG
FT                   FRRVGLALAAAAAHHFDTVPVEQVQLGDVLMVLPGETVPVDGELLSGTATLDLSNINGE
FT                   PVPREVFAGARVMSGAVNGSTALTMRATQVAADSQYQRILELVASAQESRPAVVKTADR
FT                   LAVPFTVLSLMIAGIAWAMSGVPTRFAQVLVLATPCPLLIAAPVAYIAGTGRLAAAGVL
FT                   IKAQDVLENLGRVTQVFFDKTGTLTVKQPQVVRVEMLPGAATRLNEDHVLMMAGVVESY
FT                   SVHILSKGIAKAGVEAMARLRQRFEDGQRLCPEPEASWPGHGREYPVVKNINEDAGKGV
FT                   SGEVNGHAVRVGRLSFAAAGEDGFLAVGEAAPLSPRSGQLPLRGGAQQKDDLRTRFGLL
FT                   QPDEMASYVSVDGRLIARIVLRDVPRANAKAVLAKLHELGVTELAMLTGDKRASANIIA
FT                   SEVGIDEVHAELFPEDKVAAVRAATGAGKTVTMMVGDGVNDAPVLAVADIGVAMTDGTS
FT                   TAASESAQVVIMNDNIAAVPRAIAIARRTKRVMLQAVIAGLVLATIGMIAAAFNLIPVV
FT                   VGAFLQEAIDVVSILWALTALIDRD"
FT   gene            complement(109513..110244)
FT                   /locus_tag="BLJ_0082"
FT   CDS_pept        complement(109513..110244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0082"
FT                   /product="AAA+ superfamily ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99577"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXD1"
FT                   /protein_id="ADG99577.1"
FT                   /translation="MPLNLFFSNYIDTYIERDVSEYLDVRNLAEFRRFLTLCALSSGAL
FT                   INYTNIANELGVSPRTVKAWMSILESSYIAFHLMPFYTNARKQVVKTPKLYFYDTGLLC
FT                   HLLGIRTVEALVAHPKFGDIFENLIIAETMKQHLNANQEPQLFFYRDASKVEVDLLDFT
FT                   DPNNRMLIEIKSGQTYHDRFARHLTLIGNILGIPCEQQYVTSRVEHSYVSQGIRVTSAP
FT                   RLARRPTVKSRRRAVGILCNQ"
FT   gene            110486..111937
FT                   /locus_tag="BLJ_0083"
FT   CDS_pept        110486..111937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0083"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99578"
FT                   /db_xref="GOA:D6ZXD2"
FT                   /db_xref="InterPro:IPR021163"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXD2"
FT                   /protein_id="ADG99578.1"
FT                   /translation="MTESVNTELRIAVIGAGPAGVYSSDIFLRQLKKLGEELGLGTEAR
FT                   IDLFEKLPVPFGLVRYGVAPDHPSIKFIASALEKTLDNPNIHLYCDVEFGKDVTLDDLL
FT                   ARYDAVLFATGAVKDKPLNLPGADLEGVYGAAKFVEWYDGYPTGAREWPLTAENVAVIG
FT                   GGNVAMDVARELMRNADDLKAKTDISDNVYEGIGRNKAKVLHLFIRRGVAQAKFSVQEL
FT                   REMEKLPGVQLIINEDDFDLDDETIEVAGKDKLTRQMVEELFAIREMAEDMEDDGDVDF
FT                   EGNPADRKYYVHFNSAPTEILGEDGKVKAIRVERTETGADGKMRRTGEFADYPVEAVYH
FT                   AIGYKPAEAPGITYDEHGAHLANANGDGRITTEADGGDVRDRLYATGWAKRGPVGLIGS
FT                   TKSDALAIVTNMLEDLAKAAEGGRVAADRDPESIDRLLESRGVKPIDFAGWKKVDAFER
FT                   AEGAKEGREHKKVIEPDQMRELALA"
FT   gene            112312..113253
FT                   /locus_tag="BLJ_0084"
FT   CDS_pept        112312..113253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0084"
FT                   /product="peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99579"
FT                   /db_xref="GOA:D6ZXD3"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXD3"
FT                   /protein_id="ADG99579.1"
FT                   /translation="MDAKVRVHGHFNGLKTTLLFTLMWAVIMLIWWATGGSRQTLGVYI
FT                   VIGLITTFGTYWFSDKLAIASMGAREVSEQEAPEIYQIVRELSAKAGKPMPRIYIAPTM
FT                   SPNAFATGRNERHAAVCCTQGILQILNARELRGVLGHELMHVYNRDILTSAIASAMATV
FT                   ITYLGYSLMYFGGGNSRDDRDNSGGLGLIGVLLSVILAPIAASLIQMAISRTREYDADE
FT                   DGSLLTGDPEALASALNKISYGAQTTPMRKTAGTQSVSAMMIANPFSAVGFSKLFSTHP
FT                   PTDQRIARLMQMANEMNGTPVAASTYSTRAIH"
FT   gene            113336..113409
FT                   /locus_tag="BLJ_0085"
FT   tRNA            113336..113409
FT                   /locus_tag="BLJ_0085"
FT                   /product="tRNA-Gly"
FT   gene            113534..114709
FT                   /locus_tag="BLJ_0086"
FT   CDS_pept        113534..114709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0086"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99580"
FT                   /db_xref="GOA:D6ZXD4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXD4"
FT                   /protein_id="ADG99580.1"
FT                   /translation="MRGQQRAIRVLFVAQGLSLAAMSVDLTVTALVGSELAPFAWMATI
FT                   PIALIALGTVFANTFVNRLIARIGHKHVFEAGAVIAICGGISSFCAVWFHNFPLLCVGT
FT                   FAVGIYQAASNYYRYAAADLNPGKKDRAVSVVLSAGVIAAIVGPLLATWAEGLFPVHYA
FT                   GSYLIVSVLGILALATVAMFPADQQIGSTRQPVGSAQKVGLLDLLRRPRFLLGICLGFT
FT                   ACCAMTMIMSGAPLVMEHVLRESDGTRMQAMQLHMLGMYLPMALIPLLNSKKRSHTVFV
FT                   SLALGLGLVSCLLGLGQNAPLVAMALLGIAVAWALGYNEGTVLLVSSYSADEVASARGK
FT                   GEFFLVCGQVIGSLLAGSVIEFLGWRTMLAILTLLFVLTSGIAINSRKAIA"
FT   gene            complement(115058..115849)
FT                   /locus_tag="BLJ_0088"
FT   CDS_pept        complement(115058..115849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0088"
FT                   /product="Uracil-DNA glycosylase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99582"
FT                   /db_xref="GOA:D6ZXD5"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR015637"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXD5"
FT                   /protein_id="ADG99582.1"
FT                   /translation="MASIIPPPSDESHCRGGLGGECAQDHLAREARSSPTTRTYAANRR
FT                   KRGTTTMEPVSDIRHSPLEGRRPKRTELAGFVDGTVDDIRCPHPKLLIVGINPGLWTAA
FT                   VNAPFAYPGNRFWPSLFASGLTPWQVDASYGLRLRDERMMIDRGIGLTNLVNRATAKAS
FT                   ELNTAELRQGADRLRELCARVHPRAIAILGITAYRQAFADKSAALGLQDLTAEETDRFG
FT                   GAQLWVIPQPSGLNAHATMPVLVDWWRRVADAAGLDLAAAR"
FT   gene            115839..116936
FT                   /locus_tag="BLJ_0087"
FT   CDS_pept        115839..116936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0087"
FT                   /product="fructose-bisphosphate aldolase, class II"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99581"
FT                   /db_xref="GOA:D6ZXD6"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXD6"
FT                   /protein_id="ADG99581.1"
FT                   /translation="MEAMTIATAERYAEMLDAARHGGYAYPAINVTSTQTLNAALQGFA
FT                   EAESDGIIQVSVGGSSYFSGQSVNDRVVGSLAFAAFAHEVAKRYPNITVALHTDHCAKQ
FT                   YLDGWVRPLLAHEAEQVKRGEEPTFQSHMWDGSTVPLEENLDIAAELLEKSVRAHTVLE
FT                   IEIGAVGGEEDGHSAEINEKLYSTPTDGVRVAERLGLGEHGRYMAAFTFGNVHGAYKPG
FT                   VVKLRPELLRDIQSEVWDAALDGRLGSLGASAVSTCALPDMPERKPFALVFHGGSGSTP
FT                   DEIARAVSYGVVKMNIDTDTQYAFTRAVAGHMFAHYDAVLKIDGEVGNKKLYDPRSWGR
FT                   EAESAMAARVVEACRQLGSAGKALK"
FT   gene            117074..117927
FT                   /pseudo
FT                   /locus_tag="BLJ_0089"
FT                   /note="frameshift"
FT   gene            118037..119323
FT                   /locus_tag="BLJ_0090"
FT   CDS_pept        118037..119323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0090"
FT                   /product="Adenylosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99583"
FT                   /db_xref="GOA:D6ZXD7"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXD7"
FT                   /protein_id="ADG99583.1"
FT                   /translation="MPGIVLIGAQWGDEGKGKATDLIGTKVDYVARFNGGNNAGHSVVV
FT                   GDESYALHLLPSGIINPNLTPVIGNGVVVDPEVLFEEIDGLESRGIDCSHLKVSEAAHI
FT                   IAPYHRTLDKVTERFLGKHKIGTTGRGIGPAYADKINRVGIRVHDLFNADHLHDKVEAS
FT                   LHQKNQMLVKLYNRRPIDVDQTTEELLKLGERLKPYVANTGLILNKALDEGKTVLFEGA
FT                   QATMLDVDHGTYPFVTSSNPTAGGACTGTGVGPTKITRVIGVSKAYVTRVGEGPFPTEL
FT                   LDESGEWLRQQGHEFGVTTGRPRRCGWFDAVVNRYASQVNGLTDIVLTKLDVLIGLKEI
FT                   PICVAYDVDGERHDDMPTDQAAFAAAKPIYETMPGWDEDISDCHSFDELPATCQAYVKR
FT                   LEELSGCRISVIGTGPQRDHVIQINPLVD"
FT   gene            119416..120930
FT                   /locus_tag="BLJ_0091"
FT   CDS_pept        119416..120930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0091"
FT                   /product="Cl-channel, voltage-gated family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99584"
FT                   /db_xref="GOA:D6ZXD8"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXD8"
FT                   /protein_id="ADG99584.1"
FT                   /translation="MAAAGIVIGLVSGLLVVVYRLGIEYGTDASRWIYARIRETPWLIA
FT                   PWAVAAVAAALAIAWMVGKEPMAGGSGIPQTNGVVICGLKMRWQTILPVRFVGGLLGAL
FT                   FGLSLGREGPSIQIGASGAQCVSHRLRGRRREDMQEHYLVTAGAAAGLSAAFSAPLSGM
FT                   MFALEGVHRSFSPAILMGATAASLTADFVSKYCFGLRPVLDFGDIGQLSLEEYVWLIPL
FT                   GLVAGLVGSLMNRSLLGFQTLYGKLPAWSRPMIAIAIALPVGIWLPDVLGGGSNLIDTA
FT                   EHARVGLGMLCLLFVAKMLFTSTSFGSGAPGGIFMPILAVGSLAGGICGEVLHRFGDLP
FT                   SDAVAVFAVCVMTGTLAASVKTPITSILLAVEMSGTLTHMLPVAAVAFIALLVSDLLRT
FT                   KPIYGELLERYVRAQGMQMAIASHVGSGIMELPLEMGAIADGKRVRDVRWPSGCLIIGL
FT                   RRGESEIVPRGDTRLRAGDYLVVLFSGEEEREVRPAMRRLCDARLD"
FT   gene            121117..122157
FT                   /locus_tag="BLJ_0092"
FT   CDS_pept        121117..122157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0092"
FT                   /product="Camphor resistance CrcB protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99585"
FT                   /db_xref="GOA:D6ZXD9"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXD9"
FT                   /protein_id="ADG99585.1"
FT                   /translation="MESQEQSPGDVVTAGEDSHPITQAIDTVEVTHAGATAPAANTMDP
FT                   PTIPLAPMKRMQARFNPLADGLMYVVVFVGGFVGVGCRHALDMLLPSVSGTPFVVGTFV
FT                   SNMVACFLFAMLTEFMATASWLRRRVRQVVSRGVGLGLLGGLSTMSGVMLETVEGLHER
FT                   HIASALGYLAGNFAGGLLTAAAGVVLMQALLSRSTRKRVRGAFSAVSVSDSAESDTQGV
FT                   RHVKVADVARSAAQAAMEAAQAAQQAAQTGQVPRVETPTVPPTASQPMQTGRVPQIPPL
FT                   AVPQLTQPAHPLLREPDTPDLGQLPEIQQSQPIQQPANPLPPSFEPKPITAEISLVADP
FT                   TTGEVR"
FT   gene            122157..122552
FT                   /locus_tag="BLJ_0093"
FT   CDS_pept        122157..122552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0093"
FT                   /product="Camphor resistance CrcB protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99586"
FT                   /db_xref="GOA:D6ZXE0"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXE0"
FT                   /protein_id="ADG99586.1"
FT                   /translation="MMWMICLFGGLGAMARYVLDVSIQQGWNRENRRTNRNFPLSTLVI
FT                   NGVASLCAGIAMMSYYSQSVDMDTVMMFVVGFLGGFSTFSTALNEVVSLIRQRRFTLAL
FT                   GYGIATVAVPLICVAAGFGIALLANPA"
FT   gene            122661..124082
FT                   /locus_tag="BLJ_0094"
FT   CDS_pept        122661..124082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0094"
FT                   /product="inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99587"
FT                   /db_xref="GOA:D6ZXE1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXE1"
FT                   /protein_id="ADG99587.1"
FT                   /translation="MTAVTYFTRHRRPGIAMLCSIFAVLSMLFVLPPAIASAAGTAQAV
FT                   DECNPTSDNGCVNGILQDAGKQPIAGATVKLSGKATAETTTAADGKWAFSVADDGDYTV
FT                   TIDDAVAKEHGLKSSSATVTIKKASFDKQRGVIRFDQADDTAGNGAAESADSKQGTADA
FT                   AGSADAAASSAKKGGSNIGKRIWQQLYSGIIFGLMLGLMSVGMNLVYGTTGLQSFSHGE
FT                   QVTLGGLMAFVGTQMLHMPLVASAIFAVIIGALTGFIQNEIVWGPLRRRHVGTMQQMIV
FT                   TIGLSMALQYTFQFFFGGDIKGIVKSVPNSFQIGPITTDMPTLLSALIAICVIVGVTLF
FT                   LYKTRLGRATRAVSDNAALAAASGINVDQVVRVVWILSCAMAALSGVLLGVYLNGISWN
FT                   TGATLILLMFAAVTLGGLGTANGALIGSLVIGIVADMSSLVIPNDMRYASALAILIIVL
FT                   LVRPQGIFGKQQRVG"
FT   gene            124086..125069
FT                   /locus_tag="BLJ_0095"
FT   CDS_pept        124086..125069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0095"
FT                   /product="inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99588"
FT                   /db_xref="GOA:D6ZXE2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXE2"
FT                   /protein_id="ADG99588.1"
FT                   /translation="MDFMTIISNAAGELIAPTTAAYVLAAIGLNIHFGMTGLMNMGQAG
FT                   FMLLGAYGFAITQSMGCNLFASVCAALALAVIYALLLGIPTLKLGPDYLAMVTLAAAEI
FT                   IRIVGRSTAMTNFTGGSAGISPQDFTEKFEALSPLPDGSTTFLLWTYSNNIANSWWLRI
FT                   VAWILVAIAAFLCWRWFHSPWGRMLKGIREDENAIRSLGKPVTKYKMESLILGGLFGAM
FT                   AGIIFVLPRSVQPDSLGRTVTFYVWTILLLGGAATILGPVLGSCVLWVLLTFVKEVMRN
FT                   TVPETLISSNQIEALGWVIVGVALMCLVIFRPQGLLGDRKELAFHA"
FT   gene            125062..126063
FT                   /locus_tag="BLJ_0096"
FT   CDS_pept        125062..126063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0096"
FT                   /product="branched-chain amino acid transport system
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99589"
FT                   /db_xref="GOA:D6ZXE3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXE3"
FT                   /protein_id="ADG99589.1"
FT                   /translation="MPDTTNTPTTGAQQPSGVQPGVPFHDLTKWATKAPEGETLISTAY
FT                   RDKVTEDLKFVENKPGVHKPDPILIADDVTRKFGGMTAVDVSHFEIERHGITALIGPNG
FT                   AGKTTFFNLMTGFDMPNTGTWQFDGKDMAHVQPEKVARMGMVRTFQLTKVMSRLTVLDN
FT                   MLLGAPVQPGEGMFRALFPGMWKKQEKANIEKAEALLERFLLIKKKDDYAGALSGGQRK
FT                   LLEMARALMSDPQLVMLDEPMAGVNPALKQSLLDHIMALREEGTTVLFVEHDINMVRHI
FT                   ADWVTVMAEGKIVAEGQPKSVMNDPAVIDAYLGAHANIDLGDDSVLEDLKEA"
FT   gene            126065..127021
FT                   /locus_tag="BLJ_0097"
FT   CDS_pept        126065..127021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0097"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   systems ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99590"
FT                   /db_xref="GOA:D6ZXE4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXE4"
FT                   /protein_id="ADG99590.1"
FT                   /translation="MSDVTNATDPTCVSAASVSDSGESDNRERVEVAYVSDSPESDTQG
FT                   DMQSATQGGAQETGALSRAQIHVGEPEGEPLLDAVDLVAGYLPGVNILNGASLTLHEGE
FT                   IVGIIGPNGAGKSTLLKSLFGLVHIHSGKLLLKGEDITNLRADKLVSRGVGFVPQTENV
FT                   FPSLTIAENMHMGAFQAPKLFEERFDYVCSIFPKLGQRKNQLAGQLSGGERQMVAMARA
FT                   LMMKPSVLLLDEPSAGLSPMLQDETFIRVRQVNKAGVSVVIVEQNARRCLQICDRGYVL
FT                   DQGRNAYSGKGRDLMNDPKVVSLYLGNLEEEVQEEGR"
FT   gene            127396..128700
FT                   /locus_tag="BLJ_0098"
FT   CDS_pept        127396..128700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0098"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99591"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXE5"
FT                   /protein_id="ADG99591.1"
FT                   /translation="MVIHMKKTNMKGMKKLSITVTAVVAAAVMALAGCGSGSGSGSSSS
FT                   DASDSGAKTTKFVLGGLWPETGSLAYLAPPELAAEKLAVKDINDAGGVLDSKVTTVDAD
FT                   TSDADHADQNTSAAQSVLSKNPSFIIGPASSSVVKNTYKSITSQNIPMLSMGATSAGFS
FT                   GLSDYFFRTVAPDTVQGAVMGNLIAQDGVQKLAIAVFNDEYGTGLRDTVVKTASAAGVD
FT                   IVYGEKDTFDPTETNFSSIATAIKASNPDATLVIAFDQTKPLLKALASAGVDTKKLYFV
FT                   DGNTSDYSSELDAGLLEGSKGTIPGVNPSDDFVKRLESTGVDLKNTTTYGAETYDGIIL
FT                   AALAAQKGGSADGKTIQANMAAVSGADGGEKCDSYKACLALLKDGKDIQYQGQTGIGPF
FT                   NKNNDPSSANIGVYTFDKDNKPVFDHTQSGDVPND"
FT   gene            129062..130147
FT                   /locus_tag="BLJ_0099"
FT   CDS_pept        129062..130147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0099"
FT                   /product="regulatory protein, LacI"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99592"
FT                   /db_xref="GOA:D6ZXE6"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXE6"
FT                   /protein_id="ADG99592.1"
FT                   /translation="MVGMRDVAKKAGVSLSTVSLVVNGNGYVSDDMRERVRKAMQLLNY
FT                   VPNELARNLYHDRTNLVGVIVPTIRHPFFATFTAHLQHALAAQGLRTMLCSTADEAEGE
FT                   IQYVDMLRRHMMDGIVMCAHTSHPGDYWTSIHRPIVAFDRVLGDGISSIGSDHEQGGRL
FT                   IAQMLIRNGTKHVVMIGGPRDQFFDLAARGEVEEGPFDLGKTTFPTVRYYLTLEQELTS
FT                   AGVKYEYVEAGEVMDFAGYHRAVSNALDKVTTDGVDAVVSSDIGASFCVREALSRGISI
FT                   PDELQIVAYDGTYLTDLAGMKLTAVAQDFSAIAQSAADHIVQAIANEEVAAANASRKNI
FT                   PKPFEPNVLIPMTLVPGDTTH"
FT   gene            130372..131898
FT                   /locus_tag="BLJ_0100"
FT   CDS_pept        130372..131898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0100"
FT                   /product="Sucrose phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99593"
FT                   /db_xref="GOA:D6ZXE7"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR015325"
FT                   /db_xref="InterPro:IPR016377"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022527"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXE7"
FT                   /protein_id="ADG99593.1"
FT                   /translation="MKNKVQLIAYADRLGDGTLSSMTDILRTRFDGVYDGVHILPFFTP
FT                   FDGADAGFDPIDHTKVDPRLGSWDDVAELSKTHGIMVDAIVNHMSWESKQFQDVLEKGE
FT                   ESEYYPMFLTMSSVFPNGATEEELAGIYRPRPGLPFTHYKFAGKTRLVWVSFTPQQVDI
FT                   DTDSDKGWEYLMSIFDQMAASHVSYIRLDAVGYGAKEAGTSCFMTPKTFKLISRLREEG
FT                   VKRGLEILIEVHSYYKKQVEIASKVDRVYDFALPPLLLHSLFTGHVEPVVHWTEIRPNN
FT                   AVTVLDTHDGIGVIDIGSDQLDRSLKGLVPDEDVDNLVNTIHANTHGESQAATGAAASN
FT                   LDLYQVNSTYYSALGCNDQHYLAARAVQFFLPGVPQVYYVGALAGRNDMELLRKTNNGR
FT                   DINRHYYSTAEIDENLERPVVKALNALAKFRNELPAFNGEFSYEADGDTSITFRWIAAD
FT                   GKTKAALIFEPGRGLGTDNTTPVASLAWTDAAGDHETDDLLSNLPIADID"
FT   gene            132103..133737
FT                   /locus_tag="BLJ_0101"
FT   CDS_pept        132103..133737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0101"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99594"
FT                   /db_xref="GOA:D6ZXE8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXE8"
FT                   /protein_id="ADG99594.1"
FT                   /translation="MLEPYVRPGIDDRPDLDKALSPEDKAAVARLAIKDRRRPPEASAD
FT                   QPEAQTVRLAAAGSSAAAAAAASVDTPAPDMSSAYLDMRDPMVAADGQRPTTGQVSRLN
FT                   WGFFAASILVGAPWIALNTIAMPNAVARLFGYDTAALQVTINPATGRPLPVATDLAMPL
FT                   AVLVIVGVVASMFAMPLISALSDRTRTPLGRRTPWMVAGGVLCALLTLLLGQNIGIVVL
FT                   CIFWALMQFAYAMLSAPLASAISERVPDKFRPRIERWHGIGVMLGQALGVCMGAFGVMF
FT                   DSFTPFTYTAVLFAVSGILSVLILPKEPSSIEQPRQLFNSDQVLDQLRPPAHAPAFARV
FT                   FTARTCMMTGVGLTGVFLWYLVRFWVYGKAVVFTSAPLTLPAGFLIAGMAAATLVGAAL
FT                   ASWAAGPISESIEEKNIPTTRVVAGACLLYAIGLGLAWGLGVWSTGTARENGMLLFALI
FT                   SGFAFGIYDSLGLELVMDSLPDPRRAGHDLGIYALANSAGLALAAIIGALLVNAFEHSF
FT                   GYYLLFPSAIVMVLLAGIVTLTAESAQ"
FT   gene            134226..135593
FT                   /locus_tag="BLJ_0102"
FT   CDS_pept        134226..135593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0102"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99595"
FT                   /db_xref="GOA:D6ZXE9"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXE9"
FT                   /protein_id="ADG99595.1"
FT                   /translation="MTAAVEETGLGQAAGKAATLVRDSVKTVIAASMVGTAIEFYDFYA
FT                   YGTAAANYFPHIFFSAKDNPTVALLMSLLTFAIAFIARPLGSLIFGHFGDRMGRKTTLV
FT                   VSLMTMGVGTFLIGCLPTYDQVGVGAVAILCLLRFIQGIGLGGEWSGAALVATENAPED
FT                   KRALYGSFPELGAPIGFFLSNGTYFVLESFNNQDAMLAWGWRVPFLLSAILVIVGLVVR
FT                   VHMEETPIFRMAQEQKKVVKSPLTEVFRKSWRQVLQATFLVAVTYTLFYTLATWSLAWG
FT                   TKEQGEGGGGLGFTNQEYLLMLMISICVFALFIVLSCLYADKIGRKRVLTFSSCALVVF
FT                   AVLFPFLLDGGLVGPKNFFANMVFLCVGFALMGIAFGPIGAFLPELFDANVRYSGSGIG
FT                   YNLAAIVGAAFVPTIATWLSSHWGVHSVGLYLAVMAVCCLVSVLTCRETKDADFTK"
FT   gene            135817..136869
FT                   /locus_tag="BLJ_0103"
FT   CDS_pept        135817..136869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0103"
FT                   /product="ketol-acid reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99596"
FT                   /db_xref="GOA:D6ZXF0"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXF0"
FT                   /protein_id="ADG99596.1"
FT                   /translation="MAATIWYEKDADLSVFDGKKVAILGYGSQGHAHALNLRDSGVDVV
FT                   VGLRPTSKSVEFAKEQGLEVKPVGEAVAEADVVMILLPDQYQAKVYKEEVEPNLKPGAA
FT                   LAFAHGFNIHYGYIKPSEDHPVFMVAPKGPGHIVRREYAAGRGVPVVVAVEQDPDGKTW
FT                   PLCLAYAKALGALRAGAIKTTFTEETETDLFGEQDVLMGGINHLCDLGFDVLTEAGYQP
FT                   EIAYFEVFHELKMLVDLANEGGLNKARWSCSDTAQYGDYTSTVITDETKKRMQYQLKRI
FT                   QDGSFAKEFMDDQAAGAPKFKELQEEFSHPHLETVGPKLRAMFSWNNAEAKDKDEAESF
FT                   NGKIARTQVQ"
FT   gene            complement(137135..137275)
FT                   /locus_tag="BLJ_0104"
FT   CDS_pept        complement(137135..137275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0104"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99597"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXF1"
FT                   /protein_id="ADG99597.1"
FT                   /translation="MGCGAAGRRGIYGVQISPVLRGLCPSNRSQSYRERRRSPAGVHNV
FT                   S"
FT   gene            137297..138349
FT                   /locus_tag="BLJ_0105"
FT   CDS_pept        137297..138349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0105"
FT                   /product="ketol-acid reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99598"
FT                   /db_xref="GOA:D6ZXF2"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXF2"
FT                   /protein_id="ADG99598.1"
FT                   /translation="MAAQIWYENDGDLSVLEGKKVAIIGYGSQGHAHALNLRDSGVDVV
FT                   VGLRPTSKSVDFAKEQGLEVKSVAEASAEADVIMILAPDQYQRTIWANDIEPNIKPGAA
FT                   VAFAHGFNIHYGYIKPSEDHPVFMVAPKGPGHIVRREYAAGRGVPVVVAVEQDPRGDGW
FT                   ALTLAYAKALGALRAGAIKTTFKEETETDLFGEQNVLMGGVNKLVEMGFEVLTDAGYQP
FT                   EIAYFEVCHELKMLVDLMNEGGLNKARWSCSDTAQYGDYVNTVINEDCRKRMEYHLQRI
FT                   QDGSFAKEFIDDQDAGAPHFKELQEKYSNERIETVGPKLRAMFSWNKDGVKDADEANSF
FT                   TGKIARAQVQ"
FT   gene            complement(138583..139368)
FT                   /locus_tag="BLJ_0106"
FT   CDS_pept        complement(138583..139368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0106"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99599"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXF3"
FT                   /protein_id="ADG99599.1"
FT                   /translation="MTQGLQLIRTAFAGYEDSYVIIGGTACDIIMTDNDLDFRATKDID
FT                   MVLIAEGHLREFAQRLWSFIRDGGYTSITKNSAQPHLYRFMHPSTYGYPTMIELFSRHP
FT                   DFPIVPNSFLTPLHIANDVSSLSAIMLNDSYYRLLQQGRESIQGISVLNEKYLIPFKAK
FT                   AWLDLNAREQHGEHVDGKDLKKHKYDVFRLAQLLAPEDRVSLNDEAYHDLADFLGEISH
FT                   ETLPMKQLGIRGTQQDIIDLIAAVYQLSIPPRDELPTTR"
FT   gene            complement(139365..140393)
FT                   /locus_tag="BLJ_0107"
FT   CDS_pept        complement(139365..140393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0107"
FT                   /product="Uncharacterized membrane-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXF4"
FT                   /protein_id="ADG99600.1"
FT                   /translation="MDAEHYIRETLGLPCQITSWDGTASLPLFLTNGRTFSKLTIDNTS
FT                   MLIASGEAHPFSITRVTADASRLEQRTDLPIVFQFPRLSAYQRKALIQNHVPFIVPGTQ
FT                   LYIPSLGMVFTQRISSRPLENAQDIEVRPFSPATQLVWLYLLYSNESKVQSDIARALQF
FT                   TEAQVSVAVTLLEQLAFVHRTKQGRSNSVELLTSRQTSRLDLLKSSWHLLKSPIFSKYT
FT                   VTNRNRQMIADELIPAGEFALSRRTQLATPKLRIYAVERHWLKQHNKELCIIDPALEKV
FT                   PDNAYILELWRYDPRLLAQYTQEDYLADPISTALTLGEIADERLEDAIQESIRNTFSGA
FT                   TI"
FT   gene            complement(140600..142414)
FT                   /locus_tag="BLJ_0108"
FT   CDS_pept        complement(140600..142414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0108"
FT                   /product="alpha amylase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99601"
FT                   /db_xref="GOA:D6ZXF5"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXF5"
FT                   /protein_id="ADG99601.1"
FT                   /translation="MTANNLNDDWWKQAVVYQIYPRSFKDVNGDGLGDIAGVTEKMDYL
FT                   KNLGVDAIWLSPFYPSDLADGGYDVIDYRNVDPRLGTMEDFDAMAKAAHEAGIKVIVDI
FT                   VPNHTADKHVFFQEALAAEPGSPARDRYIFRDGRGEHGELPPNDWQSFFGGPAWARVAD
FT                   GQWYLHLFDKAQPDVNWKNPDIHEEFKKTLRFWSDHGTDGFRIDVAHGLAKDLESKPLE
FT                   ELGREYSVVGVLNHDFSHPLFDRREVHDIYREWRKVFNEYDPPRFAVAEAWVVPEHQHL
FT                   YASMDELGQSFNFDFAQANWYADEFREAIAAGLKAAAETGGSTTTWVMNNHDVPRSPSR
FT                   YGLPQIKGAPYHQLPHDWLLRNGTTYPEDRELGTRRARAAALMELGLPGAAYIYQGEEL
FT                   GLFEVADIPWDHLEDPTAFHTAQATMDKGRDGCRVPLPWTAADEPALADFSRPTPADDG
FT                   TGENHVPLCAAGQFGTGASFGFSPATRAEGVTPAADPHLPQPLWFKDYAVDVEQADPDS
FT                   MLALYRAALAIRQESLTATRDTTAEQVDMGDDVVAYTRAAVGGRVFTSITNFGNAPVAL
FT                   PDGSVVLASGPLTPEAQLPTDTSAWVVQ"
FT   gene            complement(142574..143608)
FT                   /locus_tag="BLJ_0109"
FT   CDS_pept        complement(142574..143608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0109"
FT                   /product="regulatory protein, LacI"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99602"
FT                   /db_xref="GOA:D6ZXF6"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXF6"
FT                   /protein_id="ADG99602.1"
FT                   /translation="MTKASIQAVAREAGVSVSTVSRTFAKPDLVLPETRDRVMAAAEKL
FT                   DYSVSRSAAALKSGQSFRIALLASETIASWFNSNIFAGLDSALRPSGYDTVPYPMRNAA
FT                   ERHDFFADLPVRRNADAVIVSSFDIEPAEVERLKHMHVPIVGINIPSTDGFDAGVSIDD
FT                   YAAIRSAIEHLIALGHRHIAFVGSAPTETNMRYSAEARLQGVIDAAAAHPGIELTPLSI
FT                   QRGLGESNAALNAVLNASPSITAFCFEDDEMAAPVLYRLRQYGRRVPQDISIIGFDDST
FT                   LSAAVGLTTLHQDPFAMGATAGHMVLDAIAGKSIEPAFVRPGTPLILRETTAPPAATAA
FT                   PAQS"
FT   gene            complement(143920..146157)
FT                   /locus_tag="BLJ_0110"
FT   CDS_pept        complement(143920..146157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0110"
FT                   /product="4-alpha-glucanotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99603"
FT                   /db_xref="GOA:D6ZXF7"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXF7"
FT                   /protein_id="ADG99603.1"
FT                   /translation="MTDAYGNDAATSTGTIADTTNDAASGAPQRAESAERLARPLVKLA
FT                   KACGLSTSFIDQLGTYTEISDEALVAVLKALDVDASSDEAIKRSMTELEAENSKRLLPP
FT                   TIVATTGKPTSLTLNCPSDADITASIELEDSTAFGHFALLPNLNSGKPDLTIAPDLPMG
FT                   YHTLTVTVDGREGKAAIIAAPARIPVPEAVAEHQRWGWMTQMYSVRSRESWGIGDYGDL
FT                   KLLLADAADKSKADFMLINPIHAGAPIPPLEPSPYLPESRRFLNVTYIRPQDIPEYATL
FT                   PADVRAQVDALHDSVAARNDESTPMDINAAWEAKRPALRLIFEAGRNNKRELEFEHFKA
FT                   TAGPDLDSFATWCLCFEVWGAPWGENRWFFEKTIDDPAVRQLVEEHHDLFEFNRWLQWI
FT                   AAEQVNAAQQEALDHGMTLGLMQDMAVGVHGLGADAWANPERFASGGVTVGCPPDFYNQ
FT                   QGQDWGQPPFSPRYLEATGYQVYREMVHSMYEHAGAVRIDHVLGLFRLWWIPQGLGALN
FT                   GAYVTYNHEAMLGVLAIEATRAGGMVVGEDLGTVPDYVRRILSDHGVLGTDVEWFNRVD
FT                   DSPNAGDPYRAPKDYRKQALASVTTHDLPPTAGYLNFEHVKLREELHLLSEPVEAFAAS
FT                   AMAERTAMMNRLVENGYISQTVADDVEGHVQEIVEAMHAMLTDTPSLLLQAALVDGVGE
FT                   CRSQNQPGTSREYSNWRVPLADSSGHVVHTDEVFDLPRVQSLAAVMRREKR"
FT   gene            complement(146332..148098)
FT                   /locus_tag="BLJ_0111"
FT   CDS_pept        complement(146332..148098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0111"
FT                   /product="alpha amylase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99604"
FT                   /db_xref="GOA:D6ZXF8"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXF8"
FT                   /protein_id="ADG99604.1"
FT                   /translation="MTQQPQTYPKPAWLENARFYEVYPQSFADSNGDGIGDIPGITGKL
FT                   DYIAALGCNALWINPCFDSPFKDAGYDVRDYTQVAPRYGTNDDLIALFEAAHRRGMHVL
FT                   LDLVPGHTSEEHPWFQASSRPNPAERTIVASSDGPSRKENTGDPTTAPSEEGAVGEADW
FT                   GRDQPTNVSNRYIWTDSWIAGGDGLPFISGETERDGTYILNFFKCQPALNYGFAHPHQA
FT                   WQKPALGPDALATCDAMIDVMRFWLARGADGFRVDMADSLVKHDDAGKPYTIHTWQYMF
FT                   SKIRPEFPEAAFVAEWGRPNESMQAGFDMDFYLDWRWDGHPNGYNLLLRNTDTPMEHEG
FT                   DSSYFNADSGASIAPFLAEYLPQLADCRAAGGHFNLISCNHDTLRTAQRLTERELKVAY
FT                   GMLLTMPGCPFLYYGDEIGMRYRALPTKEGGYVRTGSRTPMQWASDAPNLGFSTAPADA
FT                   LYLPTDSADDAPTVTGEASRPHSLFNWIRSVLALRAAQPALAAGAGFSVVAAPADGRAF
FT                   AYLRTAAPNDDSGDGTAAGPLLIAMNPGRHSETVDLPNALSPDATMLLSLGEPVVGDGQ
FT                   LTLSPQSFAVLG"
FT   gene            148459..149703
FT                   /locus_tag="BLJ_0112"
FT   CDS_pept        148459..149703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0112"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99605"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXF9"
FT                   /protein_id="ADG99605.1"
FT                   /translation="MMARWKKALAAISACALFVTGLSACGSASAGGDAEHITLVVWASQ
FT                   EDQANTDSWLQTMEAAFEQQHPEYSITWKNQNVASADAAGIAKQDPTVAADVYTFASDQ
FT                   LGTLLDAGAIGQVSDPTMKQLEKQTKGNATMLQTVTGEDGNVYGVPLAGNTWFMYYRKS
FT                   KFTEQDITSLDAMLAKGKVSFPLTNSWYLPAFYIGAGGTLFGKDGTDAKSGVQFGGAIG
FT                   AAVTDYLVDLRNNPNFVNDKNGSGLAGLKSGKVDVVFTGNWDAATVRENLGDDWGVAKL
FT                   PSFTLNGKQVQMKAFAGSTIYGWNPYTKHPVAADQFAAFLSGTESQRKHYKMRSVIPSD
FT                   SELASDPAIEKDAVAQAQMDTIAETSVVQPSIAEMNNFWVPCENFGNSIYNKEVTHANS
FT                   AKLTEQWMASYQSLL"
FT   gene            149726..151126
FT                   /locus_tag="BLJ_0113"
FT   CDS_pept        149726..151126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0113"
FT                   /product="putative sugar ABC transport system membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99606"
FT                   /db_xref="GOA:D6ZXG0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXG0"
FT                   /protein_id="ADG99606.1"
FT                   /translation="METTAMPRAAKRAPRRRKADYIPPSRYTLRAAATQGDALTRLSFL
FT                   VLGAGNLARKQVAKGLVFLAIEVAYIAYMVTAGGPALAMLGSLGSRTQTKQKIDGYWHY
FT                   DAGDNSVLLMVYGVAAVFITVLFLVFWSYAVRSAYKAQVLARETGKAPTFIEDLKNITD
FT                   RNAQVTFMALPVAGILVFTVLPTLIMMCIAFTNYDSDHVLLFDWVGFKNFTQLFSATGE
FT                   INAAQFGSVLAWTLIWAFFATFLNFFLGLFLAMIINRRTTRLKGFWRAAFSLSIAVPQF
FT                   VSLLVINQMLQPEGAINRLLMSWGWIDSPLPFFTDTMWARVTVIVVNLWIGIPFTIMQI
FT                   TGILQNIPAEQYEAATIDGANWWQTFTRITMPYLVFVLTPYLITTFTGNVNNFNVIYLL
FT                   SGGNPTPVGDTAGKTDLLITWLYKLTVDRGDYNLGAVIGIFTFVTLAVVSLITYRSSAS
FT                   YKNEGGFR"
FT   gene            151123..152049
FT                   /locus_tag="BLJ_0114"
FT   CDS_pept        151123..152049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0114"
FT                   /product="maltose/maltodextrin ABC superfamily ATP binding
FT                   cassette transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99607"
FT                   /db_xref="GOA:D6ZXG1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXG1"
FT                   /protein_id="ADG99607.1"
FT                   /translation="MSSNAQTAIPRTDIATPKSASNPFWHDQRKRRIVGDVLSHLLLAV
FT                   LAVIWVIPIVWVVLESFNKNPGPYNETFFPTEYTLDNYTKLFTDTHILNFPRMFMHTLV
FT                   ISIVVCLISVFFVLCVAFCMSRMRFRFRKSFMNIVLVLGMFPGIMSVVVIYFILKSLGL
FT                   TQGVGVTVALILVYSAGAGAGFYVMKGYMDTIPMSLDEAAYLDGCTRWQVFIKIIIPVC
FT                   KPMLVYQALTSFLGPWLDFVMAKAIARTQDNYTVALGLYQMLSREYLNDWFARFAAAAV
FT                   IISVPIAILFIVMQRFYQESMSGAVKG"
FT   gene            152195..154201
FT                   /locus_tag="BLJ_0115"
FT   CDS_pept        152195..154201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0115"
FT                   /product="glycogen debranching enzyme GlgX"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99608"
FT                   /db_xref="GOA:D6ZXG2"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011840"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXG2"
FT                   /protein_id="ADG99608.1"
FT                   /translation="MEQQISALEVADWTPAELAMPCPDYPVYQDDDLGAFPDAKGTTFR
FT                   VWAPTASGVTLRLFTAGSPETAPEPETQADLTPGADGTWLARCDGIGHGVYYDYLVRFP
FT                   DGTVNRTADPWARAAGVNGRRSMVVDLSKTNPDGWAEDRRPHIPSRDLVIWETHIGDFS
FT                   NDEHSGIPEEHRGTYLAFTHPDTSVDGAGEFPTCVAYLKKLGITAVQIMPFYDYGSIDE
FT                   SIPRTDPKHGFNWGYDPLNYNVPEGSYSTDPYDGTVRIRECKQMIQALHAAGIKVIMDV
FT                   VYNHMFSTDNWFERMIPGYALRRRADGTFADGSACTNDVATEHPMMRKYIVDSAVYWAR
FT                   EYHVDGFRFDLMGLIDVDTMNAVRTALDQLPGGATISMHGEPWAARETALVPGTILADK
FT                   RCMPYLSPRIGAFCDSTRDAVRGHVFYQWVPGYLTGAAADYADDIRHAEDGWRGTLRET
FT                   ASVGQVIQYVSAHDDLTLWDKLCAAMRRIPTDTDYSAEGEACGDLMRANRLAAGIVFAS
FT                   AGVPFMLSGEEFARTKHGVSDSFSSPAALNQLDWRRAQRMGDLVDHYAALIQLRRGNPA
FT                   YFGGARMIVPRDDETVVFRVGDDCVAINPTGSPQTQLTTDLEIPGPYGEVSEIAPNEWQ
FT                   CIYCSGSDMPGAVEQRLLPLPPYTFTVWRRNRG"
FT   gene            154258..155076
FT                   /locus_tag="BLJ_0116"
FT   CDS_pept        154258..155076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0116"
FT                   /product="haloacid dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99609"
FT                   /db_xref="GOA:D6ZXG3"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXG3"
FT                   /protein_id="ADG99609.1"
FT                   /translation="MTDRFAPDSRSLRRELSGNAGLRVADETGAAPTVDAVFFDLYGTL
FT                   VDIHADEAAAAAWDALRSALADRGVTYASNAELRRRFEILAQPMRDAAVVAHGEWAEPG
FT                   LLPVYSALAGERRNDDATAQSLAWTFRQASTSLLRVYPGAPELLARLRVAGKRVVLVSN
FT                   AQSCYTRPELAALGLDRAFDRIVISSEVGVRKPSPAIFRRALEAEHLTPDRVFMVGNDE
FT                   RADILGAASAGIAGVYLRTEISPASDPQASAHAVLSLAGPDYAELLQYLT"
FT   gene            155185..155949
FT                   /locus_tag="BLJ_0117"
FT   CDS_pept        155185..155949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0117"
FT                   /product="putative ABC transport system membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99610"
FT                   /db_xref="GOA:D6ZXG4"
FT                   /db_xref="InterPro:IPR008875"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXG4"
FT                   /protein_id="ADG99610.1"
FT                   /translation="MNEVEMEKTRRGEQRRRKGLSVFRLKVIGAIFMALNVASVAILPA
FT                   LVDDPSQDMTALTAIVLCAAASWIAVPIYSWLLFDGYRHTHNVWAYGLRLLVVAVVSEV
FT                   PYDLIMAGKPFSLSVQNPVFGLLIALVVLALVDWLAKKYYGAFRWTLTVLVIIAGLLWD
FT                   LLLHVGVDQRVLYTGVLTLSFVMVFYFLNARENSMMFTAGLLGAVMCITPAIGVAFLHY
FT                   RNGEQGFKQPWTKWAFYVIYPVLLVFGALVAA"
FT   gene            complement(155994..157019)
FT                   /locus_tag="BLJ_0118"
FT   CDS_pept        complement(155994..157019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0118"
FT                   /product="regulatory protein, LacI"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99611"
FT                   /db_xref="GOA:D6ZXG5"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXG5"
FT                   /protein_id="ADG99611.1"
FT                   /translation="MGKADIYQVAKAAGVSISTVSRAFTRPELVSQKTRHKVLEVADKL
FT                   DFNISRSATALKSGQTYRVAMLMNEEITSWFNTQTFAGIESVMHTAGYDISLFQHIDTA
FT                   ANRHEFFTELPIRRNVDAVFVASFAIDPHEVEQLQRIHVPIIGINTPSSEGFDATISID
FT                   DEKGMYTATQHLINLGHRHIVYPCSEAAGLDSSIDARARGFIRACEDAEGRHDINWQVL
FT                   SVPRGPAFADSALSALLALDKFPDAICCQMDMMAIPLVLKLERYGHRTPRDYSIVGFDD
FT                   SPYADTINLTTMRQDPYAMGRTAAEKALKLIAGETPDTPHEVIEAQLVPRSTDMPFGEM
FT                   A"
FT   gene            157132..157347
FT                   /locus_tag="BLJ_0119"
FT   CDS_pept        157132..157347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99612"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXG6"
FT                   /protein_id="ADG99612.1"
FT                   /translation="MIEKVKKTAQLGSESSAFDGRVLLGLDRLGLNPVSQRHVTSGSRA
FT                   GVWLIGCDPTDETARYWIGNGVLDCF"
FT   gene            complement(157535..157951)
FT                   /locus_tag="BLJ_0121"
FT   CDS_pept        complement(157535..157951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99614"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXG7"
FT                   /protein_id="ADG99614.1"
FT                   /translation="MTGGRYALPAGIENSVRSVTHSRFGASAWKSRSTGFFGALASSPL
FT                   YEPYRFALLNGGAGPCGVISRMTRLADTLTPMLSSSRWTRLYPQRRLPFSNASRTSSAP
FT                   VSPPSPAVGGFSPDVSVTCASLDPASTGSIPLPG"
FT   gene            157979..158902
FT                   /locus_tag="BLJ_0120"
FT   CDS_pept        157979..158902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0120"
FT                   /product="ketol-acid reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99613"
FT                   /db_xref="GOA:D6ZXG8"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXG8"
FT                   /protein_id="ADG99613.1"
FT                   /translation="MVVGLRPTSKSVEFAKEQGLEVKPVGEAVAEADVVMILLPDQYQA
FT                   KVYKEEVEPNLKPGAALAFAHGFNIHYGYIKPSEDHPVFMVAPKGPGHIVRREYAAGRG
FT                   VPVVVAVEQDPDGKTWPLCLAYAKALGALRAGAIKTTFTEETETDLFGEQDVLMGGINH
FT                   LCDLGFDVLTEAGYQPEIAYFEVFHELKMLVDLANEGGLNKARWSCSDTAQYGDYTSTV
FT                   ITDETKKRMQYQLKRIQDGSFAKEFMDDQAAGAPKFKKLQEEFSHPHLETVGPKLRAMF
FT                   SWNNAEAKDKDEAESFNGKIARTQVQ"
FT   gene            159087..160832
FT                   /locus_tag="BLJ_0122"
FT   CDS_pept        159087..160832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0122"
FT                   /product="Alkaline phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99615"
FT                   /db_xref="GOA:D6ZXG9"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXG9"
FT                   /protein_id="ADG99615.1"
FT                   /translation="MQVRNGSAKLEGVTTTDVAKRVRPEECGPDGADDTAWKEGRTIGN
FT                   HKALTSVVAAVASIATLGALAAPAFAVDAANGTYSPNGKSVAELAKHGAGKLVANPNPG
FT                   KLTPVTDSSASGSAWATGTKTYNNAVDVDIYGNPQLNLFELAKAAGKATGNVSTAEIQD
FT                   ATPAVLESHSTERACYGPQGKTDGTSNNASKQCLANQLKENGGIGSISEQLLDTRADVT
FT                   IGGGSKYFRQTVQGGEYKGKTVWEQAKDMGFQTVENDPAAMNALQYKDGQPVLALMSDG
FT                   NMPTKFNPSKATAKDPAKDAKPTVCAPNDAWLGNRGASLKDMTKKALDLLNANPNGQKN
FT                   GFLLQVEGASIDKQDHAANACGQIGETDDFDQAIAYAIKNVDLTNTLVIVTADHAHTSQ
FT                   VLNAQPAYALSTVLKSADGNNMVVSYGTAQEASTDAEGGYNGGDMEHTGTQLRIAASGP
FT                   GAQRVIGLTDQTDNFYTIAGALGLATFPDEQNALSKDGTVKVARTQAGKVATVAIQAPA
FT                   AGSADKKPGADKNGVIASGKVPDDSAVSGPLGATGTAVMAIAIAAVMLVAIAMLIKAAR
FT                   NARNN"
FT   gene            161263..163158
FT                   /gene="dnaK"
FT                   /locus_tag="BLJ_0123"
FT   CDS_pept        161263..163158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="BLJ_0123"
FT                   /product="chaperone protein DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99616"
FT                   /db_xref="GOA:D6ZXH0"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXH0"
FT                   /protein_id="ADG99616.1"
FT                   /translation="MARAVGIDLGTTNSCIATLEGGEPTVIVNAEGARTTPSVVAFSKS
FT                   GEILVGEVAKRQAVTNVDRTISSVKRHMGTDWTVDIDGKKWTPQEISAQILMKLKRDAE
FT                   AYLGEPVTDAVITCPAYFNDAQRQATKDAGKIAGLNVLRIINEPTAAALAYGLEKGKED
FT                   ERILVFDLGGGTFDVSLLEIGKDDDGFSTIQVQATNGDNHLGGDDWDQKIIDWLVSEVK
FT                   NKYGVDLSKDKIALQRLKEAAEQAKKELSSSTSTSISMQYLAMTPDGTPVHLDETLTRA
FT                   HFEEMTSDLLGRCRTPFNNVLHDAGISVSDIDHVVLVGGSTRMPAVKDLVKELTGGKEA
FT                   NQSVNPDEVVAVGAAVQSGVIKGDRKDVLLIDVTPLSLGIETKGGIMTKLIDRNTAIPT
FT                   KRSEVFSTAEDNQPSVLIQVYQGEREFARDNKPLGTFELTGIAPAPRGVPQIEVTFDID
FT                   ANGIVHVSAKDKGTGKEQSMTITGGSGLPKDEIDRMVKEAEAHEAEDKQRKEDAETRNQ
FT                   AEAFAYSTEKLVNDNKDKLSDDIVKEVTDKVNALKEALKGDDTEKVKTAQTELMTAAQK
FT                   IGQVLYAQQGAEGAAAGAGAAGAAGAGASAGSASGSDDDTVEAEVVDDDDDKDNK"
FT   gene            163158..163841
FT                   /locus_tag="BLJ_0124"
FT   CDS_pept        163158..163841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0124"
FT                   /product="GrpE protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99617"
FT                   /db_xref="GOA:D6ZXH1"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXH1"
FT                   /protein_id="ADG99617.1"
FT                   /translation="MSEFNKDDYLNDLPDPSDAEAAGQAAQASSGADASAESDSAQDSA
FT                   AQAPSNEGADAAPAAAEGEKSDAGEKTGEGQSDSEDTLTPLGKAKKEAADYLEALQRER
FT                   AEFINYRNRTQKEQERFRQHGIIDVLTALLPALDDIDRIREHSEMDDSFKAVAAKIDKA
FT                   FEKFGVEKFGEKGEDFDPTKHEAILHKPDADADKETVDTVVEAGYRIGDRVIRAARVVV
FT                   ASPQN"
FT   gene            164020..165045
FT                   /locus_tag="BLJ_0125"
FT   CDS_pept        164020..165045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0125"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99618"
FT                   /db_xref="GOA:D6ZXH2"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXH2"
FT                   /protein_id="ADG99618.1"
FT                   /translation="MAENEWLSKDFYKVLGVSKDASDDDIKKAYRKLARKYHPDVNKTK
FT                   EAEEKFKDISEAYDVLSKKEDRQKYDAIRQFGMGGARFAGGSGAGGFDASGFSDIFGSM
FT                   FGQGAGGNGSRIRFSTSGGGPNNINDIFSMFGGAAGQGGQSYGGYGQSPYGNAGGYGYE
FT                   EAPRPENGEDRNSKISLTLRQAVKGATVSLSVDGKKFKAHVPAGVKDGQKIKLAGKGKP
FT                   GINGGKAGDLYLHVTVKPDAAFSMRGHDIVMDLPVTVGQAVAGGKVEAKDIDGNPVTFK
FT                   VPAGSSSGAEVKLAGLGVQRGNQPGDLIGRVQIMVPAKPGLAVKHAAKEFDEKAGDYLS
FT                   L"
FT   gene            165060..165635
FT                   /locus_tag="BLJ_0126"
FT   CDS_pept        165060..165635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0126"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99619"
FT                   /db_xref="GOA:D6ZXH3"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXH3"
FT                   /protein_id="ADG99619.1"
FT                   /translation="MARLANQMKQLYAMCATALVMGRADLDGADDVGFDIELPIFTVGQ
FT                   AAELGNIHPQTLRQYDRLGLVRPQRTDGGARRYCLRDIARLTRAQRLSQDEGINLSGIA
FT                   RILALEEENRQLRREVKRMQTGDQESVFAAGRDGNIVEVQRSNRARLWRNAIRRETREL
FT                   PGRDTAADTTRESDSTPADSKSMVLWGW"
FT   gene            165724..166395
FT                   /locus_tag="BLJ_0127"
FT   CDS_pept        165724..166395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0127"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99620"
FT                   /db_xref="GOA:D6ZXH4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXH4"
FT                   /protein_id="ADG99620.1"
FT                   /translation="MLLKAVFWDLDGTLIDSEPLWHDGEIEIAHNNGGEWNEDLGWECS
FT                   GTPVPHVAEVMIAHGCTLSVPEIDKQLKDYVFKAEVERLPWIPGVLDVLHSLKEAGIPS
FT                   MLVTTSPRRMAENIMKQSEGLFAGYVCGDDPYEHKPNPAPYLAAADKLGIAREDMAKCV
FT                   VLEDSSVGLQAGAASGATLIAQTGWIRTDTSGLGQFASIESYDGIDAAALDGFVRQRLG
FT                   E"
FT   gene            166662..167666
FT                   /locus_tag="BLJ_0128"
FT   CDS_pept        166662..167666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0128"
FT                   /product="ABC-type sugar transport systems, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99621"
FT                   /db_xref="GOA:D6ZXH5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXH5"
FT                   /protein_id="ADG99621.1"
FT                   /translation="MTAIQEAVPAAAGAAQSRGGEVSNAAAAAGKRVRARKHSGASQNS
FT                   WQSKLRPYLFIAPLVILSGVFIYYCIGFTVATSFTDWDGISSEMDFIGLKNYTKLLAPG
FT                   SVFWTALMNNIIFMVVTVVIQAGLGLLLAVILKERLRGSSFFKAIFFMPIAMAPVIIAA
FT                   IFRIIMDPNVGAINEALRFLHLDFLAQSWLGDPHIALYSICAINIFEWMGFSMIIYYAG
FT                   LMSISDDIYEAAKIDGCGFWNTLFRITIPNLSGTTNTLILLGIVGSLKTFDIVIQTTGG
FT                   GPGRSTEFLNTYLYKAGVQQFNGGLSAAIGVMVLIIAVMLSLIQLAFNKRANN"
FT   gene            167682..168482
FT                   /locus_tag="BLJ_0129"
FT   CDS_pept        167682..168482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0129"
FT                   /product="ABC-type sugar transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99622"
FT                   /db_xref="GOA:D6ZXH6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXH6"
FT                   /protein_id="ADG99622.1"
FT                   /translation="MKRKTSATVIMYTVLVFFFVIWIFPIYTAITKSLQAGGWNSYLSV
FT                   INNKDVHYFRVVFNSFFISVVTAVIVVVITSLAGYAFAKMKFTGSQVIYVLLLACMAVP
FT                   IASVTMPLFFTIKTFGLTNTYLGMIIPLVAFNALQMLLLWRNYFNGVPDEIIEAARVDG
FT                   CGSLRIWARILMPISTPMIATTGVLTFVYSWNEYLIPLLLIRDESKYPVTLASTYFMET
FT                   RSQTPEMVAQEYAALILMTIPSIIVYLISQKWLQSGITAGAVKS"
FT   gene            168494..170635
FT                   /locus_tag="BLJ_0130"
FT   CDS_pept        168494..170635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0130"
FT                   /product="Predicted beta-xylosidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99623"
FT                   /db_xref="GOA:D6ZXH7"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXH7"
FT                   /protein_id="ADG99623.1"
FT                   /translation="MTATISNGVSASYSPAEDELGAADPTALLAESGDLKPLAERTYTN
FT                   PVPYADGKSHTAPDPFVLKYRDLYYCYATDEHGILVSTSPDMVRWTSHGFCYTEAGRRN
FT                   FWAPSVILINGVFHMYFSNMTAEETDTHTEIMRVAVSEDPLGPFEKKAELFNTFAIDSQ
FT                   VVYGDDGQLYLLYADNQVTGLSDDRPGTSVMIDRLVTPYSRENKPRPLIVPTMDEEIFA
FT                   RNRFGDGRDWHTVEGATYFAYRDRAFITYSANAYEHEDYFVGYSYAQLPNKQADAHIDQ
FT                   LDWTKQLNENRFDPLLIRSPKVEGTGHNSIVKAPNAVDDWIVYHGRNADDELYVGTEQR
FT                   VMRIDPLYYAEGGLDTPGPTAAAQSAPLYGTVHDDFADGLNAGWSVISGAAHTESDVDG
FT                   HALVADESSVFIAVSGKSSATQVIDVWAKAPVTPLGARFGIVVRYQDANNLTKLEVDAG
FT                   RQVISVVDVIGGVASERVTNADLHDFDSHAWHEYRLERRYCRLEIRIDGRFAASCTISD
FT                   KPGQAGLFSLRTGAAFSAYAATEHVNLWGAGLRDLGRELHADRRLVIDGGVRSSGVCPV
FT                   TLELAYPLVSNRFVLDFAGQTSRGQALLSLGEYRLSGTASSVEFMRNGKSLPSTPEPAR
FT                   LRVFEDNVRRDRSGRAVLTIRIEALNGTMRLHLRGKTWQVPFADNAARARITLDRASLT
FT                   GYERTSLESSIEERSASGN"
FT   gene            170747..172072
FT                   /locus_tag="BLJ_0131"
FT   CDS_pept        170747..172072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0131"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99624"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXH8"
FT                   /protein_id="ADG99624.1"
FT                   /translation="MLNMKKAIAAVGALAMSAGLLAGCGSGSGGSDEGVGTKDSPVELT
FT                   FWTWQPTDAQWKSIYAAFQKKYPNIKINWWRTSEMADYQKKLQTSMAGGEGPDVFGVQA
FT                   GSTVEQYGRFADDMKELADKYMPGWDSKVAEGAVAQTTNKDGKMVAMPTITSGSEYILY
FT                   NKTLLDEQGIKVPTTYDELVAANKELKAKGLMPLALGAKDGWHLDDIFVWLSNQYGEGD
FT                   VYKAAEGKAKFTDETFVKTMKAWKQMIGDGLFQDGAVGTATYPDARDNYFYARKSAFFP
FT                   TGSWHVSAVLSNDETKGTAVEKDELGMMEFPQVGDKATGPTTGVDFGLSVNKDSKKKEA
FT                   AMKFIEFMTTGEGQQEWINTLQGAPVDKDMKVEVPSDATESAKASIDLVTKGQASSKLE
FT                   RKLTSQELNDEIGVQMQNIYTGDATVDSALKAIQQVNESIER"
FT   gene            172437..173465
FT                   /locus_tag="BLJ_0132"
FT   CDS_pept        172437..173465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0132"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99625"
FT                   /db_xref="GOA:D6ZXH9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXH9"
FT                   /protein_id="ADG99625.1"
FT                   /translation="MVASSRKATLHDVAKRAHVSVASVSNYLNDYPYMKPATRERIQQA
FT                   IDELGYVTNQQARNLRSGRTGLISLSLPDLNQIYFSELAEEMITRAREYGYRIIIESTG
FT                   NDRQREIESAHAMASNMTDGLILSPTAMRAEDVAELEGDYPLVVLGERIFNAPAPHVVM
FT                   PNELGAQAATTHLLEAGCRTVAVVGGTLDESVPSSRSMRTKGYLSAFAERGVTPDLNLI
FT                   RECGEWTSAEGAQAVREMYAQGIRPDGIFALNDLLAMGVISQLREMRVRVPESVRVVGF
FT                   DDIDEAKYTIPSLTTVDPQRARIAEIAITSILDQVKTGARAPRRRIDVEYSLRYRASSP
FT                   QV"
FT   gene            173569..174294
FT                   /locus_tag="BLJ_0133"
FT   CDS_pept        173569..174294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0133"
FT                   /product="DedA integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99626"
FT                   /db_xref="GOA:D6ZXI0"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXI0"
FT                   /protein_id="ADG99626.1"
FT                   /translation="MGFVNFILELLKDPRAAIAGWIAMGVAPTLGFIFLIVFIETGVVF
FT                   FPFLPGDSLLFAAGVFAAPDAATGKAALPLFWLLPVVWCAPIIGDQCNYFIGHFFGRRI
FT                   IQSGKVKALTPERLAKTEHMIEKWGPLAVFLGRFFPFIRTFMPFISGISGMRWSRFTPF
FT                   SVLGGLCWSTLFTLLGYFFGNIPAVQDHFELVIVLILLVSLAPTIIGLLKAKFGKKKPA
FT                   KVTDAQLDAMEDGIKNLDK"
FT   gene            complement(174339..175694)
FT                   /locus_tag="BLJ_0134"
FT   CDS_pept        complement(174339..175694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0134"
FT                   /product="Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99627"
FT                   /db_xref="GOA:D6ZUQ2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZUQ2"
FT                   /protein_id="ADG99627.1"
FT                   /translation="MFSMEDRRRAVDLYFTEGMTIRKVIAELGYPSEGALVKWVREDPR
FT                   YTGACRRSYTLECKTNAARRALEGEPLARVARDAGCTPTSVYQWMRRYRSEGILGLMDR
FT                   RNAPMPAEPMPAAGDDVEELRRQVEVLRLENAVMRETIDVLKADDPRLDPSMLTNRERT
FT                   RVVDAIRGEFGLAACLKAVGLKRSTYYYERGAIAAGDRYAVLRARVAGLFEQGGRAWGY
FT                   RTIHRMLRLDESDPIVVSEKVVRRIMREGAMRPVYLKRPKRWSSYAGEIGEAPANLVER
FT                   DFHADAPNMLWVTDVTQFTMDGYKCWLSPVVDCFDGMVVSWTLSRSPNADMANRMLLDA
FT                   VATLRDGEHPIIHSDRGCHYRWNEWIRICEEHGLIRSMSAKGCSPDNAAAEGFFGRLKN
FT                   ELFYGRDWRGVGYEEFRERLAAYLTHYNETRIKKSLDWMSPVQYRRSLGLAA"
FT   gene            175952..176902
FT                   /locus_tag="BLJ_0135"
FT   CDS_pept        175952..176902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXI2"
FT                   /protein_id="ADG99628.1"
FT                   /translation="MNSNTTPRVARRITSPAVAPPGIPLPTDDAPIPAYRYYTPPPRPL
FT                   ASCERQRSGEAPALALTTDTSFHNIVTMTSGHGGVGLSVMASMLAWTLARREHSCVLID
FT                   ADFVAGCLDLLLGVEREPGLRFSQVDAPLGRIEGEAMNHELMMWEGVRVLPYDPWSARQ
FT                   PDWWEVQAAIRALAETNDVVIVDAGQGGLIETVPDLRSGLQVIAAELSVMGLARAKSHR
FT                   SRLDSWGCEAPHIVGVEPRGAPRGRGHVGIGEAQDYLTATVLGPIKPSVNLCGDVLEGL
FT                   GIRSVAKGSRKAMNLLADLVEQAIRPVSGASHKDQ"
FT   gene            176907..177974
FT                   /locus_tag="BLJ_0136"
FT   CDS_pept        176907..177974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0136"
FT                   /product="type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99629"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXI3"
FT                   /protein_id="ADG99629.1"
FT                   /translation="MAAVSTRANEAGTALRTIFFGLLDDVASDPQVTDLAVTCDGRVWA
FT                   DRGNGMRETVLHVPFRSPQVVREYAVQLCAQLGRRLDDACPIADAASPDGIRVHAVIAP
FT                   LVPQGAAISIRFPDRTMASLQHLSKLGVFPAAWLPTFVGLVRKHATVLITGGTGVGKTT
FT                   LLKALLAQCDVNERIVTVEEVRELGELGRDDHVSLVTREANVEGVGAISLADLVKATLR
FT                   MRPDRVVLGECRGAEIVDLLRAFNSGHHGGMTTVHADGVNRVPSRLISLGLLAGVSPQA
FT                   LTMLAAGAFDAVVHLERVNGQRRITQIGELRVAHGELAGTPLAVWNGCHPPRYAAEWGH
FT                   FIERWGIVPRPSGGE"
FT   gene            177974..178630
FT                   /locus_tag="BLJ_0137"
FT   CDS_pept        177974..178630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99630"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXI4"
FT                   /protein_id="ADG99630.1"
FT                   /translation="MMWCAVLVALAVLIWPGNKSGRLYRLAYRGRAVDSAAINEPRYAD
FT                   SPRVGVAQVITSAIARLRGGGTLVEAFEEQSSRRFATHRITVERLITVFEQRRLPDESP
FT                   AQVLEAARGVAAAAVLSDELGCQAVPCLEAVLTAYRQMRLMQNLRSQACAVPKATVGLL
FT                   SALPAVTVALGELLGARPLAFLLGSPRGVVCLTLGGCCYAAGLAWMRALLKGSGL"
FT   gene            178627..179229
FT                   /locus_tag="BLJ_0138"
FT   CDS_pept        178627..179229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0138"
FT                   /product="conserved hypothetical membrane protein with
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99631"
FT                   /db_xref="GOA:D6ZXI5"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXI5"
FT                   /protein_id="ADG99631.1"
FT                   /translation="MSTVWVHAAAGCAAIAGWLYKALSRHDSRLPGEEPAVAHDCGSSW
FT                   TILILRMLQVSLRQGSSIPRALDMVGKAVGGDCGARMSEVGNSLTRGVPWADAWHAAMA
FT                   VQHEGAPADSPSKGNTNTTQRDLGLLQSALESSWTHGDMPGVRLESAIEQLDRDERAAI
FT                   ERNAAKLSVKLLMPTGLCFLPAFVLVGVIPAIASFMM"
FT   gene            179514..179801
FT                   /locus_tag="BLJ_0139"
FT   CDS_pept        179514..179801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99632"
FT                   /db_xref="GOA:D6ZXI6"
FT                   /db_xref="InterPro:IPR025338"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXI6"
FT                   /protein_id="ADG99632.1"
FT                   /translation="MNTPIPVIVDGQAGIFAHSKARVATLNAKAKERLCLMDARIRALM
FT                   AEPEEGAATAEYAVVLVAATGFAAVLVAILKSDAIKTLLTNIIKQALKVG"
FT   gene            179807..180184
FT                   /locus_tag="BLJ_0140"
FT   CDS_pept        179807..180184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0140"
FT                   /product="TadE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99633"
FT                   /db_xref="GOA:D6ZXI7"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXI7"
FT                   /protein_id="ADG99633.1"
FT                   /translation="MKTMRCRWRLARLPPDLCTGSATAEFAIVLPSVIAIAGLILAMGR
FT                   VVIVSMDCQGAATAAAREFVVTGDESSARSIAADVAGGDPRVSIAHNGQSTSVMVECSV
FT                   LPGPLDVTPTRVTGNATAISQ"
FT   gene            180229..180615
FT                   /locus_tag="BLJ_0141"
FT   CDS_pept        180229..180615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99634"
FT                   /db_xref="GOA:D6ZXI8"
FT                   /db_xref="InterPro:IPR021202"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXI8"
FT                   /protein_id="ADG99634.1"
FT                   /translation="MQGMRYEEGSGTMAGAMLVMAVGIALAVAASVGNLMICQNRARSL
FT                   ADLIAFDAAYALWHVDIGDPCALAANMAEANGVTLGSCSVRDEDVLVTIKVETMVPVAS
FT                   SVERMARAGPVNCTEGDNYHNNGP"
FT   gene            180663..181793
FT                   /locus_tag="BLJ_0142"
FT   CDS_pept        180663..181793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0142"
FT                   /product="diacylglycerol kinase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99635"
FT                   /db_xref="GOA:D6ZXI9"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXI9"
FT                   /protein_id="ADG99635.1"
FT                   /translation="MSESERTERRRVVAMVGNPTSDKGRGAKVDARVLGLLEDAGRAHN
FT                   FDVIDITGVSFDDSLNQARERAHEYDYLVVVGGDGMIALGANAVGCGGKPLGIVAMGSG
FT                   NDFARGLKLPVNRIETAVEGIVGAIVRGSHIDVDMGRVTSLDGGYAVNPSTGGEYEYRE
FT                   NKSAEHPIDRYYAGMLSCGLDASINDRANHSHLPTGTMRYFAAVLVELTHMKRYGYHVK
FT                   ATLADGTTDERDIITPLLTIANSRHIGGGIEVSPYSCFSDGLLDLVWMNHVPNFGECAV
FT                   AISNAYNGKLLASKVFGWKRIREIEVTRAAEGDEPPVLMADGEYIGHLPFRVVAEDCAL
FT                   RVLVPPAVAAREVDSRQEVLDAIARDGRDPVTGQFA"
FT   gene            complement(181991..182590)
FT                   /locus_tag="BLJ_0143"
FT   CDS_pept        complement(181991..182590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0143"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99636"
FT                   /db_xref="GOA:D6ZXJ0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXJ0"
FT                   /protein_id="ADG99636.1"
FT                   /translation="MSDILDEKRPTRGDARRDAIVQAARKVCLEKGFSKITVSDIASEV
FT                   GMTRSLFYHYFEDKEAVADAVLDDVIDEILTTLKQWNQARETGNVNKALDDIVHVLRSL
FT                   IADESPFSNRMIQDGNAELYIKFIDRAADRIADYIAQTTVRDFEQMHGLPITNVHETFF
FT                   TLIVGLISLVRSHPNISDRTIKEVMAQTLHIESYVV"
FT   gene            182786..185596
FT                   /locus_tag="BLJ_0144"
FT   CDS_pept        182786..185596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0144"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99637"
FT                   /db_xref="GOA:D6ZXJ1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXJ1"
FT                   /protein_id="ADG99637.1"
FT                   /translation="MALALYRRYRPDTFEGVIGQDQVTVPLMRALDEGKLTHAYLFSGP
FT                   RGCGKTSSARILARCVNCAKGPTSHPCGECESCKDLATGGPGSIDVVEIDAASHNGVDD
FT                   ARELRERAGFAPARDRYKIFILDEAHMVTQQGFNALLKIVEEPPEHVMFIFATTEPDKV
FT                   IGTIRSRTHHYPFRLVPQEVMGPYLETICDKEGIRPEPGVLKLAMRAGGGSMRDTLSVL
FT                   DQLMVGSVEGVITHDAAVALLGFTPEALIGEAVDAVINHNGEALYGVIQKVVVGGFDPR
FT                   RFVEDLLARVRDLLVLTLAGDCAESVLSDTAEAEDMDDLHRQAKALGLGALTAMADIIN
FT                   TTLGAMTGAISPRMRLELLAARLLAGSESGFATAAPAPASSGMPPAAASSTSTTSAASG
FT                   TGASGFAGASRGGFAGASHGGFSGAARNQQAAAPQSTASHESAVGDNGPVSDRPAGSPS
FT                   AQPAAATAAANAWGAPATSPAVPAQPVTSPAASDNRSIDEKWDAAVAALPETIREYVSR
FT                   DKVPTVKFGPNRKSLPCLSMTFDKSLSQHAFALAVDNSGKKAASVVLDAVRNEFGANAV
FT                   IAPSAVAANGERVESVKRMSPEQLAKVKQQIAMAKAGLAASSLGAGLGIHMGSEPKAPK
FT                   PTATGQAEDTDDSHRAGQSSASTAAKSWSDDDPWAKPAVSNASPQSADGFAPNEPAAAP
FT                   APEEHHKKHVAVPDISDGVDPWAAPAAPVAPVASVASAGPTGQSTGQPATAAPATAVAG
FT                   ASDDPWNQPQSQATASLALQPVEADPWNQPYQQSPHDDPWNQPQGNHAQAAPQPRDDPW
FT                   NQPQSQTPASSVPQTVSGNMSGDDPWNQPQSVPQPAAGDDPWNQPQPAQPTPNADPWNS
FT                   QPQPQPQVAAEDDEYSMNDQSLGEATAMNLDDLKKLFEVKKVEQFAADDPKNPKNIQPA
FT                   KKHSDE"
FT   gene            185622..186224
FT                   /gene="recR"
FT                   /locus_tag="BLJ_0145"
FT   CDS_pept        185622..186224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="BLJ_0145"
FT                   /product="recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99638"
FT                   /db_xref="GOA:D6ZXJ2"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXJ2"
FT                   /protein_id="ADG99638.1"
FT                   /translation="MALAYDGAIQRLIDAFGRLPGIGPKGAQRIAFYMLSAPEDEARDL
FT                   AEAIEEVKAKIRFCDICGNVCESSPCPVCADPRRDRSVICVVEEPKDVMSIERTREYRG
FT                   LYHVLGGAINPMANVGPADLRIPSLLKRLEGDEVKEVIMALDPNIEGEATTSYLTQLLR
FT                   PVGVKVTRLASGLPVGSDLEYADEITLGRALAGRREA"
FT   gene            complement(186221..187354)
FT                   /locus_tag="BLJ_0146"
FT   CDS_pept        complement(186221..187354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0146"
FT                   /product="sortase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99639"
FT                   /db_xref="GOA:D6ZXJ3"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042002"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXJ3"
FT                   /protein_id="ADG99639.1"
FT                   /translation="MALLHRRSTSNRASQKMRENNAAMPDDTSANDNVSPARPEPTAFV
FT                   PTPFDEVIDISDLVAERRRLQRNLWAMRIITIVSLIAAIAVACFPLALQFESDRNLAAT
FT                   TATTAKEVAGWPYPQAKDKLTAARAYNKKLAESGQPILGEAVDPFSAAQGGSQASGEDS
FT                   ASKKDKEYQSLLNTGNGVMGAIKVPKQSINLPIYHGTSEEALASGAGHLYGTSLPVGGK
FT                   STHSVITGHRGLVEALMFTRLDEVKEGDFFYIEVMGETLGYKVDRISVILPDDTSKLKI
FT                   VPGEDRVTLMTCTPYGVNTHRLLISGHRVAIPMPAPEPNDVLDARNIALGVGLGILAAG
FT                   LFIIWLARRHKAARIIRHGAFWPWMRRKGESANDTLA"
FT   gene            187962..188726
FT                   /locus_tag="BLJ_0147"
FT   CDS_pept        187962..188726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0147"
FT                   /product="aspartate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99640"
FT                   /db_xref="GOA:D6ZXJ4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXJ4"
FT                   /protein_id="ADG99640.1"
FT                   /translation="MALIVQKYGGSSVADTDSIKRVAKRVVETEKKGNKVAVVVSAMGD
FT                   TTDDLIDQALSIDSNPPEREMDMLMTAGERISMSLLAMAIHAEGSRAHSFTGQQAGFFT
FT                   DTRYGAAHIKAVRPDRVKNALSLGDIAIVAGFQGINAKGDATTLGRGGSDTSAVALAVA
FT                   LGADICEIYTDVDGIFTADPRIVPSARRIPSIGYEAILEMASCGSKVLALRCVEYAQRF
FT                   NMPLHVRSSFSRRPGTLVVPDGIDPRTLPNLD"
FT   gene            188782..189348
FT                   /locus_tag="BLJ_0148"
FT   CDS_pept        188782..189348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0148"
FT                   /product="amino acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99641"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXJ5"
FT                   /protein_id="ADG99641.1"
FT                   /translation="MTEEEAKSMGDLFPDLGPEAPVISGIAHDRSEALATVRGVPNEPG
FT                   MAAKVFTELATADVNVDMIVQAGASVGTADISFTVPESAVKQVQNTLLDKQEVLGYHSF
FT                   DVNTNVGKVAVVGVGMKTHAGLAAKFFQALSDEGINVLMISTSEIRIAALVPLDQLNDA
FT                   VKALHTAYGLDADQIEAVVYGGTGR"
FT   gene            complement(189421..190515)
FT                   /locus_tag="BLJ_0149"
FT   CDS_pept        complement(189421..190515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0149"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99642"
FT                   /db_xref="GOA:D6ZXJ6"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005676"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXJ6"
FT                   /protein_id="ADG99642.1"
FT                   /translation="MSEKIKVGILGATGMVGQRFITLLENHPWFEVVTLAASAHSAGKT
FT                   YAEAVGDRWKMETPMPEYVKNMVVVDGDDAESVASGVDFMFSAVNMPKDQIRAIEERYA
FT                   KTETPVVSNNSAHRWTPDVPMVVPEINPEHFEVIEHQRKRLGTTRGFIAVKPNCSIQAY
FT                   TPALAAWKEFEPREVVVSTYQAISGAGKTFKDWPEMVGNIIPFISGEEAKSEKEPLKVF
FT                   GHVDAEKGEIVPFDGDLKITSQCIRVPVLNGHTATVFLNFGKKATKEELIDRLVNYTSK
FT                   ASELELPHAPKHFIQYLTEDDRPQVKLDVDYEGGMSVSIGRLREDSIFDWKFVGLAHNT
FT                   LRGAAGGALECAEMLKALGYITKK"
FT   gene            190750..191370
FT                   /locus_tag="BLJ_0150"
FT   CDS_pept        190750..191370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99643"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXJ7"
FT                   /protein_id="ADG99643.1"
FT                   /translation="MSIASVEAQKQLDRIVALGYPDVADISAAAFRSLARPLIGALEHS
FT                   DLGSNILLVPTRELVSPESLIARTSINRMAGFTTMPPRDIASFLPQDGFMPPEGPFYLV
FT                   VNPHTGTCYINREPDVARKLIDSDERLPLTLEEGLAIATQHPEWLLEKNGFNLLGSRSA
FT                   DGRVPSIWMSQNAPRLGAVWPNSRHTWLGNAYCTARRGVSLFK"
FT   gene            complement(191373..192953)
FT                   /locus_tag="BLJ_0151"
FT   CDS_pept        complement(191373..192953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0151"
FT                   /product="metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99644"
FT                   /db_xref="GOA:D6ZXJ8"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXJ8"
FT                   /protein_id="ADG99644.1"
FT                   /translation="MTSLRFREDGSFRVLQMADVQDGPDVLPDTIRLIREAIREADPDL
FT                   VVFTGDQIRGYDPAYIDTFLRRRGEEPGARVRAVTEIEAKIRGIKRHPVIRKVSDRVAD
FT                   RLTEAGKPVPAALLDPDTVTNAVAAAGADSTDVITTSEVGDSVETSPTPETVSTLVYST
FT                   QSGKASPAHETPATLDELMNETREKVRRTFSGFLGPVVEAGVPFAATYGNHDFQCGILA
FT                   DEQDDIYREYPGCLNPDDSLEPGTFALPVESSDGSGRVAMSVMMVNSGDYAGKPEENDA
FT                   QYPAYVVNPRGLDLADADGYGTPTPKAIEWLGSVQTELGERNGDGKPVPAIAFQHIPPQ
FT                   EFYDCLKEVPAWTPNAVEGARTHAGRCYVLNHEVCRPGSRLGEAIGCADENVGEVDALR
FT                   EAGGYFALFCGHDHKNSFVGHVHDIDLGYAPTCGFECYGPKSRYRGIRLFEFHESNPAC
FT                   YVTRMLTWGNLVGRYSSNELRVWFEDHCVTGAVSARNELRRPQVFAVVAGAMSLGFIAI
FT                   IRSLIKAAR"
FT   gene            193642..195558
FT                   /locus_tag="BLJ_0152"
FT   CDS_pept        193642..195558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0152"
FT                   /product="2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99645"
FT                   /db_xref="GOA:D6ZXJ9"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="InterPro:IPR039371"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXJ9"
FT                   /protein_id="ADG99645.1"
FT                   /translation="MGQDQSSVFDLAAVAAASNGGNNDPLLPPARFIGDPQKPSRMPYN
FT                   KYAAYDKQIPFDYPERTWPGKRLQRAPRWCSVDLRDGNQALVNPMDSERKLRFWNLLVS
FT                   MGFKEIEVGFPSASETDFDFIRMLIERELIPDDVTIVVLTQCREHLIRRTYEALKGAKR
FT                   AIVHFYNSVSVLQREVVFRKNKEEIKKLATDAAELCKDLENEAKGIDLYYEYSPESFTG
FT                   TEPEYAVEVCNAVIGVIKPTPEHPMIINLPATVEMTTPNVFADEVEYVSTHLDDRDSVV
FT                   LSLHPHNDEGMGVAATELAVLAGADRVEGCLLGNGERTGNVDLVTLGLNWLTQGIDPQI
FT                   DLSNVPEIRKTVEYCNQIKISERHPYAGNFVFTAFSGSHQDAIKKGLEARQVAAERAGA
FT                   DLDSFVWLVPYLPIDPKDIGRTYEAIIRVNSQSGKGGMAYLLKTNHNLDLPKRLQIEFD
FT                   KIVQDYADTTKKEVKDEDIWRLFKDEYLPIEQSGMTAAGVVVGDTHDASLAPWGRLKLL
FT                   KVAVSSGEDGSDTVLKARLLDRGVNVGVDAPVEREVSGIGNGPIAAFLNAISNFGVDAS
FT                   IMDYVEHTMSVGTDAMAASYVECQVGEADDAQIVWGVGIDSSITTSALKSIISAINRSQ
FT                   RKR"
FT   gene            complement(195626..198049)
FT                   /locus_tag="BLJ_0153"
FT   CDS_pept        complement(195626..198049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0153"
FT                   /product="glycosyl transferase, family 51"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99646"
FT                   /db_xref="GOA:D6ZXK0"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXK0"
FT                   /protein_id="ADG99646.1"
FT                   /translation="MASYTRRAHSGGNGPALRQPRTAQSRADHSAQEGPYTPQESRSRH
FT                   ASHKASNSHRAPNRKKKNTGKGKHRVLKWVLGIFFSLIGLGLLAGIAVFAYLYTTTEVP
FT                   QPEKFALAEKTTVYYADGTTAIGSYAEQNRSIISCEGLPDYIGNAIVASENRTFYTDKG
FT                   LDLKGIARAFINNVTKGTRQGGSTITQQYAERYYMGETTSYVGKAREAIVAIKIAQTES
FT                   KDEVLCNYMNTIYLGRNSYGIQAAAKAYFNKDAKDLTLSEAAMIAGIIPSPSTWDPADN
FT                   ADMAKSRFKRVLNIMQEDGYITAKQHTDAKFPQTAAVAQQNEYAGPNGYLLDMVRRELV
FT                   QSKAFTKEDLDTGGYKIITTIDKSKQDLMQSIGDTRLDDMPESLQIGGIALDPKTGEVL
FT                   SVYAGSDYLSKQLNNADQAVFEPGSTMKPFALLGAAQSGVSFDTLFNGNSHQHFTGLDQ
FT                   EVNNALENNWGNINLYQATANSVNTVFMNVNEHLTPKRTAAIAHEAGIQGDIDENSMYN
FT                   VLGINALTVWDLAQGHSTIANNGVKSTLHMVSKVLDSNNKDMYNAPSKGTKVFDANDCA
FT                   LVQKAMQGTTTYGTAAGTSNMLGRPIAGKSGTANDEMASSFVGYTPSMMNVWAIWNPDD
FT                   KGNPQAVPAFSGYGISSTGYPAHLFQEFMAQALQGTEVEQFPTAKDNGKIGGPDGTWGL
FT                   GKGQSSGLSNNTNKQSTEDAQKQAEQDAQQKAAEEEAKKQQQAQEFAQQCLANPSYSTE
FT                   CPNYPGTTTGGDGNNGNNGNNPGNTGGNNGNNTGNDNGNSGGPGGNTGTNGVTQ"
FT   gene            198426..199577
FT                   /locus_tag="BLJ_0154"
FT   CDS_pept        198426..199577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0154"
FT                   /product="phosphoesterase, PA-phosphatase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99647"
FT                   /db_xref="GOA:D6ZXK1"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXK1"
FT                   /protein_id="ADG99647.1"
FT                   /translation="MNDAQTPRIRDPHAAVNLVGSGAAQPDSSSNVVDPLAALGPVSGS
FT                   DASASTSGSLGDFRPLGMDDADGASDIDRGLARLDPLTVRPRISSRVLCVVFGLLLIAI
FT                   GFGVWWGCVFTENGQSYDELVWKNLHNDVPSWTTGMMNAVAQSWLVIAVSCTIAAIGII
FT                   TALIRRRWWLAGQIAVFAVVCLAVTRIKGLLPRPFIINTESPAANSAPSGHTMLAAACA
FT                   VILLLTVPRAVRALAGVIGVVWAATVGVSVIYGQWHRPSDVAMSILLVAGLALLALAVT
FT                   RKSGMDEPGHRVSSVSVQIVGSVLITGGLLLLAYSGYVIWQVVPGLNVSASWAVQGANV
FT                   SAVVGITGVAMLAFGLLLALRQITAAPLSRLGLIGAPPAPPKR"
FT   gene            199701..202787
FT                   /locus_tag="BLJ_0155"
FT   CDS_pept        199701..202787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0155"
FT                   /product="DNA topoisomerase I"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99648"
FT                   /db_xref="GOA:D6ZXK2"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXK2"
FT                   /protein_id="ADG99648.1"
FT                   /translation="MATKLVIVESPTKAHKIGDYLGKGYTVMASVGHIRDLAQPSQVPA
FT                   ADKAKFGKFGVDVNDGFKPYYIVDGDKKRTVSELKSALKNADELYLATDEDREGEAIAW
FT                   HLVQTLKPKVPVKRMVFHEITKNAINASLGKTRDVDSHMVDAQETRRILDRLYGYELSP
FT                   VLWRKVGPGLSAGRVQSVATRLIVERERERMAFKRAPYWDIVAMLAAPDALGERAEFSA
FT                   RMIALGGKRLAGSKDFGADGQLTPDGFAANVRQLDEAGATAVAEALRTADFTVMSMETK
FT                   PYRRRPQPPFTTSTLQQTAGNRLGMGARVVMRAAQSLYENGYITYMRTDSVTLSQEAIT
FT                   AARNAVSYHFGDKFLSAEPKQYATKTAGAQEAHECIRPAGSRFHDPDELASKLPGDQLR
FT                   LYTLIWQRTLACQMADATGSTATVRLSAPAGPTEGEAVFQASGTVIEFPGFMKATGEGR
FT                   KPKAAAPGAGAGSDQAAAAGKTDVKAVRGDASESNTSLPPMSVGQQVEASDIEPDGHET
FT                   QPPARYTEATLVKTLEAKEIGRPSTYASIISTIMDRGYVYERGRALIPSWLAFSVTKLL
FT                   ETNFPKLVDYQFTAEMENGLDRIAHGEESGRDWLTHFYFGSGEGAARNADEAHEGLQQQ
FT                   VAQLGEIDARAINTIDIGDGLHVRVGRYGPYLEDMEHLDVEGNPKRASLPDTIAPDELT
FT                   VAVARDLIDNHSGGPRELGVDPVSGGTVEVRNGRFGPYVALVPPAEASAGAAGGTAGAS
FT                   AAKKGSKKAAAAAASRPKMASLFKTMSPESLSLEDALKLLSLPREVGTYEETNAETGEV
FT                   SECTVAANNGRYGPYLTKTGADGKSETRSLASEDEIFTVDIDKAKELFSQPKYGRGRGR
FT                   GAAKPPLRDLGKDPNTGKNVTIKDGRFGAYITDGETNRTVPRQYTPESITPDDAFRLLA
FT                   EKRAAGPSTRGRRGAGRAGAAKSGAKGAKKGAASAATNAAEAKRAERRAEVKKLANKGW
FT                   SNQRIAEKLSSTAATVKKDVDWLTANEGYERPAVIPKRG"
FT   gene            203065..203766
FT                   /locus_tag="BLJ_0156"
FT   CDS_pept        203065..203766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0156"
FT                   /product="dTMP kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99649"
FT                   /db_xref="GOA:D6ZXK3"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXK3"
FT                   /protein_id="ADG99649.1"
FT                   /translation="MSGLFVSFEGVDGVGKTTQVERLRAYLEAQGRTVVVTREPGGTAL
FT                   GKAIRQLLLHGVDGGAVDIAPRAEALLFAADRAQHVAETIRPALERGEVVITDRYLDSS
FT                   LAYQAGGRELTPEEIRSLSMWATNNLLPDRTYLLDMDPVLSHNRLEHAEDRMESAGSGF
FT                   QSRTRQAFLDLAAAEPNRFHVIDASQSIEQVWSAIEADIQTLLRDNVADVDTVMARSGA
FT                   STGAVTMGGVR"
FT   gene            203763..204914
FT                   /locus_tag="BLJ_0157"
FT   CDS_pept        203763..204914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0157"
FT                   /product="AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99650"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXK4"
FT                   /protein_id="ADG99650.1"
FT                   /translation="MSVWDSLVGQQPVIDVLSRIAQGDPGQITQSWLICGPPGSGRSNM
FT                   ARAFAAALESPDHGMNDEPTRVTQQVLAGTHPDVTVLATNKVTIGIDQVREIITASEQM
FT                   PATAPWRIIIIEDVDRMLERTTNVLLKEIEEPAEHCIWLLCAPSAQDVLPTIRSRTRIV
FT                   NLAVPSTQAVAGFLTSTTNVEPKVAQRAARLAEGHIGIAKLYATDEQVMTDRDELVVGV
FT                   LNLARASDAVLLAGSLIDNAKAQAEADASRITAGQEAEFRRINGLAPNDRIPPKLRGTF
FT                   NQIAKKDDVKRLVTRRTRDVLDRALNSIASIYRDVAVLQNNAEDSVGLINLENRSPITE
FT                   LSVRLNRAGAVTRLDEVAHARKRLAGNGNPLLVFESLFCALIP"
FT   gene            205031..205585
FT                   /locus_tag="BLJ_0158"
FT   CDS_pept        205031..205585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99651"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXK5"
FT                   /protein_id="ADG99651.1"
FT                   /translation="MKISADFTVIPDDFAKAAAPEYFNGGVPVVSFPFYIGDVNPEARY
FT                   LHWEFVDPDSIPVCGFEWIHWSVANLPIDALMYDFNDSHALAIPPDFSRQLPAMIPETV
FT                   QGRNSSASKFLGRSTDPAVIMRYNGPQPPDKDHEYYLQVWATKKPLPGLNQGFWLNELL
FT                   HALRNSGEAPDTDGIFLTGKA"
FT   gene            205847..207448
FT                   /locus_tag="BLJ_0159"
FT   CDS_pept        205847..207448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0159"
FT                   /product="peptidase U34, dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99652"
FT                   /db_xref="GOA:D6ZXK6"
FT                   /db_xref="InterPro:IPR005322"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXK6"
FT                   /protein_id="ADG99652.1"
FT                   /translation="MACTTILVGKDASYDGSTIIARNEDSANGEFNPKRFIVVKPEEQP
FT                   REYKSVISHLTITLPDDPLQYTAVPNADLKEGIWGEAGVNEANVAMSATETLTTNERVL
FT                   GADPFAEYTPAKGDEPEVPGGIGEEDFLTIVLPYVKTAREGVQRLGSLLEEFGTYEMNG
FT                   VAFSDSNEIWWLETVGGHHWIAKRVPDEAYVTMPNQLGIDEFDLEDALGDQEAHMCSED
FT                   LAEFIETNHLDLAVENTTPFNPRDAFGSHSDSDHVYNTPRAWYMQRFLNPYDEVWDGPD
FT                   ADHKPTSDDIPWARQPERKVTIEDIKYVLSSHYQGTPFDPYGQLGDERTRHMYRPIGIN
FT                   RQSQLAVMQIRPYRPQASRAIQWMAYGSNPFNTLVPFFPNVDTTPAYLEDTTTRVTSEN
FT                   FYWANRIIAALCDGAFRSTSNAVERYQEKTGAMGHRLVSATDEQVARLGLTAAEEAAQS
FT                   AAEEEFEADNVDGDVQPMTPDETIAALRNPEVREILATANQTMADQLKEETDKLLDSVL
FT                   YTRSMEMKNGFHMSDF"
FT   gene            207606..209123
FT                   /locus_tag="BLJ_0160"
FT   CDS_pept        207606..209123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0160"
FT                   /product="Formate--tetrahydrofolate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99653"
FT                   /db_xref="GOA:D6ZXK7"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXK7"
FT                   /protein_id="ADG99653.1"
FT                   /translation="MTTIEDFTSQYGLVQKIDAFGYMKYLAENPDAPCKHGKVVLVTAD
FT                   TPLKASRGEGKTTTTIALIDALNKRGIDAAAVLRQPSMGITAAGSKGGASGGGKASLTH
FT                   PELIDWGLCGEMGAIEAAQNLLVSFAEKAIDEGKLDTILVPRVSEVPSRSLRSTAVDYG
FT                   KGNVPEKVVLTPTCELMQIMVLSRSMDEISERVSKMIAGTKDGKAVTFGEFVDLWRITG
FT                   ILADAVKPAKTETVNGSPVYVHGGPFANVSIGIPTLVSVEMACALHDVVVVEAGYGTDA
FT                   GAQKWLDIACREYGAQWPSAAIVVTRASTWRDDPELAWRYPFHVQRLENLDIPTFPLIN
FT                   LWEGEDDQVPSLQATADELGFRTPIVGNLFRDGGEALVPQLDGFVDALQNGSMPAEPHS
FT                   HKGMALTENAKWVAENAYGVPAERVIYKPGFTESVSEAMELCQSAGISLDNLTFVAVKS
FT                   PATMTDNDRAPEEERTVTLKKVEVHAGAGLVHVNLTTSLTTPMPKIV"
FT   gene            complement(209396..209743)
FT                   /locus_tag="BLJ_0161"
FT   CDS_pept        complement(209396..209743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99654"
FT                   /db_xref="InterPro:IPR001398"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXK8"
FT                   /protein_id="ADG99654.1"
FT                   /translation="MPVIHTHVSVSTTPEQREALKAAYGKAITAVPGKSEGWLMCPFED
FT                   NMPIYFGGSDDQPAAYVEVNVFGRSVPGSAWEKLTESIMAALNSTLGIPEERTYIRYTA
FT                   TTDWGWNGGNF"
FT   gene            209944..210480
FT                   /locus_tag="BLJ_0162"
FT   CDS_pept        209944..210480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0162"
FT                   /product="GtrA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99655"
FT                   /db_xref="GOA:D6ZXK9"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXK9"
FT                   /protein_id="ADG99655.1"
FT                   /translation="MKFGIVGVIAFVIDWGILNLLVGIFHMHNVLAATISFIISLIFNY
FT                   LASMKFVFKHRDDMARWMEILIFVAGAVVGLFMNDAIIWISTYGMNHDAYVSQHAEYLL
FT                   RTNIGKLVATAVVMIWNFLIRKWLLDDTHTNAMNRLKSAENRLNAEELEAKWQNSFSHK
FT                   LGIWSLEHTPKGWSK"
FT   gene            complement(210532..211983)
FT                   /locus_tag="BLJ_0163"
FT   CDS_pept        complement(210532..211983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0163"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99656"
FT                   /db_xref="GOA:D6ZXL0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXL0"
FT                   /protein_id="ADG99656.1"
FT                   /translation="MSNNSSNSNSSTILAGIKEVGHKVFGGYAELLRIPHTARYSIGSV
FT                   IACMPFPMVGMTITISVQHYYGNYSLAGMLTAIQAIALAVATPLLGKLTDKFGQRQVSI
FT                   PTIIVWIVAAIALVTAITNRAPEWVLYCLTPFLAAIPPWGAMSRARWTKILKGDRERTN
FT                   RALSLCGVLDECMWVIGNPLASTLAVISGLLAFSFTGMCVVIGALMFLTELTTEPPSQT
FT                   ALARAEGISRKEYREREAAKAEALKVETAAEETRRRLEREGVTDEATINAAIKQAVADA
FT                   RSGKKASIWGPGLIAVCVTWFGLGAFQSATGISIIAFATEANMKQYTGFVFACFSFSSL
FT                   MGALVYGAKNWSIALWKRFYFCLAVVNIGISTFLFAKHLWVIMIIYLIIGVCQAPTWIN
FT                   GNQLMLHLVPPSRLTEGMAWMGAMNSIGSSAGSAIAGQFIDRMGSHGGFMVVTTLALAS
FT                   LVIALIGFKQIKGSTEQPTLTEVSV"
FT   gene            212223..212882
FT                   /locus_tag="BLJ_0164"
FT   CDS_pept        212223..212882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0164"
FT                   /product="Phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99657"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXL1"
FT                   /protein_id="ADG99657.1"
FT                   /translation="MSATTIHFVRHGKVYNPDHLLYERLPDFHLSDLGRRMAQATATYL
FT                   AKNPQTNTIAAVYSSPLDRTRETAGAILDALNPVREARGEASLTLTTDERVIEAGNEFR
FT                   GKRIGHGEGALWKNGNWKLVTNLYKPSWGESYQHIAARMDDFAREKVAQHPGEQIVVVS
FT                   HESPIFSYRHYLETGHPEHWMFLRHTALASVTSVTYDNETGRVMSITYVDPAANVK"
FT   gene            212970..213878
FT                   /locus_tag="BLJ_0165"
FT   CDS_pept        212970..213878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99658"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXL2"
FT                   /protein_id="ADG99658.1"
FT                   /translation="MTIELNREAIAQVAALPAVTEAAEAGAALIGLWPLTEAMQMDNDA
FT                   KYAENLQVRLTRAFARVLTGEDVTVPDAEFVYEGADEIPGRPQNIVDALLAANDAYDTM
FT                   AGYCASGDARLVFDAAATLGVRWSDSVAHTVRATIADVESQIEADAVQGRLAASGEPED
FT                   VADRFATALAVCDALLGVVAEDAGADARARATAVLPILLYVNELREQCSIPRICLTDRQ
FT                   ISGLLDARAGAGDAGTLAATAAYIAPLARDEWTRHRDDVLWDPGEAKRKAKEEDEKRNK
FT                   EALAAKFAHIKDDPGKEAVEL"
FT   gene            214003..214878
FT                   /locus_tag="BLJ_0166"
FT   CDS_pept        214003..214878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0166"
FT                   /product="Aldose 1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99659"
FT                   /db_xref="GOA:D6ZXL3"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR025532"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXL3"
FT                   /protein_id="ADG99659.1"
FT                   /translation="MDNDVNLRTLVNDGGSAVISDYGAHLLRWAPAGQPDVVWTPSTWR
FT                   IEPGKPLGGGVPICFPWFGPGFAHGRQLAITPSHGFARVRRWTLDEEGFTDDRVRYVMD
FT                   SECLTDGEVPWLDDEPEVRFRATYDVHAADTLTMSLTVVNTGDVPMSYEAALHSYLHVG
FT                   DVSDAGLVGLRGATYLDATETGFPPRLQEPEAVTFGERPVDRVYYSDSSVELRDAVLGR
FT                   VVHIVKSGSPQTVVWNPGKEGDHMRCARPGEWRGFVAVEAAACRDRGVTLAPGESHTLS
FT                   QMLSVETLDV"
FT   gene            complement(214965..216071)
FT                   /locus_tag="BLJ_0167"
FT   CDS_pept        complement(214965..216071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0167"
FT                   /product="protein of unknown function DUF805"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99660"
FT                   /db_xref="GOA:D6ZXL4"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXL4"
FT                   /protein_id="ADG99660.1"
FT                   /translation="MTDPSNAPAPPTPTPNGGPIQHHSGTPEYGAPTAAPAGQDHGRFA
FT                   APASAAQQQPYGQPIYGQPTYGQQEYGQSYGQSAPNANPYAQPSPAYGQVPPTYNQYAA
FT                   PTGAVPLNKPYYGCPFSEAFLRFWQKYTVFRGRASRSEFWWWTLAAVIINALLSLLGDV
FT                   TDGRLDFLTSLWNLAIVVPGLALAVRRLHDTNKPGWWVAVFCGMMTLGLLIMIVGGGAA
FT                   LYGAIGAIGHNYDYGYGYGYEALATGGFGALAIGGLIMLASAVTGIVFMALPSKPEGAR
FT                   FDDDAAIGAAPQNAYGMPYGASAAPGFPAPGTPAQDFGQTVPTYGQNPQYGQNPQQYGQ
FT                   TPQYAPAPQYGQVPPEHENAGPDSGETR"
FT   gene            complement(216368..219437)
FT                   /pseudo
FT                   /locus_tag="BLJ_0168"
FT                   /note="frameshift"
FT   gene            complement(219505..219975)
FT                   /locus_tag="BLJ_0169"
FT   CDS_pept        complement(219505..219975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0169"
FT                   /product="phage AbiD protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99661"
FT                   /db_xref="InterPro:IPR011664"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXL5"
FT                   /protein_id="ADG99661.1"
FT                   /translation="MKMSNEVCMRHYRRKGGPVPVWAAVETFPFDTLSRMLSLHVDAKA
FT                   LRELYRSVGLRTNLRTSSEVVHAMVYLRNLCSHHARLWHREMVIPSPMTRDMKTAFADF
FT                   EYGEKSVASSLLALMYLVRNIEDGDDYATEIRGFLDANDAYASGIRTALHWE"
FT   gene            complement(220361..221545)
FT                   /locus_tag="BLJ_0170"
FT   CDS_pept        complement(220361..221545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0170"
FT                   /product="transposase, mutator type"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99662"
FT                   /db_xref="GOA:D6ZU11"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZU11"
FT                   /protein_id="ADG99662.1"
FT                   /translation="MSKEIIQFDQAMFETKLDTMVREKVERIVNAMLDAEADEIANAAR
FT                   YERTGERKAYRAGHYERKLTAKAGRLALKVPKLKGAVFESAVIERYRRREQSVEESLID
FT                   MYLAGVSTRQVDDISQLLWGDRMPSQTLSDKLKKVYEDIDSWRTRPLESEYPYVFMDGV
FT                   WHKRSWGGHVENVSVLVAIGVDSEGHREVIGVAEGMKEDGDSWEQFVRGMIERGLKGVR
FT                   LVVGDRCAGLVSTVNSMLPKARYQRCMVHFMRNVLSKTPPTHRQWASAALKAIFAMESR
FT                   ESALAKAESVAAEMEARRLKAAANCLREGVGETTTYLLPEFPDGHRRRIRTNNMIERLN
FT                   REIRRRTRVVGSFPDGNSALMLVCARIRYVTDNEWSTRRYLDMSRLDDTLQAAN"
FT   gene            complement(221944..223173)
FT                   /locus_tag="BLJ_0171"
FT   CDS_pept        complement(221944..223173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0171"
FT                   /product="type I restriction-modification system
FT                   specificity determinant"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99663"
FT                   /db_xref="GOA:D6ZXL7"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXL7"
FT                   /protein_id="ADG99663.1"
FT                   /translation="MSRIDDLIAEYCPNGVERKPLGAIAKLYRGNGLQKKDFTDKGIGC
FT                   IHYGQIYTRYDTFTSQTISFVDKKLADKLLKVHPNDLIVTATSENLEDVCKAVAWLGGS
FT                   DIVTGGHSIVVRHHQNAKYLSYYFQTLDFFQRKRAYVHGTKVMEIKKDDLAKIVVPVPP
FT                   LPVQEEIVRILDSFSSLEAELEAELEAELEARRKQYAYYRNELLTFDRERVITACIQDI
FT                   CTRICSGGTPSSKRHDYYDGNVPWLRTQDIDFNVINQTSATISDEGLKNSAAQWIPANC
FT                   VIVAMYGATAAKVAVNSIPLTTNQACCNLQIDESKADVRYVFHWLSNEYEHLKALGEGS
FT                   QSNINAKKVRLYPISLPPFEEQQRIVSILDRFDKLTNDLSSGLPAEIEARHKQYEYYRD
FT                   RLLSFDELAA"
FT   gene            complement(223160..224029)
FT                   /locus_tag="BLJ_0172"
FT   CDS_pept        complement(223160..224029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0172"
FT                   /product="ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99664"
FT                   /db_xref="InterPro:IPR025332"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXL8"
FT                   /protein_id="ADG99664.1"
FT                   /translation="MISYVARAEKNRVVRHARVENVGVQNHLYETACPSGESGDYYFPN
FT                   YIEKSLSLTEDKLNGELGRFLHTVLDMRPSDRLEDDDLDRLVSFVSIFIPHIVSRSPES
FT                   VRYATNRAEDVLETMRELDLGSSEKLKELYRETQTREEFDETLTFAPEAIAEQISLWVQ
FT                   ILPGISKDEKFVRSSSLYKAVEYLRDCSMLVLTTSSGHPFIGIDKPVRTVITDNLTTLY
FT                   YPLSSQVAVILTDDGQHTFEKRSVSYRQLKDLNRVAFNDGGWNLVFCERSDYLNAYSGI
FT                   EGTSNEQD"
FT   gene            complement(224133..225695)
FT                   /locus_tag="BLJ_0173"
FT   CDS_pept        complement(224133..225695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0173"
FT                   /product="type I restriction-modification system, M
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99665"
FT                   /db_xref="GOA:D6ZXL9"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR004546"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXL9"
FT                   /protein_id="ADG99665.1"
FT                   /translation="MTNSGAQRAELHKAIWNIANVLRGSVDGWDFKQYVLGFLFYRFIS
FT                   EDITSYLNGYEHQAGDVDFDYAKLDDATAEQVRKSMVEEKGYFILPSDLFANVRNRADG
FT                   DENLNETLQRVFKNIEGSAIGSRSESSLRGLFDDLDLNSRKLGDTVVERNAKLVKVLNA
FT                   IGNLDLGTESFADNTIDAFGDAYEYLMTMYAANAGKSGGEFFTPQEVSELLTRIATHGK
FT                   SEVNKVYDPACGSGSLLLQSIKVLGKDKVRQGFFGQEKNLTTYNLCRINMFLHDVNYDH
FT                   FNIAYGDTLINPQHWDDEPFEVIVSNPPYSTKWEGDDNPTLINDPRFSPAGVLAPKSKA
FT                   DLAFTMHMLSWLAADGTAAIVEFPGVLYRGGKEQKIRKYLLEKNFIDAVIQLPPNLFFG
FT                   TSIATCIIVLRKSKNDDSVLFIDASERFVHVGNQNQLSPDDIAAIMDAYVKREPVEHFS
FT                   AVASLEDIRKNDYVLSVSSYVQPKDTREKIDIAALNRQISDIVARENELRTQIDAIIAD
FT                   LES"
FT   gene            225868..227388
FT                   /gene="gltX"
FT                   /locus_tag="BLJ_0174"
FT   CDS_pept        225868..227388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="BLJ_0174"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99666"
FT                   /db_xref="GOA:D6ZXM0"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXM0"
FT                   /protein_id="ADG99666.1"
FT                   /translation="MTDAENTKPELPKNVRVRFCPSPTGTPHVGMIRTALFNWAEARAT
FT                   GGTLIFRIEDTDAVRDSEESYNQILESLRWLGIDWDEGIDVGGPHGPYRQSERTAIYKD
FT                   VAAKLLEAGYAYESFSTPEEIKERNLAAGRPAEFGYDGYDRNLTDEQKAAFRAEGRKPA
FT                   LRLRMPDEDIAFDDLIRGTIEFKAGSVPDYVIVRPNGDPLYTLTNPVDDAMMEVNVVLR
FT                   GEDLLSSTPRQIVLYRYLMELGIAKEMPLFGHMPYVMGQGNKKLSKRDPESNLFNHRDN
FT                   GFIREGLLNYLALLGWSIAPDRDVFSMDEMVEKFDVRDVKANPARFDIDKAISINAEHI
FT                   RMLEPEDFLRRSVPYLHRDGVVSADNWDALTDREREVLTAAAPLVQPRVRLLGEVAGMV
FT                   GSLLSTEEYLEPADDAKKQLKDSAGEVLDKAIAALEGVDEVDWKTDNLHETLNKALVEE
FT                   GGYKPRLAFGPVRVAMSGRRVSPPLFESMEIVGKPITVARLKGLRAHL"
FT   gene            227600..227675
FT                   /locus_tag="BLJ_0175"
FT   tRNA            227600..227675
FT                   /locus_tag="BLJ_0175"
FT                   /product="tRNA-Glu"
FT   gene            227712..227786
FT                   /locus_tag="BLJ_0176"
FT   tRNA            227712..227786
FT                   /locus_tag="BLJ_0176"
FT                   /product="tRNA-Gln"
FT   gene            complement(228056..228553)
FT                   /locus_tag="BLJ_0177"
FT   CDS_pept        complement(228056..228553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99667"
FT                   /db_xref="GOA:D6ZXM1"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXM1"
FT                   /protein_id="ADG99667.1"
FT                   /translation="MTDAQQANGNQPESQNQAEATAQPHNKRVTKWVAIVIAIVAVAII
FT                   AAVAVFGTRAYSASQYDSAVAACAAASEDVRNATNDYNNLVNGDAAEAAALTKADVSDA
FT                   SALDALSKELTVELPTYEGCVADDTKGYQAATKKLEQQVTWYHEHTTSLQKAVDAVNAV
FT                   KK"
FT   gene            complement(228719..229534)
FT                   /locus_tag="BLJ_0178"
FT   CDS_pept        complement(228719..229534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0178"
FT                   /product="protein of unknown function DUF1275"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99668"
FT                   /db_xref="GOA:D6ZXM2"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXM2"
FT                   /protein_id="ADG99668.1"
FT                   /translation="MVPRKEDRYGLLSPALVVLTFVAGLVDALSYLSLGHVFVANVTGN
FT                   IVFLGFSIAHAQGFVWWTSALTLVSFMVGALIGGRIIRRFEENRAKHLLVSTCVQASFV
FT                   LAALIGVYLLNQLITGPADDASGVSSIARLAQTTQASQASQPSLNFPTARHIDLHIILL
FT                   IVLLAPAMGIQNSTARKLSVPDLPTTVLTMTLTGVVADASAHGHQQSKLGRRAVVMLAL
FT                   ASGALTGALLQAHGHENIILMVMLGCLLAVIAMMIPHVHSDAPWVTGRQ"
FT   gene            229602..231092
FT                   /locus_tag="BLJ_0179"
FT   CDS_pept        229602..231092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0179"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99669"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXM3"
FT                   /protein_id="ADG99669.1"
FT                   /translation="MARTCVGRRRHSTPYSRTVPPVSARAQIVGTEKTPVMQIDVPKSR
FT                   SVVSTKSGKVLRRRMKVDGTPESVPMYPYEIATRLSDLGRLDFSAQPVPDATRDDFDPL
FT                   ERDRLRRIIGTYQSSDRNLLELTDEELEKSLQLTVTVDGKTMPTLTGLLLLGKGESLKR
FT                   FVPTHRASFQVMSGTDIKVNQDYAGPLLKTIEQINDMFSPWNPSVELSIGLFSMMVPEF
FT                   DHRAFREALVNAFGHRDYTLLGRVRVQLDDAGLTIANPGGFVEGINIHNLLTAEPHGRN
FT                   PCLMDALKRTGLAERTGRGIDRIFEGALNYGRPLPDYSRSNRRGVSVLLPRSVPDKAFV
FT                   ELLAEERERSGKSMSLDGLLILDKLKSERRCGFDVLSGSLDMSDQRLRTVLGQPTEAGL
FT                   VESAGVGARSTYMLGAKVYRRSGRAMDYVRQSDIDRVRYPELIIKLMHEQKSVSKNDVM
FT                   ELLHLEGNQAYYQLRKLVLEGRAKKIGSGRNVRYAAVR"
FT   gene            complement(231210..231587)
FT                   /locus_tag="BLJ_0180"
FT   CDS_pept        complement(231210..231587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0180"
FT                   /product="cathepsin L4"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99670"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXM4"
FT                   /protein_id="ADG99670.1"
FT                   /translation="MVAGPCPSKALAASCKKPGPSYARTCESPYAGVDIPHRRDIRRGD
FT                   STDSVTGHSCAGGRRYHEDANHVNHHAKEHDVNYLEHRRQHKDALWEQLREPHQAPHRK
FT                   RTDKAADGIAGAGRVQVVHNS"
FT   gene            232136..233704
FT                   /locus_tag="BLJ_0181"
FT   CDS_pept        232136..233704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0181"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99671"
FT                   /db_xref="GOA:D6ZXM5"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXM5"
FT                   /protein_id="ADG99671.1"
FT                   /translation="MQSERSLIPTPMPVRRHARSGNRGLALTALCLAVLLVVMDNTIVN
FT                   VAIPTMSDALNASSTDLQWVVDAYTLSFAALLLPAGKLSDRWGRRRMLLVGLAGFAVVS
FT                   AATAFSWALWQLVTLRVVLGVCAALIYPATLSSIIVIFEGSRYRSLAVGLWAATSGVGI
FT                   ALGPIIGGVLLEHYAWNSIFWVCSVIGVVALACIAVAVPEVRAYRSERFDFPGTVLSVA
FT                   GVGLLVWAIIERPTYGWLSWQVIGGICAALIILAGFAAVEGHTHAPLIDVGLFRRATFT
FT                   SSTCAICVAFFCLFGFIFITTQWFQALRGYTALQTAVATLPFAVVMAAVAPFATQLAKR
FT                   FGYRSVVSTGLLFLSASMFVVTRVDAHCSYWFVVVPTMALMAAGIALIQGPATDALMST
FT                   VPESSTGAASAVNDTIREIGGTLGVAVMGSAISSVYPDELSDSLSGLQIPSSIAKAAED
FT                   SVMAAKSILPHLPAGIRQTVEQSVSTSFMSATHAACWIACALALAFALLCWITLPKHDS
FT                   GNLPQ"
FT   gene            234074..234709
FT                   /locus_tag="BLJ_0182"
FT   CDS_pept        234074..234709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0182"
FT                   /product="TetR-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99672"
FT                   /db_xref="GOA:D6ZXM6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXM6"
FT                   /protein_id="ADG99672.1"
FT                   /translation="MRTIRKTTKSQRTPTTEIRGLILDASKRIIEEDGYDAFTIRLLSE
FT                   KADVSPASIYRHIGDKQAVIDALIDDSFQTLREKLLRVTTEDPLQRLYDAGVVYRGHAK
FT                   ASPGIYALLWRWHAGEASEACLAAMTELVRYGQAAGKIRRDDPHLIAWSIWSAVHGFVQ
FT                   FETRPEHDTPVDDDDAAYSFLLRLLIRGVRAPQTVSEGTATIADTSRS"
FT   gene            complement(235868..236020)
FT                   /locus_tag="BLJ_0183"
FT   CDS_pept        complement(235868..236020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0183"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99673"
FT                   /db_xref="GOA:D6ZXM7"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXM7"
FT                   /protein_id="ADG99673.1"
FT                   /translation="MAGHAVEALRALGLPKVAVGVYADNKAGNDFWEQQGFAIRDDLVY
FT                   RELSL"
FT   gene            complement(238629..239417)
FT                   /locus_tag="BLJ_0184"
FT   CDS_pept        complement(238629..239417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0184"
FT                   /product="restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99674"
FT                   /db_xref="GOA:D6ZXM8"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXM8"
FT                   /protein_id="ADG99674.1"
FT                   /translation="MAFALYIVLKPRECDDKGLDVQRLASFLHRTPSSVVLKIWNIAAY
FT                   DANRKARGRVGMKHGSKLDSQVWQWYAEDPDTFMEQCLNLLRHALLQADANNFNPAPLA
FT                   SDRYSPLETATTLLVAEHTPTGEERPITTLQRVNQSYFRNSLLQNYHSTCCITGMQIPK
FT                   LLIASHIKPWKASSAVEKTAASNGLLLNAFHDRAFDQGLISIDDDYRIMVNHDKVRHSD
FT                   INDKWLYNFEGREISLPTISQPSHEFIEYHHKHIFLADAA"
FT   gene            complement(241476..242393)
FT                   /locus_tag="BLJ_0185"
FT   CDS_pept        complement(241476..242393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99675"
FT                   /db_xref="InterPro:IPR032564"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXM9"
FT                   /protein_id="ADG99675.1"
FT                   /translation="MDLTPINDFRKSHQVNTKGALAAAIQLNRFFSADTLPIDASDYHT
FT                   NKEGQVKGISKDNCQKILAEYGITRLLAAEGGRTSRGTMALMHDYAELINELRPTAEQF
FT                   NEIEQYWVKRIQAFFTSKPFKLESDNSLSVDAAVEHLLQQAAQRQKENPGTMYVGTVLQ
FT                   HLVAAKLTIVAPEVEINGASVADDPTGRGGDFNVGDTAIHCTTAPASLLMDKCQRNIKA
FT                   GLHPIIITVRDRVKTAWDLASDMGFENRLEVWDLQSFLSSNVHEHGHFTNAARHETLSH
FT                   LVKAYNQIIDEHESDPSLHIEYNG"
FT   gene            complement(242406..243584)
FT                   /locus_tag="BLJ_0186"
FT   CDS_pept        complement(242406..243584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0186"
FT                   /product="DNA-cytosine methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99676"
FT                   /db_xref="GOA:D6ZXN0"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXN0"
FT                   /protein_id="ADG99676.1"
FT                   /translation="MDDNRTHAATNTARPQALEFFAGIGLARLGLEEAGFQVEWSNDID
FT                   AAKCEMYRNNFTDTPGHTLVEGDMSELSGDDLPHDASIAWGSSPCTDLSLAGTRTGLNG
FT                   KQSGAFWQYVRLLEELGNTRPPIAVLENVNGLATSHSGEDLAAAVHAFNELGYSVDVLS
FT                   IDTRRFIPQSRPRLFLVGLQNPPAAEQFDSSLRPDWLQQVFADTSLRTHRAPLPEPPSP
FT                   LMSGLNMYVESMANDDERWWNAERTAKFLDSLSPVQATRVETLRNGATDSYRTAYRRTR
FT                   NGKAVWEVRADDISGCLRTARGGSSRQAIIRMGNGKTAVRWMTPREYAALMGAAHYNIT
FT                   GLRPNQVMFGFGDAVSVPVVEWLGKHYFMPALNGTLGKDLYVEQTLLSNHTA"
FT   gene            complement(243675..245129)
FT                   /locus_tag="BLJ_0187"
FT   CDS_pept        complement(243675..245129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0187"
FT                   /product="FRG domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99677"
FT                   /db_xref="InterPro:IPR014966"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXN1"
FT                   /protein_id="ADG99677.1"
FT                   /translation="MLKDEEHHEHVSALPSIAKITQATPNLMAISPNMTHQLLDTIQKT
FT                   PEISNNLRLISTPLKTSTSAIQTFLEQQEKALKTISNLSSSTILSSIKPIQDSLRDALA
FT                   KFDFAHYDEKYLNVYSGISQVLKQYEETQSNLQKYYRSITPSYFHSSNESPHYYSPEMT
FT                   SPSDFFDSKSGRIESIEDLNNAILLLQKHVSNIPLYWRGQNNASWGLHSKLFRLLMTQN
FT                   GVVSPQQKPKTKQPYPTEDQMIQAEKQILNLARQDWRYGNMSALEIFARIQHFGGPTRL
FT                   LDASCNPYIAAWFAVYDPTHEHEDHDARLFALAGYASGNNEQPDYSEELLSRDPFWFNL
FT                   HDYEQRAAANWGTGSRRIVWRPPEYESRIAAQNAVFILDGIPITNSRILQYFRKPTGKE
FT                   YWKRPDILAASSIYAKPFSPNHNARPNQRNLAPTYSFVIAKKAKKEIRSYLEGAFGYRE
FT                   SFIYPDFAGLASKTNNIQFPNLGDLQ"
FT   gene            complement(245883..246353)
FT                   /locus_tag="BLJ_0188"
FT   CDS_pept        complement(245883..246353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0188"
FT                   /product="AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99678"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXN2"
FT                   /protein_id="ADG99678.1"
FT                   /translation="MAPLKRLCEETGCTVIALRHLNKGQGAAIYRGGGSIGIIGAARAA
FT                   FLVAKDPENEERRLFAPVKFNLGPMPRAMAYRLEDNPLLGCAHVHWLGETDDTAESHNQ
FT                   SAYGPSEREDSDVRTFIQDYFDHNKELTLDGLYWGVPSYRVINEAKGEFSKQ"
FT   gene            complement(246353..248053)
FT                   /locus_tag="BLJ_0189"
FT   CDS_pept        complement(246353..248053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99679"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXN3"
FT                   /protein_id="ADG99679.1"
FT                   /translation="METSYEQVLEAVRRYPRDLKLQELPRDTSGRQHAQCSCPAHDGDG
FT                   GTSLHITYDQSDGKTMLHCFGAEHCDAAAIADAPGLKIIDLFDQQSGPQGHAGYSSYNS
FT                   YSCDSRLTAADLASIRHANAPLLNRNETTTITPTHTENSAEIRQQYAMPKPYLEPLVLG
FT                   QSPMFAAICAAIAVQPNIGLLHGTCPNCGTADSLTVLYSPLESATLLRCSTCQADDVLN
FT                   ALNAPATLARSNGYEAMIYDSERGTAYEYADGLIVRRSPAKRISQSGNTADKHPLWMAA
FT                   DAKRAVALGKPVYLTEGEKDAGTLRALGYAAVTAAGGGGNFATKLDLDSARSALSGADV
FT                   VAIVDKDDTGARWKEQVAQTLTPFVRSLTFIQAAGEAHDASDAAMSGVEFEILPRESIQ
FT                   HESELEPELMSRAYSLTRLADVEPERPLWLWPGHIPKGKIVLIDGDPATGKSTLALDIA
FT                   AHVTTGAAWPDGSAGCEPANVLLLTAEDGLADTVSPRIRAAQGDASKMFALSEVFKDGK
FT                   EVAITLTDALPQIAQAAREQHIGLIVVDVLISFLGSDTNSYKDQIFAHR"
FT   gene            complement(248056..248250)
FT                   /locus_tag="BLJ_0190"
FT   CDS_pept        complement(248056..248250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0190"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99680"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXN4"
FT                   /protein_id="ADG99680.1"
FT                   /translation="MAAIPTKNDYPRLTAKPAQVTEMLGYKDVKSVYGLIRTGKIRARK
FT                   VGNTFLVNLTSVREFAGEE"
FT   gene            complement(248707..250380)
FT                   /locus_tag="BLJ_0191"
FT   CDS_pept        complement(248707..250380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0191"
FT                   /product="phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99681"
FT                   /db_xref="GOA:D6ZXN5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXN5"
FT                   /protein_id="ADG99681.1"
FT                   /translation="MARTSQSTRPASRRRRFGKIERKVSANGQISYDASYIPPVEARAQ
FT                   YPHLPARIHKRFDEGYETQAEAWLNEAKRLIDLNAWAPPEVMDNADAGIKVLFRDYAAD
FT                   YVEKRRKANNEPIQQTTKEKYQQYLRDYLNPVLGNRPMAAIRPVDIRQWYDSMHVTKDG
FT                   RGESIRRHVFELLDGIMSHAANAPLDDAGTTLIKRNPVQFKVPRPATKHVYKIATYAQV
FT                   QAIADQMPPSLALAVTLSGFLGLRQGEALGLQRHDFELNEQPPIVHIRRAATEILRNGH
FT                   KEQILGSTKTPSSVRDIEIPAPLVPIIKRHLEIYMDDKPTALVFTGTRTHGIVRGQSLR
FT                   SAFIRAVKAVGDPDLQGMDFHDLRHSGLTLMAEAGATVGQLMQRGGHTNIKTVAVYQQS
FT                   SAEAEAKLRAKIESNINASTGLLSETADTEVDTPNMSDASLAANTATAPTTAESASAKH
FT                   TTTALTKNDATPNTMAIEESASSPANTPNTQQPASPDAFPANAENSVLQVLADTIAAMP
FT                   SDARLSVLRALDDGKRAKILKLLPLDVQADTVQRLIQALA"
FT   gene            250857..252224
FT                   /locus_tag="BLJ_0192"
FT   CDS_pept        250857..252224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0192"
FT                   /product="phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99682"
FT                   /db_xref="GOA:D6ZXN6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXN6"
FT                   /protein_id="ADG99682.1"
FT                   /translation="MNGASGSRRSWGKIRVKKVHGGTSYYAEYPDPRPDRKGDDGRRER
FT                   IRSPFVFSSRQAAEGWLAQQRNRIDGGIWVDPRDEYEDSASARKAEERRSESFRDYAER
FT                   WFGGKIARGEIRPSTVRTYRQRLDGVLYPAFGDKAMRDITVEDVERWYEEMGRPRKVDG
FT                   RPSTKERPRLSTRGNAYGLLRQIMQSACTAPNAILDFNPCQIKGGSAHKGKERAVIGPE
FT                   KVREIADNMPGKYRLVVLLGFWLSLRMGEILALRRRDIDLDGKVVRITHAVTYSKEYGF
FT                   VDGDPKTEAGVRSIPIPDGLVAEIRKHIDEYADPGDDGKLFHTATGNYVHHSEVEKAFI
FT                   KARRKAGCEDVVLHGLRHSGNTYFAQNTNATIADLQARGGWSTSSMAAHYMHSSQDRLR
FT                   QLTKEMSAANTVHETGSDNSAGAASELESLRSQLEEANKKNNELMQLVTERYGTKK"
FT   gene            253262..254791
FT                   /locus_tag="BLJ_0193"
FT   CDS_pept        253262..254791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0193"
FT                   /product="possible replication initiator protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99683"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXN7"
FT                   /protein_id="ADG99683.1"
FT                   /translation="MVAVFPKHQTEAAEPKKGAYVDVPLFGNPEPDTTKAAASADAKYP
FT                   TQCLHPHRRSNGMKVRCGHCSGCRLRRQLDVLSIGKAGLENSGTFVFVTLTAPSFSRPG
FT                   VPVHRVGKSCPLCGREHGGGYPLSGVPRNFDRDVNFAAMATFNVQLGGLLNATMTKLRK
FT                   KYPRSAYFYTIELQSRMAAHVHLLLRFPDEKTYVNTDGLVKLIGGTRLKGSCVQWGPVI
FT                   DIQQVGDDMNRQIVDLPTSKVAPLGDGERLLRYMTKSIRDGLVQDVADIDGLTESERKT
FT                   VGLHRMWVQRTVDGLPLFDEVNPSECCPVHGAIADVRCVEPFKVFRPSEKERQRKRERL
FT                   RRQACLRLMLANSSYGRNVDESAKSEPRTVAHQGKAWERGAVVWSERCVCERIRPKVAR
FT                   RHKRNYGLGARLWGNSRNWCGLTMTGLKKERQDHFAEAGNDATPDRGAQDNELTPEAET
FT                   VPRSTAGNESDDISAEEGGRCIRLDLNADNGPVEITLRIKVDASGVEIRCE"
FT   gene            complement(255216..255494)
FT                   /locus_tag="BLJ_0194"
FT   CDS_pept        complement(255216..255494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0194"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99684"
FT                   /db_xref="GOA:D6ZXN8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXN8"
FT                   /protein_id="ADG99684.1"
FT                   /translation="MAVKDDSKEWARYAKELGVNLQRLRVERGLTQERVAYDAGLSRYQ
FT                   YQRMEWGRIGKDTPANPTLKTIMAVAQVLGVTLDELLPQPWPDLHAR"
FT   gene            255704..256723
FT                   /locus_tag="BLJ_0195"
FT   CDS_pept        255704..256723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0195"
FT                   /product="membrane protein involved in colicin uptake"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99685"
FT                   /db_xref="GOA:D6ZXN9"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXN9"
FT                   /protein_id="ADG99685.1"
FT                   /translation="MTKPSEEVETMDDATPEESKPKGIRPANLTAVIVAAVVVALAGIG
FT                   GGYAYWTHHEGNAYHEAVAQAENADKALMKAVDEATATTYKADQLKEPKLLDKLNEQVK
FT                   KAESLKGIPDDNPSEWLAWRLASAKKANATDADEANAQAKALNAALKAVKDSRLAKELD
FT                   TAKDQLKQGIDGAGQTLKDTDGKVADNATRDSLAKAIDEANNALSKKGVTDPKTYTDAK
FT                   AKLDEAVRQVTDSKAAKEQADAEAAAQAQAQAQAAAQAQAAAQAAAQPQRSYSQSYNRY
FT                   GGSGSGYSSNRGYSAPQQSYTPSSNGGGSSYSGPTITGGGISNNDNGNGQPIGSEGLL"
FT   gene            256916..258355
FT                   /locus_tag="BLJ_0196"
FT   CDS_pept        256916..258355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0196"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99686"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXP0"
FT                   /protein_id="ADG99686.1"
FT                   /translation="MQLKKHNSKTPPKRKPKWLRKGIALLAAIATLATGGVVASTAYAE
FT                   GDTGGGGNAGGGPVGGGGSFNLQWNYGDRGKGFGPSSDWNSTKAAITNGANGFRGLGWS
FT                   VEANGDAWIKEATQEADTNCEARVQKVYPGAPKSCRVVGVGIIGSASKQYGYPGGASHS
FT                   IWMNYWDSAIAGANHSNSYDNGAGYNYRTNTPFPNDPSLTIDKIADTYAPDWVNGVSTG
FT                   TIVVIALSRYEPAGEPPFTPTISTEAPHIIQEGQPITDRVTVGVKSGDHWIDGTSVTAK
FT                   GYYFTGSKDAIIRNLPYTGDPTDAGINNYLNQIRSAGGEYPWVAGMGVRCGLNRAALRP
FT                   VGARWRQNDSRVRRKRERRPAGRVRDRGEGEPLERCFTPLPIAGRTWACTRAGRLCSLF
FT                   PFRGPGGSSSFPFSVASRSGSAVSGLPRLGGLSRRQAGSPYPRLRSQPFFHTRRGWLRG
FT                   CPSAVPAGTGYPSAGFVPPCF"
FT   gene            complement(259167..259254)
FT                   /locus_tag="BLJ_0197"
FT   tRNA            complement(259167..259254)
FT                   /locus_tag="BLJ_0197"
FT                   /product="tRNA-Ser"
FT   gene            259556..261199
FT                   /locus_tag="BLJ_0198"
FT   CDS_pept        259556..261199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0198"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99687"
FT                   /db_xref="GOA:D6ZXP1"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXP1"
FT                   /protein_id="ADG99687.1"
FT                   /translation="MNEGTAADVTAAHGGRSRQSKKHSKTYRSISAILSWLTARRPTTL
FT                   STSLRARFLPYLLTLAIAWLPWLILTWPGSMRDDTLAQYLQSSGLHHYYTQHPLFDTLT
FT                   FGLFWHIGSALGSPLIGQALYTVTQAVLLAAGCALLLCYIRKIGSPRWLIGLGLVYLAT
FT                   NYVVVGAITTMGKDSLHAVFYLPLAVLFVEACLTRGSVLARRPVAFAFVILLFATIVSK
FT                   RTALIIVLCAGCCLLAVCTPKGARRRAFACLAVAIVVAQGVWTPLSAAATHANRSPGRE
FT                   VWGLVTQPVARLAHDDPSAIDKVQRRRLNAIMDLDWAAAGINPHRTDETFRTLREHPRP
FT                   TAAQQLAALQVWAQLGLAHPTEYATAYAGVTRGWWDPRVNFAYPTDSDYLFTPSYLRQW
FT                   ASFLTEGAWKHTSDGDADTVAAERLAAIEHDLAPLRGTSDKPQWQKNILRAIHRWARSD
FT                   GHVGVRKGNPLTSMALYVTWIPLAAGLALVVRPARRRYGPALAAYGLLAFTVLSLYASP
FT                   VALFWYPIPVFLTLPLFVVLPFTFRESHPL"
FT   gene            261370..263298
FT                   /locus_tag="BLJ_0199"
FT   CDS_pept        261370..263298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0199"
FT                   /product="iron permease FTR1"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99688"
FT                   /db_xref="GOA:D6ZXP2"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXP2"
FT                   /protein_id="ADG99688.1"
FT                   /translation="MVRRACAQSAEMNTIRERDTRVAVSRVRAKSGSTGRLQSATVSAR
FT                   AFAAIVFLFAMIAATFLPSAIIPQSAFAVTPATTATAATVKSDDTTSVDYATWADVAKA
FT                   VEAQLQEGLKEYKDGNPMGAKSDFGAAYTTVYVTSNFNKVVSDTIGADKQTAQQQAFQD
FT                   LQSQVFTSDQADQLTQKVNDLTADLDATAQQLDADTSLANPKQYSEDLQKQIAKERKEL
FT                   DAKKKRTEETAKTWKEVADAMLPILDNAYKAYEGGDAAKGATLVNDAYYQHYEKLGFEK
FT                   TVLSAISGNRVSQVEYQFKLCRSSMNTGKPASEVKKYVDDLKNMLATDAAKLDGGAADE
FT                   EGGFLKFITSSVGQAFLILIREGLEALLVVAAVVAYLVKSGNKRFTKWIYVGVLAGLAG
FT                   AGIVAVIFMLAFGGSGPLQEIMEGVCALVAMCMLLWTSNWMLNKSSVEAWNRYIREKTE
FT                   AAVASVSSQVESGEKVASRTVISLAMLSFLAVFREGAETVIFYQSIYTMSQDTHGMVVG
FT                   ALAAAVVLVIIFLVIRFTSVKIPIGPFFLVTSILMSVLVVVFAGGGVHALIEGDLLPAN
FT                   YLPGVPTNDWLGFYPYAECIIAQVLAAIAVIALFVVGFAKQRKAKARLAAGASKSDAKA
FT                   DEESAQA"
FT   gene            263435..264130
FT                   /locus_tag="BLJ_0200"
FT   CDS_pept        263435..264130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0200"
FT                   /product="conserved hypothetical protein"
FT                   /note="narrowly conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99689"
FT                   /db_xref="InterPro:IPR018470"
FT                   /db_xref="InterPro:IPR038482"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXP3"
FT                   /protein_id="ADG99689.1"
FT                   /translation="MMKNKKLAALLGVLLAGSMAVSMAACGSTNNASDTKSSTSSSDTA
FT                   KKDDSKKADAPTETSGFEEVPVGPSGTAKEQDKAAGPLTVGAVYFQPIDMYPASMGLKA
FT                   ADASFHLEADIHASQEGTDYGYGKGDFVPDLTVNYTIIDKSTGKEVEGGQATSGTFMQM
FT                   NASDGPHYGANVKLDKAGTYQLKLSIESPEKNGWMLHVDPETGVKNHKFWTEPIEVTFD
FT                   NWDYTPRQW"
FT   gene            264281..265549
FT                   /locus_tag="BLJ_0201"
FT   CDS_pept        264281..265549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0201"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="narrowly conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99690"
FT                   /db_xref="GOA:D6ZXP4"
FT                   /db_xref="InterPro:IPR018758"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXP4"
FT                   /protein_id="ADG99690.1"
FT                   /translation="MLEQFVAVMPGTLAPALLVMSLSVMLTVGEGRDKPISSHWRLIGL
FT                   TVGLIAAITFAGLRASAVINQRTFVNYPVLWCAIIADILTIVVVVFARRITTNWQQHKV
FT                   FMHIANAVAAIDIALTLFYALPDVILQLTIWVEPGDPIFTSDMLLRALGFALGLAMSII
FT                   VAAIFRTMRSTAVRASFTAAVLAVLAILFVRHLTGVMQILQARGFPIGHTGFVALAWSI
FT                   NHNDWMIMAQAFVFLIPAVASVVAGFRMPLTGANEAIGRKHKAFRRRAVASAVWSLVAM
FT                   IGVTLTLTVGVAATHQTITLSPPEAYSLKDSVATIPFSQVEDGHLHRFEYKAKDGTVMR
FT                   FIIIRKNGGAYGIGLDACENCGDAGYYEKDGKIICKKCEVAINLATIGFKGGCNPIPFP
FT                   YKTGHGKITIQTTDLDALSAHFQ"
FT   gene            265571..266875
FT                   /locus_tag="BLJ_0202"
FT   CDS_pept        265571..266875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0202"
FT                   /product="protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99691"
FT                   /db_xref="GOA:D6ZXP5"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXP5"
FT                   /protein_id="ADG99691.1"
FT                   /translation="MFFLRMITRSFTRQLRRRLLIALTVCLSATVSVSMLGVVFDVGDK
FT                   LNAELSTYGSNITVQPKADAVVSDLYNTESGGAASTSDPTAFLKESDAAKIKTIFWSFN
FT                   ITNFAPQLNIHATVNGANVPVVGTWFNKDLKISTGETTVVGVEGMRSWWQLDGKWPKDD
FT                   SDQGVIGKTLASELGVTTGDTITLNKTTASGKKNEQKIKLTGVYDSGDEDNGSLYIASS
FT                   TAQVLADLPDSVDKIEVKALTTPENDLARKAAANPAALSQEEWETWYCTAYPSSIAYQI
FT                   EEVIPGAVAKQVRQVAALQGNVLQKTQAVMILMTVLSLIAAAVAVANLMVASIGERSGE
FT                   LALLKALGATDAAVSRLMLAETAAISLLGAIVGALLGSGVAQLIGRVVFGSGITMRPMV
FT                   FVLVFVLLAVTVLLASASSIRSILNLKPAEVLHGR"
FT   gene            266909..268132
FT                   /locus_tag="BLJ_0203"
FT   CDS_pept        266909..268132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0203"
FT                   /product="protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99692"
FT                   /db_xref="GOA:D6ZXP6"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXP6"
FT                   /protein_id="ADG99692.1"
FT                   /translation="MTNTGMFFRMLFSAVFRRRSRAVMAVVASLVGAATLFCLAMICLA
FT                   VPQQMNEEMRAYGANLIVTPTESTNADGKAGIDKAMVQHTTEMVKAKGSAKYATYRYEN
FT                   VRVNASPYVMAGVNAAQVKNLNHHWVVDGSWPTDGKVLVGRDIADAIGLRIGSAITIGY
FT                   RASDNASTNGTSSNSSIDQQTKDGRVSSDIMDTSGTEFRVAGIVDTGGSEDSIIYATNA
FT                   DVNKLTGITRGVDVIEYSAGASDLAGLVSSINDMTSMHVKAQQVTKITASDTRIITMLQ
FT                   TLFWIVSLVVLVLTLVGVGTTISSIVSQRRNEIGLRKALGASSRAIGTEFYIESSLYGL
FT                   IGGLIGTAIGYGLASWLCVAVFERSIGFNWWLALISVLFSALVAIVASIPPVHRATRID
FT                   PAVVLREE"
FT   gene            268148..268945
FT                   /locus_tag="BLJ_0204"
FT   CDS_pept        268148..268945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0204"
FT                   /product="ATP binding protein of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99693"
FT                   /db_xref="GOA:D6ZXP7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXP7"
FT                   /protein_id="ADG99693.1"
FT                   /translation="MLLELDHISKIYGDLHAVDDLNLTVPEGEWLAIVGSSGSGKTTLM
FT                   NMIGCMDTPSKGSVKLEGRKLEDLNATQLADVRKNLIGLVFQKFYLVPHLTAVENVMVA
FT                   QYYHSVVDEKQAMEALEKVGLKDRAHHLPGQLSGGEQQRVCVARALINDPKLILADEPT
FT                   GNLDEKNEKIVLDLFRKLHEQGTTIIVVTHDALVASCAQREIMLNHGVLVGEKWNDEDA
FT                   RKAYEAAGGKPASTGAQVEGAQNGETAIGFADPTKAAKTGGEE"
FT   gene            268993..269622
FT                   /locus_tag="BLJ_0205"
FT   CDS_pept        268993..269622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99694"
FT                   /db_xref="GOA:D6ZXP8"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXP8"
FT                   /protein_id="ADG99694.1"
FT                   /translation="MVSPPVSFADSPLVRGGLRSVNMTEKNTLKKSATLAAAGLVVAGA
FT                   LLAGCGESKATPMDDAYAGNSGETEKSQEEQSQSQSNGSDSSDGSDSGSSHNDPSTTTS
FT                   DKKDTGNYKDGNYSINGQYGPVGEDSIDVHLTIKDGNVETVKIIGHPFTTISKNHQDDF
FT                   AKAINGVVDGKPLKGLKVDKVAGASWTSDAFNKALEVARQEASIQE"
FT   gene            complement(269628..270227)
FT                   /locus_tag="BLJ_0206"
FT   CDS_pept        complement(269628..270227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0206"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99695"
FT                   /db_xref="GOA:D6ZXP9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXP9"
FT                   /protein_id="ADG99695.1"
FT                   /translation="MTEMTGTTATPRGERTREATDRKLMRATLQIAVDRGISGVTIEEV
FT                   ARRSGVAKTTIYRRYHNADELLREISAIYLAIPDSDPVPSPTREHFTQLLQRLVDWVRD
FT                   NDIDVKRVGIVLSSEAEFFQHIVDQVVTPWLEHVGAFLKQGVAQGVFREDVDEKLLLST
FT                   IIGSLVAYEAIEGKAMDDDTAWASRMADLLWPALLK"
FT   gene            complement(270342..272504)
FT                   /locus_tag="BLJ_0207"
FT   CDS_pept        complement(270342..272504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0207"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99696"
FT                   /db_xref="GOA:D6ZXQ0"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXQ0"
FT                   /protein_id="ADG99696.1"
FT                   /translation="MNTMWKLFTGDIKRLTSNVVSIIIVIGLVMIPGLFTWFNVAACWD
FT                   PFSNMKNLKFAVANVDEGYRSDLIPMKVTVGDQVVNALRANSQLDWTITSKADAVEGAR
FT                   SGKYYAAIVIPKSFSKDMMTFFSDDVQHAELTYYRNEKKNALAPNLLNEGTDEVAAEIN
FT                   TTFAKTITSAGLEIASSLADQLSKPEAKEQLNTFNANIADFATRLDDTADLLGTYSALT
FT                   DTAGALLDTSNSLITQVSSAAKQGGKDLASAKQGVTDVVGALGTTADAMSSALDASASS
FT                   FGAVSDSIDKLYSDANDGATTAADELDRQATAIGKQTEKYTEIRNTLAGILGNDSSIIT
FT                   AIDRSIARQNRLRQALNTAATDIRQGNQDAQDQHAQVKDLADQAQNSIANIKSDFTATV
FT                   KPQINSLSSTVSDASGILSSGATQLDSTLGDLKRTSDDASDMLSDARTTLDKVSGKLRS
FT                   AGAELASFNSTLSDALNSGDMSMVKEVLGNDPETLASTLAAPVQLRRKAVFPVANFGSS
FT                   MAPFYTLLPLWVGALLMVVTLKTTVSRRTRKALGDPRPHRLFLGHYGVFALIALLQSTV
FT                   SLGGDLLFLRVQAVHPLLFMLSGWLASLVFSFFTYTMVVSFGNVGKAIGVLMLIVQISG
FT                   ANAAYPVQMLPDFIAKVSPFLPLTHAVTMMRAAIAGIYDMDYWRAAGMLLAFVPPLLLL
FT                   GLLLRKPLVRFNQWYVAKVESTKVLG"
FT   gene            complement(272501..275131)
FT                   /locus_tag="BLJ_0208"
FT   CDS_pept        complement(272501..275131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0208"
FT                   /product="ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99697"
FT                   /db_xref="GOA:D6ZXQ1"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXQ1"
FT                   /protein_id="ADG99697.1"
FT                   /translation="MGNIFKVLKRDFLRLFKVPAAWVILFGMVFIPPLYSWYNIVGFWD
FT                   PYGNTKGITVAIANNDDGTDNALIGKQNLGDQIVKQLKSNDQLGWTFVTEAEAMDQVES
FT                   GKAYAAIIIPKDFSDDLAGVVTGGKSRPTLEYYVNEKASAIAPKVTDVGAFTVDRTVNS
FT                   TFVSTVSKVLTEVINTVGDKAISTEDTTKAKALTALAEASGDVQHTRSTIAKLTTKLTD
FT                   TPEQTRTARQALDDARALGIDTAEGLAGVSTLIGTTQTNLNGFVTSTSEALDQGSSLLS
FT                   QAAAQANQSVGTVAGTISAANQQVGGLINTAEDINQANADIIDQLKGLPNADREPLQSA
FT                   IATLESRNSELAGALGNLDSLNTTIGNASTDTAGLAQHLNTATQTTVREANTARGTIIS
FT                   GTIPQLNTGLNTLSSTANTLSTGITSQGSLIDQSKHTLDQLDKAASTTVTALHDTDKAL
FT                   AGVQTKLDTLTTDIKALSISSSLSSLIGTDGKLDAATIADFMLSPTVISERAVYPVASY
FT                   GSGMAPLFTTLSLWVGAFVLVVIPKLETDDEGIDDLTPTQGYLGRFLLLATLAAVQGLV
FT                   AAIGDLVIGIQCASAPVFLLTCVITSLVYMSVIFALSTTFMHVGKGVCVALVILQVPGA
FT                   SGLYPIEMMPAFFRAIYPLLPFTYSIDAMRETIGGFYDGHWFAYIGKLLIFAVLAFVLG
FT                   LGARPKLANLNRLFAREIKESDMIIGEPVHLPGSEYRVTQAIAALADRDEYRHAIERRA
FT                   AKFAYQYPRLLLGALIAGFVVPAALIIVFALTTSEKIVVMGTWLAWVLIIMGFLMVVEF
FT                   MRDSIRRQTELGNLSDESIRAMLYGHKAKRRDTSAERHEEADPSAAVTAIIPTIPPTKE
FT                   GRHAR"
FT   gene            275875..277161
FT                   /locus_tag="BLJ_0209"
FT   CDS_pept        275875..277161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0209"
FT                   /product="protein of unknown function DUF1113"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99698"
FT                   /db_xref="GOA:D6ZXQ2"
FT                   /db_xref="InterPro:IPR010540"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXQ2"
FT                   /protein_id="ADG99698.1"
FT                   /translation="MVEFKDDGTATTPGKPRENRDAESAVVADLVAVELDDAGLNLNAK
FT                   RLPILARIYGAVVLLDGLATLPIMVISILYAVREILDGHVHVDAMSLTFILSAIHAVVL
FT                   VVSAACLIVFGVMLLRNHRRYAARWTYVLMPLTLADGMLSLALTGLGFNLLLPLIQMII
FT                   LVVISVTADPSLSEERRLQRALKRMDDRDDYESAVAAGMLGRDQSGKGYIALDFFNIFW
FT                   LFTIASVGGLIMETIYHMALYNGELQDRAGLLWGPFSPIYGCGAVLVTVCLNRLWKANP
FT                   FLIFCASAVIGGAFEYCTSWFMEVAFGITAWDYTGRWLSIDGRTSGLFMFFWGLIGVVW
FT                   VKWLLPRLLALINCIPWKVRYSLTAVCTVLMVIDIAFTLMALDCWYGRMAGQPQDSPVA
FT                   MWFSERYSDAYMANRFQTMHIDPSKAGRM"
FT   gene            277340..278794
FT                   /locus_tag="BLJ_0210"
FT   CDS_pept        277340..278794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0210"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99699"
FT                   /db_xref="GOA:D6ZXQ3"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXQ3"
FT                   /protein_id="ADG99699.1"
FT                   /translation="MAEATANIGVIGLATMGSNLARNLAHHGNTVALFNRHYSRTEKLM
FT                   NEHGAEGNFVPAETLEEFAASLKRPRTAIIMVKAGAPTDATIAQLEEVFEPGDIIVDGG
FT                   NSFFKDTIKREKEVRAKGFHFVGCGVSGGEEGALNGPSLMPGGTAESWKTLGPILQSIA
FT                   AKVNGEPCVTHIGTDGAGHFVKMVHNGIEYADMQVIGEAYDILRRGLGMDTEEIGDVFA
FT                   EWNKGDLDSYLIEITAEILHHKDAETGKPFVDVVVDHAGMKGTGTWTVQAGLEFGSPVA
FT                   AIGEAVFTRALSSHGELREDAQKEGLAGPNKTIDLAGEDKAAFVEDVRKALFASKVVAY
FT                   AQGLNEIQDGAKEYGWDINLSEVARIWRGGCIIRAQFLLDRITEAFKGDNLPASLLFDP
FT                   YFEKIIGESQDAWRRVIVRAVEAGIPTPVFSSSLAYYDGLRSKRLPTALTQSQRDFFGA
FT                   HTYGRVDKPGVFHTLWAEEGKPEIEA"
FT   gene            complement(278996..279796)
FT                   /locus_tag="BLJ_0211"
FT   CDS_pept        complement(278996..279796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0211"
FT                   /product="6-phosphogluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99700"
FT                   /db_xref="GOA:D6ZXQ4"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR039104"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXQ4"
FT                   /protein_id="ADG99700.1"
FT                   /translation="MIQAGAQRFVLALLDLLAERLPDGTHRTRVDVALSGGSAAQPLGL
FT                   ALNDPLADAVDWSRVHFWWSDERFVPAYDTDRNALEARRLLLDQLVADGKLPESNIHEM
FT                   AADTRSADDIADVMDQADSDDASVRAAADAANDALLDDAASDYERELVNELGPEPVIDL
FT                   MILGMGPDGHYASLFPGHDEVKVTDRLAVGVNHSPKMPPLRVSLTAPLIARSRRTWFFA
FT                   AGAGKAESLAHVFERPNNPDYPSSYANGVDEFTWFSTEETVTEL"
FT   gene            complement(280132..281157)
FT                   /locus_tag="BLJ_0212"
FT   CDS_pept        complement(280132..281157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0212"
FT                   /product="conserved hypothetical protein"
FT                   /note="narrowly conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99701"
FT                   /db_xref="InterPro:IPR004555"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXQ5"
FT                   /protein_id="ADG99701.1"
FT                   /translation="MIIDMPNTRTREIAHKIEQLHEERGESATGRVLTLLIATEDADLE
FT                   HALEIANSASREHPCRVIAVVPDTNPADQSGEGEPNETEVAAGVSANRDNPAVDLTDGP
FT                   NDPNDSNLNAQVRFGADAGAGEIIILRPRGGLINHPDTLVIPLLVPDAPVVAWWPTTPP
FT                   SNPAKDLMGAMARSRITDALHSNNPEATIERLRRNWTPEDIDLSWTRLTVWRAMLASML
FT                   DQPPHLPITAVKVTGKADFLPLEMLCAWLRLKLGVPVETEFVPDAQAVTGVYLTREDGV
FT                   ISLERPYEDQALISLPGQTPQEVSVPMRTIEDCLTEELRRIDPDEIYAEVINEGWDLIR
FT                   H"
FT   gene            complement(281154..282692)
FT                   /locus_tag="BLJ_0213"
FT   CDS_pept        complement(281154..282692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0213"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99702"
FT                   /db_xref="GOA:D6ZXQ6"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXQ6"
FT                   /protein_id="ADG99702.1"
FT                   /translation="MSESPNWSNPLRDSRDLRLPRIAGPCSLVIFGVTGDLAQKKLLPA
FT                   VYDLANRGLLPPSFGLTGFARRDWTQERFIEFVKAAVRAHCRTPFKESTWRNLAAGIRF
FT                   VQGTFDDPEAFERLSATVQELDRDRGTQGNHAFYMSVPPRAFPQVAKQLAASGLSRSSE
FT                   GAWRRVIIEKPFGHDLASAKELDSVVSEVFDPSSVFRIDHYLGKETVQNLLALRFANAM
FT                   YEPIWNANYVDHVQITMAEDIGIGGRAGYYDGIGAARDVIQNHLLQLMALTAMEEPVSF
FT                   TAKDLTAEKTKVLSAVRLPKDLAANTARGQYAKGWQGSHEVVGYLEEKGIDPKSTTETY
FT                   AAIRLDIDTRRWAGVPFYLRCGKRLGKRVTEIAVAFKRAPHLPFEQTAVRELGKNAIVI
FT                   RVQPDEGVTMRFGAKVPGGSTMEVRDVNMDFSYGRSFTENSPEAYERLILDVLLGDPPL
FT                   FPTTEEVNLSWEILDPIEQFWSTLGQPQAYRAGTWGPAQADEMLARDGRHWRMP"
FT   gene            282868..282943
FT                   /locus_tag="BLJ_0215"
FT   tRNA            282868..282943
FT                   /locus_tag="BLJ_0215"
FT                   /product="tRNA-Lys"
FT   gene            283015..284649
FT                   /locus_tag="BLJ_0214"
FT   CDS_pept        283015..284649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0214"
FT                   /product="peptidase U34, dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99703"
FT                   /db_xref="GOA:D6ZXQ7"
FT                   /db_xref="InterPro:IPR005322"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXQ7"
FT                   /protein_id="ADG99703.1"
FT                   /translation="MSCTTILVGKNASYDGSTIIARDDDSGSGRYDPKRFVAVAPDDQP
FT                   RHYRSVLSHVEIELPDNPCRYTIAPNVLNNRGILAEAGANEHNVAMSATETIAVNERVL
FT                   GADPMVELRPAVGGPDSTDYQAEQPGGIGEEDIITLVLPYVTTAREGVARLGELLETYG
FT                   TYESNGVIISDADEIWYVETIGGHHWIARRVPDDCYATIPNQLGIDDFDLADAFGEQRE
FT                   YLCSADLREFMATHHLDRTMGTSVSSNGRHVHSAGFGTTVALPTRFNPRKAFGTATPKD
FT                   HIYNTPRAWYMQRRLNPSEDWDSPAARYTPESDDIPWCRVPEDKVSLEDVDFLLSSHFE
FT                   GTPYDPYGTTGTAESRHRYRPIGVNRTGHMVAIQVRPYVPAANRTVMWVSFGSGPFTAA
FT                   APFYANVNDTPAYLRDTTPEVSTGNLYWTNRLIAVVADAHWYETNRFIEGYAEGVRAFG
FT                   HRLIERTDEQLLARSDAESTGTNAWPLDGGHGDEKDVQGVADVLEAANDEMADYLREHT
FT                   TKLLNDVLYTSSNLMHNSFAMSDRWAE"
FT   gene            complement(284723..285757)
FT                   /locus_tag="BLJ_0216"
FT   CDS_pept        complement(284723..285757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0216"
FT                   /product="glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99704"
FT                   /db_xref="GOA:D6ZXQ8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXQ8"
FT                   /protein_id="ADG99704.1"
FT                   /translation="MASTAKTLTFVIPAYNMESYLDRCVNSLLSASDTSDLEVLIVDDG
FT                   SKDGTLEYARKLERTNPGVVRAIHQENKGHGGAVNTGITAATGMYVKVVDADDWVDPQA
FT                   IDTVLATLRAQREASEPIDMLVTNYVYDKVTKRHKIVVNFRHVMEAGRVLGWDDLGKFG
FT                   LAQYIIMHALTFRTQVVRDSGLKLPEHTFYVDFYYSYQPFPWVKRIQYLDVPFYHYFIG
FT                   REGQSVQTDVMIKRVDQLRLVNRLMTEATPERGTVPEGLYRYMIHFLTIESCVTSAFLI
FT                   LSRDPANYVKKTELWDAIDAYSPAIGKDVRSKLMSRALNLPGKTGRWIVRNGYLIAERI
FT                   VGFN"
FT   gene            complement(285781..286701)
FT                   /locus_tag="BLJ_0217"
FT   CDS_pept        complement(285781..286701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0217"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99705"
FT                   /db_xref="GOA:D6ZXQ9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXQ9"
FT                   /protein_id="ADG99705.1"
FT                   /translation="MSDSPESDDTWGRTVRELSTGREKLDSMANTSRMTSYQRREQLIE
FT                   IGRSLFASKGFEAVSVEEIAATAKVSKPIVYEHFGGKEGLYAVIVDREMRALTSVLTAA
FT                   LDDPTVHPRQIVERTALALLTYIEEDAEGFQVLARDSPSTEPSGSFSSLLGDIAVRVED
FT                   ILSETFKRQKLSTKGVPYYAQMLVGMTVFTGQYWADRPKVSKEQLAAYIVDLAWHGLSR
FT                   LDSKPQLLFEGVKARKEAERRAKRESDSGGPDSDQTSSAQSDSDRAPGEDSGLQNTSSG
FT                   AQVAQHSAESGDEVLRFEQETEHND"
FT   gene            286777..287070
FT                   /locus_tag="BLJ_0218"
FT   CDS_pept        286777..287070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99706"
FT                   /db_xref="InterPro:IPR018658"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXR0"
FT                   /protein_id="ADG99706.1"
FT                   /translation="MDRLPEWLASLTEEDLAFIKNFVLSSGSLKQMSQLYQVSYPTMRI
FT                   RLDRLIEKIRLNDNDTEDPFILLVKSLAIDDRYDVDTARILIDEYRKRKDES"
FT   gene            287385..288647
FT                   /locus_tag="BLJ_0219"
FT   CDS_pept        287385..288647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0219"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99707"
FT                   /db_xref="GOA:D6ZXR1"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXR1"
FT                   /protein_id="ADG99707.1"
FT                   /translation="MDTNVIIAIVAVAVIAAILVIGGWWFGKGRKAAVAKSTEAAKAKA
FT                   DARLAAEAESTASDSSTVKPSVDSNVDAAEKAPAESQQKSSAQASSSETAAPAPATEAK
FT                   PEPVHDTPESAGTRMQRLKARLSKSGNPFGKALFNILAKDQLSEADWEDVEDTLLLADV
FT                   GAEASEQLVEELRNDARIAGQSDPAEVRAALKDKLLKLVGTDIDRRLNADKDGANKPSV
FT                   VIMVGVNGTGKTTTAGKLSRLLVSEGKQVMLGAADTFRAAAADQLETWGAKVGVPVVRS
FT                   DKDGADPASVAFEASAKAKEANADVLIIDTAGRLQNKSNLMDELGKIRRVTEKNLPVDE
FT                   VLLVLDATTGQNGMAQAKVFAEAIGITGVVLSKLDGSAKGGIVISVQKELGVPVKLVGL
FT                   GEGPDDLAPFDPEGFVDGILA"
FT   gene            288987..290282
FT                   /locus_tag="BLJ_0220"
FT   CDS_pept        288987..290282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0220"
FT                   /product="ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99708"
FT                   /db_xref="GOA:D6ZXR2"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXR2"
FT                   /protein_id="ADG99708.1"
FT                   /translation="MGAIDSGNTAWILTSASLVFLMTPGVAFFYGGMVRAKAVLNMLML
FT                   EAAALSVTMIIWTLWGWSIAYAGSDIGGIFGDPASGFLLKDSMVAQDGVFTATGLNGNN
FT                   YPVSVDVAFQVAFAMITVGLICGAIAERVKYSTWMIFVALWVTFDYAPMAHMVWNGGLL
FT                   SADGAISKAIGAAAHDFAGGTVVHINAAVAALIIVLIIGKRKGFGTQPFRPHNVPFVML
FT                   GAFLLWFGWFGFNAGSAFAANGTAGYAWVSTSAATAAAMLSWGFTEKIRSGHYTAMGAA
FT                   SGMVAGLVAITPAADVVSPLWAIVMGAIAGVLTCLACGLKFKFGYDDSLDVVGVHGVGG
FT                   FTGTVLVGFFGEGTGLLAGGDWKQLVVQLVIALVAILYSAVITAIIAFALEKTIGWRVT
FT                   EAQEVGGIDLADQGERAYDFAGTASSVLKEVR"
FT   gene            290284..290622
FT                   /locus_tag="BLJ_0221"
FT   CDS_pept        290284..290622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0221"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99709"
FT                   /db_xref="GOA:D6ZXR3"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXR3"
FT                   /protein_id="ADG99709.1"
FT                   /translation="MKLITAIIQPHKLDDVKEALAAAGVHGLTVSEANGYGRQRGHTEV
FT                   YRGAEYTVDLIPKIRVEVLSDDADAETLVGVIIKSAGTGTIGDGKVWVAPLDSVARVRT
FT                   GETGSAAI"
FT   gene            290730..292556
FT                   /locus_tag="BLJ_0222"
FT   CDS_pept        290730..292556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0222"
FT                   /product="(Protein-PII) uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99710"
FT                   /db_xref="GOA:D6ZXR4"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXR4"
FT                   /protein_id="ADG99710.1"
FT                   /translation="MTSAVDGLKQRFMDMSQPDDDGVYRNGATKRKARTELAMQCLTEL
FT                   WNAACKDVSFPVPDSGIGFAAVGSLARGQLGPSSDLDLVIIYEPRTLNDQQLNELANKL
FT                   WYPLWDSGLDLDHSIRTRAQCEEVTDHDLPAAMGWLDVKPIAGDTALITTTATSILERW
FT                   RKAARKRLPELLDSAKARLDEFGRLQYVNQPDIKETRGGLRDSVLVSALAVSWLADRPH
FT                   GIYDEAVERLLDVRDCIHLVAGKDTNLMLTPYQAKVAAMLGLADPTWPENERAAYSIDD
FT                   LQTLLARIGRRISFSLDSTASRAGHSLTHEKPRFAFFQMFSQRSGGKREAPQFDVVAPG
FT                   VAKHEGELVLAPGAEPAKDAKLALRMAVAAGEFGLPINPSTLVNLRHCPIHDNQWDDES
FT                   RELFIRLLACGPNLMEVWESIDFVDIPGRWMPEWLGVRNRPSASAAHRYTIDRHMVEVT
FT                   SRLGRETPFGGRYDDDHFKALLLAGITHDIGKRAFVADHAAEGARHVPVILKRMGYAPD
FT                   IVDWATVLVREHLTLSEFATGKDPYDPAVAEELADRLHHDKMLLDMLFDLTRADGSSLG
FT                   ATAGETITKQYGWSKWREQIVRGMYSAARAAM"
FT   gene            complement(292590..294185)
FT                   /locus_tag="BLJ_0223"
FT   CDS_pept        complement(292590..294185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0223"
FT                   /product="MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99711"
FT                   /db_xref="GOA:D6ZXR5"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXR5"
FT                   /protein_id="ADG99711.1"
FT                   /translation="MDRKISYPHFGDNSGDNPLSYPHTGDNLVDSLGITFRAHNRCLRN
FT                   AVRRDMRVSVPIDSSDAKATSSGDTTRRDGFGTPHAGANTNTSNGPADARSTNRRIMAL
FT                   ALPTFGQLIAEPTFILIDTAIVGHIGDAALAGLSIGSTIILTAVGLCIFLAYSTTAQVA
FT                   HLLGAGRRREGLQAGIDGLWLALSIGTVLGLGLFAAAEPLCRALGGQGEVLEQAVTYTR
FT                   AIVLGAPGMLMVYAANGIFRGLQKVRITLIAAVGGAVVNTALDVLFVIVLNWGIAGSGV
FT                   ATLIAQWFMGLFLVIPAILWSRADGASLRPRLAGIAAAGGGGLPLFIRTLAIRAAMVAT
FT                   VACAARMGTAVLAGFQAVNSSWNFAMNMLDSVGIAGQTLVATTLGAGSVQQARRLTRAT
FT                   GRAGLVTGAVIGTAFAVVGLFAGHFFSPTPNIQTLIAVGMVTMGIFFPLQGWMMAIDGI
FT                   LIGARDYRYLAGTCTLTAVVYVTLILILANMVTPALTSDLMRTAVLWAAFNVVLMGGRG
FT                   LSNGLRVRSDAWMK"
FT   gene            294241..295770
FT                   /locus_tag="BLJ_0224"
FT   CDS_pept        294241..295770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0224"
FT                   /product="replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99712"
FT                   /db_xref="GOA:D6ZXR6"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXR6"
FT                   /protein_id="ADG99712.1"
FT                   /translation="MRATVSFPYDIVHLPRHILYLEAMPEGSEHSYQNGFGGGLDRGDR
FT                   GDRAGRGGTQTSAAAGDPIFDRVPPHDDDAEMAVLGGMLMSKDAIGEVSQTIDVTDFYQ
FT                   PKHQTIYNAIIDLFSASQPVDVVLVANQLLADGNLDKVGGADYLHSLVASVPTAANAMY
FT                   YAEIVHQRAILRNVIAAGTKIAQLGYSAEGSQAEDVVNLAQSEIYEMSMGKVRQDYAAI
FT                   GPVVHDALDQLDKLQQGLVNKGVPTGFRDIDDVTQGLQPGQMVVVAGRPAMGKSTLGID
FT                   FARAAALHHNMTSVVFSLEMSKVELAQRIISAETNIPMAALRRADDITPERWNTLNQFW
FT                   TKMQNAPLFIDDSPNMSLMEIRAKCRRLKQTNDLKLVVIDYLQLMTSGKAVESRQQEVS
FT                   EFSRALKLLAKELEVPVVALSQLNRGPEMRNDKKPQLSDLRESGSIEQDADVVFLVHRP
FT                   DFYDKEDRPGEADIIMAKHRNGPTETFHLAFLGATSKFKDMPQDYNANQGV"
FT   gene            295773..297242
FT                   /locus_tag="BLJ_0225"
FT   CDS_pept        295773..297242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0225"
FT                   /product="domain of unknown function DUF1727"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99713"
FT                   /db_xref="GOA:D6ZXR7"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR013564"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXR7"
FT                   /protein_id="ADG99713.1"
FT                   /translation="MASNVSRDVSQDQSSVVQTCKPWYAFATVAAGRFVRFASRVTKHG
FT                   GSALPGKVVEKIDPGFLTRTLGQLPLGVVLVSGTNGKTTTTRMVASMLSDLGLKVFTNP
FT                   TGSNFVRGVVSALLTEVTLGGKLDADIAVLELDEAYAVHFVKQVKPRYALLLNVMRDQL
FT                   DRFGEIDTTAKLLSHVAAATTGTVVLNREDPRIAALAAKAPAGTTVRYFGLADDLRRYF
FT                   PSDDDMATTVSVEGVAGPLPSARTPLSPRSELRGASAGTAELPADVTLTAVGDHKTTFQ
FT                   MDGQGYATDVKLEGVYNLYNAAAALAVVRAVMQDNAAASKATAAANACAVSADELIAAV
FT                   SRVTPAFGRGEVIDVNGSPVELLLVKNPMGFRLSLASFDPANADTMIAINDEYADGRDM
FT                   SWLWDVDFTSLRASGVAMVSGVRAWDMALRLGYDQVPVADTNTDLEQAVTAFVNANPGT
FT                   RKHIYCTYTAMLKTRAVLGRITEVRDAGVGK"
FT   gene            297347..298099
FT                   /locus_tag="BLJ_0226"
FT   CDS_pept        297347..298099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0226"
FT                   /product="CobB/CobQ domain protein glutamine
FT                   amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99714"
FT                   /db_xref="GOA:D6ZXR8"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXR8"
FT                   /protein_id="ADG99714.1"
FT                   /translation="MARTIDVVSLYPKDMNIYGDSGNVLTIRRRLELYGYEPVVHQYNQ
FT                   GDDWPDQVDLILGGGGQDTGQKKIIDDFYHRADLLRSLAADGTPMLMICGLYQLFGEYF
FT                   ETVDGTRLDGIGVIGAYTVGQNVRMIGNLVEHSDQFGDVIGYENHSGQTFLREGVQPLG
FT                   TVNQDGRGNNGEDHTEGARVHNVIGTYMHGSLLPKNPAISDFLIETAVTRRYGTFDTSD
FT                   QTPEQAKELARLDQVATNARKAAAERPR"
FT   gene            298248..298535
FT                   /locus_tag="BLJ_0227"
FT   CDS_pept        298248..298535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99715"
FT                   /db_xref="InterPro:IPR008769"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXR9"
FT                   /protein_id="ADG99715.1"
FT                   /translation="MADFDLLGDGLRKVLLAGIGALATGYEKSSELVDELVKKGEITVE
FT                   QGKALNTELKRKVSETVDDAKKAAAEAGDKAAAAADTSAADKPADEGKAE"
FT   gene            298532..300352
FT                   /locus_tag="BLJ_0228"
FT   CDS_pept        298532..300352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0228"
FT                   /product="ABC-1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99716"
FT                   /db_xref="GOA:D6ZXS0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXS0"
FT                   /protein_id="ADG99716.1"
FT                   /translation="MTKPTRATPESGSTPLSSRVDPILTPAKAEREAAANRSVDTSDTL
FT                   KQTVTKATPSVSDETLALFGRRNDFATRYHLTRRGKIKRLGQITRIVEQFDVLHGLTPV
FT                   KMRLMFEALGPTFVKVGQILSMRSEILPQSFCDELAKLRADADPMPYSTVLDVLAAEYG
FT                   RPADEVFAHIDPKPLGSASLAQVHRATLKTGEDVAIKVQRPGVRETMAQDVSIMRSIAK
FT                   AATKVIRTSQIVDLKGVVEELWDTFESETDFLIEARNLAEFKRFAARFKYMDCPTAYTE
FT                   LCTEHVVVMEYIDGISVSHPGRLVDAGYDLKEIGTKLVDNYATQILDDGFFHADPHPGN
FT                   IIIRGGQIVLIDLGMTGRLDQRTRAVLKEMIFAVAKQDSPALAEGLLRFAGTEADPEDY
FT                   PALLADLDVIVKEFGTVDLAELDIAAFLTALTQMAGRHNIEVPSTVTTVGRALVTLEGL
FT                   LDEFIPDVNMIEIISDHIATSKSLKNATKDEIKSLGVEGHQALHATLGTMTELKTVARM
FT                   LTRGQLRVNMELVGSEEPFQLLSDMVNRLTMALIVVGLFVGSSIVYYAGMKPIIFGIPV
FT                   IGFMGYVVAFALGVWIVIDIYLKGRKTKKR"
FT   gene            300417..301244
FT                   /locus_tag="BLJ_0229"
FT   CDS_pept        300417..301244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0229"
FT                   /product="alanine racemase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99717"
FT                   /db_xref="GOA:D6ZXS1"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXS1"
FT                   /protein_id="ADG99717.1"
FT                   /translation="MTAYMEHKDLTNEVIERGRANEIADGVHRVLDRIAESESVAGREA
FT                   GSVHLLAATKTRDVGEILAAIDAGVHRIGENRPQEIVVKAPGLARLLAERGYSLGVVET
FT                   EGGAAADAAHHIPFHLIGQLQANKIGKVLPAVDTIESVDSIELAEKIARRATMRGITVG
FT                   VLLEVNESGEESKSGCAPSHAIDLAQRIGAMGGLHLQGLMTIGAHVDDERTIRAGFAHL
FT                   RRTRDQILASGAEGTADCTELSMGMTHDMAYAIEEGSTIVRVGTAIFGERAFI"
FT   gene            complement(302359..302505)
FT                   /locus_tag="BLJ_0230"
FT   CDS_pept        complement(302359..302505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99718"
FT                   /db_xref="InterPro:IPR026989"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXS2"
FT                   /protein_id="ADG99718.1"
FT                   /translation="MELIVRSLAEQNGVTEQLKAENQMEWVRQMNACKAQAEEIVKAEL
FT                   IYD"
FT   gene            complement(302606..303619)
FT                   /locus_tag="BLJ_0231"
FT   CDS_pept        complement(302606..303619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0231"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99719"
FT                   /db_xref="GOA:D6ZXS3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXS3"
FT                   /protein_id="ADG99719.1"
FT                   /translation="MSAILEGTPDKRLVLVTGRAYPELAEKVAECLGTEILETTSYDFA
FT                   NGEMYVRFTEPVRGADVFVLQCHSGDINKWIMEQLIMIDALKRASAKSITVVAPFLGYS
FT                   RQDKKHRGREPITARLIFDLFHAAGADRIMTVDLHAAQEQGFFDGPVDHLTAMLVLLDY
FT                   VRSTLDLGNTTIVSPDAGRIKVSEQWAAKLGNLPLAFIHKQRDITRPNHAEAHGIIGDV
FT                   DGRDCVVIDDMVDTAGTICEAVRTLNESGAKSVTLVATHGLLSGPAVERLSHCGAHEIV
FT                   FMDTVPIPEEKRLPNMTVLSCAPLLAAGIRSVFEEGSVAILLDGLPEDMRPRNIYA"
FT   gene            complement(303741..304223)
FT                   /locus_tag="BLJ_0232"
FT   CDS_pept        complement(303741..304223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99720"
FT                   /db_xref="GOA:D6ZXS4"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXS4"
FT                   /protein_id="ADG99720.1"
FT                   /translation="MPTVLAKPTQPAAPITPGAAPVAAPGATSTTMNEQQKKIFIIVGA
FT                   VAGFLVLFGIVYGVLSSAVFSAKSVANSYVAAISSGNYDKANTIADPHVNTNQRALLTS
FT                   KASSGENTRITNARISQTSNNADGTVSAQLTYTLEGKEVNGNFTIKDNKVSVEFSE"
FT   gene            304388..304678
FT                   /gene="rpsF"
FT                   /locus_tag="BLJ_0233"
FT   CDS_pept        304388..304678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="BLJ_0233"
FT                   /product="ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99721"
FT                   /db_xref="GOA:D6ZXS5"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXS5"
FT                   /protein_id="ADG99721.1"
FT                   /translation="MSAHKYELMFIADPELDERGLKKLTEQYLELVTKEGGSFDEPDYW
FT                   GRRKLAYEIAGKTEGNYVVVKYTAEPATSDELDRVLNLNESVIRTKILRKG"
FT   gene            304735..305391
FT                   /locus_tag="BLJ_0234"
FT   CDS_pept        304735..305391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0234"
FT                   /product="single-strand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99722"
FT                   /db_xref="GOA:D6ZXS6"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXS6"
FT                   /protein_id="ADG99722.1"
FT                   /translation="MAGETVITIVGNLTADPELRTIGSGATVASFTIASTPRTWNRQTN
FT                   QFEDGQALFMRCSAWRDLADHCAQSLKKGMRVIATGRLQQRSYQAQDGSQRTVVEMQLD
FT                   EIGPSLRYATAQVTRQSSGQGGFQGRSGGFQGGQQPNQGYGNQGGQGGYAGGQGGYNGG
FT                   YQGGGAGYSQQSAAPANPSAPAVDPWSNAGASDAGSFSTFGASSDFGGDDSDPEF"
FT   gene            305452..305700
FT                   /locus_tag="BLJ_0235"
FT   CDS_pept        305452..305700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0235"
FT                   /product="ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99723"
FT                   /db_xref="GOA:D6ZXS7"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXS7"
FT                   /protein_id="ADG99723.1"
FT                   /translation="MSRKRPQPPVKPFKKKPNPLKAAKVTEIDYKDVALLRKFISDRGK
FT                   IRSRRITGVTVQEQRELSKAIKNAREMALLPYATSGR"
FT   gene            305720..306166
FT                   /locus_tag="BLJ_0236"
FT   CDS_pept        305720..306166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0236"
FT                   /product="ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99724"
FT                   /db_xref="GOA:D6ZXS8"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXS8"
FT                   /protein_id="ADG99724.1"
FT                   /translation="MAETKVILTKTVSNLGHSGDVVDVKSGYARNYLFPQGLAFAWTKG
FT                   AEAQIVAMKRARLAKAVATREDAVAAKAAIEGTTVEIAAKVSESGKLFGGISNEAIAVA
FT                   LSDKAAVNPKAIEVETIKTTGDFPAKVALHPEITASFFVKVVAE"
FT   gene            306366..306439
FT                   /locus_tag="BLJ_0237"
FT   tRNA            306366..306439
FT                   /locus_tag="BLJ_0237"
FT                   /product="tRNA-Lys"
FT   gene            306553..306813
FT                   /locus_tag="BLJ_0238"
FT   CDS_pept        306553..306813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0238"
FT                   /product="Phosphotransferase system, phosphocarrier protein
FT                   HPr"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99725"
FT                   /db_xref="GOA:D6ZXS9"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXS9"
FT                   /protein_id="ADG99725.1"
FT                   /translation="MPQIFTFTVSDPEGMHARPAGRLVAKAQEYESSITVAYGGKSVDA
FT                   KRIFGVMGLDVQQGDEVTVRVQGNDEAVAAAEFERFLKEHL"
FT   gene            306813..308492
FT                   /locus_tag="BLJ_0239"
FT   CDS_pept        306813..308492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0239"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99726"
FT                   /db_xref="GOA:D6ZXT0"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXT0"
FT                   /protein_id="ADG99726.1"
FT                   /translation="MRTIQGVSVSAGIAIGTVRVLAAVDYAVERRLIDDPQAEMDRFRA
FT                   ARDTAVAQLKQLRDNVAAEFGENKAELFDAHRLMLQDPDYAECVEGLIAQDKVNAEFAV
FT                   KSAAEQFAAMFAAMDSSTMQARAADVKDVSRRVMNVLQGKRDSTAQDGSVQGDAVQNGI
FT                   VQNGIAQNGESHIIFAEDLAPSDTAQLDRAKVLGLVTAKGSANSHTAILARTMGLPAIT
FT                   GIGDAFDPADDGHVAVIDGTSGAVFVDPDEATLTEYRRRKAEAEEHLSLLRKLKGKPTE
FT                   TKSGQRVHLYANISRPSDAAAVLANDAEGIGLFRSEFLYLEREDWPTEEFQFDAYGQVA
FT                   QEMGDRPVIIRTLDIGADKQVDYFNLSHEDNPALGYRAIRICLTRPEIFKVQLRALLRA
FT                   SAYGNIAIMLPMITSVQEVRDAKRILEEAKSELRGERIDFNESIQIGVMIETPASVIMA
FT                   DELAAEVDFFSIGTNDLTQYTLACDRQNPSLERFADPHSPAVLCMIQMTIEAAHRHGIW
FT                   CGICGELGADLSLTDTFLRLGIDELSVSPTSVLPLRNVIRNH"
FT   gene            308726..309460
FT                   /locus_tag="BLJ_0240"
FT   CDS_pept        308726..309460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0240"
FT                   /product="MIP family channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99727"
FT                   /db_xref="GOA:D6ZXT1"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXT1"
FT                   /protein_id="ADG99727.1"
FT                   /translation="MDYPLFTKLAAEFFGTAILMIFGNGSVANVELKNTKGHHAGWLNI
FT                   AMGYGFGVMFPVLMFGSVSGAHINPAMTIAQAVNGLFPWSDVLPYIVAQLLGALLGQLI
FT                   VYITYYPHYKETEDAEAILGTFCTTDADNQKANYFLNEMFGTLVLVFGALCCLSLAWGK
FT                   QDYAAASIVVGFIVWGLVTSMGGPTGPGLNPARDLMPRLLHAILPIPHKGSSRWGEAWI
FT                   PVVAPIVGAIIGAWLFVFFFAN"
FT   gene            complement(309544..312210)
FT                   /locus_tag="BLJ_0241"
FT   CDS_pept        complement(309544..312210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0241"
FT                   /product="copper-translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99728"
FT                   /db_xref="GOA:D6ZXT2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXT2"
FT                   /protein_id="ADG99728.1"
FT                   /translation="MEFSIFSTATALIVAAALTWLVLRFFFGTQKATAGAMDASGERQS
FT                   ATITVKGGYSPAVVSMRAGTPITLVFDRQETGECTSHVVFADLGLDAMLPGNATTDVEL
FT                   PALPPGEYPFACGMNMVHGMLKVEGEDGSDENTPLPHPDASYTAPTAVDAAEGERREAA
FT                   ERASEIKALTKLVIVAAVLTLPAFAVTMLHMANPALVPHWMVNPWLQAILITPVMFYCG
FT                   CPIHTVGFPALAHRSPDMNSLVSLGTSAAYLYSLVTCIAPWVFPEGSREPYFESVGVVI
FT                   TLVLVGRLLETKAREGTGKAVQSLIKLSPRTAHKLNATSADNVDGIEWRNPAYFTDTDI
FT                   DAIATGDLLVVKNGERVPTDGIIVAGEAHIDESMITGESKPVSKTVGDPVTGATVLLKG
FT                   DCVMRATQVGADTVLSQIAAMVARAQATKAPVQQLADKIARYFVPAVMIIAIWTFAIWV
FT                   SLGPVPQLAHALVTAVSVLIIACPCALGLATPLSVTVSLGLGATNGVLVTSAKALEQAR
FT                   RIGTVVFDKTGTITRGVVDAAADWDKPSYEQDTVKEGSREAIAALRARGIRTVMLSGDK
FT                   AEVAGRIAREVGIDTVICEIKPDGKAYWIAKLQRERDEAAVKSADGTSRTAAQSRTLIA
FT                   MVGDGINDAPALAQADLGIAIGTGTDVAMQSADVTLMSGDLRGVIKTINLSNATMRNIR
FT                   ENLGWAFGYNVIGIPVAAGVLYPFTGWLLSPMIAGLAMALSSVCLVLNANRLHGANINV
FT                   GAADGPAGSGSSTADVESAGSAESANAANITGSATSNAPHEPTVIIDDRTTLNQTNHVS
FT                   DQSNNPTNKENTMDTGMHMHHTAPADGETATDPVCGMTVAVNADAITREYEGKSYYFCG
FT                   EHCATNFMKAPQVFLEQ"
FT   gene            312321..312602
FT                   /locus_tag="BLJ_0242"
FT   CDS_pept        312321..312602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0242"
FT                   /product="protein of unknown function DUF156"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99729"
FT                   /db_xref="GOA:D6ZXT3"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXT3"
FT                   /protein_id="ADG99729.1"
FT                   /translation="MHGYDEDKAKVIARLRRIEGQVRAITQMVEDDKYCIDILTQISAS
FT                   NSALKSVALLLLDDHLNHCVRQASVQGGEVADEKLAEASAAIARLVKS"
FT   gene            312809..314233
FT                   /locus_tag="BLJ_0243"
FT   CDS_pept        312809..314233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0243"
FT                   /product="protein of unknown function DUF195"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99730"
FT                   /db_xref="GOA:D6ZXT4"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXT4"
FT                   /protein_id="ADG99730.1"
FT                   /translation="MFEQIGTVVIVIVVLVVGAGLGLFAGFVLGRHKGQEMARGVKSEE
FT                   LEETKTSLENARFENAELSARNAAAQAQIEGVNQQLAFAKSQLAQAQQAEQIRIQQERE
FT                   RAAAEAERKRQADAQAAEAKRAEQEARLKEQSKVLEALAPVAKNLDTLQNKVTQIEEGR
FT                   KREMGALGAQLKGLNDQQARLDKETSSLSAALRNNKVRGAWGEAQLKNIVESAGLLEHV
FT                   DFDIQVVVTDADGRTLRPDMIVHLPGGKTIPIDAKVPYADYQRACEIPDTASPEDIARR
FT                   DDLLRAHAKALREHVRALGEKAYWNAFDVAPDFVVAFIPNEALLQAALEADPTLMDDAF
FT                   SRKVALTSPVTLWAVLKSVAYAWQQQSLTDDAKQLFDLSRELYERFSTLGDYAIKLGTQ
FT                   ITKTVSAYNKFASSLERRVLPTARKLQKIEPTKIIEEVPIIESDKGNVSELSAPEVVPA
FT                   DEGDTHLTASGDSLES"
FT   gene            314230..314859
FT                   /locus_tag="BLJ_0244"
FT   CDS_pept        314230..314859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99731"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXT5"
FT                   /protein_id="ADG99731.1"
FT                   /translation="MTESGFRPTGTPDLAVAKSHNDFAVLEPREQLATLLREHVVGRPF
FT                   SELAAVTFDHRAATVMGHVLIDALEDAGYSVDDFDAVGALTAASVPMVSAMIQAAASRG
FT                   EDLDGFVMDFVYPSIKGPSIEGRRVVLLDAWLSEKSYVQTSSLVTLRNGNELSLDFGIV
FT                   EQLDAKVVAIASLVGGGAKDINVVNPSTGDEQTLPFIQVFDESELR"
FT   gene            314953..315801
FT                   /locus_tag="BLJ_0245"
FT   CDS_pept        314953..315801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0245"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99732"
FT                   /db_xref="GOA:D6ZXT6"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXT6"
FT                   /protein_id="ADG99732.1"
FT                   /translation="MHAPNQISLAAKASGEPEFREIGLGPWSETHPGEPRPDDPTSPNY
FT                   DGRFDSVLLNDGDRRNVLDRYRYWTVAAIKADLDARGRHDFEVAVENWTHDFNIGSMVR
FT                   TANAFQAKRVHIVGPHKWNRKGALMTELYQHVEHHPSIAELVESWHHRIAGEIAYERAK
FT                   AGAAAIHAHDVAVDGDNKHLHELLAEIDACDARIKELQAARVIALDIIPGAVPMETYTF
FT                   PKRCLLLFGAEGPGLSEKALELADDVVYISQFGSVRSINAGAAAAVAMHAWIAQHAVSG
FT                   V"
FT   gene            complement(316236..317204)
FT                   /locus_tag="BLJ_0246"
FT   CDS_pept        complement(316236..317204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99733"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXT7"
FT                   /protein_id="ADG99733.1"
FT                   /translation="MKHHKAVDILITKAEATQQCAYGTTKAHRSALARRVQARELKRVF
FT                   PNMYAASEYWDSLQPDERIRHIARTLHNRHPDWVFAGVTAAAIHDFEHQWHLHAGTITL
FT                   ATTSRGPNASSAKVKRIFTSSSTPEYANGLPVTSKARTVVDCGLSVDFRFALPIIDSAL
FT                   RNGVAITDILNVCSTMRRDCTPIFRLLHYANPASENGGESLGRGTIIAGGLLAPELQQN
FT                   ITDPQTGALYRVDFLWRLPENRLIVGEFDGYEKYVNPDMNDRKGVRGAVQAEKERETAL
FT                   YRAKVDTIVRFTYEEVMQQHPLLNKLRAAGIPHAGTVMGAG"
FT   gene            317736..318086
FT                   /gene="gatC"
FT                   /locus_tag="BLJ_0247"
FT   CDS_pept        317736..318086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="BLJ_0247"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99734"
FT                   /db_xref="GOA:D6ZXT8"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXT8"
FT                   /protein_id="ADG99734.1"
FT                   /translation="MRLPDNCVSHTAHIVMAMPTFSREEIVHLGDLARIALTDEEITRL
FT                   QGELNVIADSINKVQEVASDDVPPTANPVPLEAYLRPDVAETPLTQEEALAGGPKTEAG
FT                   MFVAPRILGSEE"
FT   gene            318090..319631
FT                   /gene="gatA"
FT                   /locus_tag="BLJ_0248"
FT   CDS_pept        318090..319631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="BLJ_0248"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99735"
FT                   /db_xref="GOA:D6ZXT9"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXT9"
FT                   /protein_id="ADG99735.1"
FT                   /translation="MSNETATLVKLSAAEQAAAIKKGDVTSRELVEAHLKVIEAAEPSI
FT                   KAFLKVSGDVALEQADAFDAKSAEDKAALPELAGVPIAIKDMIVTKGIETTAASKILEG
FT                   WVPPYDATVIEKLKAAGMPILGKTNLDEFAQGSSTEHSAYQTTHNPWDTERVPGGSGGG
FT                   SASAVAAFEAPIALGTDTGGSIRQPGALTGTVGVKPTYGGVSRFGAIAMASSLDQIGPV
FT                   SRTVLDSALLQEIIGGHDKRDSTSIPEGPRPMVAAAREGAKRDLKGMKVGLIKELGGDG
FT                   FQPGVEARFNEAVDKLKEMGAEVVEVSVPHIGYSLGAYYIIMPSEVSSNLARYDGMRYG
FT                   LRVMPPTGVPQTAANMMAYTREAGFGDEVKRRIILGTYALSAGYYDAWYGSAQKVRTLI
FT                   IRDFHNAFEKADVLVAPTSPSTAFKFGEKMDDPLAMYMNDIATIPANLAGVPAMSIPAG
FT                   LSDDGLPVGFQFIAPQQRDEVMYKPAAALEAALEDSWNGPIWNDLKTPWLDGLGK"
FT   gene            319656..321155
FT                   /gene="gatB"
FT                   /locus_tag="BLJ_0249"
FT   CDS_pept        319656..321155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="BLJ_0249"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99736"
FT                   /db_xref="GOA:D6ZXU0"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXU0"
FT                   /protein_id="ADG99736.1"
FT                   /translation="MAEKLMKYADATKKYDVVFGLETHVELSTNTKLFCPAHIEFGGEP
FT                   NTELTPVSLGLPGSLPVINKTAVDYAIKLGLALHCEIAEWSQFARKNYFYPDMPRDYQI
FT                   SQYDKPTNGNGYLDVELEDGTVFRVPIERAHIEDDAGKNTHVGGADGRIEGADHSLVDY
FT                   NRAGVPLIEIVTKPIEGAGDRAPEIAGAYVRAIRDIVRALNISHARMEQGNMRADVNVS
FT                   LRPSPDAPYGTRSETKNVNSFRGIEKTIQYEIRRQAARLDDGKEILQETRHWDEATQTT
FT                   AGGRLKSDADDYRYFPDPDLVMLHITKEHIEEMKAQMPEMPRERRNRLKSEWGLSDLQM
FT                   RDILNADALDLIEETVKAGAKAAGARKWWLGELSREANAKGMSLEELPITPADVAEVEK
FT                   LIASGKLNDKLAKQTVEGVLKGEGTPDEVVKKHDYKIVEDNGAIEAAVDAAFESNPDVV
FT                   EKLKSGNMKPMGVIIGAVMKATRGQADAKAVTKVVMGKIKG"
FT   gene            complement(321145..321381)
FT                   /locus_tag="BLJ_0250"
FT   CDS_pept        complement(321145..321381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99737"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXU1"
FT                   /protein_id="ADG99737.1"
FT                   /translation="MNAGNALSRLSYRINKGSRWRELSNEFELEDFPTNKCSRWRELSA
FT                   KRTEGGHPYMATTLSLTPFDSSRQREPVNLISP"
FT   gene            321451..322515
FT                   /locus_tag="BLJ_0251"
FT   CDS_pept        321451..322515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0251"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99738"
FT                   /db_xref="GOA:D6ZXU2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXU2"
FT                   /protein_id="ADG99738.1"
FT                   /translation="MTATNETLSMATEVQLKRDLPQNIVIPPIRGEMVHLRPATAEDLA
FT                   RLDELDAFYGASKITGKDAVTERAIVHTWVRRSQAWEAGQAPAESGVGDPESRRTIAWA
FT                   VLTDADHDDDGQLDAASTDNVIGMIFLIDIDGWSKSARIQIILGREYRGRGYSRDAMPR
FT                   VMTYGFAPEPAGLGMHRIWVSVPEKNSRSISVYQSLGFVPSGTSRDALWDVENNKYQDL
FT                   IVMDTLVDEYDPIRSLDAFGMHLIEDNPGVKEALSAREHSIAIQQNKPEPEPAQRGEAA
FT                   AVTTSDVQSQAQTPAAAQPVEPQAGHHDDTQKNTRHSLEEESNWPYGQAERKPSKEAWW
FT                   RTLGRGRKRDTESE"
FT   gene            322526..322840
FT                   /locus_tag="BLJ_0252"
FT   CDS_pept        322526..322840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0252"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99739"
FT                   /db_xref="InterPro:IPR019592"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXU3"
FT                   /protein_id="ADG99739.1"
FT                   /translation="MSAEDLDNYETDAELALYREYRDVIKLFTYVVETERRFYLANKVD
FT                   FNVRSAGQDVYFDVQLTDAWVWDVYRSSRFVKSVRIVTFKDVNVEEVQKTDIDIPDDIH
FT                   "
FT   gene            323266..324879
FT                   /locus_tag="BLJ_0253"
FT   CDS_pept        323266..324879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0253"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99740"
FT                   /db_xref="GOA:D6ZXU4"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXU4"
FT                   /protein_id="ADG99740.1"
FT                   /translation="MTDKQSVVIIGGGPAGLTAAWELIKDGGADKYDVTVLEGTREFGG
FT                   ISRTVKYNGNRMDIGGHRFFSKDERIMDWWKTVLPLQGAPSYDDKKLGRDHDMEPGGPD
FT                   PETEDKVMLKRHRVSRIFWNRHFFDYPISLSPNTLKAMGFKLTMVAGFSYLKSMFHKLP
FT                   EDNLENFYINRFGRKLYSMFFEGYTEKLWGRHPSQISADWGAQRVKGLSIMGVLKNAFQ
FT                   KLSPRKRSNAEVETSLIEEFWYPKYGPGQLWETVESNCEAAGVKVLTDARVVEVRQTDG
FT                   AVSSVVYEDSEGNRTELSGDQFISSMPVKDLVNAIDAAGDDPEAADSKPAPADMTEVAN
FT                   GLPYRDFVTVGLLVKHLKLKNTTNIPTLGNPPIVPDCWIYVQDPGYKVGRLQIFNNWSP
FT                   YLVKNVDDTVWVGLEYFCEEGDSFWNMSEEDVTKFAISELTRMRVINGPDEVIDSHRER
FT                   VKKAYPAYFDTYEHMDELIEYLDGFGNLYCVGRNGQHRYNNMDHSMATAMEAVGNIKTG
FT                   KTSKKNVWSVNTEKSYHEEK"
FT   gene            325085..327154
FT                   /locus_tag="BLJ_0254"
FT   CDS_pept        325085..327154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0254"
FT                   /product="transcription termination factor Rho"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99741"
FT                   /db_xref="GOA:D6ZXU5"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXU5"
FT                   /protein_id="ADG99741.1"
FT                   /translation="MANSQNLEDMKLPELKELAKQMGLRGTSTMRKPELLATLQAARNG
FT                   GEPPAGVTVRAPKAAKTAKVVKAPQSDAAEANTTDNADVATQSPAPAPAATEPQLDLPL
FT                   PVADDAKKDETEPRRTRRKAADDAASEPRAARHRRDDDQSDFARRKPRKKADEAGDLLA
FT                   TLDLGDAAPTERRRERHEDVEVPLIRRVRDDEDEQPRRRRRTAENSEETVRDLDDILAT
FT                   LPTQKHEETSEDGEQNDDHEFVRRNRRDRSDRNDRDNRNDRNDRRNRRMRGRDRDNADD
FT                   DRRYDDRDNRSDRNDRDSRREEPQEDLVPVAGIVDVLDSYAFVRTSGYLPGPNDVYVSM
FT                   GQVKKYGLRKGDAVHGSIRAPREGDRRNQRQKFVPLQAIDSINGQSVEEALNRPQFSKL
FT                   TPLYPQERLKQETAPNKLTGRIMDIVSPIGKGQRGLIVSPPKAGKTITLQNIANSIAAN
FT                   NPEVHLMVVLVDERPEEVTDMERTVQGEVISSTFDRPASDHTTVAELAIERAKRLVELG
FT                   QDVVVLLDSMTRLARAYNIAAPASGRILSGGVDAQALYPPKKFFGAARNIENGGSLTII
FT                   SSALVETGSKMDEVIFEEFKGTGNMELRLSRELADKRLFPAIDINASGTRREELITNPQ
FT                   ELPIIYRLRRLLGGMEPEQAYQTLVPRLKKTATNRDFLAAIVQQANTGNAVNGN"
FT   gene            327462..327851
FT                   /locus_tag="BLJ_0255"
FT   CDS_pept        327462..327851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0255"
FT                   /product="chorismate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99742"
FT                   /db_xref="GOA:D6ZXU6"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR010951"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXU6"
FT                   /protein_id="ADG99742.1"
FT                   /translation="MSETSSGWQRTTIDSAQAAAHPETAQAVARIKALRQTIDNIDSAA
FT                   IALLAERFKATSQVGVLKANAGFAPEDTKREDYQIERLHRIAIDAGLDPEIAEMYREFV
FT                   VTEAKKRHQRIADAGGDPGVLDVFA"
FT   gene            327973..330015
FT                   /locus_tag="BLJ_0256"
FT   CDS_pept        327973..330015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99743"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXU7"
FT                   /protein_id="ADG99743.1"
FT                   /translation="MRCGTALVSCALCVASILGGAWMSRPTPVDYGPVLATASDMYAVT
FT                   DAEGEPVRWYVVGKGGAGNGASADSGNSGSTDTDSANSNSGTSKVSRIPASAATLPWKV
FT                   SVTYSLDGPNVEANEVAGASGLIGVYIDIKPQTKEANRTIPVVAFTVPTQVADDVSADN
FT                   SITVTTQGSNTVVAAAGKAATGLEFSCYMNAKDFSMSSVALAVLPSNSSSPVVGANPDA
FT                   ANAAAQPAADTDVAQLVASAAILVDSLTDAGSGEHQQLIEQLQTLRDNERALDKSVVAE
FT                   RETAHKRTFEDYMAAYVGSYTTHLSGSIGTSTQLPALMGTAGELSGDTPLAQAVLDLAN
FT                   AVNNVSAAHQHAGAVDALDEVIRRIQQQGTTGLVDDLTAEASEEATRGSKQYADGQSQL
FT                   SAAMIPYSMKYTDVYTANLSALTGGTSSGATAYESQAIAETNGSDELADAQSKVDAAMS
FT                   TLATASEHTGKATALRQIVLRFSDQFEGVASSASGSDGDGSSGDVSSGPVTEAQALTGL
FT                   VDSQSQSFYGKTRAAQAKRKADAARKQAKAAQQQQSQHSKASLVDDTMSMSAGDVMNYA
FT                   GGLTSAIGGGGKSDSSKSDGSGTNDSAKSSDTGDSGNNLDTAPVLFGFGTGGTLLKHDM
FT                   SALINETVEISDAGTLLAQAVAQLDSPNTQQKTAETRYLIVIPTV"
FT   gene            complement(330487..333222)
FT                   /gene="valS"
FT                   /locus_tag="BLJ_0257"
FT   CDS_pept        complement(330487..333222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="valS"
FT                   /locus_tag="BLJ_0257"
FT                   /product="tRNA synthetase, valyl/leucyl, anticodon-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99744"
FT                   /db_xref="GOA:D6ZXU8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022874"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXU8"
FT                   /protein_id="ADG99744.1"
FT                   /translation="MTEGKSIINANLTPLPDKVGVDGLEDKWRTVWDEDGTYKFRNTRD
FT                   RKAVYSIDTPPPTVSGSLHVGHVFSYTHTDVIARYKRMRGYDVFYPMGWDDNGLPTERR
FT                   VQNYYGVRVDVSLPYDPDFKPPFEGTDGKKIDAKDQVPISRKNFIELCERLTAQDEKLF
FT                   EALWRKLGLSIDWSQTYHTIGQHPQRVAQKAFLRNLARGEAYQQDAPGLWDVTFQTAVA
FT                   QAELESREYPGFYHKVAFRFEDGTPIYIETTRPELLAACTSLIANPNDERYKQYFGQYV
FT                   YSPLFKVKVPILAHPAAEMDKGAGIAMCCTFGDVTDVEWWRDLKLPTRPIIQRNGRIVM
FT                   DTPDWIEDPAGREVFAETAGKTTFSARKIIVDKLRESGDLDGEPTPTKRMTNFYEKGDK
FT                   PLEIVTSRQWYLKNGGTDAKLNAELIERGKELEFHPDFMRVRYENWVHGLNGDWLISRQ
FT                   RFFGVPFPLWYPVNASGEPDYDHPITPSEDRLPIDPTIDVPEGYDESQRDVPGGFTAEK
FT                   DIMDTWATSSLTPQIVTHWAEPDEASKALFASTFPMDLRPQGQDIIRTWLFSTVDRAHL
FT                   ENKCLPWAHATLSGWILDPDHKKMSKSKGNVVVPNEPIEKFGADAVRYWAAAARLGLDA
FT                   TYDIGQMKIGRRLAIKLLNATKFALAIGREDENHHVGAAAEAAWNPADVTEPLDRAAMA
FT                   KLALVVRQATEALESYEHSKALEVIESYFWQFCDDYIELVKNRAYGTPDEQGHVPSEKA
FT                   VKSARTALGLGLDAFARLLAPYLPYATEEVWSWMHAGSGSVHRAAWPVVDPYVEAATGA
FT                   SPELLTWAGKAVEQLRKIKSEAKVSMKTPILSVALSAASEGVNAIHAALGDIAQAGRVV
FT                   GKFDLVAKHAEESAAEDAPETEVAVEASELGEPPAKKPKH"
FT   gene            complement(333366..334892)
FT                   /locus_tag="BLJ_0258"
FT   CDS_pept        complement(333366..334892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0258"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99745"
FT                   /db_xref="GOA:D6ZXU9"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXU9"
FT                   /protein_id="ADG99745.1"
FT                   /translation="MQHSKRDNTWSKWGIFLGVAVALGALVVVGWTFMQNRFQPGSSLD
FT                   ADVTIGIDDMPQSLDIRSDSSAAAERLLVDNVYETLVTVDQDNKLQPGLATSWKTSDDG
FT                   LTVTLTLQSGVTFSNGHTLDASDAVWSLQQNVTNKVADVDELGDLASVANPNATTVVIT
FT                   LAKPNPTLLRALSGRLGIVYDSESSSADYQRKAIGSGPFTVADFQPGHSLKLARSDTYH
FT                   GTKAASNVVEFMQYSDADALSKALTDGSLDMAAPVSASTATGLNGKDGLTVKEGATTDK
FT                   VLLAYNNGTDSLLSDEQARKAFRYQIDAAGIASAQPDAAGALGGPISLLEPGYEDLTGL
FT                   YPHDENQAGQMFSYFGAQYLTTVNLVVPEEYRSLAETIKQQIERQPRPTVNLEVLSDED
FT                   YAKRIKDGKWELTVMSMDGTDDAGIFADPDSMFHYDHTEAQQAYADARAATNDADYEAR
FT                   MKAYARLISEDAASDWLYTRKCFTVASTKVSGYPTSMINRRMPLAGLTVK"
FT   gene            complement(334954..335640)
FT                   /locus_tag="BLJ_0259"
FT   CDS_pept        complement(334954..335640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0259"
FT                   /product="endonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99746"
FT                   /db_xref="GOA:D6ZXV0"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXV0"
FT                   /protein_id="ADG99746.1"
FT                   /translation="MRETKSARLTRMHDEYDILRQVIPAPACALHFSNPLELLIATVLS
FT                   AQTTDKRVNTVTPELFATYPTARDLAAANPAQVEDIIHPLGFYRSKTQHLIGLATALDE
FT                   RFGGVVPRTMDELTSLPGVGRKTANVVLGNAFDIPGFPVDTHVMRVTGRLRWRSDWRSA
FT                   HPDPVKIEKEITSCFPPEEWTNLSHRLILFGRATCHARTPDCANCPLSDTCPSYAPPAG
FT                   KSTSKR"
FT   gene            complement(335699..336499)
FT                   /locus_tag="BLJ_0260"
FT   CDS_pept        complement(335699..336499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0260"
FT                   /product="response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99747"
FT                   /db_xref="GOA:D6ZXV1"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXV1"
FT                   /protein_id="ADG99747.1"
FT                   /translation="MTDLTLMTFASDPATVLPSLALLSHRVRVLPMDAASLVKMPENTI
FT                   LFLDARDDLATAKTLCRLIHASGLSTPIVLVLTEGGFTVVNSQWGIADVVVATASPAEV
FT                   EGRLRLVSERGNAPAAAAAGSPAESTTTVEDGQIRSGDLIVDTNGYTASLHGRPIDLAY
FT                   KEFELLKYLVQHPGRVFTRAQLLQEVWGYDYYGGTRTVDVHIRRLRAKLGGEYEHLIGT
FT                   VRNVGYRFDPPETDKETAAAQQAAKASSAAIDTDDDTPDLNTVA"
FT   gene            complement(336660..337364)
FT                   /locus_tag="BLJ_0261"
FT   CDS_pept        complement(336660..337364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99748"
FT                   /db_xref="GOA:D6ZXV2"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXV2"
FT                   /protein_id="ADG99748.1"
FT                   /translation="MTEITQEGWKNKALSMLLAQLTSYVLFIAATVIPSPGTVPIIPLI
FT                   IAALTLAAFVVFWPFRGSILDRIVTLVFGAISLIFVIVPFPTSEVPPDQTAADGSVLPW
FT                   YSWALAMGLLLVVLVVFSFGRQMAHEKREHLIRALSHAVTSGVAALAVAGWCFLPDLGA
FT                   MLAKGTVAGTVALIILIVLGLALAVASTLWVRDADPDPDIRYPWIGTGLMPVMLMGVTI
FT                   AATALVLGRIIG"
FT   gene            complement(337473..338057)
FT                   /locus_tag="BLJ_0262"
FT   CDS_pept        complement(337473..338057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0262"
FT                   /product="protein of unknown function DUF204"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99749"
FT                   /db_xref="GOA:D6ZXV3"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR022929"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXV3"
FT                   /protein_id="ADG99749.1"
FT                   /translation="MISIIIQILLISVSVAMDAFAVSIGKGLTVSRVRVQDAVKSTLWF
FT                   GGFQMLFPILGYFAASTFSKYVTQFDHWIIFALLVFIGGNMVHEAFEEDEENSKETAQF
FT                   DWKHMLPLAVACSIDAFAVGVSLAFMFTKAHMAFAILSIGVVTGLFSAAGLHIGRAFGS
FT                   RWQKPAQIAGGVVLILLGIKVLLEHLGVIAF"
FT   gene            complement(338291..338785)
FT                   /locus_tag="BLJ_0263"
FT   CDS_pept        complement(338291..338785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0263"
FT                   /product="Inorganic diphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99750"
FT                   /db_xref="GOA:D6ZXV4"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXV4"
FT                   /protein_id="ADG99750.1"
FT                   /translation="MAETFNVVVEIPRGSKNKYEVDHETGRVFLDRTLFTAMGYPDDYG
FT                   YIDGTLGEDGDPLDALVMIPNSVFPGCVVECRAVGLYHMVDEAGGDDKVLCVPADVRFD
FT                   DIKDIDDVNEYHKAEIKHFFEQYKALEPGKEVLPGDYWTGADAAEKEIIAARQRLADSE
FT                   K"
FT   gene            complement(339013..341253)
FT                   /locus_tag="BLJ_0264"
FT   CDS_pept        complement(339013..341253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0264"
FT                   /product="alpha amylase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99751"
FT                   /db_xref="GOA:D6ZXV5"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR021828"
FT                   /db_xref="InterPro:IPR026585"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXV5"
FT                   /protein_id="ADG99751.1"
FT                   /translation="MAAVQHRATTRTSNTDNSTTKTKSKATSARKSPATKRKRVSAETA
FT                   RAAAALKGLAVEAPAPSIEANEPGQFGRINVMDITPAEERGIFPARVELGEPFEMTAQV
FT                   FIEGRTKVGATAIVRNPRGKETMRRAMTCVNPGLDRWTVMVKCGEHSDLKPWEDGYAAV
FT                   KRQLGEWTVTIEGWEDAYVSWLHDARIKVRVMDDVDNALNSGAELLARWAETPDTGLTA
FT                   RDRKTLEKAAETMADQTLSAEDRLAAGDNPTIAALHETHPLRDGISPSQPQRFKVERPK
FT                   SSFAAWYQFFPRSEGATIDPNTGKIIQGTLKTSMAGLERAAVEGFDIVYLPPVFPIGVT
FT                   NRKGRNNTLVAGPDDPGSPFGIGSELGGHDTVDPLLGTMDDFKALCQRAHELGLEIALD
FT                   FALQCSPDHPWVKAHPNWFRHKPDGSIAFAENPPKKYQDIYPIDFNADMPGIEKEVERI
FT                   MNLWIEAGVTIFRIDNPHTKPVRFWQDVIAAVTKKHPEILFLAEAFTRPGMMRALSYVG
FT                   FTQSHCYFPWRNTKDELEEYLPVTNGDDGYYQHNTFWPTTPDILTAYVRDNGVAGHCVR
FT                   AVLAAMGSPSWGIYNGYELIENKQRPGFEEQIDNEKYEVKVRDWSKAKQYGVAEMLTAL
FT                   NKIRRAHPAALSYHNLTVLPTSDPNILAFARHTPAELTGTGQADTLIVVVNLDGHNAHQ
FT                   SMIHLELSELGLPTDRPLNVRDELTGREFQWGWDNYVSLAPWADVAHILSVQ"
FT   gene            341494..343488
FT                   /locus_tag="BLJ_0265"
FT   CDS_pept        341494..343488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0265"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99752"
FT                   /db_xref="GOA:D6ZXV6"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXV6"
FT                   /protein_id="ADG99752.1"
FT                   /translation="MMITTWRQRGMAIVAMLTGLIIMVGVVFGSANTAYAATLTPADER
FT                   YHVAFPYNDMEYYVGVAGLDASGNKYYCIEAGKLSDYVIGPTTVLASDENARRMAWILD
FT                   RYRDTDAATHAAIGIIVQDHFGRDRDEWARQMAVIQGRYPEIVAKAARIWDQSAGKTPA
FT                   GTTVERTDAEALRSGSISVKVVNRAGDAIAGVPFTVTLQGAARFVQGGNTFSGVSTSAG
FT                   SSIAWEATGAGEVTANTTYEYGRMHVMDSTQDMLAFDSMASTGGASTTFRVRKDFVPAV
FT                   STKVSEKVLDVASPVFDDVTSGVADADSYWVPDLELQARGYYFDGLDTGDVGNVITPNA
FT                   QESADAFLARLATLGYEPVAYGKASFTGVGQQARVQAMTKPDDGAAYRTKQNSGFGTWV
FT                   WVFRRSEQSKQAQEYLIGDWISPFMEATESNTSRRKLEVMSTVTEHSADIGAELSDTIT
FT                   VSGFPADHGQYAGNEEYEFAADRPYATVSVWWSGDPDNPSNDEAYKPSGGEVPTEDDNH
FT                   RLLATWEIPAMNGTFKIGAGALDAHGAPMYLTAERPGWYVFVWRFEGDDRVSPASSRYD
FT                   DAWERVRVLPPCESEKPCEPEKPETPPAPAEATTPNPRPSLPVTGGDVSLASVLAVSAL
FT                   AIGAILSIVVRWRRRYDRFKHWTMRWPIR"
FT   gene            complement(343454..343735)
FT                   /locus_tag="BLJ_0266"
FT   CDS_pept        complement(343454..343735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99753"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXV7"
FT                   /protein_id="ADG99753.1"
FT                   /translation="MKGDQAATVPREVGDHKRLVIFIADLQLSNPREATGVKFLNEAEA
FT                   GHKSYVTIDFVPSSRSSAQKRSVVHHPADIIGIMPQRVNVSASASSSA"
FT   gene            complement(343804..343880)
FT                   /locus_tag="BLJ_0267"
FT   tRNA            complement(343804..343880)
FT                   /locus_tag="BLJ_0267"
FT                   /product="tRNA-Met"
FT   gene            344096..345130
FT                   /locus_tag="BLJ_0268"
FT   CDS_pept        344096..345130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0268"
FT                   /product="Homoserine O-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99754"
FT                   /db_xref="GOA:D6ZXV8"
FT                   /db_xref="InterPro:IPR005697"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033752"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXV8"
FT                   /protein_id="ADG99754.1"
FT                   /translation="MPIKIPSGLPARDILDSERIFALEKPEAERQRVRPLKLVILNLMP
FT                   KKIETETQLLRLISKSPLQVEIDFMKTSTHEATHVSADHLVKFYENLDAFKDNYYDGFV
FT                   VTGAPVEHMPFEDVDYWDEFKTILDWASTHVFSTIYLCWGAMGALYYRYGIHKVDYPEK
FT                   IFGVFPQYLQDEYCFLTNGFDEIDLQPHSRLAGVNENEVRANHDLQILTWGPQSGPGLI
FT                   ATRDFSEVFALGHWEYGKYTLAEEYERDMAKGMTNVPFPKNYFPHDDPKLEPLFAWRAH
FT                   ANLLWRNWLNWVYQTTPYDLTEVPQLRAEKKLGTDRSIRHEPGGPRQDDFKPFVHDGYG
FT                   VIQG"
FT   gene            345592..346404
FT                   /locus_tag="BLJ_0269"
FT   CDS_pept        345592..346404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0269"
FT                   /product="ATP synthase F0, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99755"
FT                   /db_xref="GOA:D6ZXV9"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXV9"
FT                   /protein_id="ADG99755.1"
FT                   /translation="MVGSLSAGLLLADEAGAHLPSVDDFLPPEILFQGTPFAINRIILI
FT                   RIVATIVLLVVLGVTAKRAKLIPGRWQGVVEYGLDFVRDKVVYDVMGEARGKRYVPMIT
FT                   TLFFTIFIFNLCGIIPGMNMAANATVVMPLVFAVWTLIQYWIAAIRSQGLGHYLRHELF
FT                   TPGVPWPVYFLLAPINLLELLIIRPASLTIRLFANMVSGHLMVATCLAFAQFWMVDAVN
FT                   KLQGIPVGALWFAGGFAMTCFEAFVAFLQAYVFAILSTVYINLSFPEE"
FT   gene            346508..346735
FT                   /locus_tag="BLJ_0270"
FT   CDS_pept        346508..346735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0270"
FT                   /product="ATP synthase F0, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99756"
FT                   /db_xref="GOA:D6ZXW0"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXW0"
FT                   /protein_id="ADG99756.1"
FT                   /translation="MDIITLAEVAGNLSVIGYGIGTLGPGIGLGILFGKAMESTARQPE
FT                   MSGKIQTIMFIGLALVEVLALIGFVAALII"
FT   gene            346792..347310
FT                   /locus_tag="BLJ_0271"
FT   CDS_pept        346792..347310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0271"
FT                   /product="ATP synthase F0, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99757"
FT                   /db_xref="GOA:D6ZXW1"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXW1"
FT                   /protein_id="ADG99757.1"
FT                   /translation="MTQAASGIDLFIPEVYDIVWSLIILVIVAVFFYKFFMPKFNAIFD
FT                   ERAAKIQGNIAKAEQARKDADEAKAKYEAQLSTARVDAAKIRDDARAEASHIIADARSR
FT                   AESDAAQITASAQRSIESQHQQAIVSLKGEVGALATALAGKILGAKLEDNDVQSSMIDS
FT                   MIDDLGAKK"
FT   gene            347345..348181
FT                   /locus_tag="BLJ_0272"
FT   CDS_pept        347345..348181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0272"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99758"
FT                   /db_xref="GOA:D6ZXW2"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXW2"
FT                   /protein_id="ADG99758.1"
FT                   /translation="MRGEASRIADRESRDSLAPKLRDTREDAWRIGNELFTITKVLDDS
FT                   IQLERALTDPSRPVADKVAVLKELLGDNAHPMTMEIMTDLVSRRWSRARDIANAVEDFG
FT                   VDAMMYYADATDATLQVSIELSELHSALLNLPVVRAKLYDYQATSEARVKLFREVFSGK
FT                   TLNKVTMRLAEHATCNLRRRRYLETIQWLINKFSRHMGESMVTVTTATPLKKEQIKRLV
FT                   EVYSAKVGRQVHINSVVDPTVLGGMRIQVGDEVTDNTVVAQLQNLHRKVQTEATPA"
FT   gene            348257..349888
FT                   /locus_tag="BLJ_0273"
FT   CDS_pept        348257..349888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0273"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99759"
FT                   /db_xref="GOA:D6ZXW3"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXW3"
FT                   /protein_id="ADG99759.1"
FT                   /translation="MAELTIDPASIRKALDDFVSSYKPSDTPTQEVGYVATAGDGIAHV
FT                   TGLPGCMANELLTFEDGTLGLAFNLDAREIGVVILGDFAGIEEGQEVRRTGEVLSVPVG
FT                   DGYLGRVVDPLGKPLDGLGEIQGIEGRRILEAQAPDVMHRHPVDEPLSTGLKAIDAMTP
FT                   IGRGQRQLIIGDRQTGKTAIAIDTIINQKANWESGDPKKQVRCIYVAIGQKGSTIASVK
FT                   QSLEDAGAMEYTTIVASPAADSAGFKYIAPYTGSAIGQHWMYNGKHVLIVFDDLSKQAE
FT                   AYRSISLLLRRPPGREAYPGDVFYLHSRLLERCAKVSDDLGGGSMTGLPIVETKANDVS
FT                   AYIPTNVISITDGQIFLQSDLFNANQRPAVDVGISVSRVGGAAQTKALKKVSGTLKISL
FT                   AQYRSLESFAMFASDLDAASKAQLTRGAHLTELLKQPQFHPYSPEQEVVSVWTGTHGKL
FT                   DDLDLKDVLPFEQGLLDYIDHNTDILKTIRETEEFTADTEAALDKAVDEFRSTFVSSAG
FT                   KPLVEKKPDVDKAAPVDQEKIVAGEK"
FT   gene            349892..350815
FT                   /locus_tag="BLJ_0274"
FT   CDS_pept        349892..350815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0274"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99760"
FT                   /db_xref="GOA:D6ZXW4"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXW4"
FT                   /protein_id="ADG99760.1"
FT                   /translation="MGSQLALKSRIRSTESLAKIFNAQEMIASSHIAKARDVALNAKPY
FT                   TDAIFDAVQALVAHTHITHPIAVKDEKNPRVAVLALTSDRGMAGPYTSSIIRETESLLS
FT                   RLDAAGKQPELFVYGRRGSTYYKYRNRDIAATWEGDTDQPGVEIAETISNTLMDAYMKP
FT                   AEKGGVSELYIVYTEFINMVVQKVRVLRMLPVEIVKNETKVPDPDEEAPATADVAPLYT
FT                   FEPSLEKVLDAILPKYIQSRIHECLLTAAASETASRQNAMHTATDNARNLIDDLTRKLN
FT                   ASRQASITQELTEIIGSADALTKKEE"
FT   gene            350824..352296
FT                   /locus_tag="BLJ_0275"
FT   CDS_pept        350824..352296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0275"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99761"
FT                   /db_xref="GOA:D6ZXW5"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXW5"
FT                   /protein_id="ADG99761.1"
FT                   /translation="MADNQTTAAEPTNGRVTRVQGSVIDVEFPVGHLPDIYNALKVTIV
FT                   NTGAKEEGEAKETEITLEVEQHLGDSTVRCVALKPTDGLVRGASVSDTGAPISVPVGDV
FT                   TKGHVFDVSGNILNKKPDETITVSERWPIHRNPPAFDQLESKTQMFETGIKVIDLLTPY
FT                   VQGGKIGLFGGAGVGKTVLIQEMIQRVAQNHGGVSVFAGVGERTREGNDLIGEMAEAGV
FT                   LEKTALVFGQMDEQPGTRLRVPLTALTMAEYFRDVQNQDVLLFIDNIFRFTQAGSEVST
FT                   LLGRMPSAVGYQPNLADEMGSLQERITSTRGHSITSLQAIYVPADDYTDPAPATTFAHL
FT                   DATTELSRDIASKGIYPAVDPLSSTSRILDPRYVGQAHYDCANRVKAILQRNKELQDII
FT                   ALIGIDELGEEDKTTVNRARKIEQFLGQNFYVAEKFTGRPGSYVPADETIEAFTRICDG
FT                   VYDDVPEQAFSGIGGIDDLEEKWHNMQKELGA"
FT   gene            352317..352589
FT                   /gene="atpC"
FT                   /locus_tag="BLJ_0276"
FT   CDS_pept        352317..352589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /locus_tag="BLJ_0276"
FT                   /product="H+-transporting two-sector ATPase, delta/epsilon
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99762"
FT                   /db_xref="GOA:D6ZXW6"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXW6"
FT                   /protein_id="ADG99762.1"
FT                   /translation="MKVNIVAADHPVWHGEATSVTIPASEGGMGILPDHEPVLTVIKQG
FT                   TLTVVEPDGDRHMFEVTDGFISFDSNKLTVAVERGHDVQYSGTAE"
FT   gene            352677..353447
FT                   /locus_tag="BLJ_0277"
FT   CDS_pept        352677..353447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0277"
FT                   /product="protein of unknown function DUF91"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99763"
FT                   /db_xref="GOA:D6ZXW7"
FT                   /db_xref="InterPro:IPR002793"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXW7"
FT                   /protein_id="ADG99763.1"
FT                   /translation="MRVIVADCSAEYSGRLNASLPLAKRVLLIKADSSLLIFSELGSYK
FT                   PLNWMTAPCTIREIDPAAKSAQHSRESVAGGAVDGDSATHSPESVAAGEPEKVLRVSAD
FT                   KGSDILEVTLQHIYSDQTYDLGEDPGLIKDGVEDHLQRYLAEQIERIGKGTKLVRREYP
FT                   TAIGPVDIMAVNAEGEHVAVEIKRHGGIDGVEQLTRYCELLNRDPLLAPVHGIFAAQTI
FT                   TPQAQVLAKDRGFTCLILDYDDMKGTEDDSLRLF"
FT   gene            complement(353590..354558)
FT                   /locus_tag="BLJ_0278"
FT   CDS_pept        complement(353590..354558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0278"
FT                   /product="peptidylprolyl isomerase, FKBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99764"
FT                   /db_xref="GOA:D6ZXW8"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXW8"
FT                   /protein_id="ADG99764.1"
FT                   /translation="MRKSVKSMLSPLGKAVALACSLAMCVSLAACSSSSSDSKSSSNSS
FT                   DKKGQIAGVTAKGKLGEKPTISFNTPMTVSDGSYVVLQKGDGDVIEEGDRVCAQGIALN
FT                   VKDGTELMDTWTKNTPDCSLKVDSKTLSSTYYNQIKGAKINTTIGFGVNAQDSSGYSYI
FT                   LAMTFVSKSKDLKKATGEEVKDVPANLPKVTRAKNGKPSIDMNGQGSVDSLISQTLIKG
FT                   NGAKLTDKNTVVVKYTGWLTNGKQFDSSWDRDSTIDADLFSDSSGQHQVIEGWQKGLVG
FT                   QTVGSQVLLVIPPDQAYGDKEQGSIPANSTLVFVIDILAAY"
FT   gene            354639..355709
FT                   /locus_tag="BLJ_0279"
FT   CDS_pept        354639..355709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0279"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99765"
FT                   /db_xref="GOA:D6ZXW9"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXW9"
FT                   /protein_id="ADG99765.1"
FT                   /translation="MSAEEQTTRPDKGAKRPSRHAKIMRGVVTPIFGLLAVAAVVLGYM
FT                   NATIWKPSTEITASATMSGSRYTVTDPNVLTLLDQNATITVDSGSSQDEACVALGPSKD
FT                   VAGWVASEKSYTRITGLASWSELSTQKGSSTSQGAPASADDAVAFKDSDMWTAVKCGTG
FT                   SVSLESKKTGASTVAIVDLGENATNAKVQLHWVRSEVPDFAMPFYLSGGLLAVLAVLCA
FT                   SVFAMPPHKRRKRMVEGTASAVIEEEAPASIAVSGKPDGASRRNRRRHATNRRSGRASS
FT                   QSEATETPVIIDPSSRNLVADQQTGAESGAETGFSAGDNESTSVITPDELQAYFSRLAQ
FT                   EVNTGDDSADDGQEES"
FT   gene            355709..356716
FT                   /locus_tag="BLJ_0280"
FT   CDS_pept        355709..356716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99766"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXX0"
FT                   /protein_id="ADG99766.1"
FT                   /translation="MNKRWNELCVAALACVALVVPLTACEGRLPTPAADTSTKVAPDLT
FT                   EAQEKKIRLKILKTIDEADQAKNPDGYAAVMGGPQLDIRISQTTINQRGGGMSKYATIP
FT                   KDIAQTVIPMDDGWPRSVFTITTTTEDQQSKRLLVFDQESAQQNYKLMAMARLFEGAKL
FT                   PKFEIPTIGSQMGTAKDEKLVATPADALTQYADVLQNGSKSQYASKFADDLLRQELANT
FT                   TAKVQEGMQRNNGTQEQKFTVVPEQMWVMRAADGAGDLVVGRINGEWTRKAGDGRESQP
FT                   ASDDEKALFNSDKYTSTMKVTYVNVVALYIPLASSGEQITAVGADRQPVKVEAL"
FT   gene            356963..357937
FT                   /locus_tag="BLJ_0281"
FT   CDS_pept        356963..357937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99767"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXX1"
FT                   /protein_id="ADG99767.1"
FT                   /translation="MAEQQFNPGVSLAGAVDLEALKHQVKAEPGQAGGAPAAGGYVIDT
FT                   TENTFQAMVQTSATFPILLLLWVPTDDRLFPMARALGDAVNALNGQIQLSRIDISSNPS
FT                   IAQALQVQGVPALFALIAGRPMPLLQGLPGDDELKQLTDEVIPKIIEAAAQSGVNGTAP
FT                   YSGDPDSDAAKSAGATGAVAGAEQVPPEHAEAHRLAEEGDYAGAAAEYERVLGSDPSDA
FT                   LAARERAKALLLARSGAADVRDVRAAAAAAPDDVEAQLAVADIDMIGGQIQDAFDRLLD
FT                   FLAAGHKADIEQVRKRLLEYFAIPEPTDPRLTRARRRLATLMY"
FT   gene            complement(358025..358651)
FT                   /locus_tag="BLJ_0282"
FT   CDS_pept        complement(358025..358651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0282"
FT                   /product="adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99768"
FT                   /db_xref="InterPro:IPR012042"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXX2"
FT                   /protein_id="ADG99768.1"
FT                   /translation="MSEPTDDFEYERRFFCRELPAEYDDGDAPTLIIQSYYVHADNYAL
FT                   RVRLVSRKVHVDMTPDVNPVAVLDEYRDRFSEAYVTVKGPSVGGTRYEVEREIDTRIAA
FT                   ELIKRGGSVIIKNRYSVWIEEDGWSVDVFGGPNAPLIVAEAERSGPVTNLTIPKFCITE
FT                   ITDQARFNNDGLANRPFCKWADDFEEELALEGPRFQQYFGKNRMV"
FT   gene            358749..358824
FT                   /locus_tag="BLJ_0283"
FT   tRNA            358749..358824
FT                   /locus_tag="BLJ_0283"
FT                   /product="tRNA-Arg"
FT   gene            359205..359594
FT                   /locus_tag="BLJ_0284"
FT   CDS_pept        359205..359594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0284"
FT                   /product="putative endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99769"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXX3"
FT                   /protein_id="ADG99769.1"
FT                   /translation="MSEKMEAVATSEAPAALGAYSQAVKANGFVFVSGQLGIDPATGEL
FT                   AGETAGEQAAQALKNIKHILDTAGTGIEHVCRATIYLKNVEDFKEVDARYAEAFIGSVK
FT                   PARVAFGNNMIPKGALVEIDAIAVE"
FT   gene            359776..360693
FT                   /locus_tag="BLJ_0285"
FT   CDS_pept        359776..360693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0285"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99770"
FT                   /db_xref="GOA:D6ZXX4"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXX4"
FT                   /protein_id="ADG99770.1"
FT                   /translation="MASKGKPSPRSAVSPLSDEQVKRLAARHTLVDSTQYYPTGPRTPN
FT                   QPEIDAQNPKATKRLLGGVSIVFRASCKTKAWGLEQVPETGPFITAASHITMFDVFVPM
FT                   MSLFHMGRRPRYMAKAEMAKWPLIGKWFQLVGMQPVQRHSGKAKQIEETSIDILTSGRP
FT                   LTVWPEGTVTRDPKKWVMSIKEGVGYIALESSRRLGHQVPLYPAVTWGAASINHWWPWP
FT                   RKNVVMCYDHALDYSDLLADMDSWGEEPPAEAVNELMWRVLKRMNTVLEEIRGEQFPAE
FT                   GYWDYRSMSRKPWPEAGGPFPAEK"
FT   gene            360787..361788
FT                   /gene="gpsA"
FT                   /locus_tag="BLJ_0286"
FT   CDS_pept        360787..361788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="BLJ_0286"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD(P)(+))"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99771"
FT                   /db_xref="GOA:D6ZXX5"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXX5"
FT                   /protein_id="ADG99771.1"
FT                   /translation="MGKNITVLGAGAWGTAFGQVLADAGNTVTMWAKEQRIVEDIRDRH
FT                   HNAVRLPSVEKLPDNMTATGDRAEAVKNADIVVVAIAAQFARVALVEFKGLIPDHAIVV
FT                   SLMKGIERGTNKRMDEVVRESLDLPADRFAAISGPNLSKEIADRHPAATVVACTNLDNA
FT                   TKVAEACTTSYFKPFVTTDVIGLEMCGSLKNVTALAVGMARGAGYGENTAAMIETRGLA
FT                   ELTALGAAAGADPKTFFGLAGVGDLIATCGSPLSRNYTFGANLGKGLTVEGATKVSNGV
FT                   AEGVPTTDAVVALGEQLDVPTPLAYQMSRVLNEGISCSEMLAGLFGHEVTGE"
FT   gene            361975..363162
FT                   /gene="ddl"
FT                   /locus_tag="BLJ_0287"
FT   CDS_pept        361975..363162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddl"
FT                   /locus_tag="BLJ_0287"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99772"
FT                   /db_xref="GOA:D6ZXX6"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXX6"
FT                   /protein_id="ADG99772.1"
FT                   /translation="MAKKRVVVLYGGRADEHSISCISTAGVLGAMDTERFEPIPVGITK
FT                   DGKWIINGEDPRGWNLDGGELPTVKITPGSRPVMLDPSRGQDGFFIGETRHINSADSGF
FT                   GTSFVSMSDPEMHHVLTSLGHVDAVLPVLHGPYGEDGTVQGLLEMMGVPYVGCGVFASA
FT                   ACMDKHYTKVVLGAAGIPTAPGVTVDARNFTAADVLAKIEDAGLTYPLFIKPSRAGSSF
FT                   GVTKVEKADDRETQQDRLAAAIATAGEHDWKVLVEQGIDGREIECAVLCPKAGDEPEAS
FT                   WPGEIVLDHQNDDQFYDFDSKYMDASASHVEVPANLPVSVLEDVRDVARRAFKAVDGAG
FT                   LSRVDTFVTPDGTVMVNEINTMPGFTPISMYPKAWDATGVSYTELITRLIEGVLR"
FT   gene            363414..364568
FT                   /locus_tag="BLJ_0288"
FT   CDS_pept        363414..364568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0288"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99773"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXX7"
FT                   /protein_id="ADG99773.1"
FT                   /translation="MNNLRKIAAGSLAAVLAFSMAACGSSNASSDGTGKAVTVNEKSAK
FT                   ATSLADFGTMEDLEKAAKEEGALNVIALPHDWSNYGEVIEGFKKKYPEIKITELNPNAS
FT                   SKEEIDAAKTNKGTDAAPDIFDVGQAIAATSTDYFAPYKVQAWNKIPDAAKNVDGAYYA
FT                   DYTGIMSVGWNADKYGDVASLNDLLDPKFAGTVSLNGKPTEAGAAFNGYLMVNQLAGGD
FT                   INNLQPGLDFFKKLKEAGNLNTIDVTNGTIDSGQTGVVFDWTYNQASYKKELKSKGVNW
FT                   KYKTFPKAQVVSYYNQAINKDAPHPAAARLWEEYLYTAETQNLWFKGGANPVLLDSMKA
FT                   DGTVDQATLKDAITIEGQPVTYSNDDSTRITEWLQNNWDKTIGN"
FT   gene            364578..365525
FT                   /locus_tag="BLJ_0289"
FT   CDS_pept        364578..365525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0289"
FT                   /product="spermidine/putrescine ABC transporter permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99774"
FT                   /db_xref="GOA:D6ZXX8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXX8"
FT                   /protein_id="ADG99774.1"
FT                   /translation="MTAAIAPIAPNGPAASKAAGPSAASTPASSALAKHRQELGTLATT
FT                   LPFFAYTACFLLAPTVIVIIGAFQDRSGGFTLANFHKMFEANTIAAFGTSILVSVASSL
FT                   IGAVVGALASYALVIGAKPNGPLRRMVAAISSVLAQFGGVMLAFAFIATLGINGIGTML
FT                   IKTLTGYTVNPNWLSSLPGLVTVYCYFQIPLMIIIFLPAVDSIRPQWREACESLGGNTV
FT                   QYWTRVACPILAPRFISAFLLLFASAFSAYATAAALFSQRSILVPLMIQGAMRNEMDPN
FT                   QQGFAQVLAFAMIIVVAIVMLLSHAVEKRAGRWQ"
FT   gene            365522..366376
FT                   /locus_tag="BLJ_0290"
FT   CDS_pept        365522..366376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0290"
FT                   /product="ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99775"
FT                   /db_xref="GOA:D6ZXX9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXX9"
FT                   /protein_id="ADG99775.1"
FT                   /translation="MTETSTTKPPQLRAARVRKQSIIKFVILFVTLAFLFVPLLAMFIF
FT                   TLRHPLSGRWSAAPWTAIFTGNGESLGADLSVLWQGVGISLSLSAVTVVIMLILLVPTM
FT                   VIVHIRSKASERAIEWVATLPLTIPAIVLVVGLGPIYRWLSADVLSTNPIWLCFAYVIL
FT                   VMPFAFRAIAVGLNSIDVKTLVEASRSLGASWPKVFFKVIIPNLWQSILSASFISIAVV
FT                   LGEYTVASLLGRMNLQVALYQLGQSNAQISTAMSLLALLFGVVLLVALDLISDAMRKSR
FT                   EGK"
FT   gene            366381..367667
FT                   /locus_tag="BLJ_0291"
FT   CDS_pept        366381..367667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0291"
FT                   /product="ABC superfamily ATP binding cassette transporters
FT                   ABC protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99776"
FT                   /db_xref="GOA:D6ZXY0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXY0"
FT                   /protein_id="ADG99776.1"
FT                   /translation="MNNDSTPTRQETGTAVDAAPASPAIPAAVSSTAEDAFKNDPTATL
FT                   EGVRGKDVTKAAKALLKDTAKRGGGSIQMQNVVKIYPGSTVHALDDFNLDIKPGEMVVL
FT                   LGGSGCGKSTALRSLAGLEDIQGGRIMVGGQDVTGVPVNKREMAMVFQAYSLFPHMTAL
FT                   ENVEFGLEVRGMGKAERRKIAMEQLELVGLADQAKKYTQQMSGGQQQRVALARALAIKP
FT                   RVLLLDEPLSALDAKVRVQLRDQIRRIQLTTGTTTVFVTHDQEEALAVADRIGVMNKGK
FT                   IEQIAAPQDLYQRPATEYVATFIGLTNRLLGASNGDEAVVFGQRVPLLAGSAKGDSVAV
FT                   LVRPENLMLALAGSSDSHVGERARVEVIHFLGSLVRVDTVITSGEYQRWNKGEQLKATV
FT                   QLPASELPAGLAVGDDVIVAPRPVAALAC"
FT   gene            368140..369183
FT                   /locus_tag="BLJ_0292"
FT   CDS_pept        368140..369183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0292"
FT                   /product="Abortive infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99777"
FT                   /db_xref="GOA:D6ZXY1"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXY1"
FT                   /protein_id="ADG99777.1"
FT                   /translation="MSKPMPPAQQPQVPEQPQQPQQTPRDWWFTAHRRFSTIGSALAIM
FT                   MVFWIGLNILATEALRTLLGADVPAWAVLLASSGPLYVVAMPLSMLAFTRVPVIRTRQY
FT                   PMKAGEFIRIFVMCIPVMLLGNMIGNILSAGATDGQATNRINDVILGSDWRVNALFIGL
FT                   LAPVCEEWIFRKEIISRLRRYGEKTAIMFSALAFALFHMNVFQFFYAFGLGLMFGYVYT
FT                   RTSRLRYSVAMHMLINLNGSVLAPLVIQQIDPRILDGTISEAEIMRMAETGNMGGMGIM
FT                   MLYGIVMLGLCIAGIVLLITKRKSWEFYLAPEELPAGLKIRTAYANPGVISYLLLTVIL
FT                   TGWMLFA"
FT   gene            complement(369222..370019)
FT                   /locus_tag="BLJ_0293"
FT   CDS_pept        complement(369222..370019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0293"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99778"
FT                   /db_xref="GOA:D6ZXY2"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXY2"
FT                   /protein_id="ADG99778.1"
FT                   /translation="MTEYAQDIAHWFQVNAGKLIWLAVVLAVVFAADRVISRVLRRVLD
FT                   SSQIPSASIFVNLTRVTIWVTGTAMVLQPVFGINPTTLVTALGVGGVAISLGLKDTIAN
FT                   VIGGFGLMLGRVIQPGDLVTIQGVTGTVHDITWRQTVVRTRSGDMMVIPNSVLNTAALT
FT                   KLTPASEGMATLEFTAKASGDPSAISQDILDRVTKATADVALEGQPPLVKFTGFSPYGM
FT                   TGQVLVFAREGVLPSTVRDMAARAIAGSGTKYLVEDGGSSDNL"
FT   gene            complement(370099..371532)
FT                   /gene="aspA"
FT                   /locus_tag="BLJ_0294"
FT   CDS_pept        complement(370099..371532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspA"
FT                   /locus_tag="BLJ_0294"
FT                   /product="fumarate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99779"
FT                   /db_xref="GOA:D6ZXY3"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXY3"
FT                   /protein_id="ADG99779.1"
FT                   /translation="MSETSNKARLEHDCIGQMEVPADVYWGIHTQRAIGNFPVSGITDS
FT                   QHPELIRAYATVKRACAIANEELGLIDPAKAEAIRAACLEIEAGKLADQFPVDVMQGGA
FT                   GTSSNMNMNEVIANRALEIAGHQRGDYTYIHPNDDVNESQSTNDTYPAACKLALIDAIG
FT                   PLAESTKKLAKAFHDLADKHINDVTIGRTQLQDAVPMTYGQEFHAFATLLKSDLAAFDR
FT                   VVPLLAQLNLGATAIGTGICADLRFRKSAIKHLAHITGLPVTAAPDPVAAMTDMGAYVA
FT                   TSAAIKSLAVHLKKAADDLRLLNSGPRCGFNDLNVPARQAGSSIMPAKVNPVIPECVNQ
FT                   CCFTIFGMDVTVNWAVAEGQLQLNAFDPVMVHELLTGMALLTRAMETFRVNCVEGIEIN
FT                   ADLGRSYAQSSPSISAALNHYIGYEHAADIAAEAVRTGRTVREVAGERTDLPAEQLDEI
FT                   LDPIRLARGLGQTCREHRD"
FT   gene            complement(371651..372382)
FT                   /locus_tag="BLJ_0295"
FT   CDS_pept        complement(371651..372382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0295"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99780"
FT                   /db_xref="GOA:D6ZXY4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXY4"
FT                   /protein_id="ADG99780.1"
FT                   /translation="MPRPRHDSEVLPAKERLENAFWELLADRDYRKITVTDVVREAGVN
FT                   RNSFYYHFSSLPELADSAILHQVESIPINRTPDPNGNPEEQWRDRVTATLSDPEQRQRL
FT                   DRLALLAGPHSTLELTESLRDFCRLQMLSTLQRDPKNLDLKTDLMVEFTVGGMLAVLQR
FT                   WPELSDAIEIKDLLKEDVAVLAMGIYLAMSQKDMLNYWNRIFVHNAQDSAAPGMPAAAT
FT                   HAAPSPISPSNGPAGFPGYTA"
FT   gene            complement(372473..373975)
FT                   /locus_tag="BLJ_0296"
FT   CDS_pept        complement(372473..373975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0296"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99781"
FT                   /db_xref="InterPro:IPR024499"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXY5"
FT                   /protein_id="ADG99781.1"
FT                   /translation="MVNCCAQPHGRTQSQDHMAQGDMQYQRKQEVRMTGIIDYAHTETR
FT                   SFADLPFNEIDALIISTLIYEDVASICPTLMLDETQSGSFAARIRAFEPKHPLIWLKGI
FT                   WHPELESVSLDEANRELHRSPKTHADDKPHEAQMVSVVNPDLTHDLFQAAGENPRYANV
FT                   RLGAVVEHINQGEQTQFAAATFQLPDGHKRRKPTYKGTLVISFRGTDDSLIGWKEDFNM
FT                   AFQYPVPAQRSASAYLDTVARLWEGPIILVGHSKGGNLAIYAAMNADPKVRKRIQHVYS
FT                   LDGPGFPPEIVTSPAYRTIQPKVTKIVPSSSIVGMIFETPEPCRVVSSDSDGIMQHSAF
FT                   TWLLDGDQFITEPDLSSSSQLFNEELNHWIATLTPEQRERAVDALFTVLHANGATSFSE
FT                   VMSNFPASIPAMLGAYVGLTPADRRHLVEALAILFKASTAKRRPTPAPASAPSSATAKG
FT                   TAETPAGTATGTDSAAPARADTDADAGTAASPSAEDATEIAD"
FT   gene            complement(374201..374752)
FT                   /locus_tag="BLJ_0297"
FT   CDS_pept        complement(374201..374752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0297"
FT                   /product="methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99782"
FT                   /db_xref="GOA:D6ZXY6"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXY6"
FT                   /protein_id="ADG99782.1"
FT                   /translation="MTQRQLMRATVETPIGRMMMASDGEGLTELCLEDWWWATDHQAVL
FT                   DSNRESDRESDVFRMTRVWLTAYFAGERPGLDQTPPLHPAGTPFQHEVWNLVAEIPYGM
FT                   TVSYGELAAELAERRGGGRMAAQAVGGAVKRNPVTIIVPCHRVVGSGRAFGGYGGRLDI
FT                   KAELLDHEGVDLARFNLPNL"
FT   gene            375127..375522
FT                   /locus_tag="BLJ_0298"
FT   CDS_pept        375127..375522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0298"
FT                   /product="multidrug transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99783"
FT                   /db_xref="GOA:D6ZXY7"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXY7"
FT                   /protein_id="ADG99783.1"
FT                   /translation="MESIRGVRHIADAAGPPSALRRNVTKIQAGLLRNERQEGGGHGGC
FT                   RVREFLVLVEERHVGVVQELHFGTVADQGLGLFGQLIGYRHAFLISTAMAVPDVSIAWF
FT                   YPLFMLAMPIAWLLYTVTASYVHGGTR"
FT   gene            complement(375217..375612)
FT                   /locus_tag="BLJ_0299"
FT   CDS_pept        complement(375217..375612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0299"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99784"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXY8"
FT                   /protein_id="ADG99784.1"
FT                   /translation="MCYLHGQQVTKIRQSQEKAKPPRVPPVFQRLSGAAVHITRGDRIQ
FT                   QPSDGHGQHKQRVEPSDGHIWHGHGRGNQERMTITDQLAEEAKALIGDRAEVKFLNYAD
FT                   VPFFNQDEEFPNPTAAVAAAFLALVAE"
FT   gene            375613..375685
FT                   /locus_tag="BLJ_0300"
FT   tRNA            375613..375685
FT                   /locus_tag="BLJ_0300"
FT                   /product="tRNA-Gly"
FT   gene            375732..375803
FT                   /locus_tag="BLJ_0301"
FT   tRNA            375732..375803
FT                   /locus_tag="BLJ_0301"
FT                   /product="tRNA-Val"
FT   gene            375852..375927
FT                   /locus_tag="BLJ_0302"
FT   tRNA            375852..375927
FT                   /locus_tag="BLJ_0302"
FT                   /product="tRNA-Val"
FT   gene            complement(376064..377188)
FT                   /locus_tag="BLJ_0303"
FT   CDS_pept        complement(376064..377188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0303"
FT                   /product="transposase for IS3509a"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99785"
FT                   /db_xref="GOA:D6ZTL0"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTL0"
FT                   /protein_id="ADG99785.1"
FT                   /translation="MCGRAMKKNGRTGKGVQRWKRPACRLSSTMPQRRRRRERTLEEFL
FT                   SWLPGPSSQRAADSAGDARALRKRIAWCWRIRPRIAPPDARRHTVMADGTYMGHGWCLI
FT                   IAIDGQTGEVLDWQWCAHESKAAYLALFSRLPAPDVLITDGLRGAEAACTQAWPGTRIQ
FT                   RCLVHVQRNTRTDLTSRPRLQAGRELKRLSDRLTSVETAGQAVRWGEGLNAWHERWKDF
FT                   IAERTYARDDPSNPKASRHRWRWTHEELRRCYRRLERLFREGRLFAYLEPELLKGGPVA
FT                   RTTNRLEGGVNSVVKDVLRNHRGLPEEHMRRACEWVCYMKTAHPRPESFIPDALRKGEK
FT                   ATTPEPDDSVAPAYGTGIDWNEFHTTTRYPNTTD"
FT   gene            377602..377826
FT                   /locus_tag="BLJ_0304"
FT   CDS_pept        377602..377826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99786"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXZ0"
FT                   /protein_id="ADG99786.1"
FT                   /translation="MVCTTLNFAEKYLLKTEVRSVAGMSGGTSDAGTDFDVDFGGEGDL
FT                   GSDHATGFNRSLSADDYWAAAGYADESLY"
FT   gene            complement(378240..378686)
FT                   /locus_tag="BLJ_0307"
FT   CDS_pept        complement(378240..378686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0307"
FT                   /product="Vacuole effluxer Atg22 like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99789"
FT                   /db_xref="GOA:D6ZXZ1"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXZ1"
FT                   /protein_id="ADG99789.1"
FT                   /translation="MPLVLLVQQLLQSIAQTLHQSPLFGRQVPRETNLCLCAHQLGSSR
FT                   SHSCVADHEPHAPPHSTSVLTTCVNRMHRHHDSPMISRVPRSHYCFFPKTASIIGTFLV
FT                   ATTTSLTGNASFGVLSIAVLLVAALVFLLLQKDPTRANVLRHRR"
FT   gene            378570..378710
FT                   /locus_tag="BLJ_0306"
FT   CDS_pept        378570..378710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99788"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXZ2"
FT                   /protein_id="ADG99788.1"
FT                   /translation="MSAKAEIGFTRDLSAEERRLMQGLCDALQQLLNKQYQRHMWDCSI
FT                   A"
FT   gene            378689..378853
FT                   /locus_tag="BLJ_0305"
FT   CDS_pept        378689..378853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0305"
FT                   /product="flagellar FliF M-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99787"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXZ3"
FT                   /protein_id="ADG99787.1"
FT                   /translation="MGLFDSLKNFAADNLGNVLGGDFNLGSIGDLPAVIGEHFNADQLG
FT                   EINRSLATI"
FT   gene            378850..379035
FT                   /locus_tag="BLJ_0308"
FT   CDS_pept        378850..379035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0308"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99790"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXZ4"
FT                   /protein_id="ADG99790.1"
FT                   /translation="MNADRLDELQALAEENISADQISQVAGAIQEQGANLDLGSIAEQE
FT                   GLPADIISQISGLLGK"
FT   gene            379414..380484
FT                   /locus_tag="BLJ_0309"
FT   CDS_pept        379414..380484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0309"
FT                   /product="Predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99791"
FT                   /db_xref="GOA:D6ZXZ5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXZ5"
FT                   /protein_id="ADG99791.1"
FT                   /translation="MSFRANLQYLRAQRNLTQERLAMLLGVSRQAISKWESEKAYPEMD
FT                   KLLMICDLFGCTLDDLVLGDVSRPAASASAAGSSNVDSSAETASPLAASSKTAGIIAPI
FT                   AELAQDITGYDEHRRRFALLIAGGVAAIVAGVGIGNLFDSSNSILGATPLNDFLTFLCV
FT                   CVGVIAGLAMLIPGGLSRIDFKRHHPYVEDFYTGEDRSRELRLLVIGIVGGISAILIGI
FT                   AVTVYADDMLGVSDGWPNAVFLLLCAPGVFGFVYCGMRYSLLNINAYNKAAEDDRKEHA
FT                   GEQDFYAKLTGAVCGIIMMIATLIGLCLLFLSPAALRGDWSTAGTGMFWVAWPIGGMLC
FT                   GIAATAIQLFKDYRER"
FT   gene            complement(380503..380874)
FT                   /locus_tag="BLJ_0310"
FT   CDS_pept        complement(380503..380874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0310"
FT                   /product="Vacuole effluxer Atg22 like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99792"
FT                   /db_xref="GOA:D6ZXZ6"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXZ6"
FT                   /protein_id="ADG99792.1"
FT                   /translation="MHHDLDIGTIPRETNLCLCAHQPGSSRSHSCVADHEPHAPPHSTS
FT                   VLTTCVNRMHRHHDSPMISRVPRSHYCFFPKTASIIGTFLVATTTSLTGNASFGVLSIA
FT                   VLLVAALVFLLLQKDPTRN"
FT   gene            380951..381274
FT                   /locus_tag="BLJ_0311"
FT   CDS_pept        380951..381274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0311"
FT                   /product="RelB antitoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99793"
FT                   /db_xref="GOA:D6ZXZ7"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXZ7"
FT                   /protein_id="ADG99793.1"
FT                   /translation="MSTTTVRMDDDLKAEVNAILDSMGLNFNTFVNMASVQLVSQRRIP
FT                   FEVKAPEPVLPRAGHVAANGVTYRGVDEQGYPVVEVPNAMVLNPSRGADGVAVLPKAWR
FT                   DGE"
FT   gene            381264..381653
FT                   /locus_tag="BLJ_0312"
FT   CDS_pept        381264..381653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99794"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXZ8"
FT                   /protein_id="ADG99794.1"
FT                   /translation="MANNHDSPELMPVPERLHVFDVYRMQVRFEDDPTTSRNHYVAAIV
FT                   IQADDDGGVAVKLTSNPTWHGAGDVQLPEYEHAGLTHLTTARCAQLVRFLRSDLPGFTG
FT                   RLSRNDAIRVANAVGEVKPEEQVWL"
FT   gene            381832..382575
FT                   /locus_tag="BLJ_0313"
FT   CDS_pept        381832..382575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0313"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99795"
FT                   /db_xref="GOA:D6ZXZ9"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZXZ9"
FT                   /protein_id="ADG99795.1"
FT                   /translation="MSMDDETDSRYTTGNIAKLTGVSVRTVQYYDAKGLLIPNEISDGG
FT                   RRLYGTAEVERMRVILFLKGLGFKLEQIRSILSDERPERVLVDLLDQQTASLQSGIAEQ
FT                   KQRLDDCLQLRKALTVSASDFVSPTLTDMATVMNTTTTHSLHTTYLVMLAIGLPATLLQ
FT                   IVCLVIGVMTDVWWPLPVAVLLAIALAVAATKYYRSRVQYLCPACHETFQPGMREFVFA
FT                   AHTPKTRKLTCPHCGHRGHCMELSI"
FT   gene            complement(382756..384033)
FT                   /locus_tag="BLJ_0314"
FT   CDS_pept        complement(382756..384033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0314"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99796"
FT                   /db_xref="GOA:D6ZY00"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR024671"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY00"
FT                   /protein_id="ADG99796.1"
FT                   /translation="MTDPTNVHEPVPQSAKLTASEKKWIIYDVGNSAFVLLSTAVIPIY
FT                   AKSLMPADGNIVSAWGYAQTIASLVIALLMPLLGSIADVQGMKIKFFLGFFGTGVVTCC
FT                   AMALPLTWLPFLVVYILATIGLNGSLTFYDSMLIDTTSNERMDKVSSHGYGWGYIGSTV
FT                   PFIFCIALIFGGPSLFGWSTVACTRASFIITAIWWVAFTIPLLTSYRQVHYRATRDQLG
FT                   SAMRGTFSELAGTFGKIVKNKPLWMFMIAFFFYIDAVNTVISMSTSYGAELGIDSTQLV
FT                   VALLVTQFVAFPCAILYGRLAARFGCKAMITTAVVAYMCIVLFAAFFMKSAVEFWILAI
FT                   LVGVFQGGIQALSRSYYGKIIPKDHANEYYGFYDIFGKTASIIGTFLVATTTSLTGNAS
FT                   FGVLSIAVLLVVALIFLLLQKDPTQA"
FT   gene            complement(384257..385273)
FT                   /locus_tag="BLJ_0315"
FT   CDS_pept        complement(384257..385273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0315"
FT                   /product="PfkB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99797"
FT                   /db_xref="GOA:D6ZY01"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY01"
FT                   /protein_id="ADG99797.1"
FT                   /translation="MLNLRRGIGTHEPSVISLGQVWVDIMLNVDEVPAQGGFAVADHPK
FT                   PSIGGSYRVLQAASRMGVPTEHAGILGNGLWAHFIRQSFQDNGITHIGQDRLDEDSGFR
FT                   VVLSSGAPKKTFIASYGAEAHGDADTFNTLEPQPKDVVHISGNTLMDHTATGVDGFLLK
FT                   AGTDPAARDYTLVINPTNTLRLVNDHMLEDLVLARPVWSCNRQEAMTLAERLGAPIDDS
FT                   KVTIGGGLDDFMHQLCDGLGTTLRAPLVVRVGARGAWIREPGGETIHIEGYPTKAVHTH
FT                   SAGGCHTGVMCAMLAKGHSLAESVKIANAAASIAIQRSLNGVPQCPDYDEAIALIGE"
FT   gene            385644..385838
FT                   /gene="rpmB"
FT                   /locus_tag="BLJ_0316"
FT   CDS_pept        385644..385838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="BLJ_0316"
FT                   /product="ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99798"
FT                   /db_xref="GOA:D6ZY02"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY02"
FT                   /protein_id="ADG99798.1"
FT                   /translation="MAARCAVCGKGPQTGFTVSHSHRRTKRSFRPNLQSVRTTIDGENT
FT                   RLRVCVKCLKAGKVQRVAA"
FT   gene            385938..388571
FT                   /locus_tag="BLJ_0317"
FT   CDS_pept        385938..388571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0317"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99799"
FT                   /db_xref="GOA:D6ZY03"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY03"
FT                   /protein_id="ADG99799.1"
FT                   /translation="MSITMDTTLASLVTNKRRVSALKSLGIVTVGDALTYYPFRVTEPV
FT                   PLRAIREAAPGQQMAFAAVIRDMRVVPMNARRGYRLEATVDDADFARSRRVPGSTARLT
FT                   FFSYRKSYVDWVSMRLRAGTSVVVSGMPSEYMGQLQFTHPEILTVAPGSAGAGAGLEGY
FT                   ARGAASGNGAFAGSTDPYASVQSAYPPAAAASSGAALKYDADTVQEALTRVCRPRPVYH
FT                   ASSRISSEHIHETILGLLWMMGARTSSTPDGQLAGAGSAGIVAPTTDTIAVQNGEENSG
FT                   TTAESGAEALSQSIPDVLPESVRKAKNLMHRAEAFLAIHDPASTTRFKEAIETLRYEEA
FT                   FVSQTSLLKARSHAHKSAAHSCPLVTDSLRDQFIASLPFSLTAGQQQVIHDIAADLAHD
FT                   WPMQRLLQGEVGSGKTVVALAAMLQAVDAGYQAVLVAPTQVLAEQHAETIGRMVEQLKP
FT                   AIPVTLLTGGMKLAARRKALAAASSGEPGIIVATHAAFSKTFQAPHLALVVIDEQHRFG
FT                   VEQRESLNAKTDDGTTPHLLVMTATPIPRTAAMTWFGDLDISWLTELPGGRKPIRTVVV
FT                   NEADAATMGRMFAHIRARVDAGERAYIVCPRIDADDEGNEGGSGVSAAAGSARGRAAAS
FT                   GSSARTAAGGRATRAAADAIGIDDPYETFDENGETVARPPLHAVAEIADRLQKLPQFQG
FT                   IRFATLTGRDKDDVKTQVMADFAGGETPILVSTTVIEVGVDVKQASCIVIFDADRYGLS
FT                   QLHQLRGRVGRGGTNSWAFLISRAEPGSPAEQRLEVIHHSLDGAEIAQADLEFRGAGDV
FT                   LGDAQSGGKSSLKLLRVVKDADMIADARTRAEQLLAADPELADEVQLAGAVLDFTRGNE
FT                   TFLTSS"
FT   gene            complement(388706..389749)
FT                   /locus_tag="BLJ_0318"
FT   CDS_pept        complement(388706..389749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0318"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99800"
FT                   /db_xref="GOA:D6ZY04"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY04"
FT                   /protein_id="ADG99800.1"
FT                   /translation="MATIKTTNRPKVSDIAQAAGVSPATVSKVINGRDGVSDETRDRVE
FT                   LLLGEAGFRKKLPTTKTMRSIELVVSEMTNNGTVEMVKETASYARDFGLGITVSCAGPD
FT                   SGEYATRNEASSCLRNAIERNPLGVILLLSNISSAEESLLQTRNIPYVIVDPVGQVSAD
FT                   ALGVGIDNWTGGMLATQYLISLGHRRIAVITGPTNSQSSQARLSGYMAALQKNGISADP
FT                   HLIKVGDYVSDKAYKAACDLLEMREQDRPTAIFAFNDLGAINVYRAARQHGISLPEQLS
FT                   IIGFDDVYPAASMCPSLTTIRQPFDLIARQCIDLILEAREGKVERNYFIFPTQLVERES
FT                   CVSPARP"
FT   gene            390108..391019
FT                   /locus_tag="BLJ_0319"
FT   CDS_pept        390108..391019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0319"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99801"
FT                   /db_xref="GOA:D6ZY05"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY05"
FT                   /protein_id="ADG99801.1"
FT                   /translation="MTNATAKPDTSGMRKPKREYIGILYCLPYVVVFLFGMIIPMFYAL
FT                   YLSFFKQSLLGGTTFAGFDNFIAAFKDEALWSGFRRVLIYAAIQIPLNLILSLVAALIL
FT                   DSQRIRHIAVPRILLFLPYAVPGVIAALMWGYIYGDKYGLVGQIASMIGATAPNMLSEK
FT                   LMLFAIANICTWCSLGYNMLIYYSALIGIPNELYESARIDGASELRIAWSVKIPQIKGS
FT                   IMMTVLFSVIGTLQLFNEPSILMNSAPNVITSNYTPNLYAYNLAFNGQNLNYAAAVSLV
FT                   IGVIVMGLVAVVKVIGNKWENK"
FT   gene            391019..391996
FT                   /locus_tag="BLJ_0320"
FT   CDS_pept        391019..391996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0320"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99802"
FT                   /db_xref="GOA:D6ZY06"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY06"
FT                   /protein_id="ADG99802.1"
FT                   /translation="MSEAIAKPRSKSLQRRDAKLALKASQRYKRMQQREAAPKLTGKQR
FT                   VLNWLLHIIMGLMVIYCLVPLLWVFFSATKTNEGMFSSFGLWFDDKNVFWQNVQETLAY
FT                   QHGTYARWLLNTVMYAVVAGFGATIIATLAGYAIATMRFPGRNSLLAITLAFMSIPATV
FT                   ISVPLFLMYSKIGLVGTPWAVIIPQLATPFGLYLMIIYAQTSVPTSLLEAAKLDGANSW
FT                   TIFWKVAFPLLSPGFVTVLLFTLVGVWNNYFLPLIMLSDTNDYPMTVGLNMWLKMGAEG
FT                   TADGQIPNNYIVTGCLIAVAPLIIAFMFLQKYWQSGLSAGAVKQ"
FT   gene            392094..393506
FT                   /locus_tag="BLJ_0321"
FT   CDS_pept        392094..393506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0321"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99803"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY07"
FT                   /protein_id="ADG99803.1"
FT                   /translation="MTHKGVIMKKMTRIVSALAALTMVASVAACGSSTGAKNTKTAVTI
FT                   GDINNALTDTSKKIELNVWGFSGKQMAGPIEAFQKKYPHIKIKFTNTGAASDHFTKFQN
FT                   VVAANKDVPDVVQMSADRFEQYAISGALLNFANDDIEKAWSKLYAKTAWSQVHYAGGLW
FT                   GVPTDATPLAMYVRKDILDEHNLKVPTTWQEFYEEGVKLHKEDPSKYMGVLINNDISCF
FT                   TDLLRSAGARPWKVNSVDDISLSMTSGTTKEFIEFLQKCLQDGVMEAAPGWTDAFNRAT
FT                   NEGTYATYISQNWQGNSYKGQNPSLKGLIQVTLPPAFGDSADDFKSSSVGSMMSVSAAC
FT                   PKDKQAAALAFINWLDSDKEAIQSWQDTNHGNYFMAASAYQNSEDIRNMKETDGYFVNT
FT                   DVNSVYFESMDKVNTDWEYLPFMSQVGVVYKDVITPEMKVGGDMVGAMAKAQQKLKAYA
FT                   EDNGFKVTTDAD"
FT   gene            393597..394874
FT                   /locus_tag="BLJ_0322"
FT   CDS_pept        393597..394874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0322"
FT                   /product="Mandelate racemase/muconate lactonizing enzyme,
FT                   C-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99804"
FT                   /db_xref="GOA:D6ZY08"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034610"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY08"
FT                   /protein_id="ADG99804.1"
FT                   /translation="MSVITKVATYDFRFPTSATFSGSDAMNPDPDYSSAYVVISTDAGD
FT                   SGNGFVFTIGRGNDVVVRAIDSMSETLIGRNVEELLDNMRLAWDLFVRDSQLRWLGPEK
FT                   GVEHMAIGAVLSALWDLKAKRAGKPLWLLLSEMEPEELVATLDFRYLTDALTPQEALEI
FT                   LRAAQEGKAERIAHLKEVGYPGYSTAAGWLGYSDEKMVRLAKQETEVMGFKQIKLKVGQ
FT                   NLEDDLRRLKLAREAVGPDIAIAVDANQVWDVPQAIEWIGKFNDYDLAWVEEPTCPDDV
FT                   LGHAAIQKAIDPIPVATGEQMQNRVMYKQYLQAGSFKVMQIDATRVAGPQEIVLEYLLA
FT                   KKFGVKVCPHAGGVGLCEAISQLAMFDYVSVSGEMEDRVVEYVDNQHEYFVHPTVIKNG
FT                   RYVAPLAPGNGTEMKLDECMKYLHKD"
FT   gene            394890..395681
FT                   /locus_tag="BLJ_0323"
FT   CDS_pept        394890..395681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0323"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99805"
FT                   /db_xref="GOA:D6ZY09"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY09"
FT                   /protein_id="ADG99805.1"
FT                   /translation="MDLHLKNKVIIVTGGFKGIGKGITLRLAEEGAIPVVLNRSDSADD
FT                   EFRQDIEQITDSYDTYLIDLNNTDEIAPIVESVMKKYGHIDGVVNNAGRNDNLALETTS
FT                   WRQFEESIHGNLTHYYELVHQCVPALKASKGSVVNIGSKTALTGQGKTSAYAAAKGAIL
FT                   GLTREWAAALAPDEVRVNAVVVAEAWTPLYAQWIKTFGDEQAQRAQLEKITSKIPLGHR
FT                   MTETSEIADTVAFLLSDRSSHTTGQWVFPDGGYVHLDRALG"
FT   gene            395825..396721
FT                   /locus_tag="BLJ_0324"
FT   CDS_pept        395825..396721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0324"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99806"
FT                   /db_xref="GOA:D6ZY10"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY10"
FT                   /protein_id="ADG99806.1"
FT                   /translation="MTGNAQFEGVFCPSITITNADGTIDYDNWGKHLDHLIDAGIDGVL
FT                   LFGSIGEFYAIDVKTKAEAVRFAVSKVAGRMKVLVGVGDTNLDNVRTLAAESEVAGADA
FT                   LVAVSPYYFGPSPDCAKRYFSAVAKATTLPVILYNFPARTGNDLTPELVADLAAENQNI
FT                   IGIKDTVDTISHTRKVIAAVRKVNPSFSVLSGFDEYYTVNRISGGNGVLCGLTNVEPET
FT                   FVSLHRAWQSGDYATAIKSAERISYLMRLYDTADLFISAIKGAVKAKGLPIDTSIHEPA
FT                   VQLTDEQYRNIQGILGK"
FT   gene            396757..397194
FT                   /locus_tag="BLJ_0325"
FT   CDS_pept        396757..397194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0325"
FT                   /product="RbsD or FucU transport"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99807"
FT                   /db_xref="GOA:D6ZY11"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY11"
FT                   /protein_id="ADG99807.1"
FT                   /translation="MLKGIPSIIQPDLLKILSEMGHGDTIVLADAHFPAESLGIHSHVI
FT                   RYDGQPIEPLLDAVMQLIPLDQYTEHPVFLMDKVPGDAVDTPIWDRYRQVITKHEPDRQ
FT                   TAIGMLERFAFYNEAEKAYCIVATGEQSQYANIIIRKGVIR"
FT   gene            397214..398650
FT                   /locus_tag="BLJ_0326"
FT   CDS_pept        397214..398650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0326"
FT                   /product="alpha-1,3/4-fucosidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99808"
FT                   /db_xref="GOA:D6ZY12"
FT                   /db_xref="InterPro:IPR000933"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY12"
FT                   /protein_id="ADG99808.1"
FT                   /translation="MSNPTNDGINLNYLANVRPSSRQLVWQRMEMYAFIHFGMNTMTDR
FT                   EWGLGHEDPALFDPQNVDVEQWMDALVAGGMTGVILTCKHHDGFCLWPSRYTQHTIAAS
FT                   PWRDGKGDLVREVSESARRHGLKFGVYLSPWDRTEESYGKGKAYDDFYVGQLTELLTQY
FT                   GPIFSVWLDGANGEGKNGKTQYYDWDRYYNVIRSLQPNAVISVCGPDVRWAGNEAGHVR
FT                   DNEWSVVPRRLRSAELTMENSQQEDDASFASTVRSQDDDLGSREAVSGYGDDVCWYPAE
FT                   VDTSIRPGWFYHKYEDDKVMSADQLFDLWLSAVGGNSSLLLNIPPSPEGLFAEPDVESL
FT                   KGLGSRINEFRKALASSCCEVKTSSANEAAMRLIDGNQDTYWSPSTDDVAPAVTLTFPQ
FT                   LTTINAVVVEEAIECGQRIEHMRVTGVLSDGTECVLGQFGTVGYRRILRFDDVEVSSVT
FT                   LHVDDSRFTPMISRAAAVRI"
FT   gene            398666..401017
FT                   /locus_tag="BLJ_0327"
FT   CDS_pept        398666..401017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0327"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99809"
FT                   /db_xref="GOA:D6ZY13"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR016518"
FT                   /db_xref="InterPro:IPR027414"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY13"
FT                   /protein_id="ADG99809.1"
FT                   /translation="MKLTFDGISSCWEEGIPLGNGRMGAVLCSEPETDVLYLNDDTLWS
FT                   GYPHAETSPVTPEIVAKARQAASGDDYTAATRIIKEATLQEKDEQIYEPFGTARIQYST
FT                   PADGRESMKRQLDLARALAGETFQMGDANVHVDAWCSEPDDLLVYRMSSDAPIDVNISV
FT                   SGTFLKQSRASLETVSDGHRATLIVMGRMPGLNVGLLPHPSEHPWEDEQDGTGMAYAGA
FT                   FSLTATGGDINVDDNSLQCSHITGLSLRFRSMSGFKGSDQQPERSMTVIADHLEKTIDE
FT                   WSTDLQTMLDRHIADYRRYFDRVAIHLGSAHDDDTELPFSAILRSDENKEPHRLEMLAE
FT                   AMFDFGRYLLISSSRPHTQPANLQGIWNHKDFPNWYSAYTTNINVEMNYWMTGPCALKE
FT                   LIEPLVSMNEELLAPGHDAADKILGCRGSAVFHNVDLWRRALPANGEPMWAFWPFGQAW
FT                   MCRNLFDEYLFNQDASYLARIWPIMRDNARFCMDFLSETEHGLAPSPATSPENCFLVNG
FT                   EPVSVAQSSENATAIVRNLLDDLIQASHDLENLDEEDSALVREAESVRSQLAETRLGAD
FT                   GRILEWNDEFIESDPQHRHLSHLYELHPGAGITSKTPHLEEAARKSLEVRGDDGSGWSI
FT                   VWRMIMWARLRDAEHAKRIIGMFLRPVDANAETNLLGGGVYGSGLCAHPPFQIDGNLGF
FT                   PAALSEMLVQSHDGWIRVLPALPEDWHEGSFHALRARGGIQVDATWTDQTVEYTLRCSK
FT                   PTEITLNVLGTDMGRVALSPDKPFKGTIRR"
FT   gene            401161..401772
FT                   /locus_tag="BLJ_0328"
FT   CDS_pept        401161..401772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0328"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99810"
FT                   /db_xref="GOA:D6ZY14"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY14"
FT                   /protein_id="ADG99810.1"
FT                   /translation="MRVISGRFKGVALATPKTGTRPTTDRTKEAIFSHLDSWGVLDDAR
FT                   VLDLFAGTGALGIEALSRGARELVAVESSRPAAALITKTLSQLQKNRSWDASLKARVFT
FT                   KKAEQVAGGFGESFDVIFIDPPYAYETAECNQLLANLAVGSATNENTVIMLERSVRSDT
FT                   PTAPEGWQITESRNYGETAVFYIEPADDDSDIERSDDSAA"
FT   gene            complement(401796..402611)
FT                   /locus_tag="BLJ_0330"
FT   CDS_pept        complement(401796..402611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0330"
FT                   /product="tRNA (guanine-N1)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99812"
FT                   /db_xref="GOA:D6ZY15"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY15"
FT                   /protein_id="ADG99812.1"
FT                   /translation="MKIDIVSVFPEYFEVMNLSLMGKAQAKGLLEIKAHNLRDWTHDVH
FT                   HSVDDTPVGGGAGMVMKPEVWSECLDELLGFSRPSESSALSGTPVLIFPNPSAPLFTQR
FT                   DATELSHADHLLFGCGRYEGYDARIPDYYRSQGVDVREYSIGDYVLNGGEVAVSVMLEA
FT                   ITRLMPGFMGNPDSIVEESYTGEDALLEHRQYTKPAVWRGIAVPDVLLSGDHGKVDRFR
FT                   RDEALARTAEIRPDLIAALDCKALDKADRKTLMALGWEVSATHPRRLAD"
FT   gene            402610..404331
FT                   /locus_tag="BLJ_0329"
FT   CDS_pept        402610..404331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0329"
FT                   /product="peptidase U32"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99811"
FT                   /db_xref="GOA:D6ZY16"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR032525"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY16"
FT                   /protein_id="ADG99811.1"
FT                   /translation="MLSSLTVAPPALHGHHYTIAVMNTTMNLPTRKKPEVLSPAGNLRG
FT                   LKTAVDYGADAVYCGGKAFGMRSAPKNLSLEDFEEGSRYAHERGARVYVTCNVLPRNNE
FT                   IEAMREYVGQLKDTGVDALIVSDIGVMMMARQVAPNLELHVSTQAGVTNYQAANAFYEL
FT                   GARRVVLAREMDLQAVRDIRANIPGDLDIECFVHGAMCMAFSGRCLFSNYLTGRDGNHG
FT                   ECAQPCRWKYSIVEEKRPGQYFPIEQTENGAYLFNSQDMNMLGHLDDLIDSGATSLKIE
FT                   GRAKSAYYIAAMTNAYKTAVNEYMIQRGFEDADGNVLKPFRDRVIRPGDPDFGQGTEDQ
FT                   VMSNADAAFAGVADEGYDRGSDTAVADSVTGSVAAERDRVTVADAADSTASGASAGTAV
FT                   EPDGMSSHARSTRRKSNTAVEQIETDWKHAAVRPAPHVELPEWLLEETDKVAHRDYSTG
FT                   FYYPEHKVTQNTDRSAYFRSWLVVGEVLSWSADEGGRVTLMSRNKIEPGQQVEFLLPGE
FT                   RPLVFTVPETGLRDADGAPVPAINNPAHVFSMPCPHQVPINAAIRSRTKKPTLKAE"
FT   gene            404410..405390
FT                   /locus_tag="BLJ_0331"
FT   CDS_pept        404410..405390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0331"
FT                   /product="protein of unknown function DUF152"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99813"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY17"
FT                   /protein_id="ADG99813.1"
FT                   /translation="MPEYSEEILDSNSISSTDKAGRPIPVTIPIALAPGIKVVYTTRLG
FT                   GLSAGDYGNLNLGGKSGDEPEAVLSNRIALAEAVQARLSLVSQVHSGVAVDVDDSFVIN
FT                   TPFGFDVSGTHGETDTPHVIEADGQVTAQSGIALGMFAADCLPVLLGDPVTGIIGAAHC
FT                   GRRGLERGVIGATVDLMKSKGADPANIVATLGPRICGDCYEVGDEIADRFIKRFPLTKT
FT                   KTRFGGAGIDIAEAAMIDLAFAGVHQVVDSMPRVHAATQYLEEDPELAELCRTDGEGPA
FT                   ELAERIDNISHSMCTLENPLWYSHRRAALANKTHEGRLLALIVRD"
FT   gene            405470..406345
FT                   /locus_tag="BLJ_0332"
FT   CDS_pept        405470..406345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0332"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99814"
FT                   /db_xref="GOA:D6ZY18"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY18"
FT                   /protein_id="ADG99814.1"
FT                   /translation="MTERDFDTPVETPTVQPAPAQGTKPAQTVPVVAVVLAAGFGTRFD
FT                   PDNPKQLVSVGGKPIVCWSIDAFEHCDRVSDIVVVVNPKVRGEVETLVGEMGYTKVRVI
FT                   IDGGDERVDSTAAALDMLATAGIPDDAKILIHDAVRPFVEQSAIDGSIDALDQFTAATV
FT                   AYTSTDTVLLTEDLGDLKVVKSVPDRPNTFRAQTPQSFRFATIRHAYDLAAADPDFHPT
FT                   DDTRVVVDYLPDEPVAIVSGAETNLKITTLEDIPTAERIAEEILGRDPKEEARARMHAL
FT                   LAQAAGQMHR"
FT   gene            406355..407032
FT                   /locus_tag="BLJ_0333"
FT   CDS_pept        406355..407032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0333"
FT                   /product="Pyroglutamyl-peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99815"
FT                   /db_xref="GOA:D6ZY19"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="InterPro:IPR033694"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY19"
FT                   /protein_id="ADG99815.1"
FT                   /translation="MRELNVVISGFDHYDGVEVNPAVEVPKAIAEQGLGVSSAPDDPLE
FT                   QVAVTVHAVSIPVSFAKAWPTLKETIEATKPNIVIATGLKHAARGVMLERCATNLMDAI
FT                   KPDADNVTPRREPIDPNGPAAYWTRLPLRSILNDFTDDSIPATLSSDAGTFVCNSLFYN
FT                   LLNWTATQERVLGGFVSFPPVVPADSSQHGLPLDQQIAAGRDVVREAVRYYLKPSSSGI
FT                   LIA"
FT   gene            407180..408748
FT                   /locus_tag="BLJ_0334"
FT   CDS_pept        407180..408748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99816"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY20"
FT                   /protein_id="ADG99816.1"
FT                   /translation="MVDRFPVVLRGYDKEKVDAAFDATQESVKRAQQTLASMREQIAAD
FT                   DDRILQLQAQLQEEKNKKPEGNSFASLGANAQQMLASAEQTSTELLERAKQDASSIRTT
FT                   AQAQAETLINNAKLDAQHIVDDANAKAASILTNANNQAESVTTSANEDAAQLRSETAKT
FT                   ITEQRQTVELELSNAREEHTKKMASERSTQEREIADMKAEATQQVAAMRKSANEEITKL
FT                   KSDSNDQIEAALAEANKKLADVREQVSKMMTEAQRKASEIIDAAKTKGQEITDEAEVKR
FT                   TSTMSQVNAEVEQIRHDIAAQQDEATKKVNELLQHLEERRVAAKREADELVGQAKNTRD
FT                   QADSYAASKREEADIQAAAIVHKAGEEADAQIEERRAAAQSELDGLSKRIADLQERESV
FT                   ITQRVSELRSMFSQAFSGFAFGGNAAASGQSQEAAAVASLPVVAPVPEVKPVHNEADDQ
FT                   PGELSGNESAADDHNETDAAPADSADSAAQNEQSESSEPSEHQTQGEPEAPTQENPAVS
FT                   EQNGE"
FT   gene            408863..410206
FT                   /locus_tag="BLJ_0335"
FT   CDS_pept        408863..410206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0335"
FT                   /product="Bleomycin hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99817"
FT                   /db_xref="GOA:D6ZY21"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR004134"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY21"
FT                   /protein_id="ADG99817.1"
FT                   /translation="MSELTPLTGEALNTLRGDFAQSGTNRLAMNAVTAAGIDKVARNYD
FT                   RARLMQRRFSTIVDNGEATHQDRSGRCWLFSSLNVARFVAKKNMNLKEFEFSQNYAMYY
FT                   DKLERVNYFLKDVAALVAAGEPSDSRLMQHLLADVMGDGGQWTMAMNVYKKYGAVPKDL
FT                   FPETESSKNTGEMNTQLRHMLHTAVAHMYAADGDASKVEAIIADATAAGHRILTIHLGE
FT                   PPVSFDWEWTDKDGEFHRDGEITPVEFWKKYVGPAGLEDYVCLVDDPRTEHAKGKKIGI
FT                   EHLGNVAGGDATEYLNVPNQFMKDCVKQILVEQGIPVWFGADCHPFMDRENGAWATDLF
FT                   EYGRVYDVDFDLDKEARVRFGDSAMNHAMAFAGVDVADDGTTRRWRVENSWGTKIADKG
FT                   YFTMSDDWFTEYVYEVAVPKALLPEEYQKALEEPATMLPAWDPMGALA"
FT   gene            410515..411648
FT                   /locus_tag="BLJ_0336"
FT   CDS_pept        410515..411648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0336"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99818"
FT                   /db_xref="GOA:D6ZY22"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY22"
FT                   /protein_id="ADG99818.1"
FT                   /translation="MAALRGPDSSEDERRLGEQAVFPETVDVNIRQLDPIPAPRAFLRE
FT                   QPLTDEMSELVLHSRQEIRDVLNGRDDRLLVIVGPCSIHDPKAAHEYAEKLAAVKRELE
FT                   DRLVIVMRVYFEKPRTTIGWKGLINDPDLDGRFNIRKGMWLARKVLTDVLSLGLPAATE
FT                   WLDPITPQYICDAISWGAIGARNTESQVHRELASGLSMPVGFKNSTDGSIKAAADSCFA
FT                   AGFEHHFLSINLDGRVISAETKGNPDCHLVLRGSSHGPNYDAESVRQALEDLKVSKASG
FT                   PSQHGLVIDAAHGNCGKDENREAEVIEEIAERLAHGEQGITGVMMESFLVGGHQKPAPL
FT                   DQLVYGQSVTDSCVPWERTNELLHTLADAVTARSSAK"
FT   gene            complement(411610..411804)
FT                   /locus_tag="BLJ_0338"
FT   CDS_pept        complement(411610..411804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0338"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99820"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY23"
FT                   /protein_id="ADG99820.1"
FT                   /translation="MCCFLLLLHNISPWISIFPKDKVSREQTDMTTVIGQKMLTEWVSV
FT                   SIFTKTKLFSRAASGDGVG"
FT   gene            411778..413010
FT                   /locus_tag="BLJ_0337"
FT   CDS_pept        411778..413010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0337"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99819"
FT                   /db_xref="GOA:D6ZY24"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY24"
FT                   /protein_id="ADG99819.1"
FT                   /translation="MQQQEEAAHSLHPLQVGPQPLNTPEELRAIRQAMGEGKNPLVATD
FT                   VPRWEDQVGVSRIINRRVLELEPLPTPAQVLAELPLTDQAQEIVAYSRDEIRACLYGQD
FT                   DRLLVIVGPCSVHDPKAALDYAHRLAKLKDELGEQLLIVMRVYFEKPRTTIGWKGLIND
FT                   PDIDGSHNIRKGLLLARKTLLGVLKEGLAAATEFLEPTSPQFISDAVSWGAIGARNTES
FT                   QIHRQLASGLSMPVGFKNATDGSVKAAVNGCFAAAQQHTFFGIDHLGRACAVETLGNPD
FT                   CHVVLRGSIHGPNYDAESVAKAMEDVRAEMPAESAASHGLIVDCSHGNSGKDEHRQAEV
FT                   VRNIASRIAAGEQGITGIMMESFIEGGNQKAAPLDQLVYGKSITDKCISWEETEALLRE
FT                   LAEAVATRRWH"
FT   gene            413164..413751
FT                   /locus_tag="BLJ_0339"
FT   CDS_pept        413164..413751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0339"
FT                   /product="Resolvase, N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99821"
FT                   /db_xref="GOA:D6ZY25"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR041718"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY25"
FT                   /protein_id="ADG99821.1"
FT                   /translation="MRVREWARREGFNEQTVWQWCRENRMPVPFERMNTGTIIIHDPKY
FT                   ENQPAAPTANGRTVCYARVSSSDQKDDLQRQADRLKAFAINMGVKSPEVVTETGSGMND
FT                   KRRKLNRLLSDPTVGTLVVERRDRLARMNMGLVESALKAQGRRIIVVDDTEPDDDLVRD
FT                   MAEALTSFCARLYGSRAAKRKTDAALRAARDA"
FT   gene            413744..415048
FT                   /locus_tag="BLJ_0340"
FT   CDS_pept        413744..415048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0340"
FT                   /product="transposase, IS605 OrfB family"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99822"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY26"
FT                   /protein_id="ADG99822.1"
FT                   /translation="MLEAVRVALDPTPRQERLLGSHAGAARFAYNAGLAHVRDMLERGD
FT                   KPEWSYYGLRRWWNQAKNTLAVDGTTGETWWPENSKESYNSGLESLADALRNFSKSRKG
FT                   QRKGRRMGFPRFKSKDRAVPGFAYTTGSFGLIDCDPYALRLPRIGRVHCMEDVSRRVNG
FT                   AKVLRMSVSKRGGRWQASLTVERADLPIPSPPKGGSVGIDLGVKELATLSDGTVIHNPH
FT                   VLKSNLGRLKKAQRNLSRKRKGSNRRRKARTRVARLHARVADLRRDLLDKTTTMLARAY
FT                   ADISIEDLNVAGMVRNHRLARSVEDAAFAEFRRQLEYKTARTGARLHVIDRWYPSSKTC
FT                   SNCGTVKAKLSLSERVYHCEECGLVIDRDLNAAINIQVAGSAPETLNARGGSGRRTDAS
FT                   RRATRHPVKREPSDGVSRVSLGAGLGNEAMQMTSL"
FT   gene            415110..415823
FT                   /locus_tag="BLJ_0341"
FT   CDS_pept        415110..415823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0341"
FT                   /product="Methylthioadenosine nucleosidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99823"
FT                   /db_xref="GOA:D6ZY27"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY27"
FT                   /protein_id="ADG99823.1"
FT                   /translation="MGMKTVAIIGALDEEVALIAKSLTHVTHTAKGSLDIVSGTVDSFG
FT                   SDVIKVAATVGGMGLVNAAATTQLLIDEFAPDVVIFSGIAGNLNTHLHINDVVLGGTLR
FT                   YLDTDMRLVGQWKPGTADAPVEEFHSDDRLLEVADEALANAGITHITGIIASGNYFVDT
FT                   PQKVEEVIRLTGADAVEMEGAAVVQVAARNDVPALVIRALSDNADTDYEVFKEFDISEY
FT                   ADTAARLAVDIVKRL"
FT   gene            416096..417409
FT                   /locus_tag="BLJ_0342"
FT   CDS_pept        416096..417409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0342"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99824"
FT                   /db_xref="GOA:D6ZY28"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY28"
FT                   /protein_id="ADG99824.1"
FT                   /translation="MTASATAAVTKPVKKDSVPEIIAASMVGTAIEFYDNYCYSIAAAS
FT                   YFGMIFFTDVAKSNQTLATLMAFVTFAVSFLARPFGSMLFGHFGDKLGRKKTLVIALMT
FT                   MGIATFLVGCLPGYEQIGAWSVVILCICRACQGVGLAGEWSGAALVATENAPADKRALY
FT                   GSFPNLGAPIGFFCAYGLNLLLESNLSKEQMIAFGWRIPFLCSAVLVIIGLYVRARMSE
FT                   TPVFQKATEEKRTSKHPLRDLLPYWKEVVLGTVAMGITYTLFYVLGTWSLAYGVKGLGF
FT                   QQGEYLLMQMCSVVFFAIFIVVSCVYADKVGRKKVMIAVTAAALVFSFFVPMLLVHSAA
FT                   HIMIFLCVGFMIMGGLFGPCGAYLPELFPVHVRYSGAGLSYNLAAIFGGAFAPTIAQAL
FT                   VASKFGVAGVGWYMAIMAALALLALFLIKESKDKDYEL"
FT   gene            417634..418965
FT                   /locus_tag="BLJ_0343"
FT   CDS_pept        417634..418965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0343"
FT                   /product="histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99825"
FT                   /db_xref="GOA:D6ZY29"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY29"
FT                   /protein_id="ADG99825.1"
FT                   /translation="MDIWQIVVIVVLAALILAWVAVIAYNKGRVSGRLAAEQDLSGDED
FT                   TRSLFGDDAPVRPTERRLIEVLPEALIVTDRNGLVQYSSPGSVPFGLVSGDRLNSREVE
FT                   DILTQAAADGGVREREVQLPVNRNSYPSSNGRGLEAGQSRPSNMLYLRVRIGDIGDDLY
FT                   AIFINDMSEQRRFEAVRRDFVTNVSHELKTPAGAISLLAETVTDAADDPDAVRYFSGRI
FT                   STESARLTELVHHLIDLQKAQSPQSVIDARRISALDVARAAIAANQTQADSRHVDIRLS
FT                   VNGQSVPTKVEELADGEGSLEESGSPATSGPMIKADKEAMQTAVKNLVENAIHYSPEHT
FT                   TVAVGVGERDGKVTIRVVDQGIGIPAKSLDRIFERFYRVDPARSRETGGSGLGLAITKH
FT                   CVQENGGRISVWSRTGEGSTFTIELPAAPDEDDDEARPDESTQA"
FT   gene            419098..419868
FT                   /locus_tag="BLJ_0344"
FT   CDS_pept        419098..419868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0344"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99826"
FT                   /db_xref="GOA:D6ZY30"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY30"
FT                   /protein_id="ADG99826.1"
FT                   /translation="MVTIVSENFAPMRTGTYPRKATMARILIVEDEESYREPLVYQLTR
FT                   EGYDVSAAATGEEGLELFTKGGIDLVLLDLMLPGIDGTALCRRIREQSRVPIIMLTAKS
FT                   AEIDKVVGLEIGADDYVTKPYSFRELLARIRAVMRRNQATAQASGTVDDDIPLVCGDIA
FT                   MQVGQHQVTVRGETVFFPLKEFELLEYLMQNKGRVMTRHQLIDRIWGSDYVGDTKTLDV
FT                   HVKRVRSKIEEDPAHPKYLTTVRGLGYKIDTPAE"
FT   gene            420106..421239
FT                   /locus_tag="BLJ_0345"
FT   CDS_pept        420106..421239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0345"
FT                   /product="phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99827"
FT                   /db_xref="GOA:D6ZY31"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY31"
FT                   /protein_id="ADG99827.1"
FT                   /translation="MQKNILIRSIAALSGIVMLASVAACGDNTATTTDNSSSSDSTSKS
FT                   TPVSGNFSGAGASSQQAAVEAWIAGFQGTNPEAKIAYNPSGSGAGVQTFLTGATAWAGS
FT                   DKALADDEVEQSKSVCTEGTAFDVPVYISPIAVVFNLKGVSDAGKHINMDAATIAKIFD
FT                   GKITKWNDPAIADQNKDLKLPDTAITVVHRSDKSGTTQNFVSYFKDVTPDNWTYDLSEN
FT                   WPNEVGQGAKGTSGVISTVKQADGTIGYADFSQVGDLGTVAVKVGDKYNEISAEAGSKV
FT                   IEDSKQDDTVKGDNRIVIKINHATEADGAYPIVLVSYDIVCPAYKDTKQAEFAKAWLTY
FT                   VTSDEGQKAAQDAAGTAPLPSSLKSKITKSIEAIKTK"
FT   gene            421450..422403
FT                   /locus_tag="BLJ_0346"
FT   CDS_pept        421450..422403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0346"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstC"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99828"
FT                   /db_xref="GOA:D6ZY32"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY32"
FT                   /protein_id="ADG99828.1"
FT                   /translation="MSSQDKTAVQPVGGKTADKVFRGVAYACGILILVVLAAVFLFLFF
FT                   RAWPLIGGDQAANSDTVSSFTGGKASSFWGYVLPLLFGTVLVSLLALLIAFFVSIGIAL
FT                   FISHYAPKKLATALSYVVDLLAAIPSVIYGLWGGLILVPAIYPFWNWVANHLGFIPLFE
FT                   GPAANPSRTVATVAVVLAVMILPIITSMSRDIFMQTPRLHEEAALALGATKWEMIRLAV
FT                   LPFGKSGIVSASMLALGRALGETMAVLMILSPGLNYSIKLLQASQNQTIAANIAAQYPE
FT                   ANDLGVSTLIGTGLILFLITFVVNFIARKLTEKATA"
FT   gene            422436..423401
FT                   /locus_tag="BLJ_0347"
FT   CDS_pept        422436..423401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0347"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstA"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99829"
FT                   /db_xref="GOA:D6ZY33"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY33"
FT                   /protein_id="ADG99829.1"
FT                   /translation="MDGTPEIDFDRFRPTRSAIQRRNIMDRFMWALIAVAFVIACIPLI
FT                   SLLWTTIVNGIKRLNLNFLSYNMTGVVGGSQTPSGGYGGVLHAIIGTLEITAGAMVISI
FT                   PIGLMCAVYLVEYSNRGKLATTISLLVDVMSGIPSIVAGLFAFSMFTILLGPGTINGFE
FT                   GSVALSLLMLPTVVKSSEEMLKIVPNDLREASLALGVTKQRTITKIVLRTALPGIVSGA
FT                   ILAIARVIGETAPLLMTAGYISSTNVNLFSGQMTTLPVFVYQEYSKLSANCPPNADATC
FT                   VTTIPMERAWAAALVLIVIVLLLNLIGRIVAKVFAVKTER"
FT   gene            423454..424233
FT                   /locus_tag="BLJ_0348"
FT   CDS_pept        423454..424233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0348"
FT                   /product="phosphate ABC transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99830"
FT                   /db_xref="GOA:D6ZY34"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY34"
FT                   /protein_id="ADG99830.1"
FT                   /translation="MGQRIDVNHENIYYGDFLAVEDVNINIEPNKVTAFIGPSGCGKST
FT                   VLRTLDRMHEIIPGAHVEGEVLLEGKNLYDKDVDPVAVRRDVGMVFQRPNPFPTMSIRE
FT                   NVLAGVRLNNHHLAKSDADDLVEWALRGANLWEEVKDRLDNPGIGLSGGQQQRLCIARA
FT                   VAVHPQVLLMDEPCSALDPISTLAVEDLINELKSDYTIVIVTHNMQQAARIADYTAFFN
FT                   LKAVGQPGHLEYFADTITMFNNPQNEEAERYISGRFG"
FT   gene            424530..425108
FT                   /locus_tag="BLJ_0349"
FT   CDS_pept        424530..425108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0349"
FT                   /product="LemA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99831"
FT                   /db_xref="GOA:D6ZY35"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY35"
FT                   /protein_id="ADG99831.1"
FT                   /translation="MSTGLIVGIVVVVIIVVLIGWGVSAYNNLVTLKNRVKNGWAQIDV
FT                   QLKQRADLIPNLVDTVKGYASHESEVFTQVTAARAGVVAAASNPSTTTAQRAAAENQLS
FT                   RALFNLQATAEAYPQLQANQNFMDLQNQLKELENKIAYARQFYNDVVLKLNTAIETVPT
FT                   NIIAGLFHFEQAQYFEADDASRQVPQVQF"
FT   gene            425172..427442
FT                   /locus_tag="BLJ_0350"
FT   CDS_pept        425172..427442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99832"
FT                   /db_xref="GOA:D6ZY36"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY36"
FT                   /protein_id="ADG99832.1"
FT                   /translation="MRIRFIRAGIISIVATVVLAVITLAIIGTSAFGDSADLSYRTLDY
FT                   DVTATANGDLKVTQHIDVKMRERTDSDDNTKPWKQLFQQYTLNSGTLTDISDISVRNVT
FT                   DGIDYAQQSEPKLPSDVSSDKEWNSDYANHWYVADVSDGSDHPKAYTPGTDGLKPSASA
FT                   TEDDTTVEIGWNIPVTTEADSMKFDVSFTMHDVATKWKDVASFQWEPFGKKNQVPIGTV
FT                   TGTVHFPNGITGKTSWTWLHTERTSETKRNSDGSYTFTAYNIHNGDYLDVVAAFDAAKA
FT                   KGIARKGTGNHLKDLKQDEYKQQQRWLDKQRFAARARLVFWIVSIVLGIALCAWGIWAV
FT                   ISSNRRAQYSGSVEYWRDQPGISPASAARLIRVVDPSTRQSDEDRQLTATMLSLAVKKA
FT                   IAIYPGPSDMYRGIDMSQATPVGLSQMIAADQGKQYAAGITSTIVILPLAIDEAPNAQQ
FT                   LGLSESEDALLNLLIVISQRVGSPVFDLNQMKATCQNWQDGYIELGKFTGACSMEYQRL
FT                   GATRSVGWQWILPGVLAAVLGFGSLLANSFIGYPVAGLIGLPIFLVGLFCSMAGAMTVL
FT                   TDQGQDIAGRTLGLKRYMEDFSNFTDRGTADLALWDWYMVYAAAFGISDRVMRELAKAY
FT                   PQVNDPAWLDANASNSLFYWNYRPYGWYSHRHNGPFDHDAAGQMDLGVGGPAPAYGGTS
FT                   FAGGFSDLGSQLNSGLADISSTISAAAPSADSGGDFSSFGSGGGSGFGGSFGGSGGGSF
FT                   GGR"
FT   gene            427446..428003
FT                   /locus_tag="BLJ_0351"
FT   CDS_pept        427446..428003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99833"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY37"
FT                   /protein_id="ADG99833.1"
FT                   /translation="MPMSKRIVRALGLSLVGALILAALCAGALILGTDGADLSYRTLDY
FT                   DVTATADGDLKVTEHIDIKLRKRKDDDGKTKPWKQLYQQYMLKTDNLTDITDISVRNVT
FT                   NGIDYGHQAKPRLPDDVPQDEWDSDYANHWYIADVTDDDDNPQPYVPGKDGLTLDGYSE
FT                   DKTVEIGWNIPTTVKPTASSSR"
FT   gene            427955..429757
FT                   /locus_tag="BLJ_0352"
FT   CDS_pept        427955..429757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0352"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99834"
FT                   /db_xref="GOA:D6ZY38"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY38"
FT                   /protein_id="ADG99834.1"
FT                   /translation="MEYSHHRKTNSIKFTVSFTMHDVATKWKDVATFQWEPFGENNQVP
FT                   IGTVTGTVHFPKGVTASNSWTWLHTEQTSETGRTKDGSFTFTVNDVKSGEYLDVVAAFD
FT                   AAKAGDMARVETDDHLQELKEDEADDERFWRNLERQRATRRLNNWMTTISAGLIFGSIG
FT                   VVAALRFPGRSRYRGSIEYWRDRPELSPASAAKLIDIVTSGDKPDISERQLVATLLSLA
FT                   VKKVIAVFPGSADLYIGVDLKQVSPVELSQRIGSDPYKRNNARTNSTIVMLWQSDYGVS
FT                   EGFDESVFVESVFDGSGSGGSGSAASSVSDAHQPDLSASERALLYLLTVISERVGRTAF
FT                   DMDDIKDACKDWKDGYKELEKFTNACKTEFAAADIAPKTENGWLIPGAITVLIGGASIF
FT                   INGLAGYLVAGALIGIPLMTVGIFCFLMGNSYVLTDHGQQMAGQCLGLKRYMQGFSNFK
FT                   YRGVADLTLWDWYMVYAAAFGISDRVMRELAMAYPQVSDPEWLDANASDTVFYWNYRPY
FT                   DWYGLRFYNGSAFADSVADSGLAGAVPAFGGTSFAAGFSDLGTQLSYGFADITATINAA
FT                   SPSGGSGGFGGSSGGSGGGSFGGR"
FT   gene            430450..431313
FT                   /locus_tag="BLJ_0353"
FT   CDS_pept        430450..431313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0353"
FT                   /product="aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99835"
FT                   /db_xref="GOA:D6ZY39"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY39"
FT                   /protein_id="ADG99835.1"
FT                   /translation="MALFRNLGPFSTTAIGHGEMPLTIENNRGHEVGIETLHASLDAGC
FT                   RHIDTAWAYYCSGGEEQTGEKLVREALETWKGPKDEVLVATKVGHFRNFTDGRPTWDVD
FT                   GRPENLIRRGKESALALGVDTIDLLYFHRPDPKVPYNESVEAIKQLVDEGVAQEAGISN
FT                   ASIEQIDIARGILGDKLVAVQNQYSPIHLETQDTLDYCAKVGLAFVCWSPLGGYRHPYD
FT                   ETKFDPFREVAAAHGVSYQQVVLAWELAKGDHMFVIPGAHHPETILDSLKADQLELTPE
FT                   ELAKLG"
FT   gene            431405..432460
FT                   /locus_tag="BLJ_0354"
FT   CDS_pept        431405..432460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0354"
FT                   /product="Inosine/uridine-preferring nucleoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99836"
FT                   /db_xref="GOA:D6ZY40"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY40"
FT                   /protein_id="ADG99836.1"
FT                   /translation="MRKKLILDLDTGIDDALAIAYALGSADEIDLIGITATYGNVAVPL
FT                   AARNALAVVHLFGRDDVPVYPGVDHPIAPATLPKMRGTTPDERTQAYARWQNGGADGWQ
FT                   TDASWAPTPGSVAVHHPNGIGGAIIPDSPRAPEAPGSAVDFIIAAAREYGPDLTIVPTG
FT                   AMTTMATVFRNAPDLKDSGVNVTLMGGALTLPGNVGPAAEANISQDPESADYLFKCGAR
FT                   TTMIGLDVTHQTALTREKAHEWASLGTPAGDFLVTMTDYYIDFYLKNQPEIRGCGLHDP
FT                   LAVAAALDPSLVTTFGFNLQVDLEGPFRGRTIGDRSRLQDFDKHTQVALGVDVSEFLDR
FT                   FMARVTAAARG"
FT   gene            432599..433186
FT                   /locus_tag="BLJ_0355"
FT   CDS_pept        432599..433186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0355"
FT                   /product="Resolvase, N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99837"
FT                   /db_xref="GOA:D6ZY41"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR041718"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY41"
FT                   /protein_id="ADG99837.1"
FT                   /translation="MLVKEWARLEGLHPQTVWKWCRQGTMPVPVEQTPTGMWLIHDPKY
FT                   ETASQPSPAGSRTVCYARVSSGDQKNDLQRQADRLKAFALSMGVEKPEVVTETGSGMND
FT                   KRRKLNRLLSDPTVGTLIVERRDRLARMNMGLVESALKAQGRRIIVVDDTELDDDLVRD
FT                   MTEVLTSFCARLYGRRAAKHKTDAALRAARDA"
FT   gene            433179..434483
FT                   /locus_tag="BLJ_0356"
FT   CDS_pept        433179..434483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0356"
FT                   /product="transposase, IS605 OrfB family"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99838"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY42"
FT                   /protein_id="ADG99838.1"
FT                   /translation="MLEAVRVALDPTPRQERLLESHAGAARFAYNAGLAHVKAMLERQE
FT                   KPEWSYYALRRWWNANKDALAVSMETGKPWWPENSKESYNSGLESLADALKNFSKSRKG
FT                   QRKGRRMGFPRFKSKDRAVPGFAYTTGSFGLIDCDPYALRLPKIGRVHCMENVSRRVNG
FT                   AKVLRMSVSKRGGRWQASLTVERADLPIPSPPKGGSVGIDLGVKELATLSDGTVIHNPH
FT                   VLKSNLGRLKKAQRNLSRKRKGSNRRRKARAQVARLYARVANLRSDALNKTTIMLAHAY
FT                   SDIGIEDLNVAGLVKNHGLARSIQDAAFAEFRRQLTYKTARTGARLHVIDRWYPSSKTC
FT                   SNCGTVKAKLSLSERVYHCDKCGLSIDRDVNAAINIQVAGSAPETLNARGGSVRQTRLE
FT                   CGTMRHPAKREPSGGGNRVRLGAGLGNEAMQMTSL"
FT   gene            complement(435178..435792)
FT                   /locus_tag="BLJ_0357"
FT   CDS_pept        complement(435178..435792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0357"
FT                   /product="16S rRNA processing protein RimM"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99839"
FT                   /db_xref="GOA:D6ZY43"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY43"
FT                   /protein_id="ADG99839.1"
FT                   /translation="MAQQDMHDDPQQLELLRVARIGRAQGLKGEVTVRLYTDDPEWRFE
FT                   PDSVLYSHDGETEYIVEGSRTFKDRWILKLEGVDDRNAAEALNGVELYGEVDDAEDMLE
FT                   ADEWYPKDLIGLEARLVEGNGLGLPAGQVVGKVVDVVDSPAQSLLKIRLTEPVVTGQNS
FT                   KGEDVVEKTALVPFVEELVPDIDLEEQYLTLDPPGGLIPGL"
FT   gene            complement(435815..436048)
FT                   /locus_tag="BLJ_0358"
FT   CDS_pept        complement(435815..436048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0358"
FT                   /product="conserved hypothetical protein"
FT                   /note="narrowly conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99840"
FT                   /db_xref="GOA:D6ZY44"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020627"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY44"
FT                   /protein_id="ADG99840.1"
FT                   /translation="MLAQAVEHLIKNIVDFPDDVSVKSHENARGELLRVRVNPEDIGRV
FT                   IGRGGRTANAIRTVIQALSDHKVRVDIMDVRR"
FT   gene            complement(436069..437373)
FT                   /gene="rpsP"
FT                   /locus_tag="BLJ_0360"
FT   CDS_pept        complement(436069..437373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="BLJ_0360"
FT                   /product="30S ribosomal protein S16"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99842"
FT                   /db_xref="GOA:D6ZY45"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR020592"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY45"
FT                   /protein_id="ADG99842.1"
FT                   /translation="MTPGSRPQETGGVTTSPPMTAKTLETAPSATSPRVLRNNGSSTAR
FT                   PRARRFSMMFSAYANVFMRAKGEDSFLRTSAKSQRKTRFAPGAAYGLRLNETTRLRSVT
FT                   VSLRAESSDAPSPAHARSTIVSKSARRASMPRYRNVPSKRVRWSSRNTGAPPDTAMVSK
FT                   APMPKKNPSSASTRARAPGPITHSPIDQRPLSRLALPSIRLSVMKTVGAPPTRRPSGDS
FT                   VRHDRTDAQYPASALHWYGYSRARGALYTPSREDTWIPAGHAPHGKPRTRTPSITRRAI
FT                   LATKIRLKRQGKKFYAFYRVVVVDSRKKRDGKVIEEIGTYNPNTQPSTIQIKSDRAQYW
FT                   LGVGAQPSEPVFKLLNITGDWQKYKGLEGAEGTLKTVEAGPDAEARIAAVENQAQKLKA
FT                   AKSEAAAKAKAEAEAAAAAEEAPAEEAAEEAPAEA"
FT   gene            436808..437605
FT                   /locus_tag="BLJ_0359"
FT   CDS_pept        436808..437605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0359"
FT                   /product="aminotransferase, class IV"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99841"
FT                   /db_xref="GOA:D6ZY46"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY46"
FT                   /protein_id="ADG99841.1"
FT                   /translation="MGECVIGPGARARVDADDGFFFGMGAFETIAVSGGAPVFLDDHLT
FT                   RLDGTLRYLGIEARRADLETMVLRACAGLGASDDSALKLTVTERNRVVSLRRNPYAAPG
FT                   AKRVFRCDFADVRRNESSPFARMKTLAYAENIMEKRRARGRAVDEPLFLNTRGEVAEGA
FT                   VSNVFAVIGGDVVTPPVSCGLLPGVMRHAVIGFTGAVERPIMPDELLRADEVFLTNSLM
FT                   GAMPVAGIGGVEFEPGSVSRDVNDAYARMVAQARARAQEKESR"
FT   gene            437602..438996
FT                   /locus_tag="BLJ_0361"
FT   CDS_pept        437602..438996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0361"
FT                   /product="para-aminobenzoate synthase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99843"
FT                   /db_xref="GOA:D6ZY47"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR005802"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY47"
FT                   /protein_id="ADG99843.1"
FT                   /translation="MSAQVFKLRTFRPLADIVECVRGEERFAFLDSSMPGAQGRYSILG
FT                   LFPYLVIEHGRGGCLVDGVAVEGDFLDVVKKRLGPCDGARDPRLPLTGGAIGYLGYDFG
FT                   RESCGVPTRHDPVAATPEASMVFYDLLLIEDVRSRALFCCCQGRTMTAAHALTWAQDLV
FT                   DSCPPAPHPARRRSLAPCSCDFTRAGYGDALARLVDHLRAGDAYVVNMAQRLRLETSGS
FT                   PYAIYRYLRTHNPAPFSAYLRAPGLDVCCSSMERFMEIRSGHVVTRPIKGTRPRGGTPD
FT                   EDRANREELARSEKDHSELLMVVDLERNDLSIVCEPGSIGTDPDFAIETYPSVFHLVAT
FT                   VEGTLRKDRCAVDAVRAAFPTGSITGAPKVRAMQIIDELERAPRGLYTGSIGYFSDTGD
FT                   CDFNVVIRTIVREGGETSLGVGGGITVESDFDFEYDETMQKARALREAASVDRGSVGEY
FT                   NLGQNE"
FT   gene            439236..440336
FT                   /locus_tag="BLJ_0362"
FT   CDS_pept        439236..440336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0362"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99844"
FT                   /db_xref="GOA:D6ZY48"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY48"
FT                   /protein_id="ADG99844.1"
FT                   /translation="MDDARYMGLAIELAKRGAGYVNPNPMVGAVIVKDDRIIGQGYHEM
FT                   FGGLHAERNALRHCTQSPAGATLYVTLEPCCHYGKTPPCTEAIVESGIARVVVGTLDCN
FT                   PVVSGKGVRMLEDHGIRVDVGVLADECRHLIRVFSKYITTHTPYVIMKYAMTMDGKIAT
FT                   HTNQSRWISGEESRRRVHQLRRSVAAVMVGVNTVIEDDPLLTCRMAHGRNPVRVVCDTR
FT                   LRTPLTSRIVQTANDVRTYIATACDDERKAEDYRRHGCEILAVGRKGDHVDLADVVRRL
FT                   GDMQMDSVLLEGGSAMNWSALEQRIVDEAHVYIAPKIFGGTAKSPVGGQGVALPSDAVM
FT                   LRPRACSRVGEDYLVESEVVYSCSRE"
FT   gene            440321..440950
FT                   /locus_tag="BLJ_0363"
FT   CDS_pept        440321..440950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0363"
FT                   /product="riboflavin synthase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99845"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY49"
FT                   /protein_id="ADG99845.1"
FT                   /translation="MFTGIVEEVGTVADIRRSAANCTLSVDATNVMEDLHIGDSMAVNG
FT                   ICLTVVDFDRRRFTVDVMNETWRRTSLGVLRHGSGVNLERALPVNGRFGGHIVTGHIDG
FT                   TGSISSVRREGNAVWYRIAARNEILEGIVEKGSIAVDGISLTVAEVTERDFSVSIIPHT
FT                   LAQTVLGEKRVGGVVNLENDVLGKYVRNMMTTRTGLTQDLLSRCGF"
FT   gene            440968..442173
FT                   /locus_tag="BLJ_0364"
FT   CDS_pept        440968..442173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0364"
FT                   /product="GTP cyclohydrolase II"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99846"
FT                   /db_xref="GOA:D6ZY50"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR016299"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY50"
FT                   /protein_id="ADG99846.1"
FT                   /translation="MNHQSVQAALQALREGKLVLVIDDEDRENEGDLICAAQSATTWNV
FT                   NFMATHAKGLICMPMSEQLAHKLMLPPMVEHNTDNHETAFTVSIDYRGTTTGISAEERG
FT                   LTARMCVSDDVEPLDFRRPGHMFPLVAKKGGVLERNGHTEATVDLMRLAGLRECGLCCE
FT                   IMDDDGRMMRTPDLTRFAQEHQIPLLTIKELQEYRKAHDTLVECVSTVAMPTRYGEFTA
FT                   HCYVNRLNGEHHVALVMGNLGDGTDVLCRVHSECLTGDVFGSLRCDCGQQLDAAMRTIA
FT                   EHGSGVLLYMRQEGRGIGLVNKLKAYRLQDEGMDTLDANLALGFPGDAREYYIGAQILR
FT                   DLGIRSMLLLTNNPDKVYQLEDYGMEIRDRIPIEIEANAYDSFYLKTKKNRMGHILNME
FT                   EE"
FT   gene            442174..442641
FT                   /gene="ribH"
FT                   /locus_tag="BLJ_0365"
FT   CDS_pept        442174..442641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /locus_tag="BLJ_0365"
FT                   /product="Riboflavin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99847"
FT                   /db_xref="GOA:D6ZY51"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY51"
FT                   /protein_id="ADG99847.1"
FT                   /translation="MHTFEGDLVAENITIGIVVARFNEFITSKLLAGALDTLKRENVRE
FT                   QDIAVAWVPGAFEIPLIASKMAKSKRYDAIICLGAVIRGSTSHYDYVCNEVSKGIAQTS
FT                   LDTGVPVLFGVLTTDSIEQAIERAGTKAGNKGSECAQGAIEMVNLIRSMDL"
FT   gene            complement(442733..443842)
FT                   /locus_tag="BLJ_0366"
FT   CDS_pept        complement(442733..443842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0366"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99848"
FT                   /db_xref="GOA:D6ZY52"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY52"
FT                   /protein_id="ADG99848.1"
FT                   /translation="MTTIFSAVAIIALLWTALSALPAGLEARMPLPYMIALTPLLWVPL
FT                   MILAAVAAWQHEWTAMSSLIVVALIASSQRINYWGTSIDPAGKRRESHRETARETTSPT
FT                   LSKSHNSNTSSTSNTPKEGPETVPDGHRETTRETLSPQFSVMTMNCRYGRADAAEIIRN
FT                   IRERNISVLALQEVTDDLITRLTEADINELLPYHQFGDAKETDNGGFNVIYSRYEPSAA
FT                   VPNVVSIPAADVPAITLKTSGNRTVTLCSAHPKSPMRGCADWSAGILGLRELARAKSVS
FT                   NRNIVVVMGDLNSSTDHPSFRALLKSGFKDASLIQAAGPNLTFPRWLKWPRIELDHILF
FT                   TQGLRPSGVTSFEVPDTDHLALAATLTLR"
FT   gene            complement(443919..445730)
FT                   /locus_tag="BLJ_0367"
FT   CDS_pept        complement(443919..445730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0367"
FT                   /product="signal recognition particle protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99849"
FT                   /db_xref="GOA:D6ZY53"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY53"
FT                   /protein_id="ADG99849.1"
FT                   /translation="MYRRSAPPHPDLRNNPVKRTQIPFTKPHSATQSPESVVPNTAISR
FT                   VAARLLPIMAAFSSLTDRLSNAFKHLKSKGKLSEADIDGTIREIRRALLDADVALDVVR
FT                   SFTGKVRERALGTEVSDALNPAQQVVKIVNEELTDVLGQGVDRPLNFAKNPPTIIMLAG
FT                   LQGAGKTTLAGKLGYWLKDSGHTPLLVAADLQRPNAVTQLQVVGERAGVPVYAPEKGVQ
FT                   SDGGEAVAAPGQTSGDPVKVARDSIELAKQKLYDTVIIDTAGRLGVDEELMKQARDIRD
FT                   AVHPNEILFVIDAMIGQDAVKTAKAFDEGVDFTGVVLSKLDGDARGGAALSVASVTGKP
FT                   ILFASNGEGLKDFEVFHPDRMASRILDMGDIMTLIEQAQKQFDEEEARKAAEKISEGSF
FT                   GLDDFLDQLQQVRKLGSMKSLLGMIPGMAQHRKELEQFDEKEIDRTEAIIRSMTPAERR
FT                   DPSIINGSRRARIAYGSGVTVSQVNALLQRFEQAAKMMKRMSNRGGMGGGIPGFGGPAM
FT                   GGGKKKGKNKKKGGKSGNPMKREAEEKALRDKLAGKSSGSTGGSAFAKKPQNPALPAGL
FT                   EQMMGNVDGGTELPPNLGGGLGGLFGR"
FT   gene            445989..446897
FT                   /locus_tag="BLJ_0368"
FT   CDS_pept        445989..446897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0368"
FT                   /product="cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99850"
FT                   /db_xref="GOA:D6ZY54"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY54"
FT                   /protein_id="ADG99850.1"
FT                   /translation="MPTQKLLERKALIVGIVINVLQVLAGMAVFFMTGLKAMFLDFSFT
FT                   AISVLSGMVAVYLSSRTVRTTERFPNGMFALEPIYAICKAIFTMSLLVYSLIDVCRVAY
FT                   DYFVFGSGERIETGPVVIYEILTVIVCFSLYMYYRRSNRSIGDSSTMLTAECKSTLVDG
FT                   SMSFGIGVVAIFLMLLPAGGPLDFLHYTGDFFITVALVALTIKEPFSVLKEAFVELVGG
FT                   VHDDDETNAYVEAEAQRHLPANTDYEQTLIFKTGMNYTVDVYLSGIGETIDVADLIECK
FT                   RSLEKELIKRLHIVDVDFVFD"
FT   gene            complement(447145..448785)
FT                   /gene="cysS"
FT                   /locus_tag="BLJ_0369"
FT   CDS_pept        complement(447145..448785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="BLJ_0369"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99851"
FT                   /db_xref="GOA:D6ZY55"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY55"
FT                   /protein_id="ADG99851.1"
FT                   /translation="MGNSQEPQDFNISVMPSSLTPVHVAKAAEGLNLYDTASHQVSHFV
FT                   PLKPGEVGIYVCGATVQSSPHIGHIRAAVAFDIVRRWFLKLGYKVTFVRNVTDIDDKIL
FT                   DKAAAAGQRWWARAYYYEREFTEAYNTLGVLPPTVEPRATGHMSDMIDLIQRILDNGHG
FT                   YVVTDANGKPTGNVYFDVASWPHYGELTHQKQTSEVDEAAAVADRMGPSVDATGADKYN
FT                   PVDPADASPDKHDPRDFALWKAPKDTDPEDARWSTPFGVGRPGWHIECSAMSHRYLGDG
FT                   FDIHGGGLDLRFPHHENEMAQTCAAGYPSAARWMHSAWVTAKGEKMSKSLGTGLSVPSV
FT                   LAEHSAWVVRYALGSVQYRSMLEWSDQALVEAQAAYDRVSNFIERAGVALGGQPSREEV
FT                   AAVSADDLPADFVAAMNDDVNVSGATAAIFTAIRSGNTLLSQLADRADSETAKAEVREA
FT                   LLAVRAMLDTLGLDPLAEPWVSAGGAADGTAESPEHAALEALIAEQLNARAEARKAKDF
FT                   AKADQIRDALTEAGIAIEDGPQGSTWSLK"
FT   gene            448842..449732
FT                   /locus_tag="BLJ_0370"
FT   CDS_pept        448842..449732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0370"
FT                   /product="glutamine amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99852"
FT                   /db_xref="GOA:D6ZY56"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY56"
FT                   /protein_id="ADG99852.1"
FT                   /translation="MNASQAGPERGDRRMRSGTTVSREHVFDRCGNCEIHGFALPVTQT
FT                   GNARATIEVMATPQVLILQHVPWERPGRILSNLEDIGLETVTMNIVDKKKPDLPDFGEL
FT                   AGVVIMGGPMGALDYDKYPGLKAEAKLARAAVASGKPILGVCLGHQIIATALGAQLRKG
FT                   DAPEIGFAPIKRVDKHDFFSMWDKQLTVLHWHNDVVGLPEGGQLLARSSSTKVQAFRLG
FT                   SALGMQFHLEVCGSLLDEWLDEPSMVKDLKAAGGSKSRLREQFAQYDQLLHPLAEQVFS
FT                   GFAARCNSYAQTLNK"
FT   gene            449780..452056
FT                   /locus_tag="BLJ_0371"
FT   CDS_pept        449780..452056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0371"
FT                   /product="ATP binding protein of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99853"
FT                   /db_xref="GOA:D6ZY57"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY57"
FT                   /protein_id="ADG99853.1"
FT                   /translation="MPTYDIGLEHVSLAFATKTIFTDVTQGVFEGDRIGIVGKNGDGKS
FT                   TLLHLFRGTQEPDSGRVTKRGGLTFGMLDQRDPLDDNATIRQAALEGRADYEWASDNTS
FT                   REIVEALLGGMSLDAKVGSLSGGQRRRADLARLLLKDWDILALDEPTNHLDVVTIHWLA
FT                   EHLKNRWSKGQGALLLVTHDRWFLDEVCESMWEVHDGVIEPFEGGYSAYMLQRVERDRQ
FT                   ADVRETKRRNLARKELAWLSRGARARSTKQKFHVKAARELIADVPPMRNTLELKQMATS
FT                   RLGKQVVDLVDVTQIFEKPQGMADIDPDVAALSASASRVDVVNAMYAEPQLHGSVEVAV
FT                   TDLTDPRLVDAGVPEAAEAAEEARKKAEAESGNPQLADDREVRRMNTGGETIGGDTAAT
FT                   NSDDGTAAAGVTSAARKVTVSGREILDDVTWLIGPGDRFGIVGANGAGKSTLLKLIDGS
FT                   ITPTVGHVNIGKTVKFAVLSQRLDELEKLGQYKIKEVLSRYKPSYIVDGKEVTPGQLME
FT                   RLGFESAQLMTPIRDLSGGQKRRMQLLLILLDEPNVLIMDEPGNDLDTDMLAVMEDLLD
FT                   TWPGTLIVVSHDRYLLERVTDQQFALIGGKVRHLPGGVQDYLDMVEAIKNGKGLPADTP
FT                   GFAGTGSSSAKSGRGKAAAVNVAASLPQSTSRTAPSSEGANNGEDSTSKLTGKAFHEAS
FT                   KRVNAIERKLAKLEERKTELEAQMAAHDPSDYEGLNKLNEQLTAVNTESDNLEAEWLEL
FT                   SEQLE"
FT   gene            complement(452158..452436)
FT                   /locus_tag="BLJ_0372"
FT   CDS_pept        complement(452158..452436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99854"
FT                   /db_xref="GOA:D6ZY58"
FT                   /db_xref="InterPro:IPR005569"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY58"
FT                   /protein_id="ADG99854.1"
FT                   /translation="MATLTIRKIPDEQIQQLKEVAEKNNRSMESQVRSILEEWLAGTVA
FT                   HEITRKTNFYDEIREFMKNMDFEGLDKGELPLSERNSADSRPPVSFE"
FT   gene            complement(452591..453145)
FT                   /gene="ilvH"
FT                   /locus_tag="BLJ_0373"
FT   CDS_pept        complement(452591..453145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvH"
FT                   /locus_tag="BLJ_0373"
FT                   /product="acetolactate synthase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99855"
FT                   /db_xref="GOA:D6ZY59"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY59"
FT                   /protein_id="ADG99855.1"
FT                   /translation="MANYPASQPGSQRHTLSVLVENRPGVLARIAGLFARRAFNINSLS
FT                   VSPTERPDISRVTVTADVEAVPLEQIIKQLNKLLHVLKIVELDPNSTVERELVLIKVAA
FT                   DESNRSDVLEIVRLFRVRVVDVNPESLTIEATGAEGKIDALLGLLEHYGVIELVRSGAV
FT                   AVTRGPRALSEKVVGSEVTGR"
FT   gene            complement(453162..455129)
FT                   /locus_tag="BLJ_0374"
FT   CDS_pept        complement(453162..455129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0374"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99856"
FT                   /db_xref="GOA:D6ZY60"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY60"
FT                   /protein_id="ADG99856.1"
FT                   /translation="MALPTPLQAFSGVPKINAAPDKQTIVDGEKMTGAQALVRSLEDLG
FT                   VEDVFGIPGGAILPVYHEIKDNTKFRFVLMRHEQAAGHAAEGYALATGKVGVCIVTSGP
FT                   GATNVVTAIADANMDSVPMVVITGQVGVQAIGTDAFQEADIVGITYPVSKHSFLVTRAQ
FT                   DIPRVLSEAYYIANTGRPGPVVVDLTKTAQTGDMYYSWPQRMILPGYNPTTKAHGRVLS
FT                   DAAKLFSQSYRPVLYVGGGAARSNAGAQVKALADLTGAPVVTTLPARGIIPDSDPKNLG
FT                   MLGMHGTIAATGAVQRADLLVAIGARFDDRVTGKLDAFAPTARVIHIDIDPAEIGKNRQ
FT                   PDVPIVGDAATVLDDLIPEIQRTQAIQGKPNLAPWWKAIDGWREEYPMTWDEPTDGSMA
FT                   PQWVIKKLSEMADPSTIWVTGVGQHQMWASQFIDFENQHAWISSGGLGTMGYGLPAAIG
FT                   ASVGSAREFEGKKPVWLIDGDGSFQMTSEELAAAFLDHAPVKIAILNNSVYGMVRQWQT
FT                   LFYEHHYSQTNLLDGEAHGADGAAALVDGDAPLEVPDFIKLAEAYGCVGIRAFTEEEAI
FT                   NAIEKANQINDRPVLIDFRVWKDAMVWPMVAAGASNDEVTYKPGIKPLAGGTPAPGTGP
FT                   DEHATGVFEHETAAAAASEH"
FT   gene            complement(455290..456018)
FT                   /gene="rnc"
FT                   /locus_tag="BLJ_0375"
FT   CDS_pept        complement(455290..456018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnc"
FT                   /locus_tag="BLJ_0375"
FT                   /product="Ribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99857"
FT                   /db_xref="GOA:D6ZY61"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY61"
FT                   /protein_id="ADG99857.1"
FT                   /translation="MSNETPQQPTPANELLEALGTTLSPDLLVQALTHRSFSHEHPGVA
FT                   NYERLEFLGDAVLELVSTETLFTIHPDMTEGQLAKMRAKAVSEDALSAIAKTKLKVGPY
FT                   ILLGHGETEQGGAEKNSILCDIVESLIGATFLEHGIDEARKVIHRLIDDTLAEVATEGP
FT                   ALDWKTSLTVKAHGLGKDEPVYHMEVSGPEYAQIFTARVSLGENGDIIGIGKGSSKRKA
FT                   QLAAAEAGWKSLDSLKTRTK"
FT   gene            complement(456166..456360)
FT                   /gene="rpmF"
FT                   /locus_tag="BLJ_0376"
FT   CDS_pept        complement(456166..456360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmF"
FT                   /locus_tag="BLJ_0376"
FT                   /product="ribosomal protein L32"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99858"
FT                   /db_xref="GOA:D6ZY62"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY62"
FT                   /protein_id="ADG99858.1"
FT                   /translation="MALPKYKTSRANTHSRRANWKATAAATVNCPNCGAPALPHMACPS
FT                   CGNYRGRTYRSAIQPAHTK"
FT   gene            complement(456449..457078)
FT                   /locus_tag="BLJ_0377"
FT   CDS_pept        complement(456449..457078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0377"
FT                   /product="protein of unknown function DUF177"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99859"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY63"
FT                   /protein_id="ADG99859.1"
FT                   /translation="MARVEDSPWAIPVAQIASRAGQSKPIDADFPAPSGIGDSIVGIKD
FT                   GEPVHVSGQFDSIVDGLIFTGRLVAPFVSECTRCLKPIDEDWPVDVTVFFPYESGQDKA
FT                   NGKGGKNKKDDEIDIIAGEDESEDTYPLLENGAFADIEAMIRDTLVESLPLQPLCRPDC
FT                   KGLCSQCGADLNEDPDHHHDVTDIRFAGLAGLKAQLEAEQNGEQAE"
FT   gene            complement(457167..458057)
FT                   /locus_tag="BLJ_0378"
FT   CDS_pept        complement(457167..458057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99860"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY64"
FT                   /protein_id="ADG99860.1"
FT                   /translation="MTMSDDHPTGYVDLTKPNADAASSTPEPSAPEPPASTQAAPAPTE
FT                   EADVLAGSPPAAPTPTPAQMQAKAQAQAAQQTRAQAQTAQAAGTRPSFMNEMPDLRETT
FT                   DDDPATVKSREEFTTVYDIIDQLEAALGEAKSSIFAPGMVKVDRDEFTDQLSELKKMLP
FT                   VQLERASALMREAERRLESAQTQSNAIVASAQSRAADMIKDANEQAQFLAGQENVTELA
FT                   RQKARAILDQAQTRADHLTQGADQYCTTVMEGLSQQLGKLSRDVQAGLNVLEERQRAAG
FT                   EQMPHLTLNDYPEAQ"
FT   gene            complement(458065..458565)
FT                   /locus_tag="BLJ_0379"
FT   CDS_pept        complement(458065..458565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0379"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99861"
FT                   /db_xref="GOA:D6ZY65"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY65"
FT                   /protein_id="ADG99861.1"
FT                   /translation="MTIAVCPGSYDPVTAGHLDVIERSARFFDEVHVVVAVNAAKTPMF
FT                   SEATRVDVIRRALDKAGCKNVTVSSTDGLITDYCKKVGATVIVKGLRQNGDYEAELGMA
FT                   LVNRKLAGIETLFLPADPILEHISSSIVKDVARHGGDVTGMVPDCVVPMLADALAEERQ
FT                   RKD"
FT   gene            458840..459133
FT                   /locus_tag="BLJ_0380"
FT   CDS_pept        458840..459133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99862"
FT                   /db_xref="InterPro:IPR021400"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY66"
FT                   /protein_id="ADG99862.1"
FT                   /translation="MTFAEMFVDDAEPLRNPDQGAGTSVLERPETKESPVRDDGGDADR
FT                   FAHYVSKDRIAESRATGRPVVALCGKVWVPKHDPSKYPVCPDCKRIYEEMTR"
FT   gene            complement(459175..460185)
FT                   /locus_tag="BLJ_0381"
FT   CDS_pept        complement(459175..460185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0381"
FT                   /product="aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99863"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY67"
FT                   /protein_id="ADG99863.1"
FT                   /translation="MFEPTAIYAPNPHRYDTMTYNHAGTSGLKLPAVSLGFWHNFGDIT
FT                   PFDQMKSLVFTAFDNGITHFDLANNYGPEPGQAEKNCGLLLAKYFRHHRDELIISTKAG
FT                   YEMWAGPYGDLGSRKYLLASLDQSLERLGLDYVDIFYHHHPDPETPLEETMGALAQAVN
FT                   SGKALYVGLSNYDGPTMEKAAAILADLHVPFIINQNKYNILDRTVEENGLKETAFKLGK
FT                   GLITFCPLAQGLLTNRYLNGIPAGSRMAHDPRFLNDSALTEKLHKQVVDLNNLAAERGQ
FT                   TLAEMSLAWLLHDGKVTSVLTGASKPQQILDNIGALKNTHFSDEELKLIDEISAR"
FT   gene            complement(460542..461168)
FT                   /locus_tag="BLJ_0382"
FT   CDS_pept        complement(460542..461168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0382"
FT                   /product="conserved hypothetical transmembrane protein with
FT                   unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99864"
FT                   /db_xref="GOA:D6ZY68"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY68"
FT                   /protein_id="ADG99864.1"
FT                   /translation="MRFIVALWRFAIAGFCFVGTYEAWSKPQFWVYFTFQTGFVLGIVM
FT                   LWAGAATLLKGIQPPAWPKGCLTVYAIVTALVAFFLMPPDDPAYVPQVIGIMTNTMLHK
FT                   IAPIMAVIDFVLFDPHRRFRWHYMFSWLAYFPAYLVFVLARATIWPGSGPAAGGSPYPY
FT                   DFINLDALGWQGFGISCGKLAIAFFVISLVVWLLDRALPSKALLG"
FT   gene            461262..462584
FT                   /locus_tag="BLJ_0383"
FT   CDS_pept        461262..462584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0383"
FT                   /product="putative nicotinate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99865"
FT                   /db_xref="GOA:D6ZY69"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY69"
FT                   /protein_id="ADG99865.1"
FT                   /translation="MVDYSPALMTDMYEYTMLDAALKDGTADRKCVFEVFTRRLPEGRR
FT                   YGVVAGTGRILDALEHFHLDEADLKFLADRHVVSPETIKWLENFHFSGTIRGYREGEMF
FT                   FPNSPILQVEGTFGECTLLETLILSVLNYDSAVASAASRMASAAKDRPCMDMGGRRTNE
FT                   WAAVAAARAAVVGGFKGTANLLAAQLYGLKAIGTAAHCFTLVHDSERDAFESQIEALGK
FT                   NTTLLVDTYNIEEAVKTAVEVAGPELGGVRIDSGDLAAMAQRVRNQLDALGATNTTITV
FT                   TNDLDEYALAALQTAPVDSYGVGTMLVTGSGAPTCAMVYKLTEREGADGTMVPVMKKSK
FT                   DKATVPGRKLAFRSYEYALAEAEHVISGSEEKLAGFTPEPTWKNLLVDFVDHGQIDAQW
FT                   QGHDAIMAAHDYHAKALSELPITAQSLMKGEPVIPTETQVL"
FT   gene            463584..464426
FT                   /locus_tag="BLJ_0384"
FT   CDS_pept        463584..464426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0384"
FT                   /product="transcriptional regulator, Fis family"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99866"
FT                   /db_xref="GOA:D6ZY70"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY70"
FT                   /protein_id="ADG99866.1"
FT                   /translation="MSETLNDENAAGNDDVSERRAVEHRALEQCDVVHHGVVSGCPVNS
FT                   CAAVLNEVMSQTGWNAYELAQRTGLDRSAIGRVLRGQRGMLFDVLAEGLERAGFGLHLE
FT                   AVAPSQTIPEDELHMLLAQLRRPPDFDAIESGATWSTLKMLCVNLIHARNVQHQRISFV
FT                   RAVARVNDACWIAFLAGLYRFLRWDINPRNRRLTLVPPYRYGLDGWWSPLPSAAIMHVL
FT                   HRYEEPLHDMDYTYLPLIDYELNAMQRKQFNQDFMEYGILIPVDDLSQSSSGTQALTL"
FT   gene            464558..465334
FT                   /locus_tag="BLJ_0385"
FT   CDS_pept        464558..465334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0385"
FT                   /product="ribonuclease PH"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99867"
FT                   /db_xref="GOA:D6ZY71"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY71"
FT                   /protein_id="ADG99867.1"
FT                   /translation="MLGRMVEIKDMLGNHQIIRADGRKVDELRPVRITRHFTDAPEGSV
FT                   LIECGNTRVMCTATFTPGVPRWRKDSGLGWVTAEYSMLPRATAERTDRESVRGKIGGRT
FT                   HEISRLIGRCLRGVIDMKALGENQIQLDCDVLQADGGTRTASVTGAYVALVDAVNWAEK
FT                   HRHIKSASRVLKDYVSAVSVGVINGTPMLDLPYIEDSQAMTDMNVAMTGSGTFIEIQGT
FT                   AEHRPFNRAELGTLLDLAEKGNKELQAAQRAALSLD"
FT   gene            465434..466192
FT                   /locus_tag="BLJ_0386"
FT   CDS_pept        465434..466192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0386"
FT                   /product="Ham1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99868"
FT                   /db_xref="GOA:D6ZY72"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY72"
FT                   /protein_id="ADG99868.1"
FT                   /translation="MQIVVATHNEGKLVEIRRILEEDLGADAENIELVSAGSLHLPDPV
FT                   ETGVTFQENALLKARAVAIRTGLPAVADDSGLIVDVMGNAPGILSARWAGAHGHDKANN
FT                   ALLLAQIEDIPDDKRTARFRCAAALVVPDAEASADVTGGVAADGITVYTTAADGSTAPV
FT                   HARYAIKSETVELGDMPGRIIREARGEHGFGYDPLFVPDDQPAGRVSTEPDHEGEPLTS
FT                   AEMTPAEKNAISHRGKALKALVPAIEALLH"
FT   gene            complement(466364..466436)
FT                   /locus_tag="BLJ_0387"
FT   tRNA            complement(466364..466436)
FT                   /locus_tag="BLJ_0387"
FT                   /product="tRNA-Thr"
FT   gene            466643..467911
FT                   /locus_tag="BLJ_0388"
FT   CDS_pept        466643..467911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0388"
FT                   /product="Methicillin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99869"
FT                   /db_xref="GOA:D6ZY73"
FT                   /db_xref="InterPro:IPR003447"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY73"
FT                   /protein_id="ADG99869.1"
FT                   /translation="MRDFVLVKLTDEEFDDFSARHPQGNFQQTSAMGRLRAAQGIDVEY
FT                   LALKEGEKIVAAALFETHRSRFSTFAAIHDGPMCDYHDTEALTFFMDALKRHAKAKGAS
FT                   QLEITPESPYRLRDTNGASLPDDQNGAPDNKLIERLEAISFTHGGFTVGYTAVPRWRYL
FT                   KDLTGITDEKSLLKSYDKRTQWSVKRAQSMGVHVRELSDDELGVFARIEQQTAERRSFE
FT                   YRGEAYFHRFKEAFGNKAHFMVAEIHIDEYVADMTAKREALSAKVAALTAKNAEHPTTK
FT                   TERQLGEETRNLAAAEKRLNEAAEFAKDGDVLPAAASLFVEHPREVIYLFSGSVEQYKP
FT                   FYASALIQHDAMLHFCVEHGLSRYNFYGIDGVFDDPDDEGRGVLEFKQGFNGYVEELPG
FT                   EFVLPVKPVAYAMKQFAHKLLSR"
FT   gene            467985..469295
FT                   /locus_tag="BLJ_0389"
FT   CDS_pept        467985..469295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0389"
FT                   /product="Methicillin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99870"
FT                   /db_xref="GOA:D6ZY74"
FT                   /db_xref="InterPro:IPR003447"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY74"
FT                   /protein_id="ADG99870.1"
FT                   /translation="MTQSDAGVASLTPTKITPAELDAFSAAQVQGSFQQTSQMAAMGAF
FT                   NGPVDYVGVKRGDKLVAACYVVYTQSRFGLEGSVWCGPLCDYDNPQVVEAMTEALRRSA
FT                   KAHHAISVSCWPAAVYRLHDLDGKPTSDPDTTMMDNMARFGWKHGGFTVGYESVVNRWN
FT                   FVKGLDGIHNEKELLASFSKYRRKNIRIAQDSGLRVRRLERGELSTFVKLCDMSAARQG
FT                   FKSRDLAYYERLFDTFGDLIEFKVVETHFDEYLDTLQSKLNAASKDKRNLERLLHRAQQ
FT                   RPEGTAKKGASDPATLEKRIATADKKITALEKTIGEVNGIIASDGPVIPVEAGVYFWHP
FT                   NEVVCLSSGEDDRFMDYYPSSLIHFEAMLDCIARGVERFNFYGISGIFDANDPSYGVWQ
FT                   FKTRFGGFVEELPGKFTLPVDGLRFGVSEAAHKLLHR"
FT   gene            469345..470625
FT                   /locus_tag="BLJ_0390"
FT   CDS_pept        469345..470625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0390"
FT                   /product="Methicillin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99871"
FT                   /db_xref="GOA:D6ZY75"
FT                   /db_xref="InterPro:IPR003447"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY75"
FT                   /protein_id="ADG99871.1"
FT                   /translation="MSATANRTDTTYTFGVITPEEFDRLSEATSQGSFQQWSGQVRLAK
FT                   IRGHEAECVGVCDASGNLVAGCVILYLNGRFGADGSVYFGPIGISDDPALLRAITEAIR
FT                   ESARRHHAVSVACWPNVAYRLYSSDGQPDGEPNDALLTGFTDAGWTHGGFHTGYDVVCQ
FT                   WMYVKDLTGITNGKELLASFGKRAQWSVKRAQSMGVHVREIGPDEFDVFADIERRTGER
FT                   RGFATRGADYFRQFKQAYGADAHFMLAEIHIAEYVADMTAKREALQTKVAQLQTKYDER
FT                   PTTRIERQLGEESRNLAAADKRLAEVEGYAKKGDVLPAAASMFVSHPNEVVYQYSGSLE
FT                   EYKPFYASALIQYEAMLHLCVEQGVSRYNFYGISGVFDDPNDEGRGVLEFKQGFNGYVE
FT                   QMVGKFTLPVDKFRFGVSNLAHKLLHR"
FT   gene            complement(470719..471720)
FT                   /locus_tag="BLJ_0391"
FT   CDS_pept        complement(470719..471720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0391"
FT                   /product="Auxin Efflux Carrier"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99872"
FT                   /db_xref="GOA:D6ZY76"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY76"
FT                   /protein_id="ADG99872.1"
FT                   /translation="MSAILTPVGLLLIILAGYLFKRFGLFGQKDYRVLQTAEFNIVLPG
FT                   AIVYSFATNPHDISLLLISVFAFLFAFIPIVFIFLATRKRNVTDRAFLMLNGAGFNLGC
FT                   FSFPVVQSFWGAGAVVPAAMFDIGNCVMVAAGTNVLTQQLLHIQPGKTLAEQHAGSVPT
FT                   LPYEKPKDRDAKRLARRALLRTIGKSFFGSVPFDTYLLMIALTVANVRIPDWIASITQP
FT                   LSGANALVSMLMVGMLMDLPQSKHDVKEVMAVIAWRIPFSVAFALISWFLLPFSASIRA
FT                   VMVICALAPIAIFSTLFTDKVLGNAKLAGFSLAITAMISLVMMAFAHALMGV"
FT   gene            complement(471909..471992)
FT                   /locus_tag="BLJ_0392"
FT   tRNA            complement(471909..471992)
FT                   /locus_tag="BLJ_0392"
FT                   /product="tRNA-Leu"
FT   gene            complement(472080..472152)
FT                   /locus_tag="BLJ_0393"
FT   tRNA            complement(472080..472152)
FT                   /locus_tag="BLJ_0393"
FT                   /product="tRNA-Thr"
FT   gene            472442..474139
FT                   /locus_tag="BLJ_0394"
FT   CDS_pept        472442..474139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0394"
FT                   /product="Glucose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99873"
FT                   /db_xref="GOA:D6ZY77"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY77"
FT                   /protein_id="ADG99873.1"
FT                   /translation="MAINPPVDATQTPEWAALQKHYDELQAEGVSLKKWFAEDAERVDK
FT                   LSFDAGDLHFDLSKNLIKPETLQLFANLAKAVKLDERTKAMYTGVHINNTEDRAVLHTA
FT                   LRRPVEDEGKYIVDGQDTVKDVREVLDRIYAFADKVRSGEWTGVTGKKIETVVNIGIGG
FT                   SDLGPVMVYEALKPYADAGISARYISNIDPNDLAEKTKGLDPETTLFIIVSKTFTTLET
FT                   LTNAREARTWLLEELKAKGAIDGSDEKNAEAIKKHFVAVSTNLEKVAEFGIDPNNAFGF
FT                   WNWVGGRYSVDSAVGTSLAVVFGPARFEEFLHGFHEIDEYFANTPFEKNVVVLLGMLNV
FT                   WYRNFFKVASHAVLPYDQYLHRFPAYLQQLTMESNGKSVRWDGTPVTSETGEIFWGEPG
FT                   TNGQHAFYQLIHQGTQLIPADFIAFVNTPNPTKDGDQDVHELFLGNYFAQTKALAFGKT
FT                   ADEVRAEGTPEEIVPARVFTGNRPTTSIFGVALTPFAVGELIALYEHITFVEGTVWGLD
FT                   SYDQWGVELGKQLAKQITPAISQDDDALAAQDASTQSLIKFYRANREF"
FT   gene            complement(474546..475970)
FT                   /locus_tag="BLJ_0395"
FT   CDS_pept        complement(474546..475970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0395"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99874"
FT                   /db_xref="GOA:D6ZY78"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR018632"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY78"
FT                   /protein_id="ADG99874.1"
FT                   /translation="MTVAMETIRSLRAVTPQNTIIEAQHVGQRFTADNGTELTVFDNIS
FT                   FNLYEGEIVAILGRSGAGKSTFLRALAGLVKPTSGTVKYRGEALTGPNPGIALVFQTFA
FT                   LMPWLTVQDNVELGLKARGVPRAERTKLALDAIDMIGLDGFESAYPKELSGGMRQRVGI
FT                   ARALVLRPDALFMDEPFSALDVLTAENLRQEVLKLWSSEQRSIKSVLMVTHNIEEAVEM
FT                   ADRVVVLGSHPGHLIADVRVDLPRPRDRHSVEFEAMVDRLYAILTGQASQPAQQAEALS
FT                   PSASLTNAPVTDASVTDASDLQPAKTIEKIKEHPLPNATPGGLAGLLDVVAEHPHGIDL
FT                   ADLASALSFEVDDLFPLVDAGTMLRVIVVRDGHVQITEAGDSWHKADILRAKQVFASLA
FT                   MEHAPLVHNIEHALRKSAEGKLRGELMLDLLRARYANDEAHQQFAIAVEWGRYGELFDY
FT                   DADDDLLSLDEANKGE"
FT   gene            complement(475989..477779)
FT                   /locus_tag="BLJ_0396"
FT   CDS_pept        complement(475989..477779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0396"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99875"
FT                   /db_xref="GOA:D6ZY79"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY79"
FT                   /protein_id="ADG99875.1"
FT                   /translation="MTMFSFNRVDARPDASARNPSTAASDRQPFAVRLASDVLVASGIL
FT                   ALFGLIAWILPAIGEPIGPKGVPSQVSTNLADLPYYALRSVFRMFVALFFSLVFTFIYG
FT                   TAAARCRRLSRVLIPLLDILQSVPILGFLSATITIWMVLFPGSMLGVEAASIFAIFTSQ
FT                   AWNMAFSFTRSLTSEPTELDEAARSLQLTRWQRFWTLDVPNAMIPLLWNCMMSVGGGWF
FT                   FLTASEMISVNNRTYALPGIGSFVAQAAAEENLAAICWAIVMMVLVVLLIDVLLWKPLT
FT                   AWAEKFRITQSESAVRKTSVVLTIIRQSHIDEMVAWLFRPVGDLFDTLTRPLGRTGGRW
FT                   AADVKSARSRALDAVFTVLVLAACAFGLVQLMLVIHRDAGFGELGQAFVLGMVTFLRVA
FT                   LLTLVCSVIWVPIGAMIGMNPRVSRFMQPIVQVLASFPSNFTFPFVTLWFVACSVDINW
FT                   GSILLMALGTQWYILFNVIAGASQIPDDLREMTRSFQLGRWQRWRDLILPAVFGSWVTG
FT                   GITAAGGAWNASIVSEIVSYGRHTLTASGLGAYIAEATESGNTVRTIIGVTVMSVFVVA
FT                   VNRLFWNPLQRMAEHRFALN"
FT   gene            478515..478880
FT                   /gene="rplS"
FT                   /locus_tag="BLJ_0397"
FT   CDS_pept        478515..478880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="BLJ_0397"
FT                   /product="ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99876"
FT                   /db_xref="GOA:D6ZY80"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY80"
FT                   /protein_id="ADG99876.1"
FT                   /translation="MVNAVEAFDAKHMKPAEEIPAFRPGDTVDVNVKIQEGNNSRIQTF
FT                   TGVVIARKGAGVRETFVVRKISFGTGVERRFPVHSPSIDSIKLVRKGRVRRAKLYYLRA
FT                   LRGKAARIAERRDNSAK"
FT   gene            479047..479886
FT                   /locus_tag="BLJ_0398"
FT   CDS_pept        479047..479886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0398"
FT                   /product="signal peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99877"
FT                   /db_xref="GOA:D6ZY81"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY81"
FT                   /protein_id="ADG99877.1"
FT                   /translation="MQDDQDNGEFPVSDNPESNQTSYDDEADARDSRTFQVADHGIALS
FT                   PVPPAPARPAHAASSAGANAAAASSMDDDHFTLRDFFLWCGVPVLIVLLIRIFAVGFYE
FT                   IPSRSMMDTMVPGDRVVTSKLTPKIFDLQRGDVVVFKDPNNWLNEEQSSAPGGGYLIKR
FT                   LIGLPGDVVECKGTGQPVTINGVAINETSYIRPGVDPSAFPFSVTVTEGHVFVMGDNRA
FT                   NSADSRYHQDDGDRGLVPISDVVGVGIAKYWPLDRLGAIDDHHEVFKDVSDASGSNS"
FT   gene            480004..480831
FT                   /gene="rnhB"
FT                   /locus_tag="BLJ_0399"
FT   CDS_pept        480004..480831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="BLJ_0399"
FT                   /product="Ribonuclease H"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99878"
FT                   /db_xref="GOA:D6ZY82"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY82"
FT                   /protein_id="ADG99878.1"
FT                   /translation="MITPTLDLERSLAAQGYDLITGFDEVGRGALAGPVMVGCAAIWAC
FT                   DLAPLDGDDSAELSGRTYLGVPDGVADSKMLTEHRREAIFDELRDWCAAYAVGQASNTE
FT                   IDEWGITYALGVAALRALSQVERELGLRLGGGLTAKKAAGEIVEGHPGDSVGESIGNCG
FT                   ESVRALPKVAGILDGPSDYITKALNTFDAPDVPIPADITTKVKGDQHCATVATAAVIAK
FT                   VTRDRLMVDLAQSNPRYAVYEWAHNKGYGSAAHRAAIAEHGPTPLHRVSWHLT"
FT   gene            480994..482073
FT                   /locus_tag="BLJ_0400"
FT   CDS_pept        480994..482073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0400"
FT                   /product="regulatory protein, LacI"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99879"
FT                   /db_xref="GOA:D6ZY83"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY83"
FT                   /protein_id="ADG99879.1"
FT                   /translation="MFEVAKLAGVSHQTVSRVINDSPDVSDATRARVQAAIDQLGYRPS
FT                   NSARALASRRSRTIGLIAGGLKFFGPISSISSIESMAREHGLFMSVMMVHEALCTQADF
FT                   DNLCYTFNEQNVDAFIFLTPTDVMFAAACRARVTQPRVIVTATHGQMTVREGLGLISTE
FT                   NKRRTALVGIDQWGAMAKVVALLGEYGHKSALYFAGPNEWRDAHTRLDAWRKLAASRSI
FT                   DSQIVRCHTWDASEAYAHMNHLIDEYGRRGMALPTAVVAANDNQAVGVMRALHEHGLRI
FT                   PQDISVVGFDDMSGVDNMYPPLTTVHPDFEGLGVAAMRETLRLLGEGGEPTFLTTQHGM
FT                   GLIPAEVRARRSLGPAPRR"
FT   gene            482228..483874
FT                   /locus_tag="BLJ_0401"
FT   CDS_pept        482228..483874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0401"
FT                   /product="ribulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99880"
FT                   /db_xref="GOA:D6ZY84"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="InterPro:IPR042029"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY84"
FT                   /protein_id="ADG99880.1"
FT                   /translation="MAATDNAAEQAAHIAEKIRAGKTTLGIEFGSTRIKAVLIDDNFQT
FT                   IASGDYSWASHLEDGLWSYTTEEIWGGLQSAYASMANDVETAYGEKLTHVGHIGFSAMM
FT                   HGYLAFDEAGELLVPFRTWQNTNTSEAHKKLSELFQYNIPERWSIAHLYQAVLNKEEHV
FT                   SEVAYFTTLAGYVHWKLTGEKVLGVGDASGMFPIDPTTHTYETAFIEKFDALPEVAAQP
FT                   WKLENLLPEPLVAGTPAGELTEEGAKLLDPSGALNPGIVLAPPEGDAGTGMVATNSVRV
FT                   RTGNVSAGTSIFAMVVLEHKLKALHPEVDLVTTPAGDLAGMSHANNFTSDLNAWVGLFG
FT                   QFAKAIGQSVDAGMLYGTLFRAAIADDVDANCGGLLNYPFRSGEFLAGLPEGRPLFARS
FT                   PEANMTLGNFMRAQLFSAFSPVKIGMDVMTKQEHVQVDSLVGHGGIFTTPKVAQKILAA
FT                   AFNTPIKVMSTAAEGGAWGMAVLANYLWNTNEDHSNLADFLDGFVFKDAQSTTEKPVAS
FT                   DVVGFEDFFARFTKGLPIEHAAIETINLEDK"
FT   gene            483959..484651
FT                   /locus_tag="BLJ_0402"
FT   CDS_pept        483959..484651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0402"
FT                   /product="L-ribulose-5-phosphate 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99881"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY85"
FT                   /protein_id="ADG99881.1"
FT                   /translation="MATLADYGPEVRAEVKQVREVVSNLHQQLIKWNLVVWTAGNVSQR
FT                   LHTADLFVIKPSGLRYEYLTPSSMVVCDLDGNVVDGAEAPSSDTASHAYIYRNMPDVYG
FT                   VVHTHSTYATAWAATGQNIPCGLTMMGDEFGGPVPVGPFRLIGSEAIGKGVVETLKKYP
FT                   KSPAVLMQNHGPFTIGKDAEGAVKAAAMTEEVAHTMWAARQLGDIIEIDQADIDKLNDR
FT                   YQNVYGQH"
FT   gene            484856..486373
FT                   /gene="araA"
FT                   /locus_tag="BLJ_0403"
FT   CDS_pept        484856..486373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araA"
FT                   /locus_tag="BLJ_0403"
FT                   /product="L-arabinose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99882"
FT                   /db_xref="GOA:D6ZY86"
FT                   /db_xref="InterPro:IPR003762"
FT                   /db_xref="InterPro:IPR004216"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR024664"
FT                   /db_xref="InterPro:IPR038583"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY86"
FT                   /protein_id="ADG99882.1"
FT                   /translation="MVMENPFEGKEIWFGVGSQDLYGEEALRQVAIHSAEMVDYLNNTG
FT                   KIPAKIVLKPTLKSSDGVKEFMVEASANPNVIGVITWCHTFSPAKMWIRGLEVLTKPLL
FT                   QLATQHHKEIPWETIDMDFMNLNQAAHGDREFGYIVSRLGIKRKVVVGHYTDPEVVEKV
FT                   GTWARACAGWDASNNMKVMRWGDNMRNVAVTEGDKTEAERVFGASINTWAVNELVAAYD
FT                   AVKDDQVKEIIEDYKAKYDVDPALLDAKYDSLFIAAKEEAAMVNMMRANGCTAGVDNFE
FT                   DLGALPQLPGVGPQRFPSEYGWGFSAEGDWKTAVLVRIGAVMGYGLEGGASLMEDYSYN
FT                   FTEGDELDMGSHMLEVSPSIGTIAKPKLEIHPLGIGGKADPVRLVFSGKPTKDAVVVSM
FT                   SDVRERFRLLMDVVDVVEPQGSLKELPCARAVWEPKPSLKTAVECWITAGGSHHTCMIT
FT                   SVGREAWEDFARIAGVELAVIDENTTARQFEKELELSEMYHRLNNQH"
FT   gene            complement(486557..487273)
FT                   /locus_tag="BLJ_0405"
FT   CDS_pept        complement(486557..487273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0405"
FT                   /product="peptidase C26"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99884"
FT                   /db_xref="GOA:D6ZY87"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY87"
FT                   /protein_id="ADG99884.1"
FT                   /translation="MTTNRPLIAVTPLMDYGRDSLWMLPGYMEAIMRAGGTPIMLPLTD
FT                   DADILAQCAERFDAFLFTGGPDVGPMVGAAASATGRSEVLSPERDRMESILLPAVMAWD
FT                   KPILGICRGIQFINAALRGTLWQDLPSQHPSDIEHHMNPPYDAFGHNVSLVPGTPLASL
FT                   FSGQTEIAVNSYHHQAVRDVAPGLEVMAVAPDGVIEALYRPASHFLRAVQWHPEFLYKV
FT                   DPRSQAIFDAFVGSCR"
FT   gene            486824..489067
FT                   /locus_tag="BLJ_0404"
FT   CDS_pept        486824..489067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0404"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99883"
FT                   /db_xref="GOA:D6ZY88"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY88"
FT                   /protein_id="ADG99883.1"
FT                   /translation="MSERIVRRIHMVFDIARMLAWQILPQRAAQRCIDELNATADAQNR
FT                   LVPSHYSWQQNRFHSVALRREHLATAGGGGRCTNHRSHIRPARKQKRVKPFGTLRKNVG
FT                   VIGQRQHDGRTAGPHYRLHISGQHPQTIAPVIHQRSHRNERSIRSHACLFSPKCRFRRS
FT                   AANRLIQWPIMPSLYRTNVTGRAALSRQPAATRSHNVPMMGGSVRPCQCSGHCTFSGES
FT                   MPPSAHRDERVRLTGRENHMNQACVRNDTIDAGNHHGRPQYRSFLRFLTSQERNVIWLL
FT                   LAVAFLPVDGTTLGLYAPFWSPISPALFAVYCLCNWRQLRIAANRYLPMFLLPVVCIIL
FT                   SIPGWLKFGIHLNAAFMSITGLLGVLATLGAIALAFDIKRIPWRTPLRILIASYWVSFG
FT                   VGVVQWLSIRLRAKPLTDYFSHLMYRQYISDNSVWGGGRPQFLFAEPSYIGMHLFGILL
FT                   PLMWLMRGRDRIYAKRLRDLIVTYAVGAVLMQAGTRIVIDSVVALLIALVARTDWHDGA
FT                   RRVRGMLQILGACALGLLGVLADSRLSAIAENGAEGDGSFFARIYQSLDPICGLLTHPW
FT                   TLLTGYGAGNIINAVWAGAAKAGRLLDGLGMNGGAATGFAAGVNADTVWTMCAYTSVIA
FT                   EYGLIGLAMLVGASMACMTRGRTVCRGGADGASSDGLAHGVCVTDVADVADVAGGNSGD
FT                   GVAGAGSGESGVWHKTVICWLVLVAYLYIQCENYAFAALPLLVFAASKVRRER"
FT   gene            489273..490640
FT                   /locus_tag="BLJ_0406"
FT   CDS_pept        489273..490640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0406"
FT                   /product="protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99885"
FT                   /db_xref="GOA:D6ZY89"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY89"
FT                   /protein_id="ADG99885.1"
FT                   /translation="MTFVARSVRYVLRKRVRTIVLLIVLTIITASMLSTIAVSRAAQQA
FT                   AGRIEKEAVGGFVLASNLQGSMLTPRGGGMVRPADVRRIAQLPGVDSYMVRQNATADLV
FT                   GANVAKVPGGDDYDATKEQQFGNAANVIGTNDSSKLNVFTSRTLGMAEGRHLKASDKYT
FT                   SMIHEDLAKANGLKVGDTLTLKANAYDADNESHSTATVKTTIVGIFKGDSARKVSSRAE
FT                   LTANTIYTDLDTTRDLYQYKDGKEIYQDATFVLSKGVDVEKTMDAAKKLPVDWDNYQIT
FT                   RNDQYSSSMLHAARGVRSMMRGALIGVTVSAVLVLSLMLLLWMNDRRQEMGILVSLGVG
FT                   KPSLVAQYLTEMVLIGLPSLALGWLCAQGMAQWLGTTALHSVNASAAKELSSMGQVGGD
FT                   LESSMSVRTLDSLTVSVDGTAMLYVALGLLAVMLVCVAVACMPMLRKSPRDLSEIR"
FT   gene            490640..491860
FT                   /locus_tag="BLJ_0407"
FT   CDS_pept        490640..491860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0407"
FT                   /product="protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99886"
FT                   /db_xref="GOA:D6ZY90"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY90"
FT                   /protein_id="ADG99886.1"
FT                   /translation="MSMNVWKRATLAIVRKPVRSGIIGLLMLMVFTSLVAQVGVSTALR
FT                   TMSDSIGAGMGIGFTVSAGENPISAEEASRFSRIPGVTKTAYATKTLAQVDGARPVMPR
FT                   QGPRLDSDLAMQVSVLGTTDSSLSEEFQSGLYRLEQGRHISGDGDNVLVHRDFALQNGL
FT                   SVGSTFRLQQEGRNATVRVAGIFSGNVQAQSPLPSDTSENLIYSGRRVTSALTGNDQIG
FT                   MIRCLSDNPQDLSAAVSQAKTMAGGKYDVTDDSARLSGVLQSVQTVRDLVRMVLLSVCL
FT                   ADVLVLAMALVFWIRSRIHEIGTLLALGIGKMQIVAQLAIETGLMAAVAALCSLGTGAM
FT                   LSGYVSSRLLRDSGVAPLESLHVEALPPEQTLLILLLGCAVIAVALAVSCAAVLSKSPK
FT                   SILSSMR"
FT   gene            491873..492508
FT                   /locus_tag="BLJ_0408"
FT   CDS_pept        491873..492508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0408"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99887"
FT                   /db_xref="GOA:D6ZY91"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY91"
FT                   /protein_id="ADG99887.1"
FT                   /translation="MSNCLQLDHVDYAYGAAKILVLSDVSADFESGKMYAITGPSGAGK
FT                   STLLSLLAGLDAPSRGVVRFEGEDIAASGYAKHRREHVSLVFQDHNLIDYLTPEENLRL
FT                   VSTKADMKILEELGLSREESKRNIMHLSGGQRQRVAVGRALVAPGRAILADEPTGSLDP
FT                   EMTDEVIHLLQHAAHQLGKCVIVVTHSKRVADSADVVLRLRSKKLTRA"
FT   gene            complement(492826..494649)
FT                   /locus_tag="BLJ_0409"
FT   CDS_pept        complement(492826..494649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0409"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99888"
FT                   /db_xref="GOA:D6ZY92"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY92"
FT                   /protein_id="ADG99888.1"
FT                   /translation="MLDHYTTPGESIEIRDNQTIYSLLTDRLARTGADTVIAAKKIGPG
FT                   RWQNVTTGEFHERVVSAAKGLIALGIAKGDAVTIFSSTRLEWGILDFALAAVGAVSVPI
FT                   YDTDSAPQAQRIMNDSVVKLAFADNRERFDRLDSVKDHCPALKQILMLEGNALGALEGL
FT                   GVAVSDEELNERVATVRADDLATIVYTSGSTGNPKGAELTHKNFVSITITASQALHEVV
FT                   LDDHPRLLLFLPLAHCFARFIQYASIASDDGVVGYLPDTKTLLPDLRSFEPTYLLGVPR
FT                   VFEKVYNAASHKAGAGWKGRLFVKAAEAARVWSRKEQAGEQHTFAEIAERAKYETLVYR
FT                   TVRGALGPKIKYVACGGAPLSLDLAHFYNGIGLPMIQGYGMTETAAPFAATRVTDNVIG
FT                   TVGQPAPGSSIRISDEGELQVKGPNVFRGYHNLPEKTAEAFTADGWLRTGDLAEIDDAG
FT                   RIIITGRIKDIIITAGGKNVSPIPLEEEIAKCPIVEHCVVVGDQRPFIGALVTLDPESL
FT                   AIGLPAHGLSTETPVDRLATNAAVREEIQQYVDKANATVSRAESVRKFAVLGTQFTQEN
FT                   KCLTPSLKVVRPAVNRVFADVIDNEIYNGKR"
FT   misc_feature    494688..495044
FT                   /note="fragment of arabinose permease; BLJ_0410"
FT   gene            495549..498834
FT                   /pseudo
FT                   /locus_tag="BLJ_0411"
FT                   /note="ATP binding protein of ABC transporter"
FT   gene            complement(499108..499377)
FT                   /locus_tag="BLJ_0413"
FT   CDS_pept        complement(499108..499377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0413"
FT                   /product="Sugar (and other) transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99889"
FT                   /db_xref="GOA:D6ZY93"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY93"
FT                   /protein_id="ADG99889.1"
FT                   /translation="MLRLGAIPAAAFLLSMVRAPESPRFLIQAGKTEEGFAVLEHIIGT
FT                   EQARLRTDDIHASVKLETEMPHEFHDLFRPGLQKALIIGTLIKA"
FT   gene            500215..501564
FT                   /locus_tag="BLJ_0414"
FT   CDS_pept        500215..501564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0414"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99890"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY94"
FT                   /protein_id="ADG99890.1"
FT                   /translation="MRNTKKVIAATAAVATLVGLAACGSSNDNGANKGDADKAELVFWG
FT                   WDSGNSMKEILADFEKANPGITVKFNNTGTAEKTSTALSNAIAAGNGAPDVVMLEDPTV
FT                   TQFAVTDGLVDLSEFGADKLADDFAAGPWNKLQYNNKPYALPIDSGPEMFFYNKAVFDK
FT                   AGVDGESIKTWNDYYEAAKKIRATGSYITNLAGTSNDYQPFTAQIWQAGAQPWKVDGEN
FT                   ITINMTKDEGMQRYIQFVQKLIDEDLVDAKTPNWSDDWNRELNDGTLASLTIGAWMPIN
FT                   LMTGAPDQAGNWRVAQLPQWEEGKEVSAEDGGSALAVTSQSKNQAAAYKLVEYMTHGEG
FT                   AQTMADTGTFPSLKKILRSDSFTDPTTESNKKTNDYFGGQNVNEVLSAAAQRPTEKFQY
FT                   LPYNPYAQTAYGDEVSKAYSGDITLEKALENYANKLAEQGKQQGYNVTVK"
FT   gene            501783..502745
FT                   /locus_tag="BLJ_0415"
FT   CDS_pept        501783..502745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0415"
FT                   /product="MalF-type ABC sugar transport systems permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99891"
FT                   /db_xref="GOA:D6ZY95"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY95"
FT                   /protein_id="ADG99891.1"
FT                   /translation="MSDQTMAAAPQPTVGILPEEADLHTAEARVNKHKADWRGWKFMWP
FT                   FAVVFVFVFIIPIVYAIYISFFKKQMVGGTKFVGFENYARLIQDPQFWSSVGRVTIFTV
FT                   FQVPIMLFLAAAMALALDSMKLHGTKFFRISTFLPYAVPAVVSTMIWGFVYGAKYGLVG
FT                   SLNDFLGTNIDVLNPDVLLASIANINTWEYAGYNMLIFYSSLSTIPHSLYEAASIDGAS
FT                   EWQIVKKIKLPELKGSLAITVIFSIIGSFQLFNEPSILQNMVLGNAITTYYTPNMYAYN
FT                   LSFTGNQSNYAAALAIVMAIITMAIAYVVQLKSMKEQMK"
FT   gene            502748..503755
FT                   /locus_tag="BLJ_0416"
FT   CDS_pept        502748..503755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0416"
FT                   /product="sugar transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99892"
FT                   /db_xref="GOA:D6ZY96"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY96"
FT                   /protein_id="ADG99892.1"
FT                   /translation="MSTATMTSTTTMTLADLKAQEKAAKKAEKERQKRIDADEKAERKR
FT                   AAKTGFSNPANPTRSMALTIVCAIFAVYCLFPFVYLMINATKTQSDFTSTFGLGFGKTF
FT                   ALFDNIATVFTYQDGIFGRWFVNTILYVVVGAGGATLLAIMGGYALAKFRFPGRKLCFV
FT                   IIIGAISVPGIALAVPQFLLFAKMGLTNTPWSMIIPSLVSTFGLYLMWIFSDQAVPDEL
FT                   LEAARVDGAGEFRTFFQISLPLLAPGIVTTALFAIVATWNNYFLPLIMLKDSNWYPLTI
FT                   GLNQWKDQASTAGGQAIQNLVITGSLITIIPLVIAFLCLQKYWQSGLAAGAVKE"
FT   gene            503942..506074
FT                   /locus_tag="BLJ_0417"
FT   CDS_pept        503942..506074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0417"
FT                   /product="Beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99893"
FT                   /db_xref="GOA:D6ZY97"
FT                   /db_xref="InterPro:IPR003476"
FT                   /db_xref="InterPro:IPR013529"
FT                   /db_xref="InterPro:IPR013738"
FT                   /db_xref="InterPro:IPR013739"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY97"
FT                   /protein_id="ADG99893.1"
FT                   /translation="MTTHRAFRWPSLLTESGRGIAFGGDYNPDQWPEETLDEDIRLMGE
FT                   AGVNVVSLAIFSWDKIEPVEGAFTFEWLDHVIDRLGRAGIAVDLASATAAAPLWLYESH
FT                   PEVLPVDRYGHTVNAGSRQSWQPTSPVFKEYALRLCRKLAEHYKDNPYVTAWHMGNEYG
FT                   WNNRYDYSDNALAAFRTWCEAKYGTIDALNEAWGTAFWSQHVNSFDEVLLPRHMGGDAM
FT                   VNPSQQLDYERFGNDMLLDFYKAERDAIEQICPDKPFTTNFMVSTDQCVMNYAKWADEV
FT                   DFVSNDHYFHEGESHLDELACSDALMDSLALGKPWYVMEHSTSAVQWKPLNTRKRAGEL
FT                   MRDSLAHVAMGADAICFFQWRQSKSGAEAFHSAMLPHAGADSKVFRGVCELGKALKTLS
FT                   DAGLQGTELERAGTAILFSAESEWATRSETLPSMKLNHWHDVRDWYRGFLDAGLRADVV
FT                   PLAYDWTGYKTIVLPTVLSLSDEDVLRIADFAKAGGTVIVGYAAGLIDEHFHIGLGGYP
FT                   GAGNGLLRDMLGIRSEEFNILGEEAEGEPSEISLSNGLTTRLWQNDVTSVAADTTVLAS
FT                   YAGESAADWELERTPAITSRPYGNGTAIYVGCDLNRHDIAQLLKALGSRWQELSAQPTE
FT                   SGQTPTYPTTDPRILHTIRRSADGSTRFDFYLNRSNQPVAINGVEGDPIIAHRCETDAV
FT                   GYTLNRNAILIAKTSC"
FT   gene            506118..507173
FT                   /locus_tag="BLJ_0418"
FT   CDS_pept        506118..507173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0418"
FT                   /product="regulatory protein, LacI"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99894"
FT                   /db_xref="GOA:D6ZY98"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY98"
FT                   /protein_id="ADG99894.1"
FT                   /translation="MSDEKTAKRRVTLRDVAQAAGVSLKTASNVINGSGRMTDETRAKV
FT                   ESVIKDLDYRVNVAARNLNRDHTGFITLAVPSLIPPYLAELANRTIEAARQRDYSVYVT
FT                   TYAEGSAKGARDLLKKFNSTVSDGMILSMSEVENISPDDLKVDFPLVIVGARTTWGIVD
FT                   HVTPDDVSAAAMAAGYLYDRGSTRLAVIGARDVYDEDALLNAVEGNAQLRLRGIIEETR
FT                   RRGLSLDPQLIGNTDQDWTIGAGARVTQRLIDSGVPFDGVIALNDQLAIGALTALRTAG
FT                   YEVPVQVQVIGFDNNEEAPYLQIPLTTMDSRLDWTAPTAVDRILGRIDGSITKSELLTT
FT                   ESQVIARASTR"
FT   gene            507368..510061
FT                   /locus_tag="BLJ_0419"
FT   CDS_pept        507368..510061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0419"
FT                   /product="arabinogalactan endo-beta-galactosidase or
FT                   galactanase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99895"
FT                   /db_xref="GOA:D6ZY99"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011081"
FT                   /db_xref="InterPro:IPR011683"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022038"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZY99"
FT                   /protein_id="ADG99895.1"
FT                   /translation="MRRNTALARIMASGVAAIMLCAGGTFTVNAAEEEPVKADVSVKAI
FT                   QGLSDDFIGGMDVSSMLSLEESGVTFKNANGEVEDLFTLLKESGVNYVRLRVWNDPFTA
FT                   DGQGYGGGNVNADRALTMAKRATAAGLKVLVDFHYSDFWADPSKQQVPKAWKSFEGDAD
FT                   KTADTVYDYTKQTLTTFKQAGVDVGMVQVGNETTAKIAGISGWDGMSKVFSAGSKAIRE
FT                   VLPEAKVVIHFTNPEKAGTYATYAKQLSNHNVDYDVFASSYYPFWHGTTENLTSVLKNV
FT                   ASTYKKDVMVAETSWAYTLDDGDDDSNTVPSKVTADNLKKYDISPQGQADEIRAVAEAV
FT                   NNIGDNDGDGENDGLGVFYWEPAWVPVGTGGKDNAELVDTWNKYGGGWATEAAGEYDPN
FT                   DAGLYWGGSGVDNQALFDFDGKALASLPTFKYIHTGAVTDHVFTKIDPVEITATDSDSI
FT                   DAIKAQLPSEVAAHYQDGVDETETVTWQSAALDWIRGAGTYTITGTTNAGHDVTVTVTV
FT                   TATPAKDYVTDGSFENAENDKNWTIAGTGASITEDSGNAADGKRALKFWASDAYSFSAT
FT                   QTITGLEPGEYVLTAMSQGAAADNAAITDGVALSATTGGKTTSDALELNGWVKFDTATV
FT                   PVTVGADGTATITITGNLPADAWGNVDKVSLVKKTETPVKPSTENLDKAVAEAGKINRD
FT                   EYTNESLAKLDQALAAADVLLAGSTYTEQDVNDVIKLVADAIAGLAQKEVSSLTVTSSK
FT                   TTYQVGDAIDADHDLKVVGNYSAGMGNVTLSADQFTLDYDFSAPADAAKVTVTLKSNPN
FT                   VTETYTVAVTARAEGGSGNGSDGAGNGGATINPDTGEGDKTNGANGDKITGVLSNTGSA
FT                   VTAVGLAVVVLGVAGGVSLALRRKRS"
FT   gene            510697..511566
FT                   /locus_tag="BLJ_0420"
FT   CDS_pept        510697..511566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0420"
FT                   /product="aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99896"
FT                   /db_xref="GOA:D6ZYA0"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZYA0"
FT                   /protein_id="ADG99896.1"
FT                   /translation="MTNGHINPANVPDIALKDGHSIPQVGLGVLRIDDEGVAPVVESAL
FT                   EAGYRHIDGAAGYNNEAGVGRALAASGYNTGAKRETLWVTTKLRDSEQGYDSALKAFDN
FT                   SLKLLQLDYVDMYMIHWPTPFDWRSTDTWKAFVKLRDEGMARTLGVCNFMPADLKRLHG
FT                   ETGAWPAVNQIELHPTWQQREVVAFCKKHGIAVEAYSPMARGADLNAGDGTIEKIAAAH
FT                   EVSPAQVILRWHIENGTIIIPKSVHADRQRENLDLFGFALTADEHAAIDALDGPTRAGH
FT                   DPLTFTYA"
FT   gene            511570..512313
FT                   /locus_tag="BLJ_0421"
FT   CDS_pept        511570..512313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0421"
FT                   /product="conserved hypothetical protein"
FT                   /note="narrowly conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99897"
FT                   /db_xref="GOA:D6ZYA1"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZYA1"
FT                   /protein_id="ADG99897.1"
FT                   /translation="MARRNAHFRRRFNASGPLERVLILIVLAVAIGVTIGLLLPQVSSD
FT                   VAKITGGYTATGSAADTLNALAVDDNQSSSGYDRDSFGFRTTDVDGNGCDVRDDVLARD
FT                   LTDITYKYAGSCVVESGTLADPYTAQTIHFVRGRATSAKVQIDHVVALENAWQSGAHDW
FT                   STAKRHEFGNDPYNLLAVDGPANQEKGSASAAYWLPTNADYRCDYVARQIGVKDKYQLT
FT                   VTSQEKDAMLAVLHTCPGQAVPADE"
FT   gene            complement(512317..513687)
FT                   /locus_tag="BLJ_0422"
FT   CDS_pept        complement(512317..513687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99898"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZYA2"
FT                   /protein_id="ADG99898.1"
FT                   /translation="MYLKRKADAYLNAWKSDPNRSPLIIKGPRQVGKTETIDYFAAHNY
FT                   RSVVEINFVEEPKYRAITADGYGANTIVRNISLIDPAKKFIPGDTLIFFDEIQAHPDIA
FT                   TALKFFKIDGKYDVICSGSMLDISYKQIESNSVGYKTDYEMRSLDFEEFLWARGYDEAV
FT                   IESMFTHLCDAAPFSEVEMNVFSTAFMDYCVLGGMPAVVASHIRTGTFEGTLQLQRQLI
FT                   LDYQEDIRKYAQGLDQARILNMFNHIPVQLAKENKKFQISKVASGARFKDYRGCVEWLE
FT                   TSGMVNICRCMSYPELPLKGNYDENKFKIYFGDTGLFVAMLDDEASDDLRANRNLGVYK
FT                   GAMYESIVSEALRKSGYGLYYYKKEDSTLEQDFFVRTREWLVPVEVKSKKGTAKSMRTL
FT                   IASDSYPEIQFGVKLSAGNIGSSEHVFTAPYFTTFLLRRLLRAYDEGQAPMLNNPER"
FT   gene            513938..515305
FT                   /locus_tag="BLJ_0423"
FT   CDS_pept        513938..515305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0423"
FT                   /product="natural resistance-associated macrophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99899"
FT                   /db_xref="GOA:D6ZYA3"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZYA3"
FT                   /protein_id="ADG99899.1"
FT                   /translation="MAVTHTEADATAATAMTNAVADIEQETPEIGKERQLAGVGTGAGA
FT                   GTNNNKKPHAHALASILGPAFVAAVAYVDPGNVAANITSGARYGYLLVWVLVLANAMSV
FT                   LIQYQSAKLGIVTNKSLPELLGERMSDAGRFMFFMQAEVIAIATDLAEVIGGAIALNLL
FT                   FGLPLFTGGLVIGTISTVMLWFQGGKTQTTFERIIIVMLLVITFGFIAGLFVAPPNPGE
FT                   VVKGMIPRFQGADSVLMAASILGATVMPHAIYLHSTLVNDHYAGGEKPSIKTQLRGSKI
FT                   DVAWALLLAGTVNLAMLVLAANSLHGMSGTDSIDGAQRAITQVLGPVIGTIFSIGLLAS
FT                   SLSSTSVGTYAGSEIMHGLLHVNAPMWACRVVTLVPALIVLWFAKDPTQALVIGQVVLS
FT                   IGIPFAVIPLMRYTHDKELMGKWVDGPVKHVIFMIVVALIVALNVLLIVLTLMGRA"
FT   gene            complement(515633..516436)
FT                   /locus_tag="BLJ_0425"
FT   CDS_pept        complement(515633..516436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99901"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTJ8"
FT                   /protein_id="ADG99901.1"
FT                   /translation="MPADVPGHDLLGSHIVYGSQIRLAVGDPELGDVRAQLHPRPVGRE
FT                   VAVQQVLRPRARLAPVRAVFPVRVRPAYPAFQAHAPHDLQHALVAHPHPELVHEAHAYL
FT                   PVAAPVGRAREYLGDHRLDVRPGHGGRMRQKMVIRAFRQSGRPEQVPEPMSQPRQHGDD
FT                   HRSVPVADLHASRASTFSRYATLALRYAFSSSRSCSLVGAGLGLDFAPLGLPFGFGRSA
FT                   SGPPDRYSRHQRSNGVRLAILCFSMTSAFVSPCSTWSRTAASFVS"
FT   gene            515957..516523
FT                   /locus_tag="BLJ_0424"
FT   CDS_pept        515957..516523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0424"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99900"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTJ9"
FT                   /protein_id="ADG99900.1"
FT                   /translation="MLAGLGHRLRHLLRAAGLAKSTYYHLLSHPAAVTRPDIEPMVAEI
FT                   FARTPNGCGHRQIRMCLVHEFGVRVSHKSVLKVMRRMGLECRIRRPNPYRKYSSYRGET
FT                   GARAENLLNRDFTADRPWVKLGTDVTEFRVADGKAYLAPVYDMGSKEIVARDVSRHPDM
FT                   AQQWRLLAMLEEKLPEDANPILHSD"
FT   gene            516654..517856
FT                   /locus_tag="BLJ_0426"
FT   CDS_pept        516654..517856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0426"
FT                   /product="tyrosine recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99902"
FT                   /db_xref="GOA:D6ZTK2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTK2"
FT                   /protein_id="ADG99902.1"
FT                   /translation="MGETTVGHVAGEVVRALYGAGYMESTIGQYRKSIRALERYAGGPD
FT                   AVYTRGLGAGFAASTFSERTGGFSRQRWFDYGRLARLCDSYLRSGSVDLGKWRRSGLAE
FT                   PVVPGLAVVMECWEAYLAGSGLASATVGHYRRMAGLFLTWLESHGVVSLDGSDGSHVLG
FT                   FLAGLRSRWSESSMRHAASDLRPLFRWLGRDDLADAIGLAGIRRTHAIAGTLPDDEHRR
FT                   LLEACASRSVPSRDAAITLLSLTCGLRACDVIGLRIADVDWDSMSIGLVQRKTGNPLTV
FT                   PMTGPLAARLASWLLDERPATDDDRVFVRYKAPHVALRGHSSVYEAISRVMRHAGLGRR
FT                   GGSRLLRRNAATRMLEAATPLPTISAVLGHADPDSTRVYMATHRGGMLACVLPVPEGGS
FT                   S"
FT   gene            517403..518818
FT                   /locus_tag="BLJ_0427"
FT   CDS_pept        517403..518818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0427"
FT                   /product="integrase/recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99903"
FT                   /db_xref="GOA:D6ZTK1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTK1"
FT                   /protein_id="ADG99903.1"
FT                   /translation="MRCDRSEDRRRGLGFHEHRSGAAKDGQSVDRADDGTAGREAGVLA
FT                   VGRKARHRRRPCVRAVQGAPCRASGSFIGVRGDQPCHAARRARTPGRFQAVAAQRGDED
FT                   AGGGHAVADDQRGAWPRRPRFHTRLHGHAPRGNARVRAARAGRRIVMRPTEHGFVGPLA
FT                   GELEEYIRFKASMGRHGATRVQVLRSFDRHCLEHGAVRLERGVVERWIAHRIDANPGGC
FT                   RSWFSCIRDFGRWMRLAHDPDAYVLSDQWKAGSPRPTPYLLTDREAALFLRAAGTLESP
FT                   SPWAWQSRAFFMLMACCGLRTREVRRLAVGHVDHKARSIDVVDSKAGRSRRLPVGDEVA
FT                   AELLECDQRSRERFGDDRPAFFVASTGNPVSPGMPGVVFRRVWTRAGLEWPQAGKRPRP
FT                   YDFRHRFAFANIERWTRDGVDVMAMLPYLAAYMGHAGIDSTLYYVHASPDFMDGYADLV
FT                   ADAERVVPETEEP"
FT   gene            518815..519870
FT                   /locus_tag="BLJ_0428"
FT   CDS_pept        518815..519870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0428"
FT                   /product="phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99904"
FT                   /db_xref="GOA:D6ZTK0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTK0"
FT                   /protein_id="ADG99904.1"
FT                   /translation="MSKARKTAASSGEPDFWRVARDWLHHWLPKVRGSSPKTVEAYRIG
FT                   LESYVRWLETTEGTQRSHIGFGHFDRARLGRWVEWMRTERGYSDRTIMPRMTTMRVFLD
FT                   HAGLEHPALTALGNDAAGIRVKPPAREPVDHLGEEHTKALLTAWGTGDAKSRRNRMLPI
FT                   LMYDTAARIGELAALTIADVGMDKPARVTLTGKRGKSRVVPLGERTRTHLAAYLEEFHP
FT                   GPSTRDGDRPLFHSTRNGAIQPLSVDRIDEIPKTAAARARRGTCPSMPERVHCHLIRRT
FT                   RAMDLYQQGVPLPLIMQLLGHESMSTTSASYAFATLDMMRKAVDAANPGPDPSKETWLS
FT                   EQRLRQLHTLK"
FT   gene            519994..520275
FT                   /locus_tag="BLJ_0429"
FT   CDS_pept        519994..520275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0429"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99905"
FT                   /db_xref="GOA:D6ZYA9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZYA9"
FT                   /protein_id="ADG99905.1"
FT                   /translation="MGWQYRHRWWRDRLAGLNIRQSMSRKGNCIDNAATEQVFGHLKDE
FT                   FYAGREFASYEQFKNELDAYIIHWNTKRRQIRLEGHTPEEFRNMSLTA"
FT   gene            complement(520376..520492)
FT                   /locus_tag="BLJ_0430"
FT   CDS_pept        complement(520376..520492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZYB0"
FT                   /protein_id="ADG99906.1"
FT                   /translation="MAYQSVNGAAYPESKTVIFDAANATSETMKRRGRKKAE"
FT   gene            520799..521590
FT                   /locus_tag="BLJ_0431"
FT   CDS_pept        520799..521590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0431"
FT                   /product="FAD linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99907"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZYB1"
FT                   /protein_id="ADG99907.1"
FT                   /translation="MGDRDFRFKLDCAPRDVTPKALSQAVSAFARILSAADASDWRISR
FT                   MELHSIDLAAKPVVVDERTERSFATLDTITRLTTRDDVSRDEAFRFSGVFSALSDLAKE
FT                   TNANITVSSHEAEGTFTPGVLTGINRLLIRGSRRSFGHVRGMVDKVILQRTHRTLGLVD
FT                   HVTRSRVDVRFGPELDPIVKRIQVGMEVDARGFVRADDGELVSVDAEDLEIIADGHRAP
FT                   ATAEDLEGIISLDFTGALGSVDFVSTLRETHDHGTTTGGGR"
FT   gene            521587..522138
FT                   /locus_tag="BLJ_0432"
FT   CDS_pept        521587..522138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0432"
FT                   /product="PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99908"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZYB2"
FT                   /protein_id="ADG99908.1"
FT                   /translation="MKINESESSRRYPERAVVDTNVIVNVALGKDDTTDPSFLPRSERL
FT                   LNDGIAGELELLLPSMVMIELSCNFVIRSGQSGQTRSRARDHKQRLIKWCYDCELPMVD
FT                   LTADAAGWFSETPAVQNLRPGGAAILASAKYAHATHVYTWDDKFIRTVQQAREQGQTDI
FT                   IACNPPMLPPTQGELELAGN"
FT   gene            complement(522389..523228)
FT                   /locus_tag="BLJ_0433"
FT   CDS_pept        complement(522389..523228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0433"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99909"
FT                   /db_xref="GOA:D6ZYB3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZYB3"
FT                   /protein_id="ADG99909.1"
FT                   /translation="MLDSTLNLNLLAAYARFEQSMGWRLGSYAKTVIYRSAKHHVCPTC
FT                   GGPKRDSTSLCYSCTSLRQQAEALGVAHLMADRVRIANYAIKFDQMYRVMDGYKRNRPE
FT                   SKEDYCETLKYVLGDALVVHWSCPTHTSDGVMPSAWATIPSTTTSERYGQPHPLNGLVS
FT                   PMLNKTIPEVKLLANEQKHRAIAPSTFSLDGSYSDETLRHVLLIDDTWTSGGTAESASI
FT                   MLKQSGAQRVTIYCLARIINLDYCSRMIGQSVSDGYKQLTYRNGCPWDYDQCPMRNK"
FT   gene            complement(523221..524009)
FT                   /locus_tag="BLJ_0434"
FT   CDS_pept        complement(523221..524009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0434"
FT                   /product="SMF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99910"
FT                   /db_xref="GOA:D6ZYB4"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZYB4"
FT                   /protein_id="ADG99910.1"
FT                   /translation="MPSVEYTAKANAAWNQANQKVTQWREQSLDLVTVFDDRFPSRLRS
FT                   VVDVPPFLFAKGSLLSNDLGVSVVGSRKCSPEGATFAHDTACMLCEHGLTVIAGLAEGV
FT                   DSFAHRATLEAGGRTVAFIGTGINRCYPASNRELQKSIEKRGLVLSQFWPDSPPTKQTF
FT                   PMRNALMSGYGLATVVVEASEHSGTRIQARQAQRHGRPLIFRDVVLERTEWAQEYRNKP
FT                   GVFVVHSVEEVGKALDRISFLDNDVDTLLGNILDAKAQYA"
FT   gene            complement(526785..527219)
FT                   /locus_tag="BLJ_0435"
FT   CDS_pept        complement(526785..527219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99911"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZYB5"
FT                   /protein_id="ADG99911.1"
FT                   /translation="MASLLQGFEEVQLVKPVGKTVMTVTDSVVRFNKATAEVLNFPAQV
FT                   KILINDKTRQIAVTPTTAKADNAVKFSKGEGKQTTSVSIKNAVLVEAISKYFTLVEAPE
FT                   GEVSFASVNGTAYPEDKTVIFDVANATAGTMKRRGRKKAE"
FT   gene            527526..528959
FT                   /locus_tag="BLJ_0436"
FT   CDS_pept        527526..528959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0436"
FT                   /product="lipopolysaccharide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99912"
FT                   /db_xref="GOA:D6ZYB6"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZYB6"
FT                   /protein_id="ADG99912.1"
FT                   /translation="MTIADLLQIIRKHLASAIISFVVVFAAVAAVAFIMPPKYTATAEA
FT                   FATYAGQSGETQTTNDMSSGANYLNTQIKTYPELVKTEAVLQPVIKDLGLDMTTTDLAG
FT                   VVTATNPTNTFMVDISAEVGDPQQAADIANSVAKNLSDQISSDLYNSSSSGSPIKLTVV
FT                   QKAQTPTGQSSPNIPLYLAAGLILGLIVGIGVALLKDILNTKVDSTDDVRELTHASSLG
FT                   TVPQAAILDDSRPVVVAQPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLVITSTDPSEG
FT                   KTTVSSNVAVALAEEGKSVLLVDADLRHPSVAHKLGIEGHVGLSHVLSRQASPADVIQK
FT                   YWKPNLHIMPAGKRPANASILLNSDLMKEMVGQALTQYDYVIIDTAPLSVASDATVFGR
FT                   MAGGLVLVTGKGIVEKKELRSTATALQTAEVPILGFIFNFADSKKTHSKNYYYYYYEDG
FT                   NKRSSHKGAKSKGEKKARK"
FT   gene            529157..530554
FT                   /locus_tag="BLJ_0437"
FT   CDS_pept        529157..530554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99913"
FT                   /db_xref="GOA:D6ZYB7"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZYB7"
FT                   /protein_id="ADG99913.1"
FT                   /translation="MMQRNEKSMGTDERPEANAESGSSTSPARGDIVDTFWDIPPISFD
FT                   ENDGGIAQGDNGTGTVAGGVQSVFPSFDEVLEWPTASAANTAGDASSPSDAVATAPMTF
FT                   AAPDTAESAQSPQQDNNATLPLFAPISDDKPQRDSAIDDLNIDFSAIEQNPEPVEEPEE
FT                   DRVAETPRGGKGGKKRTKGIIISVIVALVVIAAIIGGVWYWRSSEQRQESRQLHQDALT
FT                   ACAEAVDLNSTAQKALTKALADTKSAQSITADQVADGATVDALKKAVAAVKNVEAVECK
FT                   TSASTSDLKEYAKTATSQTKTAKKNATAITAAAKAVTDSKNAKDQANVQQALQGKIAEA
FT                   QTLLDNSLYAVDDNSTRVTLESDIANANTVLSQQGTDVKAMQDAVNTLTASMDAVNTSM
FT                   ANYSAAVEAQQEAARQKALNDYYARLRQQQLLQQQPDDEGTGDPAAGQETKPKDDQGTE
FT                   PEDEPKP"
FT   gene            complement(531037..532020)
FT                   /locus_tag="BLJ_0438"
FT   CDS_pept        complement(531037..532020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0438"
FT                   /product="G5 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99914"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSQ9"
FT                   /protein_id="ADG99914.1"
FT                   /translation="MSKHAERTSIVKTLSRGQWAKIAAAVAAVGLIAAAGVISRDFYQA
FT                   STATHPITPTSFSATDGAASRSASRGALKSTTYVTVKVNGKSRVVLGEKDNMTTVKDVL
FT                   ETGDIVLDPEDSVSPSLDSKVSESTVISIDRANTTVETTDTDIAFNEVRKETSSLPNGQ
FT                   EKVETEGEKGVLETTSLVTRSGDKVVSSNVFTSWVKKAPVDKVILVGTATVSSPSAASL
FT                   GTTTPAGEIQSWAHDYLISNGYSEADFTAANFIISHESGWSPTATNPSSGAYGLPQALP
FT                   GSKMASAGADWQTNYQTQFKWFVNYCNGRYGSISGAYAYWQAHKSY"
FT   gene            complement(532195..532566)
FT                   /locus_tag="BLJ_0439"
FT   CDS_pept        complement(532195..532566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0439"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99915"
FT                   /db_xref="GOA:D6ZSR0"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSR0"
FT                   /protein_id="ADG99915.1"
FT                   /translation="MATTAITSAEFEKTITDNEIVFVDFWATWCGPCRAFGPIFEAASN
FT                   EPENANIAFVKVDIDANQDLAQAAGIQAVPTLMIAKQGEVIFQQAGALQASDLDDLIAQ
FT                   AKALDLAAAKAQQAAQEQQ"
FT   gene            532734..533396
FT                   /locus_tag="BLJ_0440"
FT   CDS_pept        532734..533396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0440"
FT                   /product="conserved hypothetical protein"
FT                   /note="narrowly conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99916"
FT                   /db_xref="GOA:D6ZSR1"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR032582"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSR1"
FT                   /protein_id="ADG99916.1"
FT                   /translation="MFINARDNETMPVMNDEVPDEGDYDAGRGRGEFDNITPEDFIHGG
FT                   GSGHGNPPGWLGPADINRARHQMPIAYVEIVPVRTDEMGRIAQVGSLLRVAEDGSIERT
FT                   LITGRVLYHETLREAIARNVAKDLGDIALPLLPVGLQPFTVAEFFPTPGLSEYYDPRQH
FT                   AIALCYVVPIAGDCKPQDETLDVEWVDPKSDVMNTFVAQMVNGHGRIVRQALAWAGI"
FT   gene            533524..534381
FT                   /locus_tag="BLJ_0441"
FT   CDS_pept        533524..534381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0441"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99917"
FT                   /db_xref="GOA:D6ZSR2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSR2"
FT                   /protein_id="ADG99917.1"
FT                   /translation="MAIELANHIYRDGEGVPVVLMNAYPVDHRMWDVCAKALADFADLN
FT                   DVPDFPIWAPDMAGSGASPVPSDADSGPRMANGAYSEALDRLAGAYVDLIKAAGYEQAI
FT                   WVGLSMGGYVAMDIQRLYPETVAGLALCDTMAASDGVGGENRLKMADAAEQTNSVEPVM
FT                   HFAQPADGDSTVKKTPEFIATMTGWINEQNPAGLAWRQRMTYGRPELGAVPETISAPSL
FT                   VVSGELDPSSNPSVMRPLAERIAGAEFIDIPDCGHFSAVEHPDTVARALLSLVRRVQNA
FT                   QKNA"
FT   gene            534391..535683
FT                   /locus_tag="BLJ_0442"
FT   CDS_pept        534391..535683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0442"
FT                   /product="NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99918"
FT                   /db_xref="GOA:D6ZSR3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSR3"
FT                   /protein_id="ADG99918.1"
FT                   /translation="MGTDIHFSPLALTHALPFLPLAQGDIDYQVDRRGEPGLIDELLAE
FT                   PTTKVVLTRGGLVAVPRGQGELVDYENVKMRLATLPGAYVSAELARYPEAVAMFLGSYA
FT                   GARGESVVAVDITRVPEAGVPGVDGIAGVSGAAGGVLGTQDSGTVDGALGKNGISGGAA
FT                   AGIRQPGNAKGNGGVAAAKIAGPLGVPDSAGQGADDAFDDSVGAPVQPLAPKPTLLQQA
FT                   VTRFDWVDLRGFAPHANAREAGQATSAITLSIWHSRQRFCPTCGAAVRPALAGWAQRCT
FT                   NEADGNRVLFPRVEPAVITAIVDGHDRLLLQHNAAWKDSRLYSVSAGFVEAGENLEHAC
FT                   RREAMEETGIKLGEVRYLGSQPWPFPASLMMAFKAHAITTDVHVDGEETMTARWVTRDE
FT                   YTAELIAGRMAAPGRATIARYMIEEWLGREL"
FT   gene            535709..536122
FT                   /locus_tag="BLJ_0443"
FT   CDS_pept        535709..536122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0443"
FT                   /product="glycine cleavage system H protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99919"
FT                   /db_xref="GOA:D6ZSR4"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSR4"
FT                   /protein_id="ADG99919.1"
FT                   /translation="MTMSDDNENEQPLNLDIPDHLEYSEEHAWVDRSVDPAIIGITEYA
FT                   ADQLGELVFVDLPEPGARVEAGDEIVELESSKAVQPLISPVAGTVKYVNRDVADDPSVV
FT                   NGDPYGEGWLLKVELDDDEPELLSADEYAKVVR"
FT   gene            536240..537571
FT                   /locus_tag="BLJ_0444"
FT   CDS_pept        536240..537571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0444"
FT                   /product="conserved hypothetical protein"
FT                   /note="narrowly conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99920"
FT                   /db_xref="InterPro:IPR019236"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSR5"
FT                   /protein_id="ADG99920.1"
FT                   /translation="MRSPREDFEAAGKRLPWDAAARNAALSATAPVSDVKASANGADNA
FT                   SNAEHSDDMPTVPIPARKAATTFDTPSKHERIEVKPPITRFIRRAITRVFGVWSHISTQ
FT                   VVRQWGWYPRVEPYVGYGTGDYSRLICRTVYAPKHAQSGELIRGIRGMLAVSAPRTHVQ
FT                   ASIDDTPLNTVQIGVSEVYDKVDRTRDLGSEYAISDSAGYLDLVAEHRLVPGIHRVSYS
FT                   VANRKPVSANLYTIPASAKVGIISDVDDTIMITQAPVPWKAAYNLLFLDPKKKASVPGM
FT                   SVLFTRIADLFPGAPFFYLSTSPWNVESSIRNFITDHGFPEGPLLLRDLDPRPKTFVPT
FT                   GPQHKLEFAEQLMADFPDMKFILVGDDGQKDPTTYATIARRYPGRVLAIVIRELSPRES
FT                   TGLASVTGLTSTQPTPVTDVPVFTGTTGSNILKTMLPYLKTVLR"
FT   gene            537878..540148
FT                   /locus_tag="BLJ_0445"
FT   CDS_pept        537878..540148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0445"
FT                   /product="Oligopeptidase B"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99921"
FT                   /db_xref="GOA:D6ZSR6"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR002471"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSR6"
FT                   /protein_id="ADG99921.1"
FT                   /translation="MSVPTRINDYWYFTRTQQGKQYGVQCRIPVRDADDWDPPVVDPQG
FT                   APGSMPGEQVVFDANKESEGHDFFRLGGLDLSKDGRWMLYGVDVAGDERYDFRIRDLAG
FT                   LETGEPVSELPEQFTGIGSACFTPDGQWVFWVELDVSWRPLAVWRHRVGTAVESDVCVY
FT                   RETDERFWVGVGISFDERNIVIGTGSKTTTEVLMLPVATPEGEFQAFIPRQNDIEYDVS
FT                   FACFEGAGENGADVPLAVVYHNAANPNFEIDVIDMRGHEPPYRLGEGVCIAAGSPYGCE
FT                   HGEPDKPITEAYFNAANPAILQGAHGLGIEGIALHRNFVSLSYRADGQPHVAYMTKSAA
FT                   AADFLAGRPWRFTELLPPALEDDWDMVAADRENFTGDHGEILWTEDEAPTDHTSSSDGA
FT                   SDDHLPGETRRLYTIGVGGNPSYEAPRMRYSFASYTRPGELHEIDPATGEDALLKRATV
FT                   LGDFNPRDYMERRVWITARDGERIPVSLVWHRDCPAQDSPMFITGYGAYEISSDPGFSV
FT                   SRLSMLDRGVLYAVPHIRGGGEMGRAWYEQGRRLNKKHSFEDFVDATRALQKAHLADAW
FT                   RTVANGGSAGGLLMGAIANMAPECYAGVEADVPFVDALTSILDPDLPLTVTEWDEWGDP
FT                   LHDPEVYQYMKSYTPYENVPVAVLEGGDDEAAGDGSADGAAAGALAAAQFPRIFITTSM
FT                   NDTRVLYVEPLKWLARLQSAGVDAVAKIEVEAGHGGLSGRYKQWEEVSYENAWCMDVMG
FT                   LAH"
FT   gene            540353..541384
FT                   /locus_tag="BLJ_0446"
FT   CDS_pept        540353..541384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0446"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99922"
FT                   /db_xref="GOA:D6ZSR7"
FT                   /db_xref="InterPro:IPR023698"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSR7"
FT                   /protein_id="ADG99922.1"
FT                   /translation="MAKTYKIAVIPGDGIGKEVTPWAQKALEKAAEGVADFEYENFDLG
FT                   AERYLRDGAILPEDEEERIKANDAILLGAVGDPRIKAGILERGLLLKLRFDLDQYVNLR
FT                   PSKLYKGVTSPLANPGDIDFVVVREGTEGLYCGAGGAVRRNTPQEVATEVSINTAYGVE
FT                   RVVRYAFKLAMKRKKHVTLVHKKNVLVNAGDMWQRIVDKVGEEYPEVTHDYQHIDAATI
FT                   FLVSDPSRFDVILTDNLFGDILTDEAGSVVGGVGYSASGCINASDEFPSMFEPIHGSAP
FT                   DIAGQNKANPTAAILSAAMLLEHLGFDDAAKKIHTAVEADIEELGSTVRSTDQVGKDIL
FT                   ARM"
FT   gene            541435..542520
FT                   /locus_tag="BLJ_0447"
FT   CDS_pept        541435..542520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0447"
FT                   /product="biotin/lipoate A/B protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99923"
FT                   /db_xref="GOA:D6ZSR8"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSR8"
FT                   /protein_id="ADG99923.1"
FT                   /translation="MQMRHGECKTVGGKLVAVTVSVDDDGTAQSCHISGDFFIESVSDA
FT                   ESHALLRDLEQALISDDSLRSVLDAHPSCQIIGTDEVAIKTAYSRAVSSNLPPLVGAPA
FT                   QRVGVVSPDAPNTPASINTQTKQPDKSSEYRERWNALRPQLTVIHDHPRTPDEQMAIDE
FT                   TWAREVAAGTRQPTIRFWEWAGPAVVIGRFQSAQDEVNLDIAEQLGFDVVRRCTGGGAM
FT                   FIEPGNTITYSLYAPLDFVQGVSIEESYRLCDWWLVEALRELGLDVRFAGLNDIASQYG
FT                   KIGGAAQRRFPVGSGGAVLHHVTMAYDIDAAKMSRVLNTSREKMSDKAVKSAVKRVDPM
FT                   KSQTGLSREHIVEHLIDWFAA"
FT   gene            542759..543478
FT                   /locus_tag="BLJ_0448"
FT   CDS_pept        542759..543478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0448"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99924"
FT                   /db_xref="GOA:D6ZSR9"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSR9"
FT                   /protein_id="ADG99924.1"
FT                   /translation="MSLETPNAFADEENILLHTALFKQVSPAEAEELLPHLKRATFDKG
FT                   DYIFSEGDTDQRMYLLEQGRVKLIRTSSDDRVQLLSIHAPGEVLGEIPVFDPHGGPRTA
FT                   SAVSMSHGTRVVWLEHDALFAWLDEHPRVAIDMLQVMANRQRGNNERISDLVFMDVPAR
FT                   LAKTLLNLGSRFGEPVEQGLKVPHDLTQEELAQLVGSSRETVNKALMDFSNRGWIARDG
FT                   RSIIIFQPGMLIRRSRR"
FT   gene            543591..545912
FT                   /locus_tag="BLJ_0449"
FT   CDS_pept        543591..545912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0449"
FT                   /product="glycosyl transferase, family 51"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99925"
FT                   /db_xref="GOA:D6ZSS0"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSS0"
FT                   /protein_id="ADG99925.1"
FT                   /translation="MPKKKSLTLQRVLVLLLAYIMLAVCGGVAASVLFVPGVVGANKAA
FT                   KAVIPSLKVENVDFDVTGLPQKSTMYARDGSTVIATFYNQNRIVVPLKKISKTMQQAVV
FT                   AREDRRFWTHAGVDVQGVMRAFVQTYLVKGSQQGGSSLTQQYVKNVLLMQAIEDDDPIA
FT                   QYHATEDTVARKIREMLISVQMEKKYSKAEILQGYLNIAQFGNNLYGVETAAQRYFSVS
FT                   AADLNVVQSATIAAITKNPSQYDPLVEENQKESENQRNIVLKLMLQEGYITQKQYTEAV
FT                   NTPLKDTLKVQAVNVGCQDTGDYAYFCDFVVHRIQNSEEFGKTRAERNKLLQEGGLKIV
FT                   TTLDVEANSTMMETARNTIPPDDPSGMEIAMAAVKPGTGEVLSFGLNRYYDATPAAAND
FT                   PTKSGQNYAVDLVDGGGSGWTIGSSWKPINLIAWMEAGHSINDNLQTTTTYPTTDFACN
FT                   NYKGGADSWNVSNAMGAGTVNPESPFLGLVRSHNTTQASMGAILKLCKVADTATELGYH
FT                   DAATGETIDKTQVYTPSMMIGSVNVSPLTMASIFAVYASNGVQCNPIAISKVTDKDGND
FT                   LKVPSANCHQAVDKDIIQTLAYTLNQGTVRPDGAGWSFRLADGRKSFGKTGTSEDLAVS
FT                   GGSFIPNQIAAFAVVGDAQNPYTNRISNIAINGRYNSYWDGSTIAAPAVTNFFNSYISK
FT                   KKIPIDNDYGQPVSKYTTTGKYLGIGGRTFSVPQTTTNGNSQSQTTTNGQSQSQSQSQN
FT                   TGQNNTQTQGTNSERSNDGQ"
FT   gene            546104..547477
FT                   /locus_tag="BLJ_0450"
FT   CDS_pept        546104..547477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0450"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99926"
FT                   /db_xref="GOA:D6ZSS1"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSS1"
FT                   /protein_id="ADG99926.1"
FT                   /translation="MSNDDLTHENFDFRGFDVPDLKAVTLASSSDGEQSKQPKTKHEDA
FT                   SRNRRHGKKKSKSDARSKKRAGAGKTSESFDDYEDYEEREAVGKADKKASKDRPGLFAP
FT                   MTLREVTVRNRIWLPPMCTYSSFARDGRPTPFHYQHYVSRAFGGFGMVIVESTAVAPEG
FT                   RITPCDLGLWEDGQIDAWRWIVDGIREAGAVPAIQLNHAGRKASTGCFAVGYDGQSVPE
FT                   EAGGWPTMAPSEIAFGGLRTPRALSVDEIHGLVGAFAAAAGRAVAAGFQAIQIHAAHGY
FT                   LISQFLDPLSNERDDEYGGDLTGRSRFLVEVVDAVRGVVPEGVPVLVRISATDWAAGGW
FT                   DLDQTIALSKVLKEHGVDVMDVSTGGIMSGVSIPVKPNYQVPFAEQVKSKADIPVTAVG
FT                   LITKPKQAAKILARGEADAVEIGRAALRDPYWPLRAANKLGIPSTEVPYAPQYVAGAY"
FT   gene            complement(547645..548796)
FT                   /locus_tag="BLJ_0451"
FT   CDS_pept        complement(547645..548796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0451"
FT                   /product="Dihydroorotate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99927"
FT                   /db_xref="GOA:D6ZSS2"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSS2"
FT                   /protein_id="ADG99927.1"
FT                   /translation="MTYVSESFWHDAVNKATTDLFTFGYKHIIKPNFVFNHRPDEAHDQ
FT                   MIEFCHVVKNVPPLLLAEQLMLDYTDPILETNVMGVDFTNPFGLSAGLDKNCDMPVVLD
FT                   HAGFGFETVGSTTSRPCPGNAKPWFHRLPEYDSMMVHVGLANIGSDKVIERAEKAWTQA
FT                   RQMQLSVSIARTNDDQCGDLDEGIEDYCISMRRAAGRTAMVEVNVSCPNTHVGEPFTAT
FT                   PEALDRLFTALDKIDRPQPTLVKMPLNKPWGEYKELLDVLAEHNVQGLSIANLQKDRTG
FT                   LEIPRDWEGGLSGGPCTNASTELIRKVYKEYGDRFAIAGIGGVFTPEQAYAKIRSGSSL
FT                   VMFISSLMYRGPQQITVLKRGLAQLLRRDGFEHVSDAVGVDVE"
FT   gene            549151..549954
FT                   /locus_tag="BLJ_0452"
FT   CDS_pept        549151..549954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0452"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99928"
FT                   /db_xref="GOA:D6ZSS3"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSS3"
FT                   /protein_id="ADG99928.1"
FT                   /translation="MISSQRQHLILSRLRTRGAVRITALSKELGVSAMTIRRDIAELAD
FT                   KGLLKRVHGGAVTTSTLLSEPLFSVKSQMDLGLKDAIAQEAIKYVAPGDVIAIGGGTTA
FT                   YVFAQHLLESQQSSGITILTNSIPVAELVQALESKDVEVIVTGGVITRSNSLVGPIADK
FT                   VVASLRVNTVFLGTHSVSIPRGFLMPNSLEAATDMAMMDIADRTIVLTDHTKWSCTSLS
FT                   LFARFDQVDTVITDDGLDPDSAAKTKDLVKELVLAHQSEIIEESE"
FT   gene            549959..551209
FT                   /locus_tag="BLJ_0453"
FT   CDS_pept        549959..551209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0453"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99929"
FT                   /db_xref="GOA:D6ZSS4"
FT                   /db_xref="InterPro:IPR001937"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR005850"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSS4"
FT                   /protein_id="ADG99929.1"
FT                   /translation="MADFANYTPGEYAKEHIRITPTTLADGRDFFYLDDDPEFVSGAKT
FT                   RELKDPRPLDYRFAPHLDADGNEVPYAAPQMRRDPLTGDWIPMATARMNRPITAGPGAT
FT                   AKGNPLAARKPGDPYQDGEVPDTDYNVVVFENRFPSMVRVPGVSEDVTYVDGNPLWEKK
FT                   LAAGRCEVICFDPNEDGLPADLPVSRLRTVVEAWAFRTAEISKMEGIEQIFPFENHGQE
FT                   IGVSLAHPHGQVYCYPFIAPKMEKELQHTEAYHEKTGGNLLKDIMNAELEAGERIVMRN
FT                   HSWVAYVPAAARWPLEVHVAPVRDVLTLDQLNDEERWDLASMYSHLLKRGNAFFDKGDG
FT                   KGMDLPYIAAWHQAPIHDARRENYRLNLQFFSFRRAANKIKYLAGSESGMAAWISDTTP
FT                   ELIAKRFHELGSIDIAD"
FT   gene            551226..552476
FT                   /locus_tag="BLJ_0454"
FT   CDS_pept        551226..552476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0454"
FT                   /product="galactokinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99930"
FT                   /db_xref="GOA:D6ZSS5"
FT                   /db_xref="InterPro:IPR000705"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019539"
FT                   /db_xref="InterPro:IPR019741"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSS5"
FT                   /protein_id="ADG99930.1"
FT                   /translation="MTAVEFIEPLTHEEGVSQATKLFVDTYGAAPEGVWAAPGRVNLIG
FT                   EHTDYNAGLCLPIALPHRTFIALKPREDTKVRVVSGVAPDKVAEADLDGLKARGVDGWS
FT                   AYPTGVAWALRQAGFDKVKGFDAAFVSCVPLGSGLSSSAAMTCSTALALDDVYGLGYGD
FT                   SDAGRVTLINAAIKSENEMAGASTGGLDQNASMRCTAGHALLLDCRPELTPLENVSQQE
FT                   FDLDKYNLELLVVDTQAPHQLNDGQYAQRRATCEEAAKILGVANLRVTADGISKADDQF
FT                   QALKETLDALPDETMKKRVRHVVTEIERVRSFVRAFAQGDIKAAGRLFNASHDSLAADY
FT                   EVTVPELDIAVDVARKNGAYGARMTGGGFGGSIIALVDKGQGHEIAQKIADRFEKEGFN
FT                   APRALPAFAAASASREA"
FT   gene            553089..554696
FT                   /locus_tag="BLJ_0455"
FT   CDS_pept        553089..554696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0455"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99931"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSS6"
FT                   /protein_id="ADG99931.1"
FT                   /translation="MARRSVRLLASIAAVATMATALAACGNKQATTDENGKPIVNILVR
FT                   RNVTDHPMQDTQYTKDLEAACDCTIKWQEVSDNAWGQQKSAKMAAGEFPDIGLSLFSMV
FT                   DAAKYSTYFEDLKPHLDKMPNVKKFLKAQPGAAKYVTDGTKIAMLPSDRGKGYEVSGTH
FT                   MFINKTWLDKLGLQMPTTWDELENVLDAFKTQDPNGNGKADEVPMNIRSLGFGLWSPLT
FT                   LMNSEGVVTSFMGGGASEQGYYVDNGKVKSYYTSDALKDVVSYLHGLMAKGLIPKDVLT
FT                   RDASQYASQTVSDGKTALTGVSFGWSNYAEYGDKLGDQYVTLPPLKKDASTPDSQVKWD
FT                   YSQDACRWAYSGSGLTVNPNAANQDAIYKVIDAMYGEKLSVAGFFGSIPDIVSDDGDHQ
FT                   YTIDKAKAYAEYPDTRAVALQDRFGGWIRDDVKMVNDTNADQVTASDLAIREARNRVDG
FT                   VKDVVPIYVRPNTEDSNTLQNNNTAISNYANNQIAKWVQKGGIDKEWDAYVKKVSEPTL
FT                   GLDANIKIWQKWYDKYTK"
FT   gene            554803..555774
FT                   /locus_tag="BLJ_0456"
FT   CDS_pept        554803..555774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0456"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99932"
FT                   /db_xref="GOA:D6ZSS7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSS7"
FT                   /protein_id="ADG99932.1"
FT                   /translation="MSAQTSQGVAARTVAMEAAPDRKKPGLLDRIADHLRRYWQLWILS
FT                   APALFFVGLFSYVPMWGIQLAFREFDPTKGLTGGKFVGFKYFLEFFHNPLFGEIMTNTI
FT                   RISLWTLVMGFIFPIILALLINQIGSKKIKGFVQTITYMPHFISVVVIVSMLNIFLTPG
FT                   TGILGRFFGDESLMGSTSAITAVYWISEVWQHVGWNSIIYLAALAGVDTSLYEAAKIDG
FT                   AGRLQLIRYVDIPAIMPTCAILLIMNMGSVLNVGFDKIYLMQNSLNMPATEVIATYTYK
FT                   IGIINGQYSYSTAIGLFNTLVNFIFLITANAIAKRVSDTSIF"
FT   gene            555787..556722
FT                   /locus_tag="BLJ_0457"
FT   CDS_pept        555787..556722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0457"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99933"
FT                   /db_xref="GOA:D6ZSS8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSS8"
FT                   /protein_id="ADG99933.1"
FT                   /translation="MSATIEAVTQNKNDIPWNKHVRQKQKPGDWAVSGIINVLLLLTIV
FT                   AVLYPLWFVVIASFSNPNAVAGGEVLLLPKGVTFAGYAKVFANQRIWQGYLNTIIYSVV
FT                   GTAVNMAVTIPCAFALSRREFKPRRVIMFLFTVTMFIAGGLIPNYLLYKSLGINNSMWV
FT                   FILPGAVSVYNVIVARSFFETSIPEELFDAAQIDGLSYFGYFFKIVLPLSSAILAVIGL
FT                   YYFVGHWNDFMTGLIYITDDTKQPLQVVLQQLLLVAQGTGTNVNAAAQQQAADQIKFGI
FT                   IIVSTLPLLVLYPFLQKYFNKGVMLGAVKG"
FT   gene            556784..557461
FT                   /locus_tag="BLJ_0458"
FT   CDS_pept        556784..557461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0458"
FT                   /product="protein of unknown function DUF624"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99934"
FT                   /db_xref="GOA:D6ZSS9"
FT                   /db_xref="InterPro:IPR006938"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSS9"
FT                   /protein_id="ADG99934.1"
FT                   /translation="MLARFSVAYERFCRLLVAIFVVNVAILAHTLMGAVVLGFLPSFAA
FT                   AQATFRAWVLSEDRSMRAKEVWTTFHGFWKSEVKSANLFGWPLIILWAVVIVDYYVMNW
FT                   HARGDFDIMVSGVLLLIIVVLAVFSSLVWVVRANYAERPVWIVRTTLAMIVARPLCSLL
FT                   QVGLLILTVLVWVQWSGILMVFGLSLPMFCTAWIVYSFGRLPGMDIHDRMEQSTGRARN
FT                   QTS"
FT   gene            557488..558579
FT                   /locus_tag="BLJ_0459"
FT   CDS_pept        557488..558579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0459"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99935"
FT                   /db_xref="GOA:D6ZST0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZST0"
FT                   /protein_id="ADG99935.1"
FT                   /translation="MVQSSVSQRVNRSKRLVSIKDIAKETGVSVCTVSLVMNNKDHNRV
FT                   SKAVAQKIRATAENMGYRPNSVARTLRTSKSNTLGFVTDEIATTPYASKVLEGAQDAAS
FT                   KLGYILLTTNTNNDAELENQEISALLRYNVDGFLYAMMFHRKVDIPEVLEGSPTVVVDS
FT                   EDAAGRVPSVYPDDELAGYDATNRLIQAGCRRIVYYGSATSIVAQEQRLTGYRRALAEA
FT                   GIPFDDALVVEVSEFTNADDEAARVFDEIKPDGIFCFNDVRATFIYEAARERGVRIGAD
FT                   VSVISIDNQPFITNVIKPSLTTLELPHYEMGFEAVRQLVTILDGDKAVADLESDRGMAV
FT                   QRQRDGSKTALRCRIIERDSIVS"
FT   gene            558678..560588
FT                   /locus_tag="BLJ_0460"
FT   CDS_pept        558678..560588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0460"
FT                   /product="Glycosyl hydrolase family 32, N terminal domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99936"
FT                   /db_xref="GOA:D6ZST1"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR018053"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZST1"
FT                   /protein_id="ADG99936.1"
FT                   /translation="MPDNYSVAIETGGYRLLELFAERCGDDAAVTITDGDGHQIASHAM
FT                   PVAERRHRFLIPVPTNVCLTVRARQLTVRFAYLSECENLLDEGVRFISMNPYDNEWDTQ
FT                   PTLDQIYDRFARPAAHFEPFARWMNDPNGLCRFQGRYHLFYQFNPYGFGWDNMHWGHAV
FT                   SRDLVHWTHLPIFLEPQPELHIDERIVGGAFSGSAVTVDACDNPCKGDDAAAIRLYLTR
FT                   HLETRGDESSVTEYQTTCLCEDGVHVSVESPVALRVNDGFGFDFRDPKVETGMGGEAID
FT                   PERAYMVTATNLPVAEFDTDAVSSAAPGISVQGTDGWFTCGPQGMPGTDKPNMDTVPAM
FT                   ALFSAKKPLKRNVTWQYEGPVLADFGHQLSRTYECPDLFQLDGKTVAIGALMHYRDKQG
FT                   RFQQVRWYVGDLKDTADGPRLQVGNSDWCDFGTGYYATQSFAADDGRRIVFGWYTDFPA
FT                   MRVEKPCIANGMMSLPRELHVRDGRLTSRPVKEVYEQLLGDRLEAHADENGTFFIVPNN
FT                   AYYTDMHLADDDDFTMLIATGTNSANGNSMELQLQRRDGVTRLVTKGTVVDDIDFDSGI
FT                   ADVRRVEIFFDRNVVEVFLNNGEAAGSMLFQGADGDGEFRFVADGKVDCVDVRVLDGIW
FT                   R"
FT   gene            560757..561029
FT                   /locus_tag="BLJ_0461"
FT   CDS_pept        560757..561029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0461"
FT                   /product="ACT domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99937"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR022986"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZST2"
FT                   /protein_id="ADG99937.1"
FT                   /translation="MNKAIITVVGQDTVGIIARVCTYLSEHQVNVLDISQTIIDGYFNM
FT                   MMIVDYANADKDFGAMVGNLEDLGDDIGVRIRCQREEIFTKMHRI"
FT   gene            561165..562529
FT                   /locus_tag="BLJ_0462"
FT   CDS_pept        561165..562529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0462"
FT                   /product="protein of unknown function DUF711"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99938"
FT                   /db_xref="InterPro:IPR007841"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZST3"
FT                   /protein_id="ADG99938.1"
FT                   /translation="MLNIMEVHETNQMIEQEKLDVRTITMGISLLDCASDDVDKTCDNI
FT                   YRKITTYAKDLVSTGKAIERDYGIPIVNKRITVTPISLVGASSCKTSEDFVKIAHALDK
FT                   AAKEVGVDLIGGYSALVSKSMTPAEELLIRSLPQALSETDIVCSSVNVGSTKTGIDMNA
FT                   VELLGHIIKDVAERTADNDSYGCVKFVAFCNVPDDNPFMAGGFHGVTEGDAVINVGVSG
FT                   PGVVSRALDAAKGKDFEFLCETIKRTAFKITRVGQLVAQEASRRLGIPFGIIDLSLAPT
FT                   PAVGDSVGEVLEKIGLEQVGAPGTTAALAMLNDQVKKGGIMASSYVGGLSGAFIPVSED
FT                   KNMIDAASSGCLTIEKLEAMTCVCSVGLDMIAIPGDTTAATISGIIADEAAIGMVNQKT
FT                   TAVRVIPVEGKGVGEMANFGGLMGYAPIIPVNQTSCEAFVTRGGRIPAPIHSFKN"
FT   gene            complement(563060..563659)
FT                   /locus_tag="BLJ_0463"
FT   CDS_pept        complement(563060..563659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0463"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99939"
FT                   /db_xref="GOA:D6ZST4"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZST4"
FT                   /protein_id="ADG99939.1"
FT                   /translation="MFEYGYRKSNYGPDELVTDAHGNPISVVDAMLSAEKAATTETVTP
FT                   HLCYYSPRIPGNTGSAIRLCAVTGTILHLVEPLGFNLRDTKLRRAGLDYHDMAHVVLHP
FT                   NFDNLVESMPNSRIIAFTAHATKLYTEVEYKPTDILLFGPEPGDIPDPMDIMEGPHVAE
FT                   QVRLPMRPSLRSLNLTNCASIAIYEAWRQLNFKGGA"
FT   gene            563743..564699
FT                   /locus_tag="BLJ_0464"
FT   CDS_pept        563743..564699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0464"
FT                   /product="HhH-GPD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99940"
FT                   /db_xref="GOA:D6ZST5"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZST5"
FT                   /protein_id="ADG99940.1"
FT                   /translation="MNDTAISLRLGAWWEANARDLPWRFGRATPWGVLVSEVMSQQTQM
FT                   SRVVPYWNDWMARWPDARALAAAPKADVITAWGRLGYPRRALRLQECARVVAEEYGDEL
FT                   PRTYDELVALPGIGDYTASAVLSFAFGERIAVIDTNIRRVLSRVFLGTESRGGAASPAE
FT                   RALANRMLPQDRVRGDGADCTDHAYRSGEHTFLQRSEPPSATWNQSVMELGAVVCTAKT
FT                   PLCEICPIADDCAFLKAGRPGLGERRTRPRQRFQGTDRQVRGLVLAALRELPAGVTLPR
FT                   EDADKLWKDQIQLAACIASLDDDGLIEILDGGLRLPS"
FT   gene            564763..565485
FT                   /locus_tag="BLJ_0465"
FT   CDS_pept        564763..565485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99941"
FT                   /db_xref="GOA:D6ZST6"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZST6"
FT                   /protein_id="ADG99941.1"
FT                   /translation="MAVQRNTSGARTARGAGTGANGPSGGSARNDRSGKPRKRKISKKQ
FT                   QAIYRRRRIVAGTVLLLIIALIVFCVYSLGRGIGAVNTMIHHDEVYAISRDATPAPKKV
FT                   SNVKDCSASDVTLQLSAASQSVPVGGSLDFTATIVHEGSGNCLVDGADSGRVLTITSGQ
FT                   ETIYKSDVCPADSRLLLMSKGDKDVQKVTWNTDANATLTECTDESDWAKVNAGTYVAQL
FT                   SLKDHPKVKSDPVTFTVG"
FT   gene            565724..569287
FT                   /gene="rpoB"
FT                   /locus_tag="BLJ_0466"
FT   CDS_pept        565724..569287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="BLJ_0466"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99942"
FT                   /db_xref="GOA:D6ZST7"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZST7"
FT                   /protein_id="ADG99942.1"
FT                   /translation="MATESTTNTTTIIARADQHDIDLHKASDRVNFGSIKEPIDVPYLL
FT                   GVQTDSFDWLIGSDRWKKRVEEDEANGTNTVAHTSGLDEVFNEISPIENFAQTMSLTFS
FT                   DPYFEEPRHTVQECKEKDYTYSAPLYVNAEFENGDTGEIKSQTVFMGDFPLQTPHGTFI
FT                   IGGTERVIVSQLVRSPGVYFDRQQDRTSDKEVFGAKIIPSRGAWLEFEIDKKDQPQVRV
FT                   DRKRKQSAIVFLMAIGMTKSEIAQAFKDYPLVLDALEKETLETQDEALVDLYRKIRPAD
FT                   TPTPEAGKNLLDSFYFNTKRYDLARVGRYKINRKLGVEADFNDRSLHQEDIIATIKYLV
FT                   ALHDGAATFPGKRNGEDVDLRVDVDDIDHFGNRRIRQVGELIQNQLRTGLSRMERVVRE
FT                   RMTTQDAEAITPQSLINIRPVNATIKEFFGTSQLSQFMDQNNPLSGVTNKRRLSALGPG
FT                   GLSRDRASMEVRDVHPSHFGRMCPIESPEGPNIGLIGSLATFGRVNPFGFIETPYRKVV
FT                   NGHVTDEVEYMTADRDLDHVIAQANQELDENGNFVSKSALARVGEEEAVDVPVSSVDYM
FT                   DVSPRQMVSLGASLIPFLEHDEGHRALMGTNMQRQAVPLIESERPLVGTGSEWRAANDS
FT                   GDVIKSEKDGVVTYVSADLIRVMNDDGTTSSYKLAKFQRSNQTTCYNQRPIIHDGERVE
FT                   AGSVLADGPAIQKGDLALGKNLLIAFMPWNGYNYEDAVIISQRLVQDDTLSSIHIEEYE
FT                   IDARETKLGAEEITRDLPNVGEDAVANLDERGIIRIGAEVEAGDILVGKVTPKGETELT
FT                   PEERLLRAIFGEKSREVRDTSLRVPHGETGTVIGVKEITREDAEEDGDELPNGVNQMIR
FT                   VYIAQHRKITVGDKLSGRHGNKGCISRILPEEDMPFLADGTPVDIMLNPLGVPSRMNLG
FT                   QVLELHLGWIAHSGWDISLDPNMEAEWKKLIPSGAEKAEPNTPVATPVFDGVKPEVLKG
FT                   LLSTTLPNRDGDRLVGPDGKATLFDGRTGEPYTKPISVGYMYMLKLHHLVDDKIHARST
FT                   GPYSMITQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLHEMMTTKSDDVDGRVRVYGA
FT                   IVKGDNLPPAGIPESFKVLLKEMQSLSLNVEVLNAEGVAIDMKDEDDDPASSADDLGFN
FT                   IGARPDAAAKEDQKAEEPEYQ"
FT   gene            569455..573492
FT                   /locus_tag="BLJ_0467"
FT   CDS_pept        569455..573492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0467"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99943"
FT                   /db_xref="GOA:D6ZST8"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZST8"
FT                   /protein_id="ADG99943.1"
FT                   /translation="MLDVNAFDKIRIGLATADDIRGWSHGEVKKPETINYRTLKPEKDG
FT                   LFGEQIFGPTRDWECACGKYKRVRFKGIVCERCGVEVTRSRVRRERMGHIELAAPVTHI
FT                   WFFKGVPSRLGYLLNVTPKDLERVIYFASYMVTEVNEDERHNDLPGLQDEFDSEIKRLE
FT                   QRRDSDIEARAKKVEEDLAALEETGEAKGPARTKLRNGAERDMAAIRTRYNDQIARVDA
FT                   VFDKFKKLKPGDMVDDVDLWREMQDRYGDYFDGCMGAEAIKKRLQSLDLETISKELREE
FT                   IKDASEQRKTKALKRLKVVNAFLTTGNKPEAMVLDVIPVIPPDLRPMVQLDGGRFATSD
FT                   LNDLYRRVINRNNRLKRLIELGAPEIMLNNEKRMLQEAVDSLFDNGRRGRPVTGASNRP
FT                   LKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPSLRMHQCGLPKPMALELFKPFVI
FT                   KRLVDLNYAQNMKSAKRLVDRGDAEVWGVLEEVISEHPVLLNRAPTLHRLGIQAFEPIL
FT                   VEGKAIHLPPLACAAFNADFDGDQMAVHLPLSAEAQAEARSLMMASDNILKPADGHTVT
FT                   MPSQDMILGLYYLSTVLEGAKGQGRVFSSLEEAEMALDRHEIDMQAKVLIRLPESFVLP
FT                   KNWEPGEVKVLDPREGEDEVVKEERFHDGTVLFATSYGRILFNETLPTDYPFVNEQVAK
FT                   GRLSKIVDDIAMRYSTQQVAATLDALKDLGFTRAPWSGVSFAFSDVNEPPERDEKIAEY
FT                   EAKADKVNANYEMGLLTEEARRQELIDLWTECTAEVSKEVEEKFDPTSNLAIIVQSGAR
FT                   GNMMQINQIAGMRGLVANPKGEIIPRPVKSNYRDGLSVLEYFISQHGARKGLADTALRT
FT                   AESGYLTRRLVDVSQDVIVREEDCGTKAGLPIRVAERDNDGNLVLVKAADGGPYSRLLA
FT                   ADVIDPADGQTVLYKRDDALSMDVLNDLVAHGVEEVKCRSVLTCESKRGVCAKCYGWSL
FT                   ATNKLVDVGETVGIVAAQSIGEPGTQLTLRSFHSGGVAAASDITQGLPRVTELFEARTP
FT                   KGEAPITEFAGSIKIVENDRGRQIILTPDADSGAPKEDGVIKPITYQVSKRVPLKVADG
FT                   DHIKVGTQLVEGSVDPKKILTILGKRAAQVNIVEEVHTVYRSQGVDIHDKHIEVIVHQM
FT                   TRRVTIIDSGDTDLLPGELVDNARFREINRNIVKNGGRPAVGRPALMGITKASLATDSW
FT                   LSAASFQETTRVLTEAALSEKVDDLKGLKENVIIGKLIPAGTGLARYRNAVVEPDKAIR
FT                   DTIYPNFGLGGDGDLGDASFSDADLSDLNFSNLEFGDLKLGDDFNPDDFYSDQGGQPDI
FT                   EE"
FT   gene            573764..574564
FT                   /locus_tag="BLJ_0468"
FT   CDS_pept        573764..574564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0468"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99944"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZST9"
FT                   /protein_id="ADG99944.1"
FT                   /translation="MVVINAIYKKALRARLWQPTKWGKRLLKSKDAAGGFRKMLVSEGG
FT                   KAMQSGENVLSAIRHDGTGNYAANLARQGWDALGKGMHNVGHSLKNSGRAWNRFVSGWQ
FT                   DAKQAANAAHSNPNNTVMRDFWDGQFKRFGDWSKGHGWSIGNTIMNARTGYTDFRGIHD
FT                   MKNIAAVGTHRTVWDTMNFGQHVVSYANATYDTLNTAKVVKPFVNPTTDGGLQWKHSPQ
FT                   DYFKTFVPDPDHLWNFKTIYQAPGKLSDGAAEASNAIRVGISDL"
FT   gene            574582..575634
FT                   /locus_tag="BLJ_0469"
FT   CDS_pept        574582..575634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99945"
FT                   /db_xref="GOA:D6ZSU0"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSU0"
FT                   /protein_id="ADG99945.1"
FT                   /translation="MSKHSRNDGRQPEQYARLSESPSEDESDEEFRQFLLAKGDQNDPA
FT                   VRDMLKTIDRDRYERSAANGGPTLEYESHGLFALTVPHLHGPRPGRRAFGMRGVVLKSL
FT                   WFLFVFVVSVVVQVVFMDAAKANGSGDWWPLAAVPNVVVFALVFTSMALSPFLMLLFGG
FT                   IWPRLWGLSILFGSLAMLAVGSFVGQEVGRRWLWDRYVATGLLKPGDFVDWSSDRLPAP
FT                   LAQPASGGWWVTGLVAGVLLVSGSLFLYREDRHRGSNILPRYISYGGGVVGLVAAIGIA
FT                   LTRHVSGFALVAAPFIALFVGLLWFPLDLAAACFCVDNRRESCGEWPAAFWLTAEALFV
FT                   IGVCTALPMA"
FT   gene            575682..576911
FT                   /locus_tag="BLJ_0470"
FT   CDS_pept        575682..576911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99946"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSU1"
FT                   /protein_id="ADG99946.1"
FT                   /translation="MSIRLDERRYVEELKRLVADFRMWKNPLVPLPDGFEDDLAWRSYR
FT                   VFGQTSPADIIALAVRTRDEDLVAQGEGFISDSVSMIDDEDVFGWLFRMIWGKELQLRQ
FT                   QIADADVENLDATFDFLTSACRLAAHVLLGWGEGDTSSAYIARLFLIEQYDDALNCILP
FT                   YSNVSLNTNESELVVSDLRDRAIAAAMRRGETAAMEMKLHKAEDGPHYSSGEDSTASDD
FT                   GEGLDVADDGRPFPQSDVLYLFDADHVIEAYRYFLDHADGDADGDGELDNGNPWRRPDF
FT                   VQDKLLTLAGAGIVEPLVSTALEQGDGDRLEAALNLLTIYRGIVCDDGILALPIIAART
FT                   LQDSDGLRPDADLDQRMRYLESSRDLCSSMAAMLLARIPDPSWSRRLAMDLLNADMESY
FT                   VRHVRELAES"
FT   gene            578018..579445
FT                   /locus_tag="BLJ_0471"
FT   CDS_pept        578018..579445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0471"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99947"
FT                   /db_xref="GOA:D6ZSU2"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSU2"
FT                   /protein_id="ADG99947.1"
FT                   /translation="MKNLDYLDWAVVGQPDNPVSGDTEGIARMAWKYKCLSRDFSEMAS
FT                   ALKNLDTKAGMQGEWVVKFEEKLQDLPRDFGRFADSFGEVSCQLRGWMQSLDGFQSDAK
FT                   TQLERAIAARDEKEWYERLSCGARSALTQAGAVFDELPDAATDVQRRNAREAKEAAQQM
FT                   LDGYSDHVETAGDEWADAKRRVRDIRLAYESEAHKRAGEIAKAQEHAPAVNGFEKFHYS
FT                   DGWQCIVSFAKAASAVLAIVSLFVSGWGIALAVVALGALLLADKYVDYLYRDASFNEVI
FT                   AEGAFLILSIIGSVRCFSAGLQGFKTASVAKSTGLADDLRSFKLASGNIATNLGECHSV
FT                   ASFGILTQYSKVLPTYTKVSEGMTFLGDVKRVSDSVRVIASQVGRWGGSGRTLRTVLYY
FT                   AGREHLLQKGANLAGHAHDFVLDQVKYGRQTSGPWDVAKMFIPGLAQLNDAADAVNNAG
FT                   EGFVYAGSAIRSFMVER"
FT   gene            579451..580380
FT                   /locus_tag="BLJ_0472"
FT   CDS_pept        579451..580380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0472"
FT                   /product="isoprenylcysteine carboxyl methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99948"
FT                   /db_xref="GOA:D6ZSU3"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSU3"
FT                   /protein_id="ADG99948.1"
FT                   /translation="MVRSGGRPPWERGAAGVGGDAEAGGSDVGGENRVLANGALGEFID
FT                   MCIPVGGRRVFTRLGVALWTIMWFVLFLAQVGLQARYAFFERDSARGGVWFLQMAGISL
FT                   SSDWWPVAVFFDVGVVPGLLLWLAAHVMRKPWIAVAGDVLIVQCVAGAVGAEIGKTVMY
FT                   AMYGSHVESLIDSTTGRPDRLYYDSSPAVVVPGLVVAGVAVVVAVVLVVLRGVGVSPRV
FT                   RVGGNVVAGLGLMGMLWVGPADANQLFWVNSVMAVGMVLFWIPGELRAIRRCVLEGRDA
FT                   SWQPVAAGFLVLDFVMLMLLAYAAATGV"
FT   gene            580416..581699
FT                   /gene="rapA"
FT                   /locus_tag="BLJ_0473"
FT   CDS_pept        580416..581699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rapA"
FT                   /locus_tag="BLJ_0473"
FT                   /product="polyketide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99949"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSU4"
FT                   /protein_id="ADG99949.1"
FT                   /translation="MEGVAVVVDGEGFVGCVRGLRDALAGLPVVVGLLPSSRAAHGVVA
FT                   RGYDVFGQGAFGDMVALSCTVSPGAGAARAEAMRFLDGVISVVGKSGMVGWLFRVLWRA
FT                   DGSLLDAYGRVAEGRMPLPGEESADELEGYVDAVCRMGAWVLLRWSLDDDVTRVWTDLL
FT                   LQGRYLEVLDGMMPYVSVSFDSRGVERMKEVLAFRESGAGLGSSSGSSVSVADAVGVST
FT                   DSVDADVADAAWDAALSDAAIGLDAGVVRASRQYVFDSEHVEAACGVLAGVESGDACSN
FT                   VVAGPWLDRNFVDSKARGLVGARLASLLMRAVDERDGEALHEALGVLSDCRDCVRGYGV
FT                   PALPIMLAGMGQDMTARRGGRRDDGSSPEALDMSAAAAVVALTWIADVKAARNMGLALL
FT                   SGDMPGYVRLADQFLNGSAEMGVRSMEG"
FT   gene            582212..583093
FT                   /locus_tag="BLJ_0474"
FT   CDS_pept        582212..583093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99950"
FT                   /db_xref="GOA:D6ZSU5"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSU5"
FT                   /protein_id="ADG99950.1"
FT                   /translation="MAKRAKRQPRVKLEGLGVLRYVDDDMRVVPDCAGPVYAMGGVYWR
FT                   IGVLAALSVADMLAQAWWVNMSLSIGFDPWWLGVLGIDGSSFDFLGFMAGVCAVLPVVG
FT                   ILLVLPAFIWPRERTLFHIMMLCFWEGTSRMLGAGLGRTILYMRGVRDGVIDHFAGSGV
FT                   PGPLKESDTVVGMWPAVVGDIVFAVIAFVFAVIPRRQRQGAAKPMIGIGIAASIGLFGI
FT                   VLVECGWVPISFVLLLVALFMAWAVLPSEVAIARQCASKRVEPFWMWYSAELIWVETLF
FT                   IFLAIMVAISGI"
FT   gene            complement(583109..584482)
FT                   /locus_tag="BLJ_0475"
FT   CDS_pept        complement(583109..584482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99951"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSU6"
FT                   /protein_id="ADG99951.1"
FT                   /translation="MANPIIAEKLRDFRIEDFHPIVPRDLDLGKPLTPRVGNLVKVIVG
FT                   MRRSGKSYRLFQEIEALHTSGVSWNQICYINFEDDRLGDITPSVGDEVIETFCSMHPES
FT                   LDTGLYLFFDELQEMQNWGAWLRRIVDTTKATIYVTGSSSKMLSKEISTEFRGRALDFE
FT                   LLPFSFREFVRARGIAESELLSRNEAAGYSTKERLMLSAALISYLEEGGFPAIEGLPTP
FT                   QRVTLLQSYVQRVVSRDVVERYDIARPRVASALARRLLGSNGKPLSIRKIENELRSAGL
FT                   ATSRVLLGDLLEYFEDAYLVFRMKDFSMSLKESTTSTSKIYAIDPGLAAASSMASARDD
FT                   GQRLENAVYLELRRRTAGYRRDGISSCHTKEHGYEVDFVMGDALEHEQYELYQVTARMD
FT                   DNRTIERETRALWELMAEQKLHEGTIIVGDGIEREYRNSNYVIKQVPAWKWFVAHEPR"
FT   gene            584783..586234
FT                   /locus_tag="BLJ_0476"
FT   CDS_pept        584783..586234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99952"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSU7"
FT                   /protein_id="ADG99952.1"
FT                   /translation="MLPFRFESNGAEILFYYDVTHCETMHGVLRSVVPGDQYVGILVAV
FT                   LSVMEQCEEHRVPLSYVQWDPKSVYISAQGYPLFVVVPALGLEPDRNTATTLLQTLADA
FT                   RRTRLEDAVVQGYQRALAEFLGRNSLVNADALHDFMAYLLPGTVQPRQAQSAQSTHEDN
FT                   GSETQFGATVVSDGTMVGATRFGATVLSSKPKLQTTPQQAAMPTTSAAPSTHATPAAPA
FT                   MPAAHAAPAQPTPVTSSSPVTQPTPAMPIAVNLPRKQETQPARENPVREQYIREDFARG
FT                   VASNVAAAAAAGDAATAAAVADSAATAAVAEANTDNTATAHNATNAVNNIAAARVPATN
FT                   NVVRPILPVSAVSTALRADENDSEGETMLRLYTDKSRGFTVTRLRDGKAITVHATRATI
FT                   GRSKTADIHMGGNTNVSRIHAVIDMLDDGRFCITDNHSANGTAVGGRELASGGCEYVAS
FT                   GGDFTLADDTFVISPTIEGREEPKR"
FT   gene            586260..588416
FT                   /locus_tag="BLJ_0477"
FT   CDS_pept        586260..588416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99953"
FT                   /db_xref="GOA:D6ZSU8"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR026870"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSU8"
FT                   /protein_id="ADG99953.1"
FT                   /translation="MKRCAQCGNAVPDNMMFCTRCGAPVPEDATVVASRGIPQPGASVP
FT                   QPNMPQPGAPRPNTPQANIPQPGIGRPNGSTQNGSIPGIPALGSPIPSGQTPGTYAGSA
FT                   GAVPQAGTPAPNNGMPASAVPSVGAPVQSNGNVVGNTQGNTSNGDGNNGKKPRKILPII
FT                   IAIIVVIALVAGGVTGFIFWRNAQQKAETKSTTTSATKSKPKDKTKAKVKTKEKTKPEP
FT                   AKPAVTEVTMTDFSCDGNSARDWKWTGGAMVSNVIHCWDGDSSVDSDSSSRSSSDSRDG
FT                   SGEYAFGIWTPSLDESKEIHVSMLESGEKEYSELQVAATYGDNPAVFVFYAVKTKAVDT
FT                   TPESVHLFAHEVDLETGELSDRIDLRTEEDNLIDYEQGYEYSLLAESRNMVAIKKTWHS
FT                   DEKYTANKSEQSATINHTQVMGVTHDSDAAKVLQTFQDKIVITADSDGYQYTKQVEASA
FT                   SGVSLYDAYLVKDNSYHLYSVEDNKEIMSFPLNYCDTDYSSCDLSRMRYLGKNIYVTGN
FT                   TYDYSYVIDSTTGKRQSLKDVLGLSKDEDVRAVDQFSDGTLYVQTDGNGNESKRVFLLS
FT                   SDLKPTEVLDGPQWGRLLLTDGSFKGINYLTKTIYVKTTDEQIIVDAQGKSVGKYTQLP
FT                   LDDDSMVCDHSVMEWMAWSPESSGDVIVTIGQAPGDPAPDLSNSSSQSESDSDSSDSES
FT                   DSTDSSDSSSSSSSSSDNKSDSNK"
FT   gene            complement(588609..589220)
FT                   /locus_tag="BLJ_0478"
FT   CDS_pept        complement(588609..589220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0478"
FT                   /product="FHA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99954"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSU9"
FT                   /protein_id="ADG99954.1"
FT                   /translation="MAKLPYPPAPELGWYSDDPVEGALASAAGTAEPQHNDYGQPDTGT
FT                   AQASGTFAAKPAAATSAPADTTPHAAEGDIEDWDSTVLSSSFTSKAPKKTYLLHNDVTG
FT                   QTIVIDKSTLLGRKPSMDVPQGAKAERIEDPTRTTSRNHAAISIDTDGALWIEDYGSLN
FT                   GTYIITNGQETQVTKGTPLKLSAPATVRIGDQFFQFSEQQ"
FT   gene            complement(589236..589844)
FT                   /locus_tag="BLJ_0479"
FT   CDS_pept        complement(589236..589844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99955"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSV0"
FT                   /protein_id="ADG99955.1"
FT                   /translation="MVDYDAAVAAVQDPNADPILLAKIAYENPEFGANVAVNPRCYPGL
FT                   KRWIAEFGDERARETLAQYGFTAEAFGGPVQDQEAPSQAALQAAEQQPADAYAADQYAA
FT                   AQPAADQYAAAQPAADQYAAQQPAAQAAFEEPVATNPYGFTAEQALTTTDQMQIAQIAQ
FT                   YAPELRACIARNPNTYPALIEWLGQLGDPAINAALASCQ"
FT   gene            complement(589871..590803)
FT                   /gene="ppp"
FT                   /locus_tag="BLJ_0480"
FT   CDS_pept        complement(589871..590803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppp"
FT                   /locus_tag="BLJ_0480"
FT                   /product="phosphoprotein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99956"
FT                   /db_xref="GOA:D6ZSV1"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSV1"
FT                   /protein_id="ADG99956.1"
FT                   /translation="MTTGSIRIAMTSDVGLRRKNNQDTGFAQQGVFMVCDGMGGGKGGE
FT                   QASQLAAQHFAQLASMPSRTRHDIDDTLAQAQHDILDLGDRLGGVAGTTCSGLVLPQPY
FT                   ADAINAHSAAPFDDADSPDFSDQTYVVNVGDSRTYHLSPLPDADAPATDIIPVWDASSL
FT                   TRITRDHSQRQEAIDSGQMLPEEAEATIPRNIITQCLGDPDGIVPDVYVADLTGRFIIC
FT                   SDGLHGEVSDEQIAAIAAAHSSPQEAVDALVAAALDAGGTDNITVIVADMPLTEPEHHA
FT                   FSAFKLDEGEDIGAIEDATLQTLRTIRSA"
FT   gene            complement(590800..593313)
FT                   /locus_tag="BLJ_0481"
FT   CDS_pept        complement(590800..593313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0481"
FT                   /product="transglutaminase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99957"
FT                   /db_xref="GOA:D6ZSV2"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSV2"
FT                   /protein_id="ADG99957.1"
FT                   /translation="MTFDQSSITNTNTAAYAGSSGTYTGTSSGTYTGTSTTTGSWADST
FT                   HSVIWMTRGNVLRGMGLSRQPWGKRITSLVLIAAMMLLAQANLIDVYGGVATWAIAAVP
FT                   ATLLGAIIALAGMLPALRLWWQIVFLAFAQFIIGPVVTLSSTTSHYVIPTLKTLSSGWE
FT                   MTFGSFKYIISVDPPLGTQDGVLLAVWTIGLWLTFLTGVFAINANAWLSLVGVLPLAAA
FT                   VAVCALLGTDSGWQRAICGIAFALLLIIWLSWRLELLEWGRWISALIIVVLAAGLAFGG
FT                   TLLVPQDRFVLRDRYDPPLSPYDYTSPLSGMRSYIKDHKKDVLLTVHNLPAGTPVKLAV
FT                   MDRFDGTVWNLSDSSEATDSSNYHRVGTTIKADEQGESFTATFTVDQGLTDTWLPLAGA
FT                   ATGVSFANDADNGNDTFYYNTDTDSAIIPAGTRKSLTYTESGIIARKPTDKQISSAAAA
FT                   RITQPEAQDVPDSASKLATSIAGGQSSGGAAATALADTLKDSGWFSHGLEGDYPSDAGH
FT                   GNYRINKLLAGTAMVGDSEQYASAMALMARELGLPSRVVLGFLPKNEDGEITDARTEKT
FT                   SGNGTKIEFTGNDVTAWVEIKLQGLGWVAFYPTPKETKVPDENQNLTPPNPQTLVRQPP
FT                   VPLTDPLRDQTQARGQSSLAGADADDSPTNLFWVRFWRVTRKVALYGSPLWTLLIVCGL
FT                   ILMFKAMLLARARRHGSPKARVAAGWNAIRMLAEQSGITAKGTRRDQAGAIARQLGTDD
FT                   QALIQLGREADYATFSGQDIESGQATTYWTGVDQLRKAMLASLPRFRRIRTRLSLKSVA
FT                   ILSNRHAAKSHTTHVKRARKKGKTS"
FT   gene            complement(593310..594533)
FT                   /locus_tag="BLJ_0482"
FT   CDS_pept        complement(593310..594533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0482"
FT                   /product="protein of unknown function DUF58"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99958"
FT                   /db_xref="GOA:D6ZSV3"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSV3"
FT                   /protein_id="ADG99958.1"
FT                   /translation="MASTSAALRRRRRAERMFKRAVRRIRRFFASYVSPLGWAVTGAGI
FT                   ACLIAFLPLGWYELLVFGIVAMVMMLAAIALSLGNTRFHASIAVSDHRVTVGDTISVIV
FT                   GIDNTGKTPTTTARGYLPIGDAHERFNIPMLAPGQSKQTDVEFRTVSRAILPIGPLRIR
FT                   KGDPFGLVRHEKELADRIIVFIHPRTVRLDTLNAGVPRDLEGQPSGQIVDDDLDFYGLR
FT                   EYEPGDDVRNVHWLSSAKTGTLMIRQYEATRRTDTSVTISVNPDEYVNGEEFEMAVSIH
FT                   SSIGVKCLLQDRPLFCHAGNAHGQPRNAMEFLDNASAIEPDREDNPNLAEGTLKHSPDA
FT                   SFYFFTVGSLKDIEQIKRMTLALPRSASCVVLQASAGANRGIRRFANFTLATIGELDDL
FT                   PLIMGVLA"
FT   gene            complement(594558..596129)
FT                   /locus_tag="BLJ_0483"
FT   CDS_pept        complement(594558..596129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0483"
FT                   /product="ATPase associated with various cellular
FT                   activities, AAA_3"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99959"
FT                   /db_xref="GOA:D6ZSV4"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSV4"
FT                   /protein_id="ADG99959.1"
FT                   /translation="MSENIDDATQLSDTTRLSDSTQLSDATHLSDATHLASEPHTGTTP
FT                   NTETAQQPVALPNLPQRPSQASSEKPSPTTDAASIPAGDDSTVLKPRKDATPAIPQQVG
FT                   MPAKTSTPKVALPHFGRKSGKQAATANAAPATQTSRQWTTTTAGKTAASNAETVAGRGP
FT                   VANQQAAAQSQPQSQPQRQSSKAAQAAASALPASINSGLLPQPTAQVRDFQQSFNALVE
FT                   NVSKVVIGKTIPIKQCVTALMVGGHILLEDNPGTGKTQVARGLANSISTGFKRIQFTPD
FT                   LLPSDVVGVTFYDQKRGEFEFREGPIFASIVLADEINRASPKTQSALLEVMEEQKVTVD
FT                   GVTHDVPQPFIVIATQNPIEQLGTYKLPEAQMDRFLIKTSIGYPGHDVSVDILKQVDIT
FT                   DRAQTVSPVLSGDDVMRLRQVASEIYVDDAIREYIVRLVDATRHNEKITVGSSMRGALA
FT                   LTRCARIWAAADGRAYVVPDDVKDLAVAVLAHRITLTPEATFDGATPESLIAQVLEDVP
FT                   SPTIGS"
FT   gene            complement(596140..602124)
FT                   /locus_tag="BLJ_0484"
FT   CDS_pept        complement(596140..602124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0484"
FT                   /product="fibronectin type III domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99960"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSV5"
FT                   /protein_id="ADG99960.1"
FT                   /translation="MATSSQSYDRRRRISAALRRLMPSGGHTWTVPVITLLLLLGLVAG
FT                   AVIMSTVTRRHVQLDDGTVWVTSLKNQKAARFNVKNKEADAGVSSSAPRFDIAQHNGDT
FT                   ILTETTKASTIKASTVSTGVKTDIKANTTTVVGGDTVALINEKTGNVWTGLSENLDSVA
FT                   PTTSDPKMKLGEGGRIVVTHDGKVYGYRPSDGMVLRLDNPSSAKAKTLESLTDGKQQTV
FT                   ESFTVIGSTPVIATGKTVIFKGGRVDVDTTGTLTLQEPPTDDVQSDWVAAASPRGLTLI
FT                   PLKSNAKANFIANGGKANPARPVSSKGCVYSAWSQKASNYIRACSPADTSVKPQTLESV
FT                   NTTSELVFRTNHRLVVLNDTVNGNVWNPEDSTKVIKIQWNKIQAEQTEKEQQNNDSANN
FT                   HHDFSKTCSAQSGQIKAEDDEIGARAGSEQILDVLRNDEQTDCSVLKITKVGAPNNKDV
FT                   TISPIYDGRYLQLDASATSAGTVTFTYDISDGRGQTSSATVTVTLNDGGNHAPVQFDTP
FT                   PEIDVEQGASYTANALSSFNDPDGDPLTLVSAVAQNTDPVQVSTRADGQLTFNTGALES
FT                   GRVGVEVTVSDGTATGTGMVYFSVKPANTLAAVIDPVAKTTVPNTDTVVKLSSYVHGTS
FT                   LQPAQLTQVDTPNGASTTTNAADMSLTFKATNPGTYYVPYTITQGSIPATGLARVEVQP
FT                   ATGEAAKPVAANDVALLGADNTAIVEPLTNDVDPMGGVLSVTTASAPADSGIKVGLVSH
FT                   KRVYITARQVPTKPVALTYTVANASGTAKGTIVLQPPALTTSNSVPKASNINAQVRTGG
FT                   IVSVDVLDHVAYSDGTTVKLKNNLQYDKETFKGLAFVSGDTVRYQASSETGNFPITYTV
FT                   EDNLGNVASANITITVHKSDAASKAAPTPHDAEAQVAAGQKVRIPITLTGIDTDGDDDQ
FT                   LLGLGNKAPTLGRISEVGSDYLVYEAYPDSSGTDTFSYAVEDWTGQRAQAQIRVGVFQG
FT                   SSDSGVYARDDEITLRPNTAATVPVAQNDISGDNTNLTVDKHVEVQGLDGVSVKDNMIS
FT                   FTTPGSATTAYIAYTVKDKAGLSDTATLTVNVDPNAAIEPPTAYDYRVPSAATIDKKSV
FT                   DVDVSQWIANPSGTANELKVGVHPSASAHAHVKGGEHSTTITVDLTSQARAVPYTVTNT
FT                   KYNITSTAFIQVPAYGVFPPTLRPKAPELKVNSRETIEININDYVRVGAGKEPYIESAD
FT                   SVSATKASNSDFYVNDKTLKFTAAKDYAGPASITFTAVDGKQGSDKTKIINSAVITLQI
FT                   TVIGRDVPPPTFSSSTIDVEAGADPKTVDLTALTHAPSGVYDDEKQYTYSGGSSSSGRI
FT                   TANLSRSGSLQVSATKDAAPGTTASIPVQIAYGAGTVNAGVTVRVVSSTRPLARVGDKT
FT                   LKIKAGASDAVNVLTGAYNPFPDSSLTVISCKADDAAKLTIAGCDASGNVTIAVASDPG
FT                   ASTNTVLVTVQDGSKSKDREVTASITVSVIDKPEPPLLSPVAGEPQDSAVSLTWTPGAA
FT                   NGSPITNYKVSWTGAATGEKDCGAVTSCQVTGLKNGKTYSFTVAARNDVGWSKPSTAVE
FT                   ATPDKVPSAPTDVTVTGGNKTAKVTWKAPSGDFSAVDNYSVTVTGAGAPQTKETGNTAT
FT                   ELSFTFNNNDISDGTAITATVKAHNKINWSAESAASPSEKIWGDPDAPNIALSNNDTTV
FT                   TAKVTLGNNRNAGCRRISLGGDVKDTIDCSDGGATFDINENDLNTREITVTATVVPQRD
FT                   ASAGTGKSRFVPQYKVQPPTDVYTTGSGSTCTVHWTKQGHAQSYNVTADGIDSGTATNR
FT                   NSLDFRMSPWAKCNTASVQQVFNGATSDAATGGPYNGAPYTYEKKAVINKPQELRWSDN
FT                   AHVINVTGGSVEVYGKQATVQIIINGQPFTWNPGQPLDVTDLAVAADGNYTWSVKVTGG
FT                   PGYSGLDNTADGSSVAGTRPSDSSEGTESLKSGTDVTTLAKNPWILGFGNTPISSITIH
FT                   KQ"
FT   gene            complement(602291..603712)
FT                   /locus_tag="BLJ_0485"
FT   CDS_pept        complement(602291..603712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0485"
FT                   /product="protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99961"
FT                   /db_xref="GOA:D6ZSV6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSV6"
FT                   /protein_id="ADG99961.1"
FT                   /translation="MANIPMRPPKLPGYDFVQMLGSGATATVYLYNQRMPARPVAVKVS
FT                   AKTLDPRAAALFNREANFMAKLSSHPYILPVYGAGVTSDGHGYIVIEYAPGGTYNSIMK
FT                   ARSMTCEQVLDLGIKLSSALFTAHRSNIIHHDIKPSNILITSQGLPVLGDFGISTDVYD
FT                   RTETGFSPPWAPPEVLQHLTNGSEAADIYSLAATLYAMFVGCSPFQHEYHPRSQSELIS
FT                   LIVNQPLPRLNRPDVPADVEAVLRRALNKDPDQRYYSALEFARAMQRVQFAYFGHATPV
FT                   TVEGMPAYPKDIERRRRATDQRDQTTRSSRRWVKPVGITVGILAAITAAALIFAFVVVP
FT                   RMDSATGSDTKQVATPGTKDDDNNRNNQDDVITDTANAQIPSPENLNGTYAADGSSVTF
FT                   TWTNPDPQSGDTYAWAIVQGSNTDQSAQTVTTSDPTVTVNAQEGSQTCIQVSIVHKNRQ
FT                   MSVSPAIACAAKPQE"
FT   gene            603844..608109
FT                   /locus_tag="BLJ_0486"
FT   CDS_pept        603844..608109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0486"
FT                   /product="large hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99962"
FT                   /db_xref="GOA:D6ZSV7"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSV7"
FT                   /protein_id="ADG99962.1"
FT                   /translation="MTRLEPGTVLDGIDRDGAARLIVGTPGSGKTEFALSVLMAGLRRY
FT                   GGTQAVMAVSGRVAADALGNRVIRELGFSVQARPVTTLGAVAFRAISASREGTGLPSPR
FT                   LLNGAEQDALLRQVMAVHLRHAVAGDDCGTCDLLRVYFAQDDWAKLIRDAGAGEMPGSA
FT                   ASAQSSLSQQGSDSLSPTSAGGSTSADRFTRGISDAFISQLRDMLARLDELGVGVHEEP
FT                   RLLDAVTEDARLSVQWRLAFALRREYIAAQSAAYPGQYRLDASYLLVAGARVVHEAFAA
FT                   DHADDSGRPMRMEALGLPRLLVVDDVQDTTLAGMRFLEELGNAGVKLVLVGNSDESVQT
FT                   FRGSYPEYLMRRAVEGWLKAKEEQLVGGSTGADQSHMTMADVIASRISLSIPSPEDEPL
FT                   PPAERPGKLTAMLGGVDAANYQSDGTVTAGLYRSSREELDDVVWRIKRAHLDRHIRWND
FT                   MAVITHDNAAVRLFGERLRRDGVPVRYSSVTRPLKDETFVQGLFALVELARLRAEGMAE
FT                   CQMTLASCAAYIRTRVATLMNGPLVSAGGRPGQGRPARLAPIELAMSALESLAHLATDD
FT                   AMLTSLTTAWETLRETYHETRRETGRETSSSVVPSPVSVGILGEPSDDDLAFGVDALYV
FT                   MLAVDDAAAPAQAALASIHAVLGNDPQARAFANLWHLVGSVASGLERLPASQRVQPRYA
FT                   LSVAWNATGLAPVWQRAALFNTAEGRTANDRLDAAMRLFQFADDSTASRDITSFMAQVR
FT                   GMEVQADSLAHIGPVEDAVTLTTPAGAAGRHWGYAWIPVVQQDVWPNLAGRNTMFGGED
FT                   LAELVLRGALEESDKTGHDPQFAAVLSGEKKGFLVALTRARRIMISAVWNDSMSPSDFL
FT                   FGYLPEYYPRNRQQAPFTTVGAHTGSAEYDLAGLDADPRGLVSAARAVLATAQPQQAAA
FT                   KDAAVALTLLSEHGVRAANPQSWAFVESPAQSDSASSGGASSGGASSDSASSDSASSGG
FT                   VQSDGIQTGKGKTDAQAAPMVTLSPSAVDSLWACPVCWMLENRFAGPRPSSVATSFGTL
FT                   IHAVAQQGSEEGLDHLSHNAQTLATLGLDSTVGTERRIEAVTARLNAIYQSKRPDPNAI
FT                   ADTRNRYEATRKDESAADALRNIADYFVRSDADPETYLGKNSSNFSIGALAGAECEREF
FT                   AARFDVRDILDAYNAVPGMHPIDRNMLVRLMGALVGGWPEGMDEHLTVRLSGRIDRMET
FT                   RVLADGGECIRLIDYKTGRTPTVKQIFNDLQLVCYQLGLVFPEDGPRGAKALAAMPHIS
FT                   QSALFHVGQNAAPARSYAPEGAFQPPLFTDGSLNAEPFTPRYWYKDPNRFFDIPAIDPA
FT                   TPPEGVSAEAWAQFAALAGTQTLWSLTMIARVFYAAAASRSAIIEAHPQDTHIGFCRMK
FT                   NVCPACAGQIDTIFETRQA"
FT   gene            608106..612128
FT                   /locus_tag="BLJ_0487"
FT   CDS_pept        608106..612128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0487"
FT                   /product="UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99963"
FT                   /db_xref="GOA:D6ZSV8"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSV8"
FT                   /protein_id="ADG99963.1"
FT                   /translation="MSTFTPSAEQAAIIDAPVNADVLVVAGAGSGKTFTMTQRIIALIN
FT                   RGVAPERILGLTFTRKAAGELLERVSAAVAGDMAGSTTATVSDRAFLKPAIFTYDAFFQ
FT                   TIVRQYGLLVGFDQNTQPLSAAGALQLATEVIDSHMDLAFSEDFGAFSSLANRVLALSD
FT                   AIGSAMIGAGCTSFDDAINQVRQWDSAFINRLQQAVADEPMPEDEPKIPKIKRLKKDTD
FT                   ASWQAKLDDRAEHLHARCAYHCGALLETTRKRDILLQLVEAYAQAKRERNMAEFSDFTI
FT                   AAYQLIERFPSIGERTRRRYSHVLLDEYQDTSTTQAALLAALFHVDASQRSAVNAVGDP
FT                   FQSIYAWRGASPGAFRMFQQDFHLPAGYKPFPLSVTRRNSRIVLEAANNLTLPLRSNPS
FT                   RPSSSLMREVDVSSLDPMPDAPEGTLGVLGFATAGQEIDAVVRFCKTAIARHRSAAEQQ
FT                   EQMPGEQKVPVAVLFRSKSHMPEYQAALEQAGLTTFVVGYSALLERPEIRDLMALLHVA
FT                   ADHTDTGSLMRLLATPRFTMSAADLTMLARFAEEQNMEQRFQALVQAGLAQPDTPANEW
FT                   AAVVREYRDQVANAVFLPDVLLRGDLVKLLERLSAHGRNAITRAAVMLRQVHDAVGRPL
FT                   GDVIRAGIEALDLDIDTVLAGVLHNPQHRANPALAHMPMDAIVDLVDTYTQEIAAEQTP
FT                   SLHGFITWVDHLASVEDEAASLPDAPVDVELMTVHQSKGLEWDAVAVVGLTAGGFPSNQ
FT                   GDHLKIVLDEHHTGGTEQGHWTAPEYHETADSWLTNPTAVPVPMRADAGILPRFPHDAD
FT                   VEADPIASLAALDDVELIDDEVFGSMREFGDGVEEVDASGWYLTQAEEYGRRLHADERR
FT                   LMYVALTRAREDALMTYCAYTGESGRDPSVVPKGSRAAQPSNFWLEVHDALQAREHAIS
FT                   AQDCVERLQAANAGKPMLISAQGEAIAPPEGFFIGEHAAAYSDAVVGEAWQTPITQTNA
FT                   AAELPWPATLSDAVHEQLSRGIDVIAADSSSLEQHQDAGPLLQRAQLLVDDADLMADAA
FT                   SGQSLDEAVKAKAQRVLAAGRQNVTSLQARVGGMNEREERLYWRSIIRPIPRISSPAAE
FT                   AGTQFHAWAEQFINAGKPDEAVLAYEAEPSMPHTGQDAGFVSREAMLADLAERERQCRK
FT                   PSTRQPAVPQPTAQQSVSAVSATSISSDNATESKLVAWQRRLAESSWAKRIPAWTERAI
FT                   VVDVPGVGLVNGKLDAVFIGGLDPSSTTVRFTVVDWKTGRRPTKPDDITRKLAQLDMYR
FT                   LLLAAVEGVELDSIDATLYYVSEPDEGLRELHARAKTKQEILTELSSGIPEQSDND"
FT   gene            612340..613659
FT                   /locus_tag="BLJ_0488"
FT   CDS_pept        612340..613659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0488"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99964"
FT                   /db_xref="GOA:D6ZSV9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSV9"
FT                   /protein_id="ADG99964.1"
FT                   /translation="MSTTRAVSKSSAAHSPYQRLFMLPGAKAFCLSGAVARLPISMMSL
FT                   GIVLALNHLYDNWTIAGTMSAAYVLAMSCVTPFYARAFDRFGQARVGRLALAVQIVAML
FT                   AFAFAALVRVPIPLLFVLAIIMGLTQFSFGALVRTRWSYALRGVEDGEQLLNTAYAMEA
FT                   AIDEIVFILGPILAAWLATSVHPVSQLFVPTVACGIGGTIFFSLKSTQPPVIVEQVTVA
FT                   AHDDGSPAASEDADQLTLRQLKRSGAKPKSVLLYAGVLPLLAVFIVFNMSFTSFDVSIT
FT                   ATMKSMGLEPFLGLQLAMFAVGSCIGALVFGSCRLKGSHWAHMVMFLSLLTVGYVFFRL
FT                   SMDNLILLGVFEILAGLTVSPTFATGNLIVKDLVPAESLTEGLSWVTTAGTVGTSIGSS
FT                   VAGIVLDASNPHVGMMLPFIFTLASVPLALAGWALAKRRG"
FT   gene            613997..614752
FT                   /locus_tag="BLJ_0489"
FT   CDS_pept        613997..614752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0489"
FT                   /product="Dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99965"
FT                   /db_xref="GOA:D6ZSW0"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSW0"
FT                   /protein_id="ADG99965.1"
FT                   /translation="MIKVSVVGAKGRMGSHVVEAVNNAEDTQLALALDAGDDLTQVTTD
FT                   NTDVVVEFTVPSVSLNNVLTLIGQGVDVVVGTTGWTDEKLAQVKSAIANGPKPETQKVF
FT                   IAPNFAISAVLADYFATKAAKYFESAEVIELHHPTKVDAPSGTAIHTAHGIAEARKAAG
FT                   LAPVPDATETDGGSRGQVVDGIHVHAVRLRGLNAHEEVLFGNAGEQLTIRADSFDRASF
FT                   MPGVLLAVRKLAGGAPAGLTIGLDHFLDL"
FT   gene            614894..615820
FT                   /locus_tag="BLJ_0490"
FT   CDS_pept        614894..615820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0490"
FT                   /product="dihydrodipicolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99966"
FT                   /db_xref="GOA:D6ZSW1"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSW1"
FT                   /protein_id="ADG99966.1"
FT                   /translation="MGSTVNTMSEHDMHLLEPAPFGRILPAMVTPMKSDGSVDFAAAQK
FT                   LAKYLVADGADGLVVNGTTGESPVTHMDEKVELVRAVKEVVDVPVISGAGSNDTAHTVR
FT                   MVEQTQEAGADAVLVVMPYYSRPSQDGIVGHYKAVDESAEKPIIVYDVPGRTGLKVKVE
FT                   TYDRLAGLEHVKAVKDATGDLAAAVEKQQRTGLAWYSGDDGLFLPFLSIGAVGIISVIA
FT                   HVASNPMQQLVQAFDRGDITTARRLANQLAPLVHALNGDGYQAVMAKAALKVKGVIPST
FT                   TMRLPNIGPDATQLDKAEEGMRAAGLL"
FT   gene            615905..617755
FT                   /locus_tag="BLJ_0491"
FT   CDS_pept        615905..617755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0491"
FT                   /product="beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99967"
FT                   /db_xref="GOA:D6ZSW2"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041636"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSW2"
FT                   /protein_id="ADG99967.1"
FT                   /translation="MAQEQKKTSKNTNSRRRGSARGRNANGSNSRTPSRKINATRQATA
FT                   PQQDAVLIAPPKYRKGSMRITPLGGLGEIGRNMNVIEYNGHLLLIDCGVLFPEEEQPGV
FT                   DLILPDFSYIKNRLDKVDALVLTHGHEDHIGGVPYLLKLRPDIPLIGSKLTLAFVDAKC
FT                   KEHHQNPTKVEVAGREKLKVGPFDLEFVNVTHSIPDALAVYVKTPAGSLIDTGDIKLDQ
FT                   LPLDHRITDLVEFGKIGEKGVDLLMMDSTNAEVPGFVKPETSIGPALDQAFAQATRKII
FT                   VASFSSHVHRVQQVVDAAHKYGRKVVFVGRSMVRNMSIAADLGYLHIPEGTVVDLKQAN
FT                   DIQDDKLVFMCTGSQGEPMAALGRIADGNHRDIHINEFDTVILASSLIPGNEHGVYKVI
FT                   NKLVQLGAKVVNRDNAAVHVSGHCNEGELLYMYNIVKPKCAMPIHGENRHLVANGLIAV
FT                   KTGVDPQNVVLAEDGDVVDLYHGKAAVVGSVPCGYVYVDGDSVGELTDDELEKRRILGT
FT                   EGFVSAFVVVDTDNHEVVTGPKIYLNAVAEDESEFDKVRHQIVEQLNDQMMQGTRDTYK
FT                   LQQTMRRTLGSWVARQLHRKPMIVPVVADIAQDVETVETK"
FT   gene            617797..620406
FT                   /locus_tag="BLJ_0492"
FT   CDS_pept        617797..620406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0492"
FT                   /product="aminopeptidase N"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99968"
FT                   /db_xref="GOA:D6ZSW3"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR012778"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024571"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSW3"
FT                   /protein_id="ADG99968.1"
FT                   /translation="MPGSNLTRIEAEERKAVIEAPIHYHVDLDLTVGAKNFGSKSLICF
FT                   NAKPGSSTFLDLIADEVTSIDLNGKSLDPAVAFQDNRIELTDLKEKNEVTVEAKCRYSN
FT                   TGEGLHRSVDPSDGNIYLYSQFEVPDARRVYAVFDQPDLKATFDFKVLAPASWIVTSNM
FT                   PVATIEDDPRETLDGTLGDKPNESTRLWDFEPTPVMSSYLTAICAGPYAEWHTEYLNED
FT                   GRTVPMAQYCRQSLAKAFAKDVDYLFDITKKGFAFYAKTWGVPYPYAKFDQIYVPEYNA
FT                   GAMENIGMVTIRDSYVFESKVTDALAERRVVTVLHELAHMWFGDYVTMRWWNDLWLNES
FT                   FAEFTSTLATAEATEWHDAWATFCSGEKSWALRQDQLPTTHPIVAPINDLNDTYVNFDG
FT                   ITYAKGASVLKQLAFYVGRTQFFEGIHNYLNRHAYSNATLADLLSELEKTSGRDLKAWS
FT                   AKWLEESGINTIATGLTVNADGTIAELKLTQSAPAEHPVLRPHRLAVGFYNEDAETGKI
FT                   VRTEQFELDVDGETTIVEAAAGKPRPAFVLVNDDDLTYTKIRFDAESQAFAEANLHRFD
FT                   DALARAVTWLAFWDMTRDGEFPAERFVDMTLRLLATETESTTFRYALACMGTTAHHYVA
FT                   PARRDDVLRHVAAELWTLANAAEAGSDTQFQLATAYLGYGEEGDAAFAANAHGLLDGTV
FT                   RLEGLEIDNNFTWTIVQALTSVNEMTNDDVDAQLAKKETTENREFAYGARASMATTEAK
FT                   EWAWDQALHNDELTNSQLEAVARGFSATPRPDLAEPFAAKYFETVDWVWANKTYHMAEA
FT                   LLNGLYPGYADPATLVKLGDAWLDEHIAADNALKRLIVENVASSHRTLKVREYNEAL"
FT   gene            620583..621470
FT                   /locus_tag="BLJ_0493"
FT   CDS_pept        620583..621470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0493"
FT                   /product="protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99969"
FT                   /db_xref="GOA:D6ZSW4"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSW4"
FT                   /protein_id="ADG99969.1"
FT                   /translation="MIAGFSITSLLLILLAGIGAGFVGYAVGASSLVSYPALLAFGIPP
FT                   VLANASNTVGVVGTGIGGVMGARKELKGQAVRSITYVVIGAFGGVAGAFLLLKLDPSVF
FT                   EFAAPVLILLSSLIIAINPRGRMQAKQAAADATAQLKHIEATEATDATDAAKRATTPTA
FT                   PHRPPEQLVQPMSQDSWWVWLGVVAVAIYSGYFGAGAGTLALAMLDAAKIGPFHKINAL
FT                   KTLIGTGANISASVVFIIQGAVDWPAAIMLCIGCFIGGYIAPPITRKIPANIMRAAAVI
FT                   AGIILTIDLGLKTY"
FT   gene            621618..622001
FT                   /locus_tag="BLJ_0494"
FT   CDS_pept        621618..622001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0494"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99970"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSW5"
FT                   /protein_id="ADG99970.1"
FT                   /translation="MTSSIRQTRRRFTALRAMLIGGSRREQVLFAGVMKELLAPINNPR
FT                   YVIIGKEWGVRTYGVSFPCPSIFARRQQDAEILRRQLDRCLTHCTMVYTRTEEGRRTLL
FT                   RCQTRSFLNRDEQLPRILTTTSE"
FT   gene            622777..622911
FT                   /locus_tag="BLJ_0495"
FT   CDS_pept        622777..622911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0495"
FT                   /product="glycosomal membrane like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99971"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSW6"
FT                   /protein_id="ADG99971.1"
FT                   /translation="MKVTNGLACLWTPINVCDNDSRYMAPGAGVADAACVAQELCWYV"
FT   gene            complement(623732..624838)
FT                   /locus_tag="BLJ_0496"
FT   CDS_pept        complement(623732..624838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0496"
FT                   /product="Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99972"
FT                   /db_xref="GOA:D6ZSW7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSW7"
FT                   /protein_id="ADG99972.1"
FT                   /translation="MGQQYSHLSSEERILIEKLHCEQRLSIRRTAERIGRDKSTVSREL
FT                   RRGLWFASNENGSYRPYRPKRLKTGPWTSGPFYSALAAQRKADLRRRGSRKPRRMDSDR
FT                   LRAWVLDALRRGWSPELIEGRLKAQCAGDPSMRISHECLYQWIHAKPQRALDLRQYLAR
FT                   GRKRRTRKKGRKAKGPRIPMRVPIADRPEAVGSRKGFGHFESDTVVGAAPSRRCMNTQV
FT                   ERRSRRLFARLVDDKSASATARAEYEIFKGMPPAARVDRTWDNGTEASLHVLVDEALGM
FT                   LTYFADPYSSWQRGSNENRNGRIRRYLPKGTSFEDLTQDELDAIVGEINDTPMKLLGYK
FT                   TPNEVWDEEMAKLQSKQADPKPAVALTS"
FT   gene            625100..626485
FT                   /locus_tag="BLJ_0497"
FT   CDS_pept        625100..626485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0497"
FT                   /product="phosphoglucosamine mutase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99973"
FT                   /db_xref="GOA:D6ZSW8"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSW8"
FT                   /protein_id="ADG99973.1"
FT                   /translation="MPKMFGTDGVRGLANRDLTARLALDLGDAAVRVLGDAGTQDDQPE
FT                   GRRRALVGRDTRVSGDFLASALSAGMAAGGFDVIDAGIIPTPGVAYLTSVLNVEMGAVI
FT                   SASHNPMPDNGIKFFARGGFKLPDQKEDDIEAVLGQDWDRPTGAGVGRVSHDQTTATNL
FT                   YIDHLVATIAPLNDDKTQPKPLKGLKIVADCANGATSVVAPEALRRAGADVIVINASPD
FT                   GYNINKNAGSTHPEQLQAMVKATDAVMGVAFDGDADRCLAVDEDGNMINGDQIMGILAR
FT                   AKQREGKLNHDTLVVTVMSNLGLKLALKDMGIKTVETAVGDRYVLEEMLKGGYSLGGEQ
FT                   SGHVINREFATTGDGTLTALTLCNEVVKSGKSLKELAADFPQLPQTLINVPNVDKKAAA
FT                   TNKRIQDAVAREEELLGDTGRVLLRPSGTEPLVRVMAEAATQAYADEVCTRLAKIVAEE
FT                   LAL"
FT   gene            626508..627161
FT                   /gene="def"
FT                   /locus_tag="BLJ_0498"
FT   CDS_pept        626508..627161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="BLJ_0498"
FT                   /product="Peptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99974"
FT                   /db_xref="GOA:D6ZSW9"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSW9"
FT                   /protein_id="ADG99974.1"
FT                   /translation="MFGKNAKVDLELNRDVEQLIKTGGKEKILPIVQAGEPVLRQRTVA
FT                   YNGQLSKRTLAKLIDTMHTTMLEAPGVGLAATQIGLGLALAVVEDHVRDDEDDPREIAE
FT                   FPFHVIINPSYRPTSDKTASFYEGCLSFDGYQAVRKRWLDITAEWDDEDGKHHSEPLHG
FT                   WPARIFQHETDHLSGELYIDRAEIRSLTTNENLEDYWCDDPVPTEAAEELGFAL"
FT   gene            627218..628636
FT                   /locus_tag="BLJ_0499"
FT   CDS_pept        627218..628636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99975"
FT                   /db_xref="GOA:D6ZSX0"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSX0"
FT                   /protein_id="ADG99975.1"
FT                   /translation="MPKDADGTTIDWDWVRSLDLAHGVGTIPESIPQSIHDALKADYAT
FT                   RERLESIIAQCNSAFMTDFDRLIGSYRLPRALAYANRRLNDNINTMLHLGEQQHLWAVS
FT                   RERRGRATIAVLKPYSGSGPSNDDQGMLDLSGEAGGASAGNTAAENSDVKFPTTVALDD
FT                   IQDRTAAILDARAKRRKAQRFQKRAGDAAMARANLSGATSPGGAALPGGAAASGNATGH
FT                   HSKPDWRDAYLPGRDVDAVMGIDIETTGIDPARDYIIDVGFEFMNMASPRPAGEPETYA
FT                   YEQGYYAAGDAYGQSRLAFGVPPENAALGNALIAKLTGIDVRGRSSEAGYRLFDEWPQA
FT                   QAGLLARLTQQPYVAHNATFEHSWFMLNVAGYAESYRAGRITIIDTLPMSRQWDPGAVP
FT                   TNEHPYGDNTLDAYAKRQGALDSAHNERHLGLEDSHIMLVAMKHHLAALKAQGKGPWGP
FT                   AGRAGVGGKSCRSR"
FT   gene            complement(628653..629726)
FT                   /locus_tag="BLJ_0500"
FT   CDS_pept        complement(628653..629726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99976"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSX1"
FT                   /protein_id="ADG99976.1"
FT                   /translation="MRSRCFPPPREFIKHLVADGRFDYIETGSLISINANVKDILIPSE
FT                   EESMRMGPMDFEEFLWAMGEDALVRMIRHAFDSGVALPDSLHRKASRLWREYMLVGGMP
FT                   QAVAAYAPARNMAAADRAKRLVLKLYREDIGKYGGLAAKRVRAVFDAIPGQLAKHEKKL
FT                   VYTQVEEGSRSRDFMTAFAWMREAATVNLCTLAENPSLGLALSADDTVVKCYMADTGLL
FT                   STMAFSADGPSLPDVYRQVLLGADGVNEGMLAENAVAQQLAAAGHDLYFYAKSSNVREE
FT                   RMEIDFLIVRPYPDAAMKPRISPIEVKSGKRYSTISLDKFRAKFASRTGEEYVLHPRPM
FT                   AKKDHRRLLPLYMSFCL"
FT   gene            630285..630416
FT                   /locus_tag="BLJ_0501"
FT   CDS_pept        630285..630416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0501"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99977"
FT                   /db_xref="GOA:D6ZSX2"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSX2"
FT                   /protein_id="ADG99977.1"
FT                   /translation="MSDYQDSRQQRENRRRTIVRVVCVVIAVAMLGSLVIPAIYAGL"
FT   gene            630652..631776
FT                   /gene="prfB"
FT                   /locus_tag="BLJ_0502"
FT   CDS_pept        630652..631776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="BLJ_0502"
FT                   /product="peptide chain release factor 2"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99978"
FT                   /db_xref="GOA:D6ZSX3"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSX3"
FT                   /protein_id="ADG99978.1"
FT                   /translation="MAEFDFTQAIGEARAKYESIAKALDVDRLKADIKDLETQAAAPGL
FT                   WDDPENAQKITSRLSAAESQLKRLNSASQRIDDVETLVELGHEEGDQDSLDEAQSEIGE
FT                   IQKDLDQMEIQTLLDGEYDERSAVVTIRSGAGGVDAADFAQMLLRMYLRYCERNGFKAK
FT                   VMDTSYAEEAGIKSATFQVDAPYAYGRLSVEGGTHRLVRISPFDNQGRRQTSFAAVEVV
FT                   PLVEATDHIDIPDTDIRVDTYCSSGPGGQGVNTTYSAVRITHLPTGIVVTMQDERSQIQ
FT                   NRASAMAVLQSRLLVLRHEEEAKKKKELAGDIKASWGDQMRSYVLHPYQMVKDLRTGYE
FT                   TSQTQAVFDGDINAFIEAGIRWRHEQRRAAETEE"
FT   gene            631785..632951
FT                   /locus_tag="BLJ_0503"
FT   CDS_pept        631785..632951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0503"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99979"
FT                   /db_xref="GOA:D6ZSX4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSX4"
FT                   /protein_id="ADG99979.1"
FT                   /translation="MALISLDNVSKIYPKGTRPALDDINLDIERGDFVFLVGASGSGKT
FT                   TLLSLLLREEEATNGEIRVAGNDLRRITNRQVPQYRRSLGFVFQDYKLLNNKTVWENVA
FT                   FALEVIGTRRSTIKSLVPKVLNTVGLTGKEKNYPHELSGGEQQRVAIARAYVNHPQILL
FT                   ADEPTGNLDPTTSLGIMEVLDAINRTGTTIVMATHNEEIVNSMRKRVVELHNGKIVRDE
FT                   AHGSYDSALFFPDAEVEAKSDTAHHVLAAATKAIEGSDEPSEGIARLANSVHSGRTGRY
FT                   GETFAPLEDTLTWGKGIPLDEQAAALESTQAFDPFKDESAATAAVADTSVSSAAEPPAP
FT                   PELPAPPAPPEPPAPPEPPAPPANEQSAGEQSAADQTSDDQPAEGAKE"
FT   gene            632963..633886
FT                   /locus_tag="BLJ_0504"
FT   CDS_pept        632963..633886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0504"
FT                   /product="protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99980"
FT                   /db_xref="GOA:D6ZSX5"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSX5"
FT                   /protein_id="ADG99980.1"
FT                   /translation="MRARFILSETWANLTRNLSMLLSLTLVTFISFLFIGASVLTQAQI
FT                   TKAKGDWYDKVEVVVWLCPDGTSQSANCASGKSPSANEITALQKTIRDELNDVVSNIDY
FT                   VSKQDFYDNTFTKQYPNGEFQGRTLTADDMQDSLWLKLKDPTKYQVVSEVLSGKEGVED
FT                   VTDQRQIFDPVFAVLNRATAVTAVLAGVMVVVAILLTGTTIRMSAASRRTETEIMRYVG
FT                   ASNWTIRLPFILEGTIASLIGSVLSCLMLSAIVNVFVTGWLAKSVTWIPYVNQLTVLVI
FT                   SPFLVVGAILLSIIASTISLRRYLRA"
FT   gene            633989..635350
FT                   /locus_tag="BLJ_0505"
FT   CDS_pept        633989..635350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0505"
FT                   /product="CHAP domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99981"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSX6"
FT                   /protein_id="ADG99981.1"
FT                   /translation="MTNVRVIKPALAALVAAAACVGGLAFSSAQPAQADTYSDLINAQN
FT                   QHAASVQREAELKQQLAGASQDLANKVLELDDLTNNKIVAAQAKVTQANEDAATAQDEA
FT                   DAASGRLSAAQKDKETLEEQIKQTGKDYDDAHAAVAQLARDEMHGSNASDVMSVVTGAA
FT                   STQDFVNSMQSRDALSRNEANAASSAATSLSTSKNRGERLAAIEKQIAVLKTQADEKAA
FT                   SAQTAAETAQSERDALDKLRQEGETRRDELSSMIDSLDSQSAKQAARTVLIASQVDSYN
FT                   RQFQKEQQDAANRVDTGNQGGTPSTPVTPAPAPAPAPAPAPAPAPAPAPSVGGQGTSNG
FT                   DYGNAYAAGQCTYWAYERRRRMGIGTPSYLGNGGFWWRSAPAYGLRVDHTPQVGAALSF
FT                   LPGQDGADGTYGHVAVVEAVYGDGTFQISEMNWGGPWNMHYRTLTNLGQYWFVH"
FT   gene            635557..636033
FT                   /gene="smpB"
FT                   /locus_tag="BLJ_0506"
FT   CDS_pept        635557..636033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /locus_tag="BLJ_0506"
FT                   /product="SsrA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99982"
FT                   /db_xref="GOA:D6ZSX7"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSX7"
FT                   /protein_id="ADG99982.1"
FT                   /translation="MPKETGEKLIVQNKKARHDYAIEDKYEAGLALTGTEVKSLREGRA
FT                   SLSEAFISIDRRGEMWLEGANIPEYLNGTWNNHAPKRKRKLLLHRLQITKLARGIEAKG
FT                   YTIVPLSLYFKDGRVKAEIALARGKKEFDKRQALREEQDKREALRAMRYANMRH"
FT   gene            636196..637149
FT                   /locus_tag="BLJ_0507"
FT   CDS_pept        636196..637149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0507"
FT                   /product="extracellular solute-binding protein, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99983"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSX8"
FT                   /protein_id="ADG99983.1"
FT                   /translation="MSLSKGIQSAAAAALSAAMLIAVAACGTTDSTDTASKSGDSSKDS
FT                   SSTSIQGFDTSSIQKDDEIAALLPDSVAGDGTLTVGADTSYAPAEFLAEDGKTPVGFDV
FT                   DLSKALAAVFGLKENTVSSTFDSIIPSVGSKYDIGISSFTVTKERMEAVDFVTYFKAGS
FT                   TFVVQKGNPNKVDSSNLCGVKVAVQTGTTQEEEVNKDNEQCKADGKDAIDIQSSKLQTD
FT                   VTTAVASGKADIFYADTPVAGYAIKQTGDTLEALGEDVGVTPEAVAVKKGDSKTAEAVQ
FT                   KAIQKLMDDGTYKKILDTWGVSSGAVDKAEINPSVE"
FT   gene            637283..638230
FT                   /locus_tag="BLJ_0508"
FT   CDS_pept        637283..638230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0508"
FT                   /product="extracellular solute-binding protein, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99984"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSX9"
FT                   /protein_id="ADG99984.1"
FT                   /translation="MQSTKLKSIMAIALSSAMLFATAACGTSDKADAGTDSDKGGSSKS
FT                   VTITSYDVSSVKKDDAIAALLPESVTKDGKLTIGTNPSYAPAEFLDADGKTQIGYDMDL
FT                   ARAMGNIFGLETEIVSSNFDTIIPAIGSKYDLGIAAFTITKERMESVDFVSYFTAGMGY
FT                   AVATGNPKNVDENDLCGLNVAVETGTVEEEAINKTAKQCKADGKKDITIQSSKQQTDAT
FT                   TAVVTGKADVFFADSPVVGYAIAQTDGQLEQLGKDFDEVPNAIAIKKGDSQTTEAVQKA
FT                   MQKLMDDGTYTKILQHWGVESGALDKAEINPAVE"
FT   gene            638418..639413
FT                   /locus_tag="BLJ_0509"
FT   CDS_pept        638418..639413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0509"
FT                   /product="transcriptional regulator, Fis family"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99985"
FT                   /db_xref="GOA:D6ZSY0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSY0"
FT                   /protein_id="ADG99985.1"
FT                   /translation="MAKKEVDGEGLNIPNRIKALPVKRPGPIVAAVIVVLLAAMLIQGL
FT                   ITNPRLDWPTVWKYLFNENVLEGIRYTLELTVISMVVAIILSVILAIMRKSINPVLRGV
FT                   SWFFIWFFRGTPVYTQLIFWGLFAVLIPKISLGIPFTSVEFWSIDSNVVVTAFNAAWIG
FT                   LALNEAAYLSEIVRAGLEAVDPGQTEAAKALGMNRTLIMRRIVLPQAMRIIIPPTGNET
FT                   IGMLKTTSLVTAVPFTLELQFATNAIANRIYKPIPLLLVACFWYLLITSILMVVQSRLE
FT                   AHFGKGFNARPVGTKGKQPPYDPPYPGKSDGEPKDDVNKINQTTFTGLNA"
FT   gene            639430..640260
FT                   /locus_tag="BLJ_0510"
FT   CDS_pept        639430..640260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0510"
FT                   /product="ABC-type polar amino acid transport system ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99986"
FT                   /db_xref="GOA:D6ZSY1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSY1"
FT                   /protein_id="ADG99986.1"
FT                   /translation="MTTNDITNSAPVVRKAADGSVIPAVEAVQVHKAFGPLHVLKGIDL
FT                   TVMPGTVTVILGPSGSGKSTFLRLINQLETLTGGSIEVYGELIGYKHVTKNGQDMLQTL
FT                   DDKEIAAQRSRLGMVFQRFNLFPHMTALENVMEAPIHVQHQSKKAARDLAVAELQRVGL
FT                   GDRMDYYPSQLSGGQQQRVAIARALAMKPEIMLFDEPTSALDPELVGEVLNVMRSLAKE
FT                   GMTMVCVTHEIGFAREVADQIVFMDGGVVVEKGGPDIIDHPTEPRFKDFLQHVL"
FT   gene            640604..642496
FT                   /locus_tag="BLJ_0511"
FT   CDS_pept        640604..642496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0511"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99987"
FT                   /db_xref="GOA:D6ZSY2"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSY2"
FT                   /protein_id="ADG99987.1"
FT                   /translation="MCGIVGYAGNIETACGKPLEVCLQGLERLEYRGYDSAGVALTAPG
FT                   MDKVVVRKKAGRLKNLVEDIERKPMPLATVGIGHTRWATNGEPSDVNAHPHTSMDGKVA
FT                   IIHNGIIENASQLRFDLQAEGYRFASATDTEVAAKLLGKIVDKIIADEGKPDLFKAVRR
FT                   MARMLEGAFTILATDCRQPDIVVGARHDSPLVVGLGEGENFLGSDVAAFVAYTKRAMEV
FT                   DQDQAVCVSADKVIVADFNGNVVENPKTYTVDWDASAAEKGGWDSFMDKEIHEDPAAVQ
FT                   RTLLGRFDTNGDITLDEVRIDEHDFKAIDKIIVVACGTASYAGQVAKYAIEHWVRIPVE
FT                   IELAHEFRYRDPILTPRTLVVAISQSGETMDTLMALRHAREQGSKVLAICNTQGASIPR
FT                   ESDAVLYTHAGPEVAVASTKAFVAQITAAYLLGLYLAQVKGAMFRDEIHQMLDSLKDMP
FT                   RKIQWVLDTQPKTIQAAAERMVNANSFLFLGRHVGYPVALEGALKLKEIAYTFTEGFAA
FT                   GELKHGPIALVDEGEPVVFIVPPQRGRNVLHAKVISGIEEVKARGAYIIAVAEQGDPDV
FT                   ERYADVVFWRPACPTLMSPLVDVVPLQLFAMDMAKLKGYDVDKPRNLAKSVTVE"
FT   gene            642510..643274
FT                   /locus_tag="BLJ_0512"
FT   CDS_pept        642510..643274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0512"
FT                   /product="pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99988"
FT                   /db_xref="GOA:D6ZSY3"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSY3"
FT                   /protein_id="ADG99988.1"
FT                   /translation="MIDEPHIPFEMDVLYEDERIIVVDKPHFLATMPRGMWYRQTALIR
FT                   LRERLGEPDITPAHRLDRMTAGVLVFVRDSACRGAYQMLFQNRQAVKIYECLAPCRPIS
FT                   GPRFGTIMQVEPPRPFPLLRRSHITKEHGTMAAFEEPGLANAETLIERGDLCFPPAGGR
FT                   WREAPEGGPHPGNHPICRYTLHPRTGKTHQLRVHMNSLGLPIVGDDFYPRIQTRPYDDF
FT                   SQPLQLVARVLRFTDPITGEKREFVSRVPLKI"
FT   gene            complement(643319..644617)
FT                   /locus_tag="BLJ_0513"
FT   CDS_pept        complement(643319..644617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0513"
FT                   /product="HipA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99989"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSY4"
FT                   /protein_id="ADG99989.1"
FT                   /translation="MSENTLNAFLGETPIGQFRRTNDGSIIFQYHDSYRWSQSPTPISL
FT                   SMPITAAEYSGDIPRNFLEALVPESPQARDEAMRLHHARSTSAFDLLQAIGFDATGALR
FT                   LSADPHLPIDDDSLIPISDSQIANRLRAAAPTGIQSASVDEHWSVAGQQGKIALRNRNG
FT                   SWFSTTGIARTTHIIKPGIPTLPHQAFNEHITMRIVEAMGIPVAHTSFHIFDGVPAIIS
FT                   ERYDRIVSANGTVTALHQEDFTQALGIPSSLKYEEHNGPTSNAYAEMLRKHGLPGQAES
FT                   NIRAFTDGILASYLVGATDSHAKNYSLLLDGASVRLAPLYDLASVFPYLGHGKQIINAT
FT                   LAMNIGGRRDLLQLRRKHLERFAQRMGLDEESVILRFHTLVDSLPEAFDSTVQPAHDVI
FT                   ASIGAQEFIDSYRKRIMMVYDDAMSWMASRKGQ"
FT   gene            complement(644622..644852)
FT                   /locus_tag="BLJ_0514"
FT   CDS_pept        complement(644622..644852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0514"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99990"
FT                   /db_xref="GOA:D6ZSY5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSY5"
FT                   /protein_id="ADG99990.1"
FT                   /translation="MDIAEYARLIKDERQRQGISQTDMAQRLGVSRRWLIEFEHARVPN
FT                   PGFSTILSALTELGLSLDVRKTPQPAELYEW"
FT   gene            complement(645027..646037)
FT                   /locus_tag="BLJ_0515"
FT   CDS_pept        complement(645027..646037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0515"
FT                   /product="regulatory protein, LacI"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99991"
FT                   /db_xref="GOA:D6ZSY6"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSY6"
FT                   /protein_id="ADG99991.1"
FT                   /translation="MSRPTQVSMQDIAKAAGVSPQTVSRVANGSDAVKPETRQRVEAAM
FT                   KRLGYRPNYAARALKHGRFQDIGVVMFNTATFGNARILDSIVANAADDDYSVTIQTMRH
FT                   GAERTLSAAIDRMQRQPVDGVIVVLEERISDFVGYKPPRELPVVLICESAADHCPTVDA
FT                   DQYGCSTAIVDYLMSKGHKTVYHIAGPSTSRAAESRARGWREALEQMGARVPSMYIGDW
FT                   CADSGYQAGVALAHDPDCTAIYAANDQMAYGAMLGLQSAGKRVPEDVSIVGVDDSLVDM
FT                   VPRLNLTTMKLRFDDIGATAFSMVRRQCEGEKIPVGVKTVIPPELIERGSVRDIS"
FT   gene            646212..647186
FT                   /locus_tag="BLJ_0516"
FT   CDS_pept        646212..647186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0516"
FT                   /product="sugar ABC superfamily ATP binding cassette
FT                   transporter, membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99992"
FT                   /db_xref="GOA:D6ZSY7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSY7"
FT                   /protein_id="ADG99992.1"
FT                   /translation="MITQTFWSTFEGEGLGMASADIAAAPVHSGKARVNKHKADWRGWK
FT                   FMWPFAVVFVFVFIVPIVYAVYISFFKKQMIGGTKFVGFENYARLLGDGQFWSSVGRVA
FT                   LFTCVQVPIMLCLSALMALALDSMKLHGTRFFRISTFLPYAVPAVVSTLIWGFVYGAKY
FT                   GLVGSLNDFLGTDIDVLAPSVLLASIGNIVTWEFTGYNMLIFYSSLSTIPHSLYEAASI
FT                   DGASEWQIVKSIKLPELRGSLAITVIFSIIGSFQLFNEPSILQNMVPGNAITTYYTPNM
FT                   YAYNLSFSGNQSNYAAALAIVMAVITMAIAYIVQLNSLKEQMK"
FT   gene            647245..648252
FT                   /locus_tag="BLJ_0517"
FT   CDS_pept        647245..648252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0517"
FT                   /product="sugar ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99993"
FT                   /db_xref="GOA:D6ZSY8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSY8"
FT                   /protein_id="ADG99993.1"
FT                   /translation="MSAATTSAAGRLTDGELKAREKAARKAEKARQKRIAADEAAERRR
FT                   SAKAGFANVNNPRRSTLLTVLCAVFAVYCLFPFVYLLINATKTQADFTSTFGLGFGKTF
FT                   ALFDNIATVFSYQDGIFARWLFNTILYVVVGAGGATLLAIMGGYALAKFRFPGRKAVFV
FT                   VIIGAISVPGIALAVPQFLLFAKLGLTNTPWAMIIPSLISPFGLYLMWIFSEQAVPQEL
FT                   LEAARVDGASEFRTFWQISLPLLAPGIVTTALFTIVATWNNYFLPLIMLKDADWYPLTI
FT                   GLNQWKDQASTAGGQAIQNLVITGSLITIIPLVIAFLCLQKYWQSGLAAGAVKE"
FT   gene            648252..648383
FT                   /locus_tag="BLJ_0518"
FT   CDS_pept        648252..648383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99994"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSY9"
FT                   /protein_id="ADG99994.1"
FT                   /translation="MESAPPTRCLHRLAAGSLPPSRLRRDNLPHQREVIVPSPPLTS"
FT   gene            648467..650542
FT                   /locus_tag="BLJ_0519"
FT   CDS_pept        648467..650542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0519"
FT                   /product="Beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99995"
FT                   /db_xref="GOA:D6ZSZ0"
FT                   /db_xref="InterPro:IPR003476"
FT                   /db_xref="InterPro:IPR013529"
FT                   /db_xref="InterPro:IPR013738"
FT                   /db_xref="InterPro:IPR013739"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSZ0"
FT                   /protein_id="ADG99995.1"
FT                   /translation="MERKEFKWPQPLAGNKPRIWYGGDYNPDQWPEEVWDEDVALMQQA
FT                   GVNLVSVAIFSWAKLEPEEGVYDFDWLDRVIDKLGKAGIAVDLASGTASPPMWMTQAHP
FT                   EILWVDYRGDVCQPGARQHWRATSPVFLDYALSLCRKMAEHYKDNPYVVSWHVSNEYGC
FT                   HNRFDYSEDAERAFQKWCEKKYGTIDAVNDAWGTAFWAQRMNNFSEIIPPRFIGDGNFM
FT                   NPGKLLDWKRFSSDALLDFYKAERDALLEIAPKPQTTNFMVSAGGAGIDYDKWGYDVDF
FT                   VSNDHYFTPGEAHFDELAYSASLCDGIARKNPWFLMEHSSSAVNWRPINYRVEPGELVR
FT                   DSLAHLAMGSDAICYFQWRQSKAGAEKWHSSMVPHAGPDSQIFRDVCELGADLNKLADE
FT                   GLLSTKLVKSKVAVVFDYESQWATEHTATPTQEVRHWTEPLAWFRALADNGLTADVVPV
FT                   RGPWDEYEAVVLPSLTILSEETTRRVREYVANGGKLFVTYYTGLVDDKDHVWLGGYPGS
FT                   IRDVVGVRVEEFAPMGNDFPGAMDHLDLDNGTVAHDFADVITSVADTAHVVASFKADKW
FT                   TGFDGAPAITVNDFGDGKAAYVGARLGREGLAKSLPVLLEELGIETSAEDDRGEVLRVE
FT                   RADETGENHFVFLFNRTHDVAVVDVEGEPLVASLAQVNESEHTAAIQPNGVLVVKL"
FT   gene            650667..651680
FT                   /locus_tag="BLJ_0520"
FT   CDS_pept        650667..651680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0520"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99996"
FT                   /db_xref="GOA:D6ZSZ1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSZ1"
FT                   /protein_id="ADG99996.1"
FT                   /translation="MADVAHEAGVSVASVSNFLNKQPYMSEAMAARIAEAIDRLGYKVN
FT                   SSARNLRSGRTRLLKLVIPDLRQVYFSELAEDILAEARQHGYGVIVESTTNNRARELES
FT                   IASMGTHSADGLILSPLMMTVDDIAALDGDYPLVLLGERLFGVNAPHVVIRNREGAAAA
FT                   TYHLLDAGCRRIAVVGAVPHPEHDFSSGSIRTHGYREALAARGIPCDDSLLIETQGWGS
FT                   ADGLVAVDTMLESGLQFDAVFALNDLLAWGVLRELRERGVAVPDDVRVIGFDDVEESAY
FT                   MVPSLSTVNPGREAIARLAVESIIQQVESGSRAPAQTIEAPYSLSLRESSPALARA"
FT   gene            complement(651800..653500)
FT                   /gene="abfA2"
FT                   /locus_tag="BLJ_0521"
FT   CDS_pept        complement(651800..653500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abfA2"
FT                   /locus_tag="BLJ_0521"
FT                   /product="alpha-L-arabinofuranosidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99997"
FT                   /db_xref="GOA:D6ZSZ2"
FT                   /db_xref="InterPro:IPR010720"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSZ2"
FT                   /protein_id="ADG99997.1"
FT                   /translation="MTTHNSQYSAETTHPDKQESSPAPTAAGTTASNVSTTGNATTPDA
FT                   SIALNADATPVADVPPRLFGSFVEHLGRCVYGGIYEPSHPTADENGFRQDVLDLVKELG
FT                   VTCVRYPGGNFVSNYNWEDGIGPRENRPVRRDLAWHCTETNEMGIDDFYRWSQKAGTEI
FT                   MLAVNMGTRGLKAALDELEYVNGAPGTAWADQRVANGIEEPMDIKMWCIGNEMDGPWQV
FT                   GHMSPEEYAGAVDKVAHAMKLAESGLELVACGSSGAYMPTFGTWEKTVLTKAYENLDFV
FT                   SCHAYYFDRGHKTRTAASMQDFLASSEDMTKFIATVSDAADQAREANNGTKDIALSFDE
FT                   WGVWYSDKWNEQEDQWKAEAAQGLHHEPWPKSPHLLEDIYTAADAVVEGSLMITLLKHC
FT                   DRVRSASRAQLVNVIAPIMAEEHGPAWRQTTFYPFAEAALHARGQAYAPAISSPTIHTE
FT                   AYGDVPAIDAVVTWDEQARTGLLLAVNRDANTPHTLTIDLSGLPGLPGLGTLALSKAQL
FT                   LHEDDPYRTNTAEAPEAVTPQPLDIAMNATGTCTATLPAISWISVEFHG"
FT   gene            653660..655012
FT                   /locus_tag="BLJ_0522"
FT   CDS_pept        653660..655012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0522"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99998"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSZ3"
FT                   /protein_id="ADG99998.1"
FT                   /translation="MKFGKKTIALIGAVAMLSSVAACGSTSAGDSGSTGSSDKKIELTV
FT                   WSWDSTLPRTVKGFEAKNPNIKVKVTNAGTNKDEYNALSNAIEAGSGAPDIAQIEYYAL
FT                   PEYVIRGHLENLSDLGASDFKDFYTPGTWSSVSINDGVYALPMDSGPMAWFYNKDVFDK
FT                   AGVDPTQVRTWDDFYEAAKKIRAVDSYITSDSGDAGFFDSMTWLAGATPFETSKDGETV
FT                   TINLTGDKNVKTFTDFWQKMIDEDLIDTKTVGWTDDWNKGLDDGSIASLLTGAWMPYNL
FT                   LSGAPNGDGKWRIAQMPTADGSETNSENGGSSLAIVKSDDKAKVAAAYKFMEYACHDAE
FT                   GIKTRVDGGAFPADNDTLKSNDFLNMTSLTDSDGKAHEYFGGQKFNEELAKAAANVSTG
FT                   YKFLPFEVYARGKFGDYAGDAYTGKTTLSDAVASWQKDLQDYAKQQGYQVK"
FT   gene            655344..656687
FT                   /locus_tag="BLJ_0523"
FT   CDS_pept        655344..656687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0523"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADG99999"
FT                   /db_xref="GOA:D6ZSZ4"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSZ4"
FT                   /protein_id="ADG99999.1"
FT                   /translation="MKFTVAKKAIALTGAVAMLGSVAACGSDTASGKPAQDKDVTEITV
FT                   WAWEPTLTQVAKDFTKKTGIKVDLKNVGTNTKEYTQLDNAIEAGSGAPDVAQVEYYAIP
FT                   QYAIKGNLLDITDKTSGYSDFYTPGPWASVQFAGKVYGLPMDSGPMAFFYNKEVFDKAG
FT                   VDAEQIKTWDQYYDAAKKIHALGDNYYITSDTGDAGFFDSMTWLAGAKPFQTSSDGSEV
FT                   TVNLTEDKGVKTFTDFWQKLLDEGLLDTKTAGWSEDWFKGMVDGTIASLFTGAWMPANL
FT                   ANSAADGAGKWRVTQMPTADGSTTNSENGGSSLAVLASTKKADAAYQFIEYANHGDGVA
FT                   TRVAGGAFPADKASMESDSFKNTTTVKNADGEDVDYFGGQKYNEVLAQAAENVSSDYQF
FT                   LPYEVKARTIFGDYLGKSYTGDQKLTDGIAAWQKALQDYGKDQGFTVK"
FT   gene            656833..658224
FT                   /locus_tag="BLJ_0524"
FT   CDS_pept        656833..658224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0524"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00001"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSZ5"
FT                   /protein_id="ADH00001.1"
FT                   /translation="MATIAVTAILSVSLASCGQATDDNRTEISVWSWEPSMGEVIRRFE
FT                   KANPDIRVKWTNISGYGNLNTAIQDGYGTPDVAQIEYYALLQYAVSGQLLDLTDKIGSD
FT                   YSNFFTLGTWSSVQLAGRTYGLPMDSGPMGFFYNEDVFRQAGVDATKIKTWDDYYEAAE
FT                   KLKEIGAYIAADSGDGSFYDAMVWLAGGQPFHTSADGKTVTIDLDEDAGTQRFTEFWQK
FT                   MIDEGLVDTTSATWSDRWKSRVGTGTIASVFSGAWMPSLLLSNVPGAAGLWRVAPMPTY
FT                   GGQPANAENGGSALTVLQLTRKPDAAYRFVDFVAHDAQGISARVDGGAFPADYATLNSA
FT                   DFLDKTTITNDRGIEIPYFGGQKFNRVLSEAAEDVSVGYQYLPFEVYARSDFKSTVGQA
FT                   YEWSGSFHAYQQRQEAIEMGMKDEEGNPLEPLEKPGKKVSLSDGLAQWQKDLREYGLNQ
FT                   GFTIK"
FT   gene            complement(658296..659063)
FT                   /locus_tag="BLJ_0525"
FT   CDS_pept        complement(658296..659063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0525"
FT                   /product="putative transcriptional acitvator, Baf family"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00002"
FT                   /db_xref="GOA:D6ZSZ6"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSZ6"
FT                   /protein_id="ADH00002.1"
FT                   /translation="MLMAVDIGNTNIVIGFLEGDRIVGSYRITTKATHTSDEYGLMITQ
FT                   FLALSDYTADDVDDVIVCSVVPKVMYSFRASLIKFLGLEPMVVGPGVKTGMNIRLDDPK
FT                   TLGSDCIADCAGAYHTYGGPVLVADFGTATTFNYVDGSGTIRSGFITTGIRTGAEALWG
FT                   QTAQLPEVEITQPQSILATNTRTAMQAGLYYTFLGGIERTIQQFRKEIDEPFQVVATGG
FT                   LSRIFKNDTDMIDVYDSDLIFKGMAYIYSRNVK"
FT   gene            complement(659067..660380)
FT                   /locus_tag="BLJ_0526"
FT   CDS_pept        complement(659067..660380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0526"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00003"
FT                   /db_xref="GOA:D6ZSZ7"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSZ7"
FT                   /protein_id="ADH00003.1"
FT                   /translation="MAHILLGVTGSIAAFKACHLASDWTKAGHEVRVIETTAAEGFVTP
FT                   LTFTSLTHQPTRTTMFPAYPAAHGDVTANPTVPTTINHVADAAWANLLVVAPASADVIA
FT                   RIACGLANDTLTSTILAYEGPKILCPAMNVHMYNNPATQRNLKTCAELGWQIVEPEEGN
FT                   LACGDVGRGRMEEPARIEEVAARLLADAQDDQAPSSSPLKGLRVLVTAGPTQEPLDPVR
FT                   YLTNHSTGKMGYAIASAAAEFGADVTLVSGPVALTAPDAVDVVRVTTAQDMFDAVADAF
FT                   PAADITIMAAAVGDFRVAEIAPEKIKKAGRSSITVELVSNPDILAWAGERKRDDGSQIL
FT                   CGFAMETEHLIRNAEKKLTSKHCDMLVANNLRDAGAGFGTDTNVVTVLTSGAEDAGTPK
FT                   IEHWDKMDKTVLAQRLLLRLAALRSGGASNVDDENKEA"
FT   gene            660637..662304
FT                   /locus_tag="BLJ_0527"
FT   CDS_pept        660637..662304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0527"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00004"
FT                   /db_xref="GOA:D6ZSZ8"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSZ8"
FT                   /protein_id="ADH00004.1"
FT                   /translation="MSQNNGVHGESGATEDRNTSGADQAASTDASLNARAKSSNKKNGG
FT                   PKWWLWTLIAVVVAAALIVGVTVFGGKGKGKDANASGSASRSDTVAVGLKLAPVNLDIR
FT                   HQSGSALEQILIGNVYEGLVSRGSDNKVHPGLAKSWEISKDGLTYTFHLNEKMNFSNGD
FT                   KLDAEDVAWSINELKAQKYYDYEQVKSLDKAEAVDANTVRLTLSAPNSNMLWYLTSRPG
FT                   LVYDKDATWDQKNGALGSGPYTVVSFDPNDKIVLKANPKYWGTEHKARTENVIVRFLPD
FT                   ENASINALKSGDVQVLSSIIPATLAEPFRKDPNYVVKVGGGSDKFVLAFNMANDKLSDK
FT                   RVRQAIRYAIDHKQIIASRGGVDAPLGGPIPEMDPGYEDLSGLYPHDVAKAKKLMEQAG
FT                   YSESKPLDLTLTYANVYGTELGDQLKSQLKPIGIDLKINYVEFSTWLQDVHANGNYDLS
FT                   LVDHAESHDFYGWTTPSYYFHYDNKDVQALYAKALEATSDDEASKYLAKAAKIVSEDAP
FT                   ADWLFSLKVTIAYAKGVNGVPQDFIQTVLPLWRITYTK"
FT   gene            662425..663390
FT                   /locus_tag="BLJ_0528"
FT   CDS_pept        662425..663390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0528"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00005"
FT                   /db_xref="GOA:D6ZSZ9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZSZ9"
FT                   /protein_id="ADH00005.1"
FT                   /translation="MRFLMQRLLLFAAALFGISVLVFAMLRILPGDVAVVMAGMNASPA
FT                   RVAALRAEFGLDRPYVVQYLDWAGGLLHGDLGVSALTGRAVTSQVGQRATITFPLIVMS
FT                   LVIALTLGLSMGAAAVISRSPAVRGFLRVLSIVGGAVPALWSGLLLILLFARGVGLVGL
FT                   LPSQGFPAAGWGAPGRAVSSLILPALATGFVSGAGIMRYTRSILEGIADEGGPIDMAMS
FT                   CGMIRTQALLRVGLRLAAPQLVSVVGLAFASMITGVMVVENLFALPGLGALLVGDVGNR
FT                   DLVAVQSELFLLAAFFLLIGLAVDLLHALLDPRLAAGKEE"
FT   gene            663390..664361
FT                   /locus_tag="BLJ_0529"
FT   CDS_pept        663390..664361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0529"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00006"
FT                   /db_xref="GOA:D6ZT00"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT00"
FT                   /protein_id="ADH00006.1"
FT                   /translation="MVDRNGRWRRSGVVLGTIWSRGTGRYSLIVLGSWMVVALVSLFWT
FT                   PQSLLATDGYHVWDKPSSAHWLGTDGTGADVLSWLMAGSRTNLAIALLTVVCSAAIGIL
FT                   LVGLMVARSSALASASVAVVDALISIPTVLIALLLAVPFGASAAVVIGACSIGYGLHLA
FT                   RVARPAALLAARSGYVQSARANGASGFGVLVRHIVPNITPVLMVQSSMSAGTSVLAEAG
FT                   LTYLGVGVGAGVPSWGHSLATSVKLINVFPLTVVWPGLIVTLAVVALNLFGDALRDATD
FT                   PVANPALRQMTVPGAVVPVARGAGDTAAQSAVAAPKETDDER"
FT   gene            664348..665274
FT                   /locus_tag="BLJ_0530"
FT   CDS_pept        664348..665274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0530"
FT                   /product="peptide ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00007"
FT                   /db_xref="GOA:D6ZT01"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT01"
FT                   /protein_id="ADH00007.1"
FT                   /translation="MMSVEIHGLNIAIGGKPIVTDVDLSIADGERVGLIGSSGSGKSMI
FT                   AKSLLGLLPREAVLSGTITMGETAILSGETAESRHGQEDDSGSDEERGAADRHHVAGER
FT                   RVATSGHDSAAYADEHTLADLRGRYVGTVFQNPAHALNPVMTVAQQIALPLRLHYDLTK
FT                   AERAERVNTMLDKVGLDRDVAGTYPHELSGGQQQRVGIATALITSPRFIIADEPTTALD
FT                   SITQRQIVDLLTSLVDDAGASMLFITHDFSVLARATTRCYVLDAGRVVESGPTADLLAA
FT                   PTTPQAQRLVAAAQTLTLHTPKEDSHE"
FT   gene            665267..666052
FT                   /locus_tag="BLJ_0531"
FT   CDS_pept        665267..666052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0531"
FT                   /product="peptide ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00008"
FT                   /db_xref="GOA:D6ZT02"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT02"
FT                   /protein_id="ADH00008.1"
FT                   /translation="MSNSSVPLLSAHSISKSFGPRTARHQVLFDVSADVHAGECLAVIG
FT                   GSGSGKSTLTRIMLGLESADSGSVEYESQSIVGGRKSPGFATLRRESGLVFQDPFSSLD
FT                   PRWQVAKSVAEPLSLQRRDLNNTDIDERVVAALTMAGLEPADFLNRYPIDLSGGQAQRV
FT                   VIARAIINEPKVILADEPMSAIDVAARIQILDAFAAIREARPSTAIIMVSHDLGVVQHI
FT                   ANRVLVLHDGRVEETGPTAEVLGNPQSDYTRQLIEAASL"
FT   gene            666534..667601
FT                   /locus_tag="BLJ_0532"
FT   CDS_pept        666534..667601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0532"
FT                   /product="cystathionine beta-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00009"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT03"
FT                   /protein_id="ADH00009.1"
FT                   /translation="MTIHNSLAELIGNTPLVKLNHIPQAAGVKATIAVKVEYFNPGGSS
FT                   KDRIAERIIDAAEQSGQLKPGGVIVEPTSGNTGVGLALVAQQRGYRTIFTLPDKVSESK
FT                   RAVLRAYGAEVIVTPTDAGPDDPRSYYQVAERLANTIPGGFRPNQYDNPNGPLSHYYTT
FT                   GPEIWEATDHKVTHFVAGIGTGGTISGTGKYLKEASNGAVKVIGSDPEGSIYSASSRDE
FT                   VHQYDIEGVGEDFYPKAFDRNITDDIVRVSDAEAFEMTRRLAGEEALLVGGSSGMAVAS
FT                   AIKYALANDLDENQIVVVLAPDSGRSYLEKIFNDDWMRANGYGDIVERTSKPSLAEQYL
FT                   NGTPSDEGAADGLHN"
FT   gene            667585..668877
FT                   /locus_tag="BLJ_0533"
FT   CDS_pept        667585..668877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0533"
FT                   /product="cystathionine gamma-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00010"
FT                   /db_xref="GOA:D6ZT04"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT04"
FT                   /protein_id="ADH00010.1"
FT                   /translation="MDSITSCQKNQYQYPHWPTAPVLPSNTEQSRKEPNIMSAEYNAKF
FT                   ANTDIATRAIHAGQEPDPTTGAVVTPIFATSTFKQDGVLGLRGGHDYSRSINPTRTSFD
FT                   EQLAAVEGGKYALSFSSGLAAIDVLLRSTIKPGDNILLGNDVYGGTYRLLSKVFVPWDV
FT                   GLDVVDITDLKAVETALASKHYQYVWVETPSNPLLNITDIAATAEVAHKYGTKVAVDNT
FT                   FASPALQHPLADGADVVVYSTTKYIGGHSDVVGGAVVVNDEETREKVAFLQNAAGAVPS
FT                   PFDSWLDIRGLKTLDLRVKRHSANALKVAEWLESQPSDVIERVWYPGLESHPAHEIAAR
FT                   QMHGGFGGIVSVQLAAGAEAAKHFVDHTQIFTLAESLGGVESLIEVPAAMTHASVAGTT
FT                   LQVPANLVRISVGIENADDLIADLKQALDRI"
FT   gene            complement(669011..670735)
FT                   /locus_tag="BLJ_0534"
FT   CDS_pept        complement(669011..670735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0534"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00011"
FT                   /db_xref="GOA:D6ZT05"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT05"
FT                   /protein_id="ADH00011.1"
FT                   /translation="MANDTFSFSSPDDQETAVLQPVAADGLFAAAATGTATPQQSDNGT
FT                   NNHADNTAYVGEHVMASTTAKSHGKAARIAIITIFAVLLAALIAYFFVGRWYFQDKAAP
FT                   GVHLGNVSVMGQTREELANTVKQQLNNTTVTFTAEGNSVKASLKDLGVTVDTDKTVDAL
FT                   LNAKTGDVAKLNIFDQPHIALTATRDKETAEQFVTAGLVDEADRAQIATVVYNKSTKQF
FT                   DYTAGQDGKGPDINVVNAAVKEAVTTPGENATVPVKLQTAKNPIDEASAQQTQFDANAK
FT                   LGLKLTVDNGVNKSVTIPADTIASFLKPTVNKADGTMSLVVDRDAITKYVTSDSVTKEL
FT                   TVPKVTREVYITPKNEGGVEIGADKTLGVDGIEVTGAGDAPERLATAIEQNQSTDSTVA
FT                   VKDSPYDVKQVEVPHNFDTANGDKWVHVDLTNQTATAYQGTTVVRKFNIASGKPTADGS
FT                   MLSDTGTFYVYLKYESQTMVGEGYNQPGTPWISYYNGGEALHGVPAYMWGEHPIYVQQG
FT                   IPGSHGCINMQVADAKWMYDFATIGTRVVVDGTTPTSGQALRPAGADATGWQGGNAS"
FT   gene            670894..672846
FT                   /locus_tag="BLJ_0535"
FT   CDS_pept        670894..672846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0535"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00012"
FT                   /db_xref="GOA:D6ZT06"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT06"
FT                   /protein_id="ADH00012.1"
FT                   /translation="MTAHQAALEALTRYFGYDSFRPGQQGIVEALLAGRDVLGVMPTGA
FT                   GKSVCYQIPAALSPGATLVISPLISLMRDQVDALNDLGLPAAFINTTQTPDEQAMVFAQ
FT                   AAAGQIKLLYVAPERLETGRFRDFAARTPISLIAVDEAHCVSQWGQDFRSSYLGIGDFI
FT                   AGLPQRPPVGAFTATATERVRRDIVGLLGLRNPAVTVTGFDRPNLYFDVVKLETKYKAA
FT                   WVARYVADHPDESGIVYCATRKTTEALADTLNQMGHPAVAYHGGMSPDAREAAQRDFIT
FT                   DKVPVVVATNAFGMGIDKSNVRYVIHHNLPESIEAYYQEAGRAGRDGEPSRCTLLWNET
FT                   DIVTRRRLLDNDYENERLTPEEQEIVRQSKRRLLDGMVGYCRTTDCLHRYMTRYFGQEL
FT                   SPNAGSAAGEDIAADSSQSGRCGACSNCESTFETIDVTRVAQAISRCVHDVGQRVGSGK
FT                   IVKILRGSRAQDLAWLNPERMPTFGMLKDVNEARVRDVLSQMATDGYLSIAEGRMPIVM
FT                   FGARAAETAAPDFHYEIKRVERKSAAAGSGRSGGVADTADSANVPGALGSYIPDDDEES
FT                   LFQKLRELRRTIAQEIGKPPYIVFSDKTLRDMARIKPVTNAQFLAVNGVGQHKLDLYGQ
FT                   RFMQTIASFNAGSAS"
FT   gene            672959..673453
FT                   /locus_tag="BLJ_0536"
FT   CDS_pept        672959..673453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0536"
FT                   /product="quorum-sensing autoinducer 2 (AI-2), LuxS"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00013"
FT                   /db_xref="GOA:D6ZT07"
FT                   /db_xref="InterPro:IPR003815"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR037005"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT07"
FT                   /protein_id="ADH00013.1"
FT                   /translation="MAEDKAEKPVVESFQLDHTKVKAPYVRYIDTETGPHGDVISNYDL
FT                   RLTQPNEQAIPTGGLHTIEHTIAVLLRERIPGYIDCSPFGCRTGFHLLTWGTHSTEDVA
FT                   KALKESLEFIAYKATWDDVPATTEKSCGNYRDHSLFAAKEWAKQILEEGISSDPFERKV
FT                   V"
FT   gene            673695..674237
FT                   /locus_tag="BLJ_0537"
FT   CDS_pept        673695..674237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00014"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT08"
FT                   /protein_id="ADH00014.1"
FT                   /translation="MTQSNAANKATGRRFRHATMRDLPQMHKIYARARALMAANGNPTQ
FT                   WGNEFPRESVIEDDIANQRTMLLVDTCNGHERILAQFALCPGKDPTYAKIDGAWLDNDT
FT                   YVTIHRIAASGLVRHAARDCIRWALKHYGNVRADTHPNNKAMQHVLESSGFARCGLIQL
FT                   LDRPVDTTRIAYQRHEW"
FT   gene            complement(674425..675885)
FT                   /locus_tag="BLJ_0538"
FT   CDS_pept        complement(674425..675885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0538"
FT                   /product="amino acid permease-associated region"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00015"
FT                   /db_xref="GOA:D6ZT09"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT09"
FT                   /protein_id="ADH00015.1"
FT                   /translation="MDLFRKKSVDQLVAESTPLKRTMRTFDLTMLGIGAIIGTGIFVLT
FT                   GKGALTAGPALSVSFLLAAVCCGFAGLCYAEFAAMAPVSGSAYSYAYLAFGELIAFVIG
FT                   WDLILEYALQAATVSAGWSGYFNKLLEGFGLHLPVELTAAYGTNPDVTTYFNLPGFVIV
FT                   LIITWVLSIGINQTKRTNDVMVLIKLAIIVLFIVCAVWYVKPSNWQPFSPYGIYTFQPG
FT                   STQPYGIVPAASIVFFSFIGFDAVSSSAEETINPNKTLPRGILLSLAVSTVLYIVMTMI
FT                   MTGVVPYKEFAKYIDAPVAGVILETGMNWLAVIVNLGALIGMTTVMLVQLYGQSRICYA
FT                   MSRDGLFPKFFGHVHEKYRTPFKGTWFFGLLTAFAGGFININVLFELVNIGTLSAFIIV
FT                   SAGILWMRKTQPNAPRGFRAPGVPVTPILAIVFCFVLIAGLNWETWVRFAIWFGLGLIV
FT                   YFGYSRKRSKLGLEQKAGADTKVAATED"
FT   gene            676073..677431
FT                   /locus_tag="BLJ_0539"
FT   CDS_pept        676073..677431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0539"
FT                   /product="alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00016"
FT                   /db_xref="GOA:D6ZT10"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT10"
FT                   /protein_id="ADH00016.1"
FT                   /translation="MSMNAAPEIAFSSEQGKANYAAARRQYPAQAIVNLETMRDNMAHL
FT                   VSVVGGPNSGTAVMGVVKADAYGHGLLPAALAALAGGATWLGTAQSHEALLLRKLGIGP
FT                   DRCRILTWVYNGTEVPFDELIAADIDVSVGSLPGIDAVAAAARKLGKPARVHVKVDSGF
FT                   GRNGFTPAGFDAALAKLVPLAKEGVLHIVGQWSHLAVADSPDVPEFVSSTDRQIETFKD
FT                   FTRRMEQAGIPPEIRHLANTAATLDRPEIHFELTRPGIGLYGYEPDPAMGTPRDWHLTP
FT                   AMRLQAQLGTVKDVEAGHGISYGRTYLTPDNTSTAIVPLGYADGIHRSASGFDMEGAKH
FT                   VEKPGGPLRIMTTEGPKLYRVCGRVCMDQFIVDLHGSAAELGVHEGDTVELFGPGRGED
FT                   YVEPTADDWARAADTISYEIFTCLRNRIPRLYEHAAEVLPAADLAKLDPATLL"
FT   gene            677651..678910
FT                   /locus_tag="BLJ_0540"
FT   CDS_pept        677651..678910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0540"
FT                   /product="putative deoxyguanosinetriphosphate
FT                   triphosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00017"
FT                   /db_xref="GOA:D6ZT11"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT11"
FT                   /protein_id="ADH00017.1"
FT                   /translation="MLSDEGYSAFDEERWAPEPPKSKSRTAFERDRARLIHSSALRRLG
FT                   AKSQILIAGTDDFARTRLTHTLEVAQIGRQIGALLGCDPDVVDCACLAHDLGHPPFGHN
FT                   GERALADIASNIGGFEGNAQTMRILTRLEPKIFHPDGRSAGVNLTRAALDAAVKYPWTL
FT                   AEADRHPKGERSKKFCVYPDDEPVFRWLKIGAPRAAKPMECQIMDLADDIAYSVHDVED
FT                   SIATGAFDPIVLADPKMLDHIIEQTRAWYGAKWDADKLLAAFMRLRREHLFPAHFNGSR
FT                   ESLAQLKNITSDLIGRFCWSVETATRDTYGPGPLTRYSSNIVIPENTNYEIVALKGIAV
FT                   YFVMAPREREPFHQEELKIVSDLVDVLMADSPLPSDALESQFLADWNESTNDNERLRVA
FT                   IDQVASLTDNSALALHSILC"
FT   gene            679074..681173
FT                   /gene="dnaG"
FT                   /locus_tag="BLJ_0541"
FT   CDS_pept        679074..681173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaG"
FT                   /locus_tag="BLJ_0541"
FT                   /product="DNA primase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00018"
FT                   /db_xref="GOA:D6ZT12"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT12"
FT                   /protein_id="ADH00018.1"
FT                   /translation="MVGMIRKEDVEKVRAAADLYDIVSATVTLKPSGTGTFVGLCPFHD
FT                   EKTGSFNVRPSLGVWHCFGCGLGGDVFKYVEQSENIDFREAVELLADKYHIELHYENSG
FT                   NGPNRENTGSKRTRLLEACEEAQRFFVSQILTKEALPARKLLGGRNFSQADCERFGCGY
FT                   APQGWDNLVRHLASKGFTQKEILDAGLARQGQRGIYDYFRGRVTWPIRDSTGRTLGFGA
FT                   RKLYEDDQIAAKYINTPDTQLYRKTQVLYGIDLAKSAIVKKRQVVIVEGYTDVMAMHLA
FT                   GIDTAIATCGTAFGTEHAKIVRRLIADDSLGAVQLVGPLKVKDQPLSSRIVFTFDGDAA
FT                   GQKAALHAFGLDSAFLSQTFVAVADDNLDPCDLRIERGNEAVRSLIARAKPLYDFVIDA
FT                   AISRFDLTYTPGQVGAMKAVAPLVAQIRDRSLWDAYARKSAGRIGVDLEVMRREVMNAR
FT                   RQMHVRDEDAYAPKRRFERDEPRVEPGTNPYANPASRKALERRDVVEQAYFKIDDAVFI
FT                   AEQQFMAVLIQVPRAIDRTMFGQLTIEHFMTSVFRTLFQAIAAAGGLPSDDTPQGLWMH
FT                   NLTKAGGPMLNQVINELAVMPLPLPGDDGGNGAQPPQSNVPGGVGGGAAAVQLRPATPE
FT                   EQRYATELLTRLLDMGFMRQIGLAKRRMAQLPDGEEKITLLGQITRMETARKDLQAQIY
FT                   GNTVG"
FT   gene            681363..682238
FT                   /locus_tag="BLJ_0542"
FT   CDS_pept        681363..682238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0542"
FT                   /product="pyridoxine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00019"
FT                   /db_xref="GOA:D6ZT13"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT13"
FT                   /protein_id="ADH00019.1"
FT                   /translation="MTQNRAELNRNLAQMLKAGVIMDVTTPEQAKIAQDAGACAVMALE
FT                   RIPADIRAAGGVSRMSDPAMIKGIQEAVSIPVMAKVRIGHIAEARILQAIDIDYIDESE
FT                   VLSPADDVYHIDKNQFDVPFVCGAKNLGEALRRIAEGAAMIRTKGEPGTGDVIQAVRHM
FT                   RTMNKQIRELVALRDDEVYEAAKQLAVPYDLAKYVHDNGRLPVVNFAAGGVATPADAAL
FT                   MMELGAEGVFVGSGIFKSGDPAKRAAAIVKATANWQDADLLAKLSENLGEAMVGINEDE
FT                   IQTIMAARGE"
FT   gene            682324..682962
FT                   /locus_tag="BLJ_0543"
FT   CDS_pept        682324..682962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0543"
FT                   /product="SNO glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00020"
FT                   /db_xref="GOA:D6ZT14"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT14"
FT                   /protein_id="ADH00020.1"
FT                   /translation="MVVAVEYISKEESADVENVKHGVTGILAVQGAFAEHAAVLDKLGA
FT                   PWKLLRAAEDFDESIDRVILPGGESTTQGKLLHSTGLFEPIAAHIKAGKPVFGTCAGMI
FT                   LLAKKLDNDDNVYFGALDAVVRRNAYGRQLGSFQATADFGAADDPQRITDFPLVFIRGP
FT                   YVVSVGPEATVETEVDGHVVGLRQGNILATAFHPELTDDTRIHELFLSL"
FT   gene            683020..684684
FT                   /locus_tag="BLJ_0544"
FT   CDS_pept        683020..684684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0544"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00021"
FT                   /db_xref="GOA:D6ZT15"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT15"
FT                   /protein_id="ADH00021.1"
FT                   /translation="MQLELNRRSKVPMYRQLAAELREQIVSGAMAEGYRLPPERELSSR
FT                   LEVNRTTVLQAYQQLKDEGLIASKVGKGTFVLPAASASRTPHTSNSDFGNAITRTTRSS
FT                   AEMGTSQASSSGDVERATSTDFLTTDQGSSSAAVHTIRESRSVQGPEPTVVRPPWSVLF
FT                   SDYSNRFTYHDIASAERAQRGDTIIDFATGSPNPADIPDDLLRKVSIEAFESREFDGQP
FT                   ESPIEGFEELRALLAEHMRTRGVQCGVRNMMVLSGSEQGIDLIVRAFINPGDCVLVEQS
FT                   TFFPALQTFRSADARIIGVPVDEHGMRTDLLDGYCARFRPKLIYTVPTFQNPTGTTLPP
FT                   ERRSELIDVARRYQCLIVEDDAYGDLWYGGESSDAHRPIPLKGMENAGYVMYLSTFSKT
FT                   VTSGLRTGWVVADPHVINRLAALRRMVDQHTSTSSQRICLELLKEGRVAEHLRGLIKAY
FT                   RIRRDAAIAALERYAPDEVYWTVPAGGYYIWVSLPDGVRSLDVLESCRSQGVTFMPGSV
FT                   FDVDEMDDSHIRLNFVRPDAADIDTGIRIIGETIAQM"
FT   gene            685038..685970
FT                   /locus_tag="BLJ_0545"
FT   CDS_pept        685038..685970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0545"
FT                   /product="Asparaginase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00022"
FT                   /db_xref="GOA:D6ZT16"
FT                   /db_xref="InterPro:IPR000246"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT16"
FT                   /protein_id="ADH00022.1"
FT                   /translation="MTTSSVSPVTTELAGSETGITFIIHAGAGSRGKHSTPERIAQVEL
FT                   DLQRALDAGYQLLESGAPAHEAVVAAIHVMEDAPEFNAGRGAALTSDGIAQMDACLMTG
FT                   DGEVGAVTGVSTVKNPIDAARAVKEQTKHVLFADPTDAEIADWGVATESNEYFITEQRR
FT                   QSLAEAQSGGDEWEKHGTIGAVARDAEGNIAAGTSTGGITNQMHGRVGDSPLPGCGTFA
FT                   NQSTVAVSCTGIGEAFIKVVAAHQVSDRVRFAGENVEDAATATLDEVAAHHGDGGMIVL
FT                   PAVGRGVVAYNSEMMNFGYRSAQGGKVQG"
FT   gene            686001..686135
FT                   /locus_tag="BLJ_0546"
FT   CDS_pept        686001..686135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00023"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT17"
FT                   /protein_id="ADH00023.1"
FT                   /translation="MAGVLRILGKESAAHRPFMYAASAADQCGSARYLVIVLYVGMFV"
FT   gene            complement(686096..686218)
FT                   /locus_tag="BLJ_0547"
FT   CDS_pept        complement(686096..686218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00024"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT18"
FT                   /protein_id="ADH00024.1"
FT                   /translation="MKLRITPVFPVKRFAAVSAQNVKNVQFDYTNMPTYNTITK"
FT   gene            686520..687707
FT                   /locus_tag="BLJ_0548"
FT   CDS_pept        686520..687707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0548"
FT                   /product="Di-and tricarboxylate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00025"
FT                   /db_xref="GOA:D6ZT19"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT19"
FT                   /protein_id="ADH00025.1"
FT                   /translation="MRRWLINVAKNETILIVAAILALISCFIVPPDADYKSYIHASTIS
FT                   QLICLMIVVCGFQRIGVFRIIGSRLLEKVSTMRGLVITLVALTFFSAMFITNDVALVTF
FT                   VPFAVAVLIMAGQEDKTILVVTLMTIGANVGSMLTPIGNAHNLYLKALTGMPTMEFLGI
FT                   MAPYSGTAAVLLVIVISVVFGGKPVGDLGDLETGVLAPERNKHQPDEIRITGYGAGYGG
FT                   WRTIVYSLLFIVCLLAVSDVIPLWVMCVIVVVVFLFTDRRVFKYVDWGLPLTFCMFFIF
FT                   IGNMKRVPEFYELARSLVGGHPLEVAVGSSQVISNVPTTILLSGFCDQWRDLIIGTNLG
FT                   GMGTLIASMASLISYKNVVRQYPHKKGRYLAVYSAVNVLFLAVLLTLSWIIEPSL"
FT   gene            complement(687732..687992)
FT                   /locus_tag="BLJ_0549"
FT   CDS_pept        complement(687732..687992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00026"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT20"
FT                   /protein_id="ADH00026.1"
FT                   /translation="MFINLFRRQRPALARLARNSNAYRQPMVAAVSSSAVGVSSITSAS
FT                   TTANTDGVSGVSTLDATIGRIHDIPQSAMSRLTGSPTVYAR"
FT   gene            complement(688173..690428)
FT                   /locus_tag="BLJ_0550"
FT   CDS_pept        complement(688173..690428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0550"
FT                   /product="alpha-L-arabinofuranosidase A-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00027"
FT                   /db_xref="GOA:D6ZT21"
FT                   /db_xref="InterPro:IPR010720"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT21"
FT                   /protein_id="ADH00027.1"
FT                   /translation="MVRISVGSPTHHTSGRLYGVFFEDINHGADGGLNANMVNNYSFDG
FT                   VYLDHHTWRMAGAERWRTQADSLRFWDFINCSAASLGSEIRGIHGQRVTTDCPAPPIHA
FT                   HSRYARITSDVPSETGPAYLENLGYNGGGDNGGEPAFSIVADHTYSVSLAVRPVHGRAK
FT                   LSVGVVDRYGLPLTSTTRLSYIVDADPLDDTEETGLRQDDSANAQDSGVSISPDSSDGA
FT                   IAIGRDGWYRFNANVTGLNTDYGKLRITIDAGERTTFDLDLVQFMDADYWGAGDPRWRY
FT                   GKLRRDLVETIQALHPAFLRFPGGCIVEGVTPGNEYRWKDTVGSLAARRQQYSMWSFKM
FT                   PDGSSYSQSYQIGFYEYFCLCEDLKAKPLPTLFAGIACQSPGRDPRHMDINSATFRNNV
FT                   IQDYLDLIEFANGDPESSSWAAVRRDMGHPEPFGLDMIGVGNENFGADYVAKFDMISEA
FT                   IHERYPDMLCVMSAGLFPFQPTMKRSWDHARALAATDSGAHDSATGDAIIVDEHSYHSP
FT                   EWFAYQASRFDAYPRCGAGVYFGEYSANGYFAGQPQTEQGANTWKSALGEAAFLTGCER
FT                   NSDVVRMTSYAPLLAHIPAKGWAQNLIELNPAHVNPTVNYEVERLFSTHLGDTTYAVSI
FT                   EQTASRPAKHLYVSATGHDGDDACRYIKIVNTSDSPVDVTLEIARGLAGLGASPSRPVR
FT                   LEVTTLSASPTAKTTIGYRGEASGAIVPERRAYTLPSPSSLLAMKIKPYSVTLVASR"
FT   gene            690448..691449
FT                   /locus_tag="BLJ_0551"
FT   CDS_pept        690448..691449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0551"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00028"
FT                   /db_xref="GOA:D6ZT22"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT22"
FT                   /protein_id="ADH00028.1"
FT                   /translation="MERKGKRKSSLTVHVAVNPSRLFAGIQPVPSKQEWKIRTTRSAAV
FT                   QSSVGIRERIDHVYPSLRPAERAVAQYIRDHIEEAADLTVGQMADIAHVSQPTVIRFAR
FT                   KLGFGGYRELRYVLRHPAAEHKVTFNPLAGFDLNPWDGEDEIPGKAAYGAKALIDELHS
FT                   ALDPKAYRKAVALLAESEFIDIFGVENSLTPAMDLFTKLGYLGLTCRLNTDAYLQQIGA
FT                   GHLPHGAVAVAFSHSGSSADTVKALRLAKSHGAKTIAITNAIGAPLASWADVTLLTGRD
FT                   SHTIYGNAIFSRVADTALVDMLYMGVILSDYGRFSTALDESGRMIRDRVFEN"
FT   gene            complement(691517..692584)
FT                   /locus_tag="BLJ_0552"
FT   CDS_pept        complement(691517..692584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0552"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00029"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT23"
FT                   /protein_id="ADH00029.1"
FT                   /translation="MPASVSADAGNAPAGSITNTGANNTFTSATESSLATLLSNQCPFV
FT                   IKATIFEGNGKNAIRERHTFTGSVLRQLDQASALLNGINESGQYPAIALREALVNALEH
FT                   RDYTYSGPTLINIFDSRLEIVSLGGLTDGLEINDLLNGVCQPRTPRLAELFADLGLCEN
FT                   CGTGIQRIMDAYAQSAVSPQLRVGPTSVAMVLPIPVSAEAASLHRTDTDASAAPSTTDE
FT                   AQRAKMYSFPTIQRMTDNAADALAGARIIGCAPLQTLILGSGFGERPDGDDQVSTRPLD
FT                   TATLEPSPQTLEQFTLNFLAFRGVKLSRKTMQKALGLNKDQMTQLLDQLELSGKIERHT
FT                   HAKSTTYSLAHASGR"
FT   gene            692802..692878
FT                   /locus_tag="BLJ_0553"
FT   tRNA            692802..692878
FT                   /locus_tag="BLJ_0553"
FT                   /product="tRNA-Arg"
FT   gene            693128..693919
FT                   /locus_tag="BLJ_0554"
FT   CDS_pept        693128..693919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0554"
FT                   /product="ABC superfamily ATP binding cassette transporter,
FT                   ABC protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00030"
FT                   /db_xref="GOA:D6ZT24"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT24"
FT                   /protein_id="ADH00030.1"
FT                   /translation="MPRAIIEVRNLRKEYPVEDETVVALDRVNLSIPQGQICCIFGESG
FT                   SGKSTLLNQLAGMEKPTRGGVRIGGVPVSKLDERELAAFRQKHLGFVFQSYNLLPNLTA
FT                   LENVAMPLMFRGVPKEQRERAARGVLKRVGLGHRLSHYPRQMSGGQQQRVGIARAFVTK
FT                   PEVVFADEPTGNLDSKTKTEVMTMICAFAHDFNQTIVLVTHDPQMASYADRIVTLLDGR
FT                   ITSDRLNTDLSRPTVPSTPSAPTTPTTPSTPSAHRTQGTDR"
FT   gene            693916..695082
FT                   /locus_tag="BLJ_0555"
FT   CDS_pept        693916..695082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00031"
FT                   /db_xref="GOA:D6ZT25"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036238"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT25"
FT                   /protein_id="ADH00031.1"
FT                   /translation="MKHLSHHTIAIIVALLSTLSLALAVISLPHQAYAVDGTDGTSGTN
FT                   STSQGSDGDSAPIAGPVPNIIITNFAYGGDSVAAGSKFNLDFTFQNKGQVAVTNMVVTV
FT                   DGGESFAIAGGTNTFYVDALWAGYAMTQSVPMQALASAKSGAQSVTVNFRYEYVDASAR
FT                   SSSQSDVKISVPISQPDRFEISDPVVPDQVIAGQENTVTMEYVNKGKGDIANVEATMEG
FT                   EGFDATMKTQYVGNVASGATGTIGYAFTPHASGELKTTLKVTYEDSDGQTKTKEFPLAI
FT                   PVTDMQPVDDSDMADPNMDQSANQGFPVLVYVVIVVIAVVIIVVIVLLVRRRRKQKAKK
FT                   NDIDEDWDDWSEGKDDKTDTDVTDGAAADTAPIAPASPASPAGPSHKA"
FT   gene            695247..696653
FT                   /locus_tag="BLJ_0556"
FT   CDS_pept        695247..696653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0556"
FT                   /product="protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00032"
FT                   /db_xref="GOA:D6ZT26"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT26"
FT                   /protein_id="ADH00032.1"
FT                   /translation="MLKSMGDLSIVTVYTNGYAGPMGGGGSSEMGDTKLDDKAVESFRA
FT                   MSGVSGVTPMMNFPYNVTARAGAGGRYLYDYVQIMGIDMTQFDQMGYKLVGGEKPVKKD
FT                   QVLAGEWFAYGFMDTLKNGEQRTSTRGGQYSSCTFDQTTGQCEEDQDEDPFFDPLATQI
FT                   SLTTGTNYQGDQYTMNMYGGGGGTGGAGGNTAGQSENVTFDVRASGIVAGDYNKGYATS
FT                   DGLVMDLQALKELAAKVDPAAAKKATAYNQVLVKAADLKSVPEVESQIKALGYETSSYE
FT                   DMRKSLEEQSRAIQLILGGIGAVSLLVAAIGIANTMVMSVTERTREIGIMKALGCYVRD
FT                   IRVMFLAEAGAIGFFGGLVGCVLSGLISLGINVVGALYAGGMSGGMSGGMVSGAGGGSG
FT                   DGTGGGTSIWTILWQAIVGGENVTRYSVIPWWLFLFVVLFSTLIGLLFGFGPANKAVKI
FT                   PALDAIKNNE"
FT   gene            complement(696637..698826)
FT                   /locus_tag="BLJ_0557"
FT   CDS_pept        complement(696637..698826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0557"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00033"
FT                   /db_xref="GOA:D6ZT27"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT27"
FT                   /protein_id="ADH00033.1"
FT                   /translation="MRSASGNGFDSSDSFAVSGAAERTARLHDIPPSITPSHGDDSHLL
FT                   SRIASPADVKALAPNELAELCREIRTTLLAYGHQHGGHIGSNLGMVEATVALHRVFDSP
FT                   RDRIVFDVSHQSYVHKMLTGRAAAYLDPDRFSEVTGFTNPDESKHDQFVLGHTGTSISL
FT                   ACGLAKTRDMEGPNSGIGNVIAVIGDGSLSSGVAFEGLNNAAEQGGNLIIVFNDNEMSI
FT                   AGDFGGMYGPLARLRASGGTAQPNLFNAFGLDYRYVEAGNDVSALVAAFEEVRDIDHPV
FT                   VVHIHTLKGAGYDGEETHTDRQTASASPVSFDSPTGVHPTDNVNHSEPWHSDHCNLSDH
FT                   EPHEGQCEASHWQNPDAAIGKPDDPRKHYGKMAMAALEPRFAAEPGLVVISPATPGSNG
FT                   ITHEFRERAGAHYVDTGITESHAVAYAAGIARAGGTPVVATTASFFQRAYDQFFQEMSL
FT                   NRSRVTVLDFLGGLSGSDNTHSGAYDVTMFSNIPGATMLVPTSARDYLADLAWATAPAG
FT                   SADAPAGPVVIRVPGEAILTAERDATLLPVTGGQIADRPQSTSLPVSVSSASGGISAAT
FT                   VRGTVSVTAQRAGVRHMLDWRVNQTGSHVAIIGLGNAYPLAEQTAAALSADYGITATVI
FT                   DPRQCTSLDSDVLESLRDGHQQVITLEDGQLEGGWGEKVTAYYANHHVSDGSRNPHVLN
FT                   FGAAKEFTDRVPLGELNERYGLTVEQVTEAITRCF"
FT   gene            699000..699992
FT                   /locus_tag="BLJ_0558"
FT   CDS_pept        699000..699992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0558"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00034"
FT                   /db_xref="GOA:D6ZT28"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT28"
FT                   /protein_id="ADH00034.1"
FT                   /translation="MKAVYASTVNHADPLAALAVGEQPEPQARPFWSTVSVRAVTVNHH
FT                   DVWSLQGVGLAAEQTPMILGTDAVGILDEDIPGKHGLKAGSEVVLYTFVGTDGAGVAPG
FT                   ERRTILSEKYPGTMAEKTSVPSANVFAKPASLTTAEAAALGTSWLTAYSLLFDAAGIKP
FT                   GDSVLIQGAGGGVSTAAIQLAHAAGLEVFVTSRDADKRSKALKLGANAALEIGARLPRK
FT                   VDAVIESVGAATWGHSVRSVRPGGTIAICGATTGDQPGAELTRLFFQDIRVQGCTMGSR
FT                   EDFARLLRFVEHADLHPVIDSVVSGLDAAPEAFARMIAGDMFGKIVIEL"
FT   gene            700094..700594
FT                   /locus_tag="BLJ_0559"
FT   CDS_pept        700094..700594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0559"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00035"
FT                   /db_xref="GOA:D6ZT29"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT29"
FT                   /protein_id="ADH00035.1"
FT                   /translation="MANESKPEVAVVMGSASDWETMKRACDILDQFGVAYHKQVISAHR
FT                   TPELMAEFAHNARANGLKVIIAGAGGAAHLPGMIAAQTTLPVIGVPVRSHALSGWDSLL
FT                   SIVQMPGGIPVATTAVGNSGATNAGLLAVQMLSVFEPELADKLEDYRNELKEKVAESNA
FT                   QLV"
FT   gene            700578..701756
FT                   /locus_tag="BLJ_0560"
FT   CDS_pept        700578..701756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0560"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00036"
FT                   /db_xref="GOA:D6ZT30"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT30"
FT                   /protein_id="ADH00036.1"
FT                   /translation="MPSLSEETGGRVSMLMPGSTIGIIGGGQLGRMMALSARYMGFRVG
FT                   VLDPTPNCPTGQVADFQITAEYDDKTAIHDLAVQSDVLTYEFENVDAGAIDEVRGITAT
FT                   PQGTDLLRVTQHRVREKQFINDHGTATAPWRAVNNFDELDAALGDIHYPAVLKTVSGGY
FT                   DGHGQLVLRSDADLEKIRSRSDRGGGFPPSILEGFVDFAFEASILVSGNGKDFVTFPIV
FT                   RNEHRNNILHMTIAPAEVSEHVAREAHELAIRLAKGFELAGTLAIELFITKDDQVIVNE
FT                   LAPRPHNSGHYTIEACSMDQFDAHIRGIAGWPLPKPKLLSPAVMVNVLGQHVEPTRALI
FT                   ATHPEWNVHDYGKAEVRHDRKMGHITVLTDDPAKTVADLEATGCWDDLKKKA"
FT   gene            701753..702148
FT                   /locus_tag="BLJ_0561"
FT   CDS_pept        701753..702148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0561"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00037"
FT                   /db_xref="GOA:D6ZT31"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT31"
FT                   /protein_id="ADH00037.1"
FT                   /translation="MTLPMVEHIERQTKQKDAIRAALADCEEFISAQDLHRRLEDEGSK
FT                   IGLATVYRQLNALADAGAADTIRLDGQQLFRLCGDDGHHHHLVCRRCGKTVEIDPPSEA
FT                   WLRKVADGHGFTVESHTLEVFGLCSDC"
FT   gene            complement(702228..702443)
FT                   /locus_tag="BLJ_0562"
FT   CDS_pept        complement(702228..702443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0562"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00038"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT32"
FT                   /protein_id="ADH00038.1"
FT                   /translation="MFMTSGGYKHVFGEQHQSNAYMVRLKNHETSNVESRSAKLMKLDG
FT                   VKGIVQNTTSKKQHARRAEVSGIAAE"
FT   gene            702705..703628
FT                   /locus_tag="BLJ_0563"
FT   CDS_pept        702705..703628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0563"
FT                   /product="periplasmic solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00039"
FT                   /db_xref="GOA:D6ZT33"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT33"
FT                   /protein_id="ADH00039.1"
FT                   /translation="MSIMSNAKRALAIAAAAATLLSMAACGSSNAASGKSDSSGAASSG
FT                   KIEVVASINQWGSVAEDLGGSNVEVTNIMTKTNVEAHDYEPTSQDVAKFGTAKVAVVNG
FT                   ADYDPWATKAAQPTKATLVTAAETAGIKEGDNPHVWFSAKVRSNTADAITAAYQKADPS
FT                   HKDDYAKLNKEWHAKEDQLESKIKETSAKTEGLPYAATESVAWYLADDLKMTDATPKGY
FT                   AQASANESEPTPADIKDFQDTLKAGFIKMFVFNSQEANSTTDQITGAAKDANVPIVELA
FT                   EQMPKQYTNLLDWMSALVDQFAAAVK"
FT   gene            703889..705964
FT                   /locus_tag="BLJ_0564"
FT   CDS_pept        703889..705964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0564"
FT                   /product="sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00040"
FT                   /db_xref="GOA:D6ZT34"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT34"
FT                   /protein_id="ADH00040.1"
FT                   /translation="MSENTSNTTTVKPHFKLWAKKVEANEVTPQHPHKPFPGWVYGVLF
FT                   VIFDIIVVTALEVGVSSSSTRVQLSSPTVGFGFVSKMWTDGNFVFVLNVILVALLYLML
FT                   LMLFNRFWTASIVILAVGIIVAAIEHFKVEIRYEAILPADLGFLGSNTGNMLTFIPAGA
FT                   HVTILVALGAFAALLALILVLRHFDGRKGRMIRTDNLSLNLTSRLILLLLPILVFALYC
FT                   IHVSTTDSLANKFSRALGDTPSMWDSVYDAQRNGPLVAFTRQLNPKIMDKPSNYSEETM
FT                   KKVAARYQKEAETINASRTNNLTDSTVVYVLSESFSDPSRVPGLKTNKDSMPNIRKIKA
FT                   GTTSGLMLSSGYGGGTANLEYMGLSGLSMANFESSLSSPYQQLVPSQHWTPTINQLWGA
FT                   PVNSLGYHPYESSMYSRATNYKKFGFSHFYTLTGPDVIKYQDKIDESPYVSDKSSYDSA
FT                   LEGIKSGKTNKFIQIITMQNHMPYHEWYENNDYTAESTTGTPLGDDEQQSIETYQKGVE
FT                   ITDQATQEFLNELDALDKPVTVVFYGDHLPGIYSSASEDDNNSLALHLTDYFIWSNKAS
FT                   SSQGNKASDAAYSSPNFFVAQAADHMNAKVSPYLAFLTEMHSKIAAMEPPVVNKIQGWD
FT                   RIPEGQNIYLDQNGNPMSTDDFDKETKQLLADYKLIQYDITAGKNYLKDTDFMTLP"
FT   gene            706085..707722
FT                   /locus_tag="BLJ_0565"
FT   CDS_pept        706085..707722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0565"
FT                   /product="aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00041"
FT                   /db_xref="GOA:D6ZT35"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT35"
FT                   /protein_id="ADH00041.1"
FT                   /translation="MTNQTFEQLKKTYESGRTRPLAWRRAQLNALRRLVTENRDAFVSS
FT                   AMADLGKPAAETVLMELNLVAGEAQFVRNRLSLWTARHPKAMHWMLQPAAGWTIAEPKG
FT                   VVLIISPWNYPVLLALEPMADALAAGNAVCLKPSELSPDTSKLLAELVPQYLDSEAVRV
FT                   VEGGPKETGELLKCPFNHIFYTGGGHVGKIVMRAAAEHLTPVTLELGGKSPCFVDRTAD
FT                   INVAARRIAWGKFTNAGQTCVAPDYVLATPDVAEALAERIAVAITEFYGEDPKASPDFG
FT                   RIINDRHFERLCKLLPVGTVPPEEPSSPLVQVASAVGAAMDMVGRRFNAVTTGRGGAGE
FT                   MAGSANNAAKPTAGSNMAAADDGATASAAVEPSEIHKVPGVFDLAGRIVCGGKVDRAAR
FT                   YIAPTVLYGTSPDAPVMKEEIFGPILPILVVEDAESAIRFINKRSRPLAAYVFSRDHEV
FT                   RLTFERQTSSGALGYSLPLGHLLSSRLPFGGVGASGIGTYHGKAGFLTFSHVKTVVTKP
FT                   QFPDTLRLVYPPFNEAKAKLFDIIAKFS"
FT   gene            complement(708096..709364)
FT                   /locus_tag="BLJ_0566"
FT   CDS_pept        complement(708096..709364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0566"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00042"
FT                   /db_xref="GOA:D6ZT36"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT36"
FT                   /protein_id="ADH00042.1"
FT                   /translation="MGQKVLVIGSGAREHTIAYTLLKAPSIDEVTVAPGNPGMLKDGIH
FT                   TTQLSQSNHAALIEFVKNNGYDWVFVGPEVPLIEGIVDDFAAAGIKAFGPSKAAAQIEG
FT                   SKDFAKQLMDRHNIPTAKYKTFGDLDMAQAYVHEHGAPIVIKADGLAAGKGVTVAMDEH
FT                   TAQRALEDIFIDHRFGSAGAKVVIEDFLDGQEFSLMSFVNGTDFWPMPISQDHKRAHDG
FT                   DEGPNTGGMGAYSPVPQIPQSVVDEAIEKIVRPTVEGMAEEGTPFTGILYAGLIATADG
FT                   PKVIEFNARFGDPETEVVLPKLTSDLGAGISAILDGETPEFTWDESNATLGVVIASNGY
FT                   PENVIKGARVPEIEVDEDSHVYYAGVASDEHGNLVANSGRVLLVETSAPDIKSAQDKVY
FT                   AIIDKLELRGLFYRHDIGFKALK"
FT   gene            complement(709421..710458)
FT                   /locus_tag="BLJ_0567"
FT   CDS_pept        complement(709421..710458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0567"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00043"
FT                   /db_xref="GOA:D6ZT37"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT37"
FT                   /protein_id="ADH00043.1"
FT                   /translation="MPKAYENAGVSVEAGYEVVKRIKSHVARTNRPGVVGGIGGFGGLF
FT                   DLASLGYKEPVLISGTDGVGTKLMVAKLANKHDTIGIDCVAMCVNDIAAQGAEPLFFLD
FT                   YIACGKNDPALLEQVVAGVADGCVQAGSALVGGETAEMPGMYDEDEYDLAGFSVGVAEK
FT                   SAIVDGSTITEGDVLIGLPSTGVHSNGFSLVRKALFEQAGYTVDTELAELGGAKLGDVL
FT                   LTPTKIYVKALSPLFKAGVVKGVAHITGGGFIENIPRMIPDGLAAEIELGTWPVLPIFD
FT                   VLEKAGNIDHKEMYNIFNMGIGMVLAIDPARKDEALKLLADNNEPAYVLGQITTDTTDT
FT                   QIVLK"
FT   gene            complement(710630..712141)
FT                   /locus_tag="BLJ_0568"
FT   CDS_pept        complement(710630..712141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0568"
FT                   /product="amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00044"
FT                   /db_xref="GOA:D6ZT38"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT38"
FT                   /protein_id="ADH00044.1"
FT                   /translation="MSAELEDIHEECGIFGVWGHPDASRLTYFGLHALQHRGQEGAGIV
FT                   SNDNGHLIGHRGLGLLTQVFGDEREIERLKGNCAIGHVRYATAGSGTTDNIQPFIFRFH
FT                   DGDVALCHNGNLTNCPSLRRKLEDEGAIFHSNSDTEVLMHLIRRSMQRTFMDKLKEALN
FT                   TVHGGFAYLLMTEDAMIGALDPNGFRPLSLGKMKNGAYVLASETCALDVVGAELVRNIR
FT                   PGEIVVVNDHGYKIVQYTNNTQLAICSMEYIYFARPDSDIYGVNVHSARKRMGARLAAE
FT                   SPVEADMVIGVPNSSLSAASGYAEAAGLPNEMGLIKNQYVARTFIQPTQELREQGVRMK
FT                   LSAVRSVVKGKRVIVIDDSIVRGTTSKRIVQLLKEAGAAEVHMRISSPPLKYPCFYGID
FT                   ISTTKELIAAKMSVEEIREYIGADSLAYLSLDGLVESIGLNADAPYGGLCVAYFNGDYP
FT                   TALDDYEADFLKSLTPEDRVRLPEFALYKSKYIGNEYNTVQPDVQ"
FT   gene            712653..713690
FT                   /locus_tag="BLJ_0569"
FT   CDS_pept        712653..713690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0569"
FT                   /product="adenine-specific methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00045"
FT                   /db_xref="GOA:D6ZT39"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT39"
FT                   /protein_id="ADH00045.1"
FT                   /translation="MGFKGKLYKTTLINNRRYLGNKYKLLPFITKVVDEECTGIDVVAD
FT                   IFAGTGAVSSAFPGKTVITNDIMYSNYVCNYAWFGAETYDPQKIVNYVVEYNAISQYDD
FT                   NYMTDNFADTYFSYNDCSKIGFIRQDIEDNYQAGDLNDREHAILIASLLYAMDKIAKTC
FT                   GHYDAYRKGAKFDKPLELRVPLAEVHNNAGNQCFNEDANELVKDIHADLIYIDPPYNSR
FT                   QYSDAYHLLENVAHWEKPEVFGVARKMERKAIKSKYCTRSATETFEDLIGNINARYILL
FT                   SYNNMATKGDGRSNAKIADEDIVRILRNKGELKIFSEDYKPFSAGKSSITGNAERLFLC
FT                   TCNEG"
FT   gene            714679..716793
FT                   /locus_tag="BLJ_0570"
FT   CDS_pept        714679..716793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00046"
FT                   /db_xref="InterPro:IPR018573"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT40"
FT                   /protein_id="ADH00046.1"
FT                   /translation="MKVSKGHIFNLFDTNGRRNDVIAAMRGYLSILNTIRANQDLPWRA
FT                   MPNSPAQVLFYRHAIGMFPDVFKDHPKYDELISTIHEYPALEAAIDRADMEWLESHGDE
FT                   YANVDINFDEGVEDRARHYTSNLVKLGFADGRRNISPVGNILLDRIPLHEDGLERLLSL
FT                   NKENILYLRQLLKLRIFDKAGERYYAPFVMGVYALLRKSRLSEDDFFGMVQGSSPYSNI
FT                   DDVDRYIDNFSVEGQLHNHAVSTPDEINIDQQLTYDVFKQYFLNRKSARTVNIYYGFYQ
FT                   CIFEFTVDRTPEKLDLLLTYYESNRSVLNKAFGFGRNVFDTRTGDRPDVQDFLDENEDM
FT                   FSSDINDYLYRQFAISKFWDTLREYSDTTKRIFKASGLISFENGYVELAYHELCACIFN
FT                   AADLKPKIFGSMDDEVVPYYESYDEYEEGVSSYFCSNFSLCDILGLQESLDEIKEHISE
FT                   AFGGAAPEDIPDITRRRRWEEFEVFVANQYPVERVKELLALFGDRNNDKRIKQEVCEDA
FT                   TVPTIYEFIVGLAWYYFSGKRFNLLSSYNLTLSADFEPLNHAGGGQGDIVIESKHDVTM
FT                   LEATLMNVNSQKRGEWEPVLRHSVNLKVDEEARKTDRRVTTFFIADVFDANTINIWKAV
FT                   ASVPLQSTTAGAAYTDNVVIMPISSLELCGLMDRSSQYDTVMQRVHDLFEVDKSNFDLQ
FT                   WRDKFIDEIV"
FT   gene            717015..718610
FT                   /locus_tag="BLJ_0571"
FT   CDS_pept        717015..718610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0571"
FT                   /product="UMUC domain protein DNA-repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00047"
FT                   /db_xref="GOA:D6ZT41"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT41"
FT                   /protein_id="ADH00047.1"
FT                   /translation="MAMAGERASAQREHTYIAIDLKSFYASVECAARGLDPLTTHLVVA
FT                   DETRTDKTICLAVSPSLKSYGIPGRARLFEVKQRLNGVNAERAVHAPGGRLIGESCDAR
FT                   DLEHSPRLKASMVIAKPRMAHYLEISGRIYGIYLRYAAPEHIHVYSIDEVFIDATPYLR
FT                   SLGMGAHAMARTIVREILAETGITATAGIGSNMYLAKVAMDIVAKHMPADKDGVRVAEL
FT                   NEMSYRRLLWDHRPLTDFWRVGRGYAKKLEHAGLMTMGDIARCSVGRASDYYNEDLLYR
FT                   MFGVNAELLIDHAWGWEPCEIADIQSYEPDAHSISSGQVLTGPADYATARLITKEMADA
FT                   LALDLVDKGVLTNRLTLAVGYDIGSLDASKLDSCADYAMKRAAERAAKSYQGPVAVDRF
FT                   GRKVPKSAVGSIGLGDFTSSSARIREAMTMLYGRIVDSRLLVRRLTVIADDVATPEELA
FT                   AGKRYEQLDLFGDDEAQSYGSEPADDRDGEHDIQRALLDVKRKFGRNAVIKAMDMEDGA
FT                   TGQGRNRQIGGHRA"
FT   gene            718607..718825
FT                   /locus_tag="BLJ_0572"
FT   CDS_pept        718607..718825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00048"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT42"
FT                   /protein_id="ADH00048.1"
FT                   /translation="MTLQETHAYDDIINLPHHQSRKHPHMSRHQRAAQFMPFAALTGYG
FT                   QVIEQTAKNAETAIAQAEAQGDTDFGA"
FT   gene            complement(718859..719665)
FT                   /locus_tag="BLJ_0573"
FT   CDS_pept        complement(718859..719665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0573"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00049"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT43"
FT                   /protein_id="ADH00049.1"
FT                   /translation="MDLVTTGTANSQTNIANDSTIPNTIPDERAIAPGDLSSLAHCPFL
FT                   LGNPQDIDGRIGEILFRRAGFEPKVAARSDNILTLLELCHYGMGACLCPERFLPALLDG
FT                   ERLRTLHVLDCGPETEYAIRFDVSATPYRWSVIDDFIRCAREVTTGEGVNDRGLSRKHI
FT                   FESIDQTLKNMQTDYLDMYFCHRFDETTDLTETLRVVANELGTNLPVLSMAWILQHPEI
FT                   SCVIAGASKPSQLENNMKAAGFVIPADAMAEIDKITGFHHFERHVG"
FT   gene            719820..721202
FT                   /locus_tag="BLJ_0574"
FT   CDS_pept        719820..721202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0574"
FT                   /product="Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00050"
FT                   /db_xref="GOA:D6ZT44"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT44"
FT                   /protein_id="ADH00050.1"
FT                   /translation="MLEAGAMLLFCAVLFASVALGWSIIPALFVGVLLFMGYGLVRRCS
FT                   LRAMASRAAGSVRSAGTVVVTFVLIGVLTSLWRASGTIAFIVAHSTAVIHAATVIPLSF
FT                   LLCSAMSVLVGSSFASAATMGTICMSLGLSMQANPVMLGGAILAGVYVGDRCSPVSTSA
FT                   LLVKQLTHTNLFSTIACMLRTGAVPFVLSCVVYVAAAVAEWLCASGGSGFGAARAAVST
FT                   NTSSITDIGGLFSSAFDLHWLTLVPALLVIVLALLRVDVRLLMLASIAASVAICVGVQH
FT                   MEWAELLRLLIFGYHAQNPQVAALLDGGGILSMLTVMATVCISSAYAGIFAETRMLARL
FT                   QQVIEMLGHRIGACGATMITATCAAALACNQTLTIMLTHQLCGGLYGDDESERAAQAID
FT                   LEDSAVVIAPLIPWSIAGAVPLATINAPTLSLAAATFLYLLPLCRMAVSAVRHRRAITT
FT                   NI"
FT   gene            complement(721233..721796)
FT                   /locus_tag="BLJ_0575"
FT   CDS_pept        complement(721233..721796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00051"
FT                   /db_xref="InterPro:IPR026353"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT45"
FT                   /protein_id="ADH00051.1"
FT                   /translation="MGLMSEHVEHGFGPVWDGESRALILGSMPSPKSRAAAFYYMHPQN
FT                   RFWPVMQALFANSADPTDAVGDLPESRRAFALRHHIALWDVIASCDITGASDASIRNAV
FT                   PNDLTPILRGAPIAHIFATGAKSAQLYRKLIEPRLTEAGIAIGMTQLPSTSPANASMRL
FT                   PDLITAYREAFREYNIVVRQTTNI"
FT   gene            complement(722282..723334)
FT                   /locus_tag="BLJ_0576"
FT   CDS_pept        complement(722282..723334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00052"
FT                   /db_xref="GOA:D6ZT46"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT46"
FT                   /protein_id="ADH00052.1"
FT                   /translation="MSKHSRNDGRQPEQYARLSESPSEDESDEEFRQFLLAKGDQNDPA
FT                   VRDMLKTIDRDRYERSAANGGPTLEYESHGLFALTVPHLHGPRPGRRAFGMRGVVLKSL
FT                   WFLFVFVVSVVVQVVFMDAAKANGSGDWWPLAAVPNVVVFALVFTSMALSPFLMLLFGG
FT                   IWPRLWGLSILFGSLAMLAAGSFVGQEVGRRWLWDRYVATGLLKPGDFVDWSSDRLPAP
FT                   LAQPASGGWWVTGLVAGVLLVSGSLFLYREDRHRGSNILPRYISYGGGVVGLVAAIGIA
FT                   LTRHVSGFALVAAPFIALFVGLLWFPLDLAAACFCVDNRRESCGEWPAAFWLTAEALFV
FT                   IGVCTALPMA"
FT   gene            complement(723352..724152)
FT                   /locus_tag="BLJ_0577"
FT   CDS_pept        complement(723352..724152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00053"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT47"
FT                   /protein_id="ADH00053.1"
FT                   /translation="MVVINAIYKKALRARLWQPTKWGKRLLKSKDAAGGFRKMLVSEGG
FT                   KAMQSGENVLSAIRHDGTGNYAANLARQGWDALGKGMHNVGHSLKNSGRAWNRFVSGWQ
FT                   DAKQAANAAHSNPNNTVMRDFWDGQFKRFGDWSKGHGWSIGNTIMNARTGYTDFRGIHD
FT                   MKNIAAVDTRRTVWDTMNFGQHVVSYANATYDTLNTAKVVKPFVNPTTDGGLQWKHSPQ
FT                   DYFKTFVPDPDQLWNFKTIYQAPGKLSDGAAEASNAIRVGISDL"
FT   gene            724181..724294
FT                   /locus_tag="BLJ_0578"
FT   CDS_pept        724181..724294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0578"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00054"
FT                   /db_xref="InterPro:IPR025324"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT48"
FT                   /protein_id="ADH00054.1"
FT                   /translation="MMFYTFEARAGVDLSKAEIDVNKHNRTIDITLPAPTI"
FT   gene            724718..725530
FT                   /locus_tag="BLJ_0579"
FT   CDS_pept        724718..725530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0579"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00055"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT49"
FT                   /protein_id="ADH00055.1"
FT                   /translation="MISYVRNVGKTVLAAVVSLVFIVGAAGCGNTQKDDGPDYADDEAM
FT                   SIIAKAYQKRSDVLDQYEQKKDTDSVKHVKDAVQAEIDNDEPLKERQFKDSKLQEKVIT
FT                   YINLLEDSQKVNEDYSYLSSDYSTEWTKVYDKRSALLKDFVDNYKLTVDSKYQDPLNDI
FT                   VANGSSVKKKTETEDALNNLIASATFEKTDDGYGYYAYSAVIENISGIDFGTVNLILAL
FT                   YDADGVKAAEVYASTNAWPAGEKVKFETGSDADAAQVKASVDHYEVDD"
FT   gene            complement(725614..726273)
FT                   /locus_tag="BLJ_0580"
FT   CDS_pept        complement(725614..726273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00056"
FT                   /db_xref="GOA:D6ZT50"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT50"
FT                   /protein_id="ADH00056.1"
FT                   /translation="MKHCDACNVDFTGDMARCPLCQNELHGEASPAAFPAQQIYLRPRR
FT                   LAVEIITFVTGAILLLHGFFSYLFSWPIPIASASAAALIISVLFINSAILHAPRPLRLM
FT                   FRYFYIMLAIALVWFVATMNHVVTMFVIPITCLVSLVFDVVLLIVLRAKAIDQYAKYLA
FT                   FDIVAGLLPLTFIPLGWAPWDVLVMVSGLVSLLVLLGLLVFARRQLFSEFGKQFSA"
FT   gene            complement(726270..727640)
FT                   /locus_tag="BLJ_0581"
FT   CDS_pept        complement(726270..727640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00057"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT51"
FT                   /protein_id="ADH00057.1"
FT                   /translation="MARRTWYRLDNIGKFYSSQAGRSSQTVFRYSAELADDIAPDILQH
FT                   ALDHAIAQFPSFNVHLLNGMFWHYLEQSDGRPLVEPEHLPICSRLHYGPKSMLFRVSYF
FT                   RNRVNLEVSHIISDGRGAINLFKSLLHAYIAERYDVPGVPSDYDGSDSDKAENSFDKYY
FT                   EKDKAGAAPGTKIYRLAGPIDRDAPTFMEYHVSASKVLGAAHQCGVSLTSYLIAAILCA
FT                   IRDVMPSRARNRAIRVDIPVDLRAFFRSETVRNFYGMTYVAYTPADIEADEDSAKTSAT
FT                   GPDATGDGQQSAARTAHGNGMGGLLTDEPLADIARHVQEQLDHATSRERVESHMNRMIA
FT                   LEKNPALRLAPSPAKDWVLELARFIADRETTTTVSNLGRVTLDERLASHVRSVSFLTTP
FT                   ASLNFTVCSFGDDLSIGISTVYHDLNVIKNLCRILAAQGISGRMNIAGAHVEKGASA"
FT   gene            complement(727613..728275)
FT                   /locus_tag="BLJ_0582"
FT   CDS_pept        complement(727613..728275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0582"
FT                   /product="carboxylesterase or lipase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00058"
FT                   /db_xref="GOA:D6ZT52"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT52"
FT                   /protein_id="ADH00058.1"
FT                   /translation="MLTPPVGCADSPHRGGDISATIPAPDPDSIVLFGDSAGGNLAAAV
FT                   SLMARDRGEFMPRTQMLLYPVVGNDYNPETSPFESVRTNGTDYILTAQDMADYIDMYRS
FT                   SVADLTNPYFAPLTAHDLSNQPRTLVLSAEYCPLRDEDEAYARRLQLVNDNVSCYRIHD
FT                   GIHGYLLNTSAVGLVSTTYRIIEHFLDDTPLVPAPGTGTTANAPEGGDAWQDVLGTD"
FT   gene            complement(729047..732781)
FT                   /locus_tag="BLJ_0583"
FT   CDS_pept        complement(729047..732781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0583"
FT                   /product="phosphoribosylformylglycinamidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00059"
FT                   /db_xref="GOA:D6ZT53"
FT                   /db_xref="InterPro:IPR010141"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT53"
FT                   /protein_id="ADH00059.1"
FT                   /translation="MVFRVYVEKKPGFDVEAQQLAGELRTILGLTGLKALRIVNRYDVE
FT                   GISQELFDQTVPTVFSEPQVDNVAYDLPDFAGAKVFATEFLPGQFDQRADSAAECIQLI
FT                   SQGERPTVRSAKLYALEGDLTDADVDTIKHYVINPVEAREASLETKETLKTQVPVPGKV
FT                   ETIAGFNEMDAEAGQKFIDERGLAMDLADLEFCQKYFSEESREPTITEIKVIDTYWSDH
FT                   CRHTTFGTELDEVTIDDATVKAAFERYLAMRHELGRDAKPVCLMDMGTIGAKWLKKNGV
FT                   LTGLDESEEINACTVKVKVDVNGHDEDWLFLFKNETHNHPTEIEPFGGAATCIGGCIRD
FT                   PLSGRSYVYQAMRVTGAADPTVPVSETLEGKLPQRKLVTTAAAGYSSYGNQIGLATGQV
FT                   DEIYHPGYVAKRMEVGAVVAATPADHVRRETPAPGDKIILLGGRTGRDGIGGATGSSKA
FT                   HNVESLELDGAEVQKGNAPVERKLQRLFRRGDACRLIKRCNDFGAGGVSVAVGELADGL
FT                   FVDLNTVPKKYEGLDGTELAISESQERMAVDVAAEDVDEFLAYAREENLEATVIATVTE
FT                   DPRMVMTWNGDKIVNLSREFLASNGASKHQTVHVEEQQSYETPWGEGTLAERMNKLVTD
FT                   INVASNKGLSERFDSTIGAGTVLMPFGGKRQLTPNMAMVAKLPVFGETTTASAMAWGFN
FT                   PYIMSKNQFTGAYLSVVESLAKLVAAGFEHEKAYLSFQEYFEKLRDEPERWGKPAAAVL
FT                   GALMAQVDLGAGAIGGKDSMSGSFEDLDVPPTLISFAVAVGNMKRATSPEFKDADHRIV
FT                   RIAPRYLADGLTPDKDALLEVFSVIEELTDFHDALAVSTPGYGATAEALFKMTLGNRIG
FT                   VTLNNSIAVDDLFTPAYGSFIVELADDAKLPAVSNLVEIGEIGTTTSEYVFKAAGETLD
FT                   LDAVQEAWESGIESVFPYRSKGEDKGATVETIDFHAPKKTVYVGSSVAKPHVVIPVFPG
FT                   NNCEYDSAAAFERAGADVTTLIVNNLTPAAVAESTQALVDEINKSQIVMIPGGFSGGDE
FT                   PDGSAKFITAFFRAPAVTEAVRDLLKNRDGLMLGICNGFQALVKLGLVPYGDIVPMTDA
FT                   CPTLTFNTIGRHQSRLVRTRVASDLSPWLSKTSVGDIHTVAISHGEGRFVASDEVLAQL
FT                   RANGQIATQYVDETGTPGMDLDVNPNGSLLAIEGITSPDGRVFGKMGHSERSGNGLYVN
FT                   VPGNKYQPIFEAGVEYFAA"
FT   gene            complement(732844..733596)
FT                   /locus_tag="BLJ_0584"
FT   CDS_pept        complement(732844..733596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0584"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00060"
FT                   /db_xref="GOA:D6ZT54"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT54"
FT                   /protein_id="ADH00060.1"
FT                   /translation="MEKLEKLYEGKAKQLYATDDPEVLWVEYKNTATAGDGEKKEDFTG
FT                   KGRLNNLITTIIFDLLKKRGIDSHLIKRVDDTGQLVRKVNMFPLEIVLRNVAAGHFCSR
FT                   LGVEEGLPLKEPVLEYFLKNDDLHDPFVNDDDLVALGVCTREDLAEIAPLARKINEALI
FT                   EIFAKIDVKLVDFKIEMGRATDGTLLLADEITPDSCRLWDQKDHSGKVEHLDKDLFRRG
FT                   LGSIIPAYEEIEERLAELAKSEGIEVAE"
FT   gene            complement(733682..733804)
FT                   /locus_tag="BLJ_0585"
FT   CDS_pept        complement(733682..733804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00061"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT55"
FT                   /protein_id="ADH00061.1"
FT                   /translation="MPEGYTTGDELIVLANDGRLRHPNSVWPFDAATYDAPAAS"
FT   gene            complement(733989..735326)
FT                   /gene="purT"
FT                   /locus_tag="BLJ_0586"
FT   CDS_pept        complement(733989..735326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purT"
FT                   /locus_tag="BLJ_0586"
FT                   /product="Phosphoribosylaminoimidazole carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00062"
FT                   /db_xref="GOA:D6ZT56"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005862"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT56"
FT                   /protein_id="ADH00062.1"
FT                   /translation="MTENAVNTAVTSTSSPAIPAETSAVSPATRAANRPLGTPLGKHPT
FT                   RVLFLGAGELGKEVAIELMRLGAWVCAADSYAGAPAQQVAHEYRALDMANAAELQALFD
FT                   EIKPDIIVPEVEAIATDVLAGTAAAGAQVVPSAEIAAICMDRERLRVLAHEELGLPTTP
FT                   YRFAGSLEELRAGASEVGYPCVVKPVMSSSGHGQSVVRSADAIDAAWTEAQEGRRAADE
FT                   GDVSRVIVEALAPLERELTVLTVSSSAGIVTCAPIGQRQESGDYRESWQPATEPDGEAE
FT                   RARDIARTAVEGLVAKAQAAGETGWGVFGVELFVLTDGSILFNEVSPRPHDTGMVTMAS
FT                   QRLSEFALHARAILGLPITPEHVSLTIPAGSVAASHAIVVAGDGEVEFTDVAAALAEPG
FT                   TDLRIFAKPEVHGHRRMAVALAVGESEADARAKAGLVADALTITVE"
FT   gene            735420..735542
FT                   /locus_tag="BLJ_0587"
FT   CDS_pept        735420..735542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0587"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00063"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT57"
FT                   /protein_id="ADH00063.1"
FT                   /translation="MRQPIPFHTRSCSAADAIAARWFRMGQCAKTGLKRALIVL"
FT   gene            735500..736660
FT                   /locus_tag="BLJ_0588"
FT   CDS_pept        735500..736660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0588"
FT                   /product="glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00064"
FT                   /db_xref="GOA:D6ZT58"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT58"
FT                   /protein_id="ADH00064.1"
FT                   /translation="MRENGIEESIDRPLTIALVVDTVGNQGNGTSNSALQWAAELERQG
FT                   HHVRLVGIGAPEYPARVNKVPLVSWVAAKQLMQFAEPSDTLFRTAFQGVDVVHIYMPFK
FT                   FGRRAAKVAHQMGIPVTAGFHLQPENVLYSAGPLRRIPGISSFLYWLFKHWLYKHIDHI
FT                   HVPTEMTASLLRAHGYKAKLHVISNGYSPVYSPKKPADPDASAPVPFRVIASGRLASEK
FT                   DQITLIKAVSMSRHAGDIQLVIAGTGPLKQYLKFRAGRLLARKADIGFHKHADMPDLLR
FT                   SGDLFVHCSIADIESVSVIEAMACGLVPVIAASELSAASQFALIDESLFPVRDAALLAR
FT                   RIDWWIAHQAERAEWGEKYAEYTKAHYSVEASVHKFVDMERKAIGE"
FT   gene            complement(736807..737832)
FT                   /locus_tag="BLJ_0590"
FT   CDS_pept        complement(736807..737832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0590"
FT                   /product="Threonine aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00065"
FT                   /db_xref="GOA:D6ZT59"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT59"
FT                   /protein_id="ADH00065.1"
FT                   /translation="MLSFENDYSRAAHPAVLEAVAEANNHLYSGYGSDELSDQAKAKIR
FT                   EACGQPDADVWFLVGGTQTNQVVIDTITPAYAGVVAVASGHPNVHEAGAIEFSGHKVLT
FT                   IPQHNGKMDPTELDEFCKTFYADGNYEHMVFPGSVYVSQSTEYGTIYSKAELQAIADVA
FT                   HKYDMPLFADGARLGYALTTTGSDMTLADLATIADVFYIGGTKVGALFGEAVVFTKHNT
FT                   PKHFLTLIKQHGALLAKGFVLGAQFDALFTDNLYFKIARNANEAADRIREALRAKGYTL
FT                   TFEAPTNQIFVTMDQPTIDRLEREIKLGFTEKADDTHTVMRICTSWATTPEEVDQLIEL
FT                   L"
FT   gene            complement(737982..738057)
FT                   /locus_tag="BLJ_0589"
FT   tRNA            complement(737982..738057)
FT                   /locus_tag="BLJ_0589"
FT                   /product="tRNA-His"
FT   gene            738394..739455
FT                   /locus_tag="BLJ_0591"
FT   CDS_pept        738394..739455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0591"
FT                   /product="Bile acid:sodium symporter"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00066"
FT                   /db_xref="GOA:D6ZT60"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT60"
FT                   /protein_id="ADH00066.1"
FT                   /translation="MEKVKAFADWLTKWFTVIVIVWAVFNYFVPAASLWGKAYTGYMLG
FT                   IVLFGMGLTLTLDDFKRILTQPLMVIIGTVAHFIIMPLIAVALCAIFHLSGPLAVGVIL
FT                   VGCCPSGTSSNVMSYLSRGDVALDVSIGILSTLCAPFMIPLLMQLLASQYVSVPTQSLF
FT                   LNAVKVVLFPIALGVICHMIFGKKIEKVTVALPIVSQVAILLIIGVVVAANGPKLFVAS
FT                   SLMAIPVVILHNLCGYSLGFGFSKLMYKIYPKGFRYAQQKAITFEVGMQDSALGATLAL
FT                   TSFATNPLAAVPSTFFSVWHNISGSILSSWWRNHDDKHEIHWDSDNGEKGSAKSTVSAA
FT                   HPFDADKAAKVAA"
FT   gene            740171..740542
FT                   /gene="rpsL"
FT                   /locus_tag="BLJ_0592"
FT   CDS_pept        740171..740542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="BLJ_0592"
FT                   /product="ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00067"
FT                   /db_xref="GOA:D6ZT61"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT61"
FT                   /protein_id="ADH00067.1"
FT                   /translation="MPTIEQLVRKGRQAKPKKSKTLALKGSPLRRGVCTRVYTTTPKKP
FT                   NSALRKVARVRLSSGIEVTAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGALDT
FT                   QGVKDRKQGRSLYGAKKAK"
FT   gene            740548..741018
FT                   /locus_tag="BLJ_0593"
FT   CDS_pept        740548..741018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0593"
FT                   /product="ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00068"
FT                   /db_xref="GOA:D6ZT62"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT62"
FT                   /protein_id="ADH00068.1"
FT                   /translation="MSRKGPSKKHVVLPDPIYGSTVVAQLINKILLDGKKSIAEDIVYS
FT                   ALDMVKEKSDQEPVAVLKRALDNIRPSLEVRSRRVGGATYQVPVEVKPNRANTLSLRWL
FT                   TDFSRARREKTMAERLANEILDASNGLGASVKRREDTHKMAEANKAFAHYRW"
FT   gene            741050..743173
FT                   /locus_tag="BLJ_0594"
FT   CDS_pept        741050..743173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0594"
FT                   /product="translation elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00069"
FT                   /db_xref="GOA:D6ZT63"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT63"
FT                   /protein_id="ADH00069.1"
FT                   /translation="MAEEISDLHDVRNIGIMAHIDAGKTTTTERILFYTGKNYKIGETH
FT                   DGASTMDFMAQEQERGITIQSAATTCFWSRQSHDTKDKFQINIIDTPGHVDFTAEVERS
FT                   LRVLDGAVAVFDGKEGVEPQSETVWRQADKYGVPRICFINKMDKLGANFYYSVDTIKEK
FT                   LGATPIVMQLPIGSENDFTGVVDLVEMQAYVWNGTEELGAKYDTTEIPDDLKDKAQEYH
FT                   EKLVEAAAEADDELMNKFFEDGDLSKEDIRAGVRKLTIAKEAFPVFCGSAFKDKGVQPM
FT                   LDGVVDYLPSPEDVPAIKGYKPGDESVEIDRHPVKSDPFAALVFKISTHPFYGKLVFVR
FT                   VYSGSVVPGDSVLDSTREKKERIGKIFQMHADKENPMDRADAGNIYTFVGLKNVTTGDT
FT                   LCSINDPITLDSMTFPDPVIQVAVEPKTKADQEKMGIALSKLAEEDPTFQVTTDEESGQ
FT                   TLIAGMGELQLDIIVDRMRREFKVECNQGKPQVAYRETIRKAVMDQGYTHKKQTGGSGQ
FT                   FAKVLMNFEPLDTTEGKTFEFENKVTGGHISAEFIGPIEAGVKEAMESGVLAGFPVVGV
FT                   KATVTDGQMHPVDSSEMAFKLAGSMCFKEAAPKAKPVILEPIMKVEVRTPEEYMGEVIG
FT                   DLNQRRGNIQSMTDGVGVKVIDAKVPLSEMFGYIGDLRSKTQGRAMFTMEMDSYDEVPK
FT                   SVSEEIIKAQRGE"
FT   gene            complement(743250..743381)
FT                   /locus_tag="BLJ_0596"
FT   CDS_pept        complement(743250..743381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0596"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00071"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT64"
FT                   /protein_id="ADH00071.1"
FT                   /translation="MRLSTLVLFLCHYFCPPGRLVSFLRPFAQGLAYSTGFLGYVPL"
FT   gene            743346..744545
FT                   /locus_tag="BLJ_0595"
FT   CDS_pept        743346..744545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0595"
FT                   /product="translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00070"
FT                   /db_xref="GOA:D6ZT65"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT65"
FT                   /protein_id="ADH00070.1"
FT                   /translation="MAKEKYERTKPHVNIGTIGHVDHGKTTLTAAISKVLHEEFPDVNP
FT                   EYDFNQIDSAPEEAARGITINIAHIEYQTEKRHYAHVDCPGHADFVKNMITGAAQMDGA
FT                   ILVVAATDGPMAQTREHVLLARQVGVPKILVALNKCDMVDDEELIELVEEEVRDLLDEN
FT                   GFDRDCPVIHTSAYGALHDDAPDHEKWVQSVKDLMAAVDDYIPTPVHDLDKPFLMPIED
FT                   VFTISGRGTVVTGRVERGQLAVNTPVEIVGIRPTQQTTVTSIETFHKTMDACEAGDNTG
FT                   LLLRGLGRDDVERGQVVAKPGSVTPHTKFEGEVYVLTKDEGGRHSPFFSNYRPQFYFRT
FT                   TDVTGVIELPEGVEMVQPGDHATFTVELIQPIAMEEGLTFAVREGGHTVGSGRVTKILA
FT                   "
FT   gene            744764..745495
FT                   /locus_tag="BLJ_0597"
FT   CDS_pept        744764..745495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0597"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00072"
FT                   /db_xref="InterPro:IPR025503"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT66"
FT                   /protein_id="ADH00072.1"
FT                   /translation="MMTGSQAAHCGSVSALSLGLPVSTAIPEAKGTLPKALFVGKAPIS
FT                   GKLKQRLVNEIESITMLALVRSINTGLADGKLVPEVLVIGLKLTAKATGIPNEVIDLIA
FT                   GQRKSGIVFVCVRDVPFEGSTREECAFAVRRAIPGRAGHTPIYRVYAGDWQPAGEAQLE
FT                   LAGSTIDELWASLCSQTILGTPEIENLDARIIRHTEIARLESEVDKLTRDHQRVKNPVQ
FT                   RNEIYAKLHKAKTQLAKLREA"
FT   gene            745632..746450
FT                   /locus_tag="BLJ_0598"
FT   CDS_pept        745632..746450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0598"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00073"
FT                   /db_xref="GOA:D6ZT67"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT67"
FT                   /protein_id="ADH00073.1"
FT                   /translation="MFPMLETLVAVYEVGQFTLAADELKVSQSTVSSRIAQLEQMVGAP
FT                   LFVRNAKSDVTPTQAGRMLYQTAIGIDGLWRDTREQIARVQEAREPLAVSFSHTTAAIL
FT                   LPKALPVMARNMDSFDFAVHVMNSDAILERVSMKAVQLGVVEKPIVNDSVDRVTLCEDR
FT                   LVLAGEPDGVWMVREHGSGVRYYTDLYFKTAQVVPARTMEVSSNAAIVAALSAGFGQSL
FT                   ISEAAVPAGVPVQRELGDEFVRRFYALVPRSGLTHDQRELAEMIIAALRG"
FT   gene            746620..747684
FT                   /locus_tag="BLJ_0599"
FT   CDS_pept        746620..747684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0599"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00074"
FT                   /db_xref="GOA:D6ZT68"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT68"
FT                   /protein_id="ADH00074.1"
FT                   /translation="MREFCTKWWKRITTVDMLFIGVLTLLASLFASWLKQFPGFSLFGA
FT                   LIIALLIGMIIQFPIRSAYVGSNDGRKAGVKDAAGLISNKLLRLGIILLGFKLNLAVLF
FT                   TQGIKCLPIAAVVVTLTIIVCYAIARKLGVDPMLAILTAGGTGICGAAAVMGLAGSIKV
FT                   SEDKQDEKDNDVTMAVAIVAIMGTVFALLEIALGPLTGMTKDQLGITAGASLHEIAHAV
FT                   AAGDAFGAVDIATIMKLSRVLMLVFAAIIIAIWWEKKHSEMENTGKKTVAFPWFMLGFI
FT                   GASIIGTFVPLIASITPQLVDFAYIVLGMAMAALGINVNFKAIASKGKKPMLASFLTSI
FT                   LLMCFAAGVAMLFF"
FT   gene            complement(747872..748087)
FT                   /locus_tag="BLJ_0600"
FT   CDS_pept        complement(747872..748087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00075"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT69"
FT                   /protein_id="ADH00075.1"
FT                   /translation="MANMREKNKQNGLAVLGEYVGVSATQTIVEYATFAILHLIGVPSQ
FT                   IANSPVPWRCSCCYGAGSLWRSQSWW"
FT   gene            complement(748147..748512)
FT                   /locus_tag="BLJ_0601"
FT   CDS_pept        complement(748147..748512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0601"
FT                   /product="Camphor resistance CrcB protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00076"
FT                   /db_xref="GOA:D6ZT70"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT70"
FT                   /protein_id="ADH00076.1"
FT                   /translation="MTVFLPILVCLCGGVGASCRYLLDVTIKTYWRRAFPLSTFTINLI
FT                   AGFLAGLVAAMALGGTLDEPWRLVLATGFLGGFSTFSTAINEMVTLFRKHRYPTAAAYL
FT                   VLSLGVPVVAAACGFLA"
FT   gene            complement(748512..749048)
FT                   /locus_tag="BLJ_0602"
FT   CDS_pept        complement(748512..749048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0602"
FT                   /product="Camphor resistance CrcB protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00077"
FT                   /db_xref="GOA:D6ZT71"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT71"
FT                   /protein_id="ADH00077.1"
FT                   /translation="MGSQSPSADARPGTRTATPPAHKLPDIHLDIVLVVFCGGAIGTAI
FT                   RYAFAQIPAAGSFHTGTFVANMLACFCYAGLTAYLAGSSRFRARAKELASRGLGMGVCG
FT                   GLSTMSTLALEGFTAIRDGQVAAGIAYLLVTFALGLVCASAGVWAGTHLAGSSNASAEA
FT                   SADTNAATTSKGGKA"
FT   gene            749386..750429
FT                   /locus_tag="BLJ_0603"
FT   CDS_pept        749386..750429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0603"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00078"
FT                   /db_xref="GOA:D6ZT72"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT72"
FT                   /protein_id="ADH00078.1"
FT                   /translation="MSETMKAAIFVEPGKMAVEEVPKATLEQDDDIVIRVVRTCVCGSD
FT                   LWFFRGLSGQAAHSQVGHESIGVVEEVGAAVESVKPGDFVVVPFPYSCGKCPVCKAGFE
FT                   SVCPHGGYFSACQAEYLRVPEADGTVVKVPGSPEDYDDATLASLLTVSDVMSTGYHAAV
FT                   SAEVKPGDTAVVMGDGAVGLCGVIAAKMRGATRVIAMSRHEDRAALAREFGATDIVPER
FT                   GQEAIDKVLEMTGGYGADAVLECVGSKQSFDTAIGLVRRGGVIGRVGLPHDVEISAEGT
FT                   FYGNVGIKGGPAPVRHYDIDGGLLDAVLKGEINPGRVFTAEYDLDHIQDAYEAMDQRKV
FT                   IKALIRF"
FT   gene            750660..752021
FT                   /locus_tag="BLJ_0604"
FT   CDS_pept        750660..752021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0604"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00079"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT73"
FT                   /protein_id="ADH00079.1"
FT                   /translation="MLKRKMLDKLIAWKQKAGGRESLLIEGARRVGKSTIVEEFGRTQY
FT                   KSYILIDFARLPRDVRDIFENQRDDFDTLFMLLSAYYRKRLYERESLIIFDEVQRYPAA
FT                   RELVKYLVADGRYDYVETGPLISIKRNVANIVIPSEERKMDMGPLDFEEFCWAMGEELL
FT                   AETIRKSFERLVPLPDALHKRAMRLWREYLLVGGMPQAVADYVEQRDFGEVDLIKRGIL
FT                   QLYSDDIGKFANGDAGRVRGIFAQIPGQLSKHEKRFTLASVDKGARSREYDSAFFWLED
FT                   ARLVNLCRNSTDPLVGLGLYEDNDSFKCYMADTGLLVSQAFADRETTPDDVYRDILFDK
FT                   LSLNEGMLVENAVAQQFRANGRKLYFFSRSDRADATKTMEIDFLIVREYDNAAMKPRIS
FT                   PIEVKSTKRYGVSSLDKFRKRYAQRLGKEYVLHPRQLEVDGERIKLPLYMAHCL"
FT   gene            complement(752130..752747)
FT                   /locus_tag="BLJ_0605"
FT   CDS_pept        complement(752130..752747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0605"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00080"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT74"
FT                   /protein_id="ADH00080.1"
FT                   /translation="MPWFSAKNALAEDPVMGLLREQVTTTRKGVSIALDAVEGHLSVDE
FT                   SRKSVNDIEHEGDEVRSKVVHALAKAWTTPLDREDLFRFSRSIDDVLDNTRDFIREIHL
FT                   WKGHAGEHANVALTHVNVALHDLELAVTAEGADMRRYCLEASKESAHVRRAYESGLAAV
FT                   YTGEMSMDTLKTRDLLRRVDVIGLRLGESSDAILDGLVKRGL"
FT   gene            complement(752888..753760)
FT                   /locus_tag="BLJ_0606"
FT   CDS_pept        complement(752888..753760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0606"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00081"
FT                   /db_xref="GOA:D6ZT75"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="InterPro:IPR032160"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT75"
FT                   /protein_id="ADH00081.1"
FT                   /translation="MSTKTAAPRFGRERYADINIDLNRACDQSPFVIAAHRGTPRGDIR
FT                   ENTLNGVIATTKVNADIAEIDVIRSTDGEYFAFHDGTEMARLRITDDILSKTAAELDEL
FT                   RYTEYPGAYYGNVERVAHILSNAPDILINIDRSWRYWSTGFLDWLDQFHLERKLILKCP
FT                   VAEGFQQALHDHETKYMFMGMIQSPDELDLFVDDEQINTVGVELVATTEDTPLADPAVF
FT                   RTISEHGLYSFVNALDLGNGYCGLKGMDDTRSILEGPQHGWGALLTLGANVIQTDWPEK
FT                   LDEYRRVIA"
FT   gene            complement(753868..755220)
FT                   /locus_tag="BLJ_0607"
FT   CDS_pept        complement(753868..755220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0607"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00082"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT76"
FT                   /protein_id="ADH00082.1"
FT                   /translation="MRKSTLLKAAAIAVLPMLALSACGSSSNTNADANGGEQNVTFWYS
FT                   NSGPAVDAINQLVSEFNDANKGKIKVEASYQGSYTDVQQKFSAAVQAKSTPSILQMNDT
FT                   STGYMIDSKMTTPVYKFAEGDSDFDTADLQPVALKYYSDDNGLLSLPFAISQPVTYINN
FT                   KLAQQAGLDVSNPPTTFAEVVDWANTIHEKTGAYGFSMNMVDSWILEELSASHGELIAT
FT                   PDNGRGGKAVTGVNMTSATQLDMFQKIADMFKDGTALNPGTDSSSMMTAFTSDKLGLVL
FT                   TSSASYTSLLPGDSTSNVTVAQFPHDASNKKAGTPIGGNSLWIVAAEHSEAEQKATWEF
FT                   GKYMMAPHAQAVFAKASGNLFANTKAADETEGKEALADPNVKVFYEQLEANPSTSVSLG
FT                   ARTGAYPSIRKDVMASFNEVVSGSKDLKTAMQEAQTQSAKDIATYNKAAGK"
FT   gene            complement(755380..756186)
FT                   /locus_tag="BLJ_0608"
FT   CDS_pept        complement(755380..756186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0608"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00083"
FT                   /db_xref="GOA:D6ZT77"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT77"
FT                   /protein_id="ADH00083.1"
FT                   /translation="MIRKTSPVSQGLWAALALIVTVLVMLPVLYIYVGAFFFDANGLFK
FT                   GFTLGNFMRAMSQMPLTQQLGNSIVVTVCQTAGQIVTAFLAAYAIVFCNLRRPGMWMMV
FT                   FLMSMMVPGETTLLSNYLNIANWGLMDTIPAIFLPFLVQGFTVFLFRQAFRSFPKELRE
FT                   ASLIDGAGHLQFMIDVLLPIVKPTIIAATINAMVAAWNGYFWPLLVTNKPEHRTIQVGI
FT                   TQLSGTDGSNIGVVLAGAAIAVVPAMILTLLFNRSLRGMSVAGSIK"
FT   gene            complement(756186..757181)
FT                   /locus_tag="BLJ_0609"
FT   CDS_pept        complement(756186..757181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0609"
FT                   /product="sugar ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00084"
FT                   /db_xref="GOA:D6ZT78"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT78"
FT                   /protein_id="ADH00084.1"
FT                   /translation="MALGKAMPEPEKERKREMASSTHSSQSPHGAKTHGGRTANVLVAK
FT                   NRLTGAVMLVPALALLVVFVFGPLVRVVMMSMQGTDIFGSPSGFIGLENYRTVFTDPAF
FT                   VKVLIQTFLYAVLVVAGRIALGVLLAILLTRHIMGIKILRVAMTSIVSVSVAAASLGFL
FT                   ALFGSSGVINSIIEKLGIRPVGFLTDAKWAFFTVTLVTIWTGLGFALILLCAAIDGVDQ
FT                   EILEAARIDGANEARIQWSIVLPLITPTLFYIAVTTCIEALQAFAQINILTKGGPGQAT
FT                   TTITYNIYTTAFNAGSANFGIASALGIVLFLFVFVLTLLQFRFLEGKVNY"
FT   gene            757469..758410
FT                   /locus_tag="BLJ_0610"
FT   CDS_pept        757469..758410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0610"
FT                   /product="phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00085"
FT                   /db_xref="GOA:D6ZT79"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT79"
FT                   /protein_id="ADH00085.1"
FT                   /translation="MWVIPMLALVFCLLGGRNDGSPLVAINLKAARRVTAAPFLMLATA
FT                   VALLPAANSRVGGTIVAMVSSEGSGGQSPLLLATVLVAASATLLALNGGGVPTSITLAL
FT                   VGASSGAGFAGGQPQWHLVLRVLGIAILSPLVAFAISRTIYLLFQSRTPQSSTAMVFLG
FT                   FLLTCIAYGSNDGQKMIALFGTAMGVDLGTATHSAAITAIVAATFLTGVLTGMPKGAAA
FT                   LQRGTIVPDSRQIWVTLWAASAAVLVSSAAGSPVSMTQSISGALIGTCQTNDWRKVRWG
FT                   EARRILIAWAATLPMAWILGYAAANGLDLLPL"
FT   gene            complement(758510..759538)
FT                   /locus_tag="BLJ_0611"
FT   CDS_pept        complement(758510..759538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0611"
FT                   /product="regulatory protein, LacI"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00086"
FT                   /db_xref="GOA:D6ZT80"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT80"
FT                   /protein_id="ADH00086.1"
FT                   /translation="MEAAESRQPTIFDVAAEAGVSKSMVSRVMRGEGGVRQEKVDRVLA
FT                   AAEKLGYVPSAMASGLASKRTKTLGVVVRNAKLPFYGFLQGAMQKRARERGYQMVSISG
FT                   VEELSADDARQALRDLIALRVEGLIVCSAMLAVEDFMPFIDRIPFVMAGHEDTTRTVSS
FT                   VFCDEEDGGRRLAQYVHDFGHREVAVFLVPRKYSVSQYGRGMAMIELLGQLGIRVKVMD
FT                   MKGAEEVGTLVDEVLCHPRITAYMCPSDVVMLNVMDELRRRDVSVPQDVSVTGYDGFGP
FT                   LASPYLGFTTYRQPLEEIGSRAVDLVLERLDGGDHAVEALPVKGEFIHGRTVALPRWKD
FT                   GR"
FT   gene            complement(760590..761165)
FT                   /locus_tag="BLJ_0612"
FT   CDS_pept        complement(760590..761165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0612"
FT                   /product="MarR-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00087"
FT                   /db_xref="GOA:D6ZT81"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT81"
FT                   /protein_id="ADH00087.1"
FT                   /translation="MSSTSNNTADGDIKNDVLSSFISIGRIMAYRAIHRRLVSPGAKSP
FT                   RGEHAFDPRRGQGRVLATLRESDQTSQKDLAAMFDMSRQAMAELLKKLEASGHISRRPS
FT                   RRDSRVMMVSLTNQGRKAADLLGKAPDQTSSMLDCLNETELQTLHGYLQRIIDTSSDDL
FT                   PASTAEDVKKCELLIEHLKRRRMPADRA"
FT   gene            complement(761182..761925)
FT                   /locus_tag="BLJ_0613"
FT   CDS_pept        complement(761182..761925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0613"
FT                   /product="Dioxygenase-like 2-nitropropane dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00088"
FT                   /db_xref="GOA:D6ZT82"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT82"
FT                   /protein_id="ADH00088.1"
FT                   /translation="MNITHDMSNDLTEYDPESRQVDGPNPIENRISSSAARVPDIISCT
FT                   SGITVQGRQLHSFAFTTDAAIIRNTNADAILAVYPFTGEPVITQALLTVAQAPLFVGVG
FT                   GGTTTGPRVIQLAMMAEMQGAAGVVLNAPAPPSTVYDVARITNTPVIATVLTCDDELDE
FT                   KIEAGASIINVAAGRRTPDVVQQTRQRHPSIPLLASGGSTDESMAETIVAGANALTWTP
FT                   PNAQEMQRSMMMRYRGESTGDNMQH"
FT   gene            762095..762931
FT                   /locus_tag="BLJ_0614"
FT   CDS_pept        762095..762931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0614"
FT                   /product="Putative AAA+ superfamily ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00089"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT83"
FT                   /protein_id="ADH00089.1"
FT                   /translation="MRMLFDADLSVERLIPALSIESGTRITPEDTLVIFDEVQEVPRAM
FT                   TSLKMFNEDAPEYDVLATGSALGIAMHLGFSFPVGKVSRLKLYPMSFVEFLYACKQYAL
FT                   AEMLEPKDFPLINVMHDRVMTWLRYFMYTGGMPEIVEAFASTLPNPDFTAVRKLQNSLV
FT                   SDYRDDFSQHVDMRDSPAVTTLRLNQVWDSIPSQLAKENKKFVYGVVRAGGRGKDFESA
FT                   IQWLVDASLTLRASAIAQAGTIAFPVTRIPLVPPPGIGRLDEVTPSCEPSNDQGQR"
FT   gene            763339..765096
FT                   /locus_tag="BLJ_0615"
FT   CDS_pept        763339..765096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0615"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00090"
FT                   /db_xref="InterPro:IPR025101"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT84"
FT                   /protein_id="ADH00090.1"
FT                   /translation="MPSHARTVTRTTHRVRNALLVVLLLLVVCAAAAGFSGFKLYKSAM
FT                   SAKAHLNNVVNAAKVIKDGSTDDIVKALSDVSYIQEEAAAAKQDVSGGLWTLAEKMPVV
FT                   GGDVKTARTAIGTIDDFAQTTLPQLGKVVTTLTGASLSSGDGQLNMEPIIAAAQQLATV
FT                   DQSVQSQARTIQDLPDAKLGVVNNALQNGKTQMAALAQVTENLSGMLNMLPNFLGANGA
FT                   RNYVLLAQTNSEIRGTGGLIGSAGSFSADNGKIAVGEFHADAEFPSNAALDDVNQDGDG
FT                   TLYSGLYFGQVIHNLSSTPDFPRVASMAQKFWQAAPFGGSSDGVMSFDPVALQAMIGAT
FT                   GDVTLSDGRVLNGSNTAEFLLNGAYKELTPSAQDQYFSETAAQAVAHLFSDMNTQKLMT
FT                   VAKTMLRMAEQRHLYFWSFHEEDQAVLRSAGVTGEITNDAKNPVTGVYFNEMQASKMDW
FT                   YIQRKSTVKRTGDNTYHVTYSFTNTLQPGEAGSLPEYITANAKGGVAVNRVVIYTPAGG
FT                   EVSNVSASNGSSFAQVQAKDHMTYMDDISLAPQDTVTIEYDVTTAAGSANLKLDQTPTT
FT                   GDPAITYEY"
FT   gene            complement(765250..765447)
FT                   /locus_tag="BLJ_0617"
FT   CDS_pept        complement(765250..765447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0617"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00092"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT85"
FT                   /protein_id="ADH00092.1"
FT                   /translation="MLGTAPPPRYLTSVRVSRRHLFLDFALGCRRLSFMVSSIITANDS
FT                   SRTPDENLSSWAPSAICNSN"
FT   gene            765446..768034
FT                   /locus_tag="BLJ_0616"
FT   CDS_pept        765446..768034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0616"
FT                   /product="excinuclease ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00091"
FT                   /db_xref="GOA:D6ZT86"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT86"
FT                   /protein_id="ADH00091.1"
FT                   /translation="MSNDQRPQTIEVRGARVHNLKNIDIDIPLGELVGVAGVSGSGKSS
FT                   LALGVLYAEGSRRYLEALSTYTRRRLTQASRAQVDEVLHVPAALALHQRPTVPGIRSTF
FT                   GTMTELLNSLRLLFSRVASHVCPHCGARNESTLNVAAGLPITCAGCGKEFHAPGAESLA
FT                   FNSAGACPTCSGTGIVREVNRAALVPDESKSIDDGAVLPWGSLMWDLMKQVCGAMGVRT
FT                   NVPFSELTPEERDIVFNGPAVKKHILYKPKKGDDFAELDFTYFNAVYTVENALAKAKDE
FT                   KGLKRVARFLKEGPCTDCGGTRLSVAARAPHVRGLNLAEASAMTLDAAVDWVRGVPESL
FT                   PADMRTMATNICESFLDVARRLLDLGLGYLALDRAGATLSTGERQRVQLARAVRNRTTG
FT                   VLYVLDEPSIGLHPSNVDGLLGVMHDLVADGNSVVVVDHDVRVLKAADHLIEMGPVAGA
FT                   EGGHVIAQGTVGEVAANPGSRIAPFLSDQANARIRERVAEPQVFDLGHIRMTTSQLHTV
FT                   KPLDVDIPRGRLVAVTGVSGSGKTTMVLESLIPALKAQAAGERLPEHVRELEAEGIHRA
FT                   NLIDATPIGANVRSTVATYADIHDELRRAFARTDGAKAGGWKAGDFSYNTGRLRCPTCD
FT                   GTGSISLDVQFLPDVTIECPDCGGSRYASEAGAIRRAVKAAKGKAAKMKVPDKRKAAKE
FT                   KLSEATDQGGGNISLSLPQLMAMSVDQALSVTGDLKKVHARLTTLRDLGLGYLTLGEPT
FT                   PALSGGEAQRLKLASEMGKAQSDAVFVFDEPTIGLHPLDVRVLLGVFDRLVASGATVVV
FT                   IEHDLDVIANADWIIDMGPGGGESGGHIVATGTPEQIAANPNSITGRYLR"
FT   gene            768092..769450
FT                   /locus_tag="BLJ_0618"
FT   CDS_pept        768092..769450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0618"
FT                   /product="MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00093"
FT                   /db_xref="GOA:D6ZT87"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT87"
FT                   /protein_id="ADH00093.1"
FT                   /translation="MVQIHGIRRASADAKYRQMTGQPVKPLILKLCLPAVISNLVTTAY
FT                   NLTDTFFIGQLGTAQSGAIGIAFSIMTVMQALGFFFGNGAGNSMSRELGKQNNERASRL
FT                   LAVGFAGAVLSGLVIATIGLLTLRPLVVMLGSTSTIAPYAVQYLTPLLVAAPCVCGSFA
FT                   LNGLLRYQGQSAFGMIGLVSGALLNFLLAPLFIFVAGLGIFGAGLATAICQTVSFTILT
FT                   TMSRKFGVMKLSLRNCKPDVLLMREVAGGGLPSLIRQGAGSISVTCVNIAANPFGDAAI
FT                   AGMAIVMRIMLGANSVIVGLGQGFQPVCGYNYGAGLFARVKEGYWFCVRLATCVLVALA
FT                   ALLWIFAPQLVEIFRSDPAVVAVGVAALHIQCCTVILNGFNMMGNMMTQTMGRTGIASF
FT                   LALCRQGLFLAPIVLILPMMFGVLGVEMAQSVSDVLTFVVTIPFMRRILHELR"
FT   gene            769696..770388
FT                   /locus_tag="BLJ_0619"
FT   CDS_pept        769696..770388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0619"
FT                   /product="HhH-GPD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00094"
FT                   /db_xref="GOA:D6ZT88"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT88"
FT                   /protein_id="ADH00094.1"
FT                   /translation="MQNMKRMKANQAHKWPVPERIELLYRTMADALGPTGWWPAETTFE
FT                   IMVGAVLTQNTAWSNVDRSLAALKAEDVLEPHALVAMEPERLQELIRPSGFYVNKSKTV
FT                   QSLSWWYVERCGAAPEGAAAISDAELRAELLGLFGIGGETADDLMLYVFSRRTFVADTY
FT                   ARRLFAFLGFDVPAGYLAFHRAYSPVVLDTNLSVKDLQEFHGLIDEFGKAYRDDAAKSE
FT                   SFLGGWRA"
FT   gene            770550..771224
FT                   /gene="lacA"
FT                   /locus_tag="BLJ_0620"
FT   CDS_pept        770550..771224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacA"
FT                   /locus_tag="BLJ_0620"
FT                   /product="galactoside O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00095"
FT                   /db_xref="GOA:D6ZT89"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="InterPro:IPR039369"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT89"
FT                   /protein_id="ADH00095.1"
FT                   /translation="MMTEDKPIAKPIIDDATREKMALMFSGEVYLPDDVDGFFDLQAAQ
FT                   RDLQLELNATPLTNPKRRTELMQAFFGAAGEGLYLECPVYANWGCNTYWGERCYANFNL
FT                   TLVDDGEIFIGSHTMIGPNVTLVATGHPVRPDLRYQGAQYSLPVHIGENVWIGANVTVL
FT                   PGVTIGDNAVIGANSLVTKDIPANTVAYGSPCKVIREINERDDVYYWRDRQFSERFKLK
FT                   EQ"
FT   gene            complement(771234..771434)
FT                   /locus_tag="BLJ_0621"
FT   CDS_pept        complement(771234..771434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0621"
FT                   /product="Isoleucine patch superfamily acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00096"
FT                   /db_xref="GOA:D6ZT90"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR039369"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT90"
FT                   /protein_id="ADH00096.1"
FT                   /translation="MWVGANVSILPGVTIGDNCVISAGSVVTHSIPANSVTYGAPCEVV
FT                   REIGDKDREYFYKNRKLDVWE"
FT   gene            771662..772750
FT                   /locus_tag="BLJ_0622"
FT   CDS_pept        771662..772750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0622"
FT                   /product="Auxin Efflux Carrier"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00097"
FT                   /db_xref="GOA:D6ZT91"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT91"
FT                   /protein_id="ADH00097.1"
FT                   /translation="MGQFGVMIGQLVGFLIMLMVGYGCVRLRFYGQTALDGMCSLLLNV
FT                   LIPVLVFSNAVDGADRAQLASNWGVMLLTAVMYALLILVFWLVAELLRLKGSRSHVFQA
FT                   SLIFGNAGFIGIPLIMALWPQNGAIYVALMSIIDQTLLWTYGVWLCEPVGETTGGNAIG
FT                   ARGAVVNGSVNGAGSVGNAGSASNAANGGSPAVVRPSPGTRVLGLLKRFVNPAFVGVML
FT                   ALILILLGVKVPDIILKPLHTIGNMATPMSLIYLGGLFALTKWWGVLKRYELYAGLVAK
FT                   MIAFPLAFYALLTALTGASPQLPITHDMVLMITVIAGLPTMTTIAMFTGRKNNMPEYAV
FT                   GFVLVSTLFSLASLTIVSAVVF"
FT   gene            773057..773359
FT                   /locus_tag="BLJ_0623"
FT   CDS_pept        773057..773359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0623"
FT                   /product="beta-glucuronidase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00098"
FT                   /db_xref="GOA:D6ZT92"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT92"
FT                   /protein_id="ADH00098.1"
FT                   /translation="MNTEPNKPFLFTEYGADTDAGAHKLPSVQWSEEYQCEYLTMQHEV
FT                   FDMFEAVVGEQVWNLCDFQTGEGIMRVDGNKKGVFTRDRQPKAAAYVLRERWETK"
FT   gene            complement(773539..774975)
FT                   /locus_tag="BLJ_0624"
FT   CDS_pept        complement(773539..774975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0624"
FT                   /product="glutamine synthetase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00099"
FT                   /db_xref="GOA:D6ZT93"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT93"
FT                   /protein_id="ADH00099.1"
FT                   /translation="MTELKSKEDVEALINKEGIEYVSVRFTDLIGVQQHFTVPASEFLK
FT                   DAFTDGMPFDGSSVQGFQAINESDMKLVPDVETSFVDPFRKHKTLDVAFSIVDPLTDEP
FT                   YSRDPRQVAGKAEAYLKSTGIADTASFAPEAEFFIFDKVRFENSMQRSFYEVDSIEAPW
FT                   NSGVDSEEDGTPNIGFKNRVKKGYFPVPPIDHTQDLRDDMVANLQKVGLILERSHHEVA
FT                   GAGQQEINYRFNTLQHAGDDLMKYKYVVHETAALAGKAATFMPKPIADDNGTGMHCHQS
FT                   LWKDGKPLFYDEKGYAGLSDLARWYIGGLIKHSSSVLAFTNPSLNSYHRLVPGFEAPVN
FT                   LVYSARNRSAAIRIPLAGTSPAAKRIEFRAPDPSCNPFLAFSAQLMAGLDGILNHIEPP
FT                   EPVDKDLYELPPEEHAGIKQVPSSLAEAMDALEEDHDFLTAGDVFTDDLIETWIGLKRD
FT                   EIDQARLAPTPLEYELYFHI"
FT   gene            complement(775295..776077)
FT                   /locus_tag="BLJ_0625"
FT   CDS_pept        complement(775295..776077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0625"
FT                   /product="conserved hypothetical transmembrane protein"
FT                   /note="narrowly conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00100"
FT                   /db_xref="GOA:D6ZT94"
FT                   /db_xref="InterPro:IPR025445"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT94"
FT                   /protein_id="ADH00100.1"
FT                   /translation="MAEKDAKPKKQSTIKQIIQIYKYTAKEDKALPWLEAGAFLLPVVV
FT                   MIIIGLIVKWTWLTWIFTMITAIMLGILLATMMLTRRADAVGYKQIDGKPGAAIGVLSN
FT                   MQKAGFDFPQEPVWIDPKTKDAIWRGTSMNGIYLIGEGEYGRVMKAMDRQERDIKGVTA
FT                   GSSIPIYRIAVGHGPKQVPLTKLRSTVIKSKSYEPTHHKNALIAKIHPRRRFLLTKAEM
FT                   ETLNDRLRTLQAKKGYAIPKGMDPNRPQKISRRAMRGR"
FT   gene            complement(776161..777651)
FT                   /locus_tag="BLJ_0626"
FT   CDS_pept        complement(776161..777651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0626"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00101"
FT                   /db_xref="GOA:D6ZT95"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT95"
FT                   /protein_id="ADH00101.1"
FT                   /translation="MSEQFDLVIIGAGPGGYSTALRAAELGMKVALVERDATVGGTCLN
FT                   RGCIPSKALITATHTIDTVHRAAELGVNASVNGIDFGTLRDYRLRVVKTMVGGLAGLLA
FT                   HRGITVFRANAAFHADEIAPATSNHIVHLVPSPDQSDILTYHKADVPEPSGPTMDLTAT
FT                   NIVIATGAKPHPLPGNPFAGALIDSTQALEVNEFPSSAVIIGAGAIALEFASMWNAAGS
FT                   KVTLLIRKDRVLSAWDRRAGTTLTRELKRHGVNIITRASVTHVDTGANLGATVHYTREG
FT                   QDGEQSVWGEIALVAIGRDPITDPAWGVTIDDHGHVATDAYGRTDKPGVWAVGDVTAGH
FT                   ALAHRAFEQGIVIAETIAGLNPKPVDEAAVPQIVFSFPEAASVGLTVEQAQAREDLVEI
FT                   KETNYPMLANARMLMSGTAGSLTIVSGCDAANPDTPRVLGVHMVSPMASDIIAEAEQLV
FT                   GNHVPLADAARLVHPHPTFSETLGEALLKADGRPLHTR"
FT   gene            complement(777799..778422)
FT                   /locus_tag="BLJ_0627"
FT   CDS_pept        complement(777799..778422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0627"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00102"
FT                   /db_xref="GOA:D6ZT96"
FT                   /db_xref="InterPro:IPR021403"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT96"
FT                   /protein_id="ADH00102.1"
FT                   /translation="MTWNPFRKKEEAQVPVEQAPKKAADPSEKKGRPTPKMKQAQAAGI
FT                   RPLVPVDRKASAKAAKARLRERENAEYEAMQKGDINHMPKSERLPWRIYIRDYVDARFN
FT                   LGEWFIPVAFAILIVSMFVTSLMQNQWASIIMMALMYGYLIAVIIDVWLMWRKLKAKLI
FT                   AKYGEQSVSKGSRSFSYAWSRSIQMRRWRLPKPRYPKRGHWPAD"
FT   gene            778526..779893
FT                   /locus_tag="BLJ_0628"
FT   CDS_pept        778526..779893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0628"
FT                   /product="peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00103"
FT                   /db_xref="GOA:D6ZT97"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT97"
FT                   /protein_id="ADH00103.1"
FT                   /translation="MATLTADEIRSRVETDWNRIVKVLAEKVALQSISAKGITAEHMKR
FT                   SAEFVADELRLVGVDAKVVQASNADGTPGAWEVIGSHIVSPDAPTVLLYAHHDVQPVPD
FT                   PAEWNTDPFVATEIDGRLYGRGSADDGGGIAIHSGALKALGDDLNVNIKVFIEGEEEMG
FT                   SPSFIPFIEAHRDEFAADVIIVADSGNWSADIPSLTTSLRGNTCVDVTVQGLEHPVHSG
FT                   QYGGPILDSNTLAAMLIASMYDENGDLAVPGVAAEEPIGGLQRDLDETTVREDSGVVAG
FT                   YEFAGTGSLASRLWTKPSVTVIGFDAHPVEGSFNVIAPETRFRLSLRTAPTQRPEEAQE
FT                   ALAAFLESHAPFGAKVTVERGENGMGWAMDPTAVATKDVLEAMTEAFGVEPINKGEGGS
FT                   IPFIPELQRIFPNAQVLVTGPEDPKANAHSPNESISLPGLKNNVITEALLLDKLGK"
FT   gene            780152..780793
FT                   /locus_tag="BLJ_0629"
FT   CDS_pept        780152..780793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0629"
FT                   /product="conserved hypothetical protein"
FT                   /note="narrowly conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00104"
FT                   /db_xref="GOA:D6ZT98"
FT                   /db_xref="InterPro:IPR017195"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT98"
FT                   /protein_id="ADH00104.1"
FT                   /translation="MYVRPAYEQKKGTFMTEAVAKANYKWRVVDIVVAAIIAVASGVIF
FT                   WGWDIVCSAPLALFEGVTPGFEGLLNGFWLFAGPLAAIIVRKPGAALFAETLAAFLELT
FT                   LGNQWGVGGSLIVGIIQGLGAEIAFAVFAWKKWNIGTTILSGALAGVGCWAYYWATNPG
FT                   WNGLRVTWYLVGSIISGVVIAGVVVWYLSRALAATGALERFESGRSKARV"
FT   gene            780793..782271
FT                   /locus_tag="BLJ_0630"
FT   CDS_pept        780793..782271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0630"
FT                   /product="ATP binding protein of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00105"
FT                   /db_xref="GOA:D6ZT99"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZT99"
FT                   /protein_id="ADH00105.1"
FT                   /translation="MQVNPAAVEASGWGWRHATRKDFALRAADFAIRPGERVLLLGASG
FT                   AGKSTMMAGLAGVLGGDEEGEQEGSLTIDGVDAREARGRVGLVLQDPDSQIILERLGDD
FT                   AAFGCENLNVPREEIRQRVGESLDMVGLGGLELDRSTRHLSGGQRQRLALAGVLAMKPG
FT                   LLLLDEPTANLDPEGVVEVHDAVKKVIEATGQTMVVVEHHIDVWLDLVDRVIVLGRPDA
FT                   SSPTGAVIADGKPDEVFAEMGDVLAAGGAWVPGRAIPDYSPKREPAHDAPVLSTENLSF
FT                   GRGTALGVGINLDFYPGEVTALMGPNGAGKSTLALTLAGLLEPIAGKVFIADNLKPAHA
FT                   GREPIDWKSKELLGRIGMVFQEPEHQFAANFVRDEVAIGPKSMGQSQDEAYQTADRMLE
FT                   QMNLTRFAKANPYTLSGGEKRRLSVASMLAAAPKVLVMDEPTFGQDFSTWNEMVKLIAA
FT                   IRDQGSCVVMVTHDEALVDALGARRVMFEEARHE"
FT   gene            782264..783091
FT                   /locus_tag="BLJ_0631"
FT   CDS_pept        782264..783091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0631"
FT                   /product="cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00106"
FT                   /db_xref="GOA:D6ZTA0"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTA0"
FT                   /protein_id="ADH00106.1"
FT                   /translation="MSDVVTVSPQETRVEPVKASSPSWFIARINAVSRIIGALLLCIPM
FT                   FISLDVVSASTALGIEFVLLWIGGVAPWTVCRKTWPVWIAAAGSFISVFLYGRTSGEIL
FT                   WQGGWIVISEGSVNLAIATAIRVAAIAVPGVILALGLDPTDLADGLVEILHFSPRFVYG
FT                   GLAGLRMFTLLQEDWRALGLSQRSRGLGDGNAIARALSQAFGLLVLSIRRATKLATAME
FT                   ARGFGSSAPRSQARISRLKPVDWIFYVICLAVPLASIGVAVGTGNWHFAFQGV"
FT   gene            783203..784081
FT                   /locus_tag="BLJ_0632"
FT   CDS_pept        783203..784081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0632"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00107"
FT                   /db_xref="GOA:D6ZTA1"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTA1"
FT                   /protein_id="ADH00107.1"
FT                   /translation="MPINAQILDNPKSDRVRRIADLTRAKGRERSGRFLIEGPQSVREA
FT                   VTWRPDVVQDLYVEVSQALEHPRIISSTLEKIVETSQDATIYVHYCTGDVMHRISPDAQ
FT                   GIVAVGNAESMHAGADDVELGKNGRGPQIAAFWQVRDPGNAGTVIRAADAAGCDAVIFV
FT                   DDCVDVLNPKVIRSTAGSLFHLPVLAMSTDEFFTWTGDHNMGVWAADVYGTEECKPESL
FT                   PAVLADKAAVEAPKAVLFGNEARGLEPDILTRCGRIVSIPLYGKAESLNLGTSAAVMLM
FT                   SLSMSGHVERM"
FT   gene            784147..785202
FT                   /locus_tag="BLJ_0633"
FT   CDS_pept        784147..785202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0633"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00108"
FT                   /db_xref="GOA:D6ZTA2"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTA2"
FT                   /protein_id="ADH00108.1"
FT                   /translation="MVFDADQVTAEVAKGIEKIQNASNLEELKAIKTTYAGADSAMTKA
FT                   SKAIGSLPVDQKKEAGKLMGKLRADFGRAYGPKEVELKEAAEKAALAAETVDMTLPVNR
FT                   KPLGARHPLPKLMEDVEDFFISMGWQISSGPEIEAEWYNFDSLNFGPDHPARQMQDTFY
FT                   VKGNQAKDAAGFVGSNMVVRTQTSSDQVRALLTRGVPLYIASPGRVFRTDELDATHTPV
FT                   FHQCEALAVDKHLTMADLKGVLDKLAVAMFGPEAKTRLRPSYFPFTEPSAELDLWFPDK
FT                   KGGPGWLEWGGCGMVNPNVLKSAGIDPDVYTGFAFGVGMERTLLLRSDINDMHDLVEGD
FT                   VRFAEQFVMGE"
FT   gene            785210..787819
FT                   /gene="pheT"
FT                   /locus_tag="BLJ_0634"
FT   CDS_pept        785210..787819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="BLJ_0634"
FT                   /product="phenylalanyl-tRNA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00109"
FT                   /db_xref="GOA:D6ZTA3"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTA3"
FT                   /protein_id="ADH00109.1"
FT                   /translation="MPMIDIDWLKDHVEVPEGLTYEQLAKDLVKVGLEEEEIHSSQVTG
FT                   PIVVGYVVDATPEPQKNGKTINWCHVDCGDEWNETDEDGNKVPRGIICGAPNMKAGEKV
FT                   VVTLPGAVLPGDFKIEPRKTYGHISNGMCASERELGLGDNHNGIILLRQYGFSEAEYEA
FT                   LKPGQDAMHLLHLDQPLLEINITPDRGYTLSYRGVAREYHHSTGAAYTDPAVALNEKAP
FT                   EPADYQPGTPVDIDVEIDDNNPIHGVPGCDRYYARIVKDFNPNAHTPNWMRRRLIRAGM
FT                   RSISLAVDVTNYVMLDLGQPMHAYDLDKLEGPIVVRRANEGEKLTTLDGKEHDLSVEDL
FT                   LITDSPNGERGSRILGLAGVMGGLYGEVTADTKNILLEAAHFDQVTIARSARRHKIPSE
FT                   ASRRFERGVDTALQPAATQMAAELMAKYGNGEPSEHPNDVNNTPRAKVIHFKASEVARV
FT                   AGLDVDINRISDILTDIGCTVAGGGNGEFAVTAPSWRPDLNEPCDLVEEIARLVGYDQI
FT                   PITVPPAPVEGLVGLTPDQQRRRRVADELAEFGMVESLSYPFVGDDDYKAFGFDPEATK
FT                   KVSVEIANPLYGDRPYLRREILPTLATTVQRNIRRGIENVSLYELGHVYLWDPNAPAIP
FT                   ALPGGVRPTDEQLAALDAGLPEQPDHVAGILTGLAEDDGWMGGKRPVDWSDAVEAVRRI
FT                   AGRIGAAIELDQPAADDVPVQWHPGRVARVMVGDVFTGWVGELHPRVNEALGFPAHSAA
FT                   FELNLTALFATLTGKPVQAKPISTFPPVKQDLAFTVDETVTAGQLENVIRKAAGANLES
FT                   IELFDVFTGEQVGEGKKSLAYAVVFRSPSKTLSAEDSDAIRKAIVAEAAEIGAQLRA"
FT   gene            787850..788536
FT                   /locus_tag="BLJ_0635"
FT   CDS_pept        787850..788536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0635"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00110"
FT                   /db_xref="GOA:D6ZTA4"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTA4"
FT                   /protein_id="ADH00110.1"
FT                   /translation="MSQPEQDKPKYGQYQQPEYGAMSGQYGPNYNPYIYGAPEPDTKKD
FT                   SAAAAGNNGGAAQSQQAGQPYGQQPAWPGNQQAGGWPYAQGGQQSGPGAYPGGYPGMQG
FT                   QSYGQQPNGQPHQPHYYHGIDLNDPNQNPLYGHWDSYAIISFILALFFPVPVLSALMGA
FT                   VAMWRTRTFHMKGFGLAVAAVVINVLYTIAVIWMAFNGYDAMSLYQEALQQLTGGTGSS
FT                   SDSISA"
FT   gene            788635..789729
FT                   /gene="argC"
FT                   /locus_tag="BLJ_0636"
FT   CDS_pept        788635..789729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argC"
FT                   /locus_tag="BLJ_0636"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00111"
FT                   /db_xref="GOA:D6ZTA5"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTA5"
FT                   /protein_id="ADH00111.1"
FT                   /translation="MAKYTVAVAGATGYAGGEALRILAAHPDFDITCVAGHSSVGESMA
FT                   KHMPHIPQLANLVVEDTTPEVLNGHDVIILALPHGASGKLASQLDPNAVVVDLGADHRL
FT                   EEQAAWDEFYGGDFYEHWTYGMPELITGKAADGSYTRQRAALPGAKRIAGPGCNVTATT
FT                   LALQPGIAEGLVESQDIVADLVVGYSGAGKNLKRTNLLAAEALQSALPYSVGGKHRHIP
FT                   EILQNFAHAAGKSAAEASEFTLGFTPILAPMSRGILATVSARMTDKAKALSDEEIRAVW
FT                   SKAYEGQDFMVLLPEGTLPATGNIIGSNAAHLQVVADRKAGRIYAFAAIDNLNRGTAGQ
FT                   AVQSLNIALGLPEDAGLTKIGVAP"
FT   gene            789726..790901
FT                   /gene="argJ"
FT                   /locus_tag="BLJ_0637"
FT   CDS_pept        789726..790901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argJ"
FT                   /locus_tag="BLJ_0637"
FT                   /product="arginine biosynthesis bifunctional protein ArgJ"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00112"
FT                   /db_xref="GOA:D6ZTA6"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTA6"
FT                   /protein_id="ADH00112.1"
FT                   /translation="MSVTFAQGFSAAGVAAGISSVEGKKDLALVVNNGPLDAAAGVFTS
FT                   NRFCAAPVQWSRKVVADGHVKAVILNSGGANACTGEAGYAQSVATAETVAGLIGAEPND
FT                   VAVCSTGLIGELLPLDNVLAGAKSAHEALAATAEAGAAASHAIMTTDTKPKTVELTGSN
FT                   GWKIGGMVKGSGMIAPQLATMLCVITTDAVVSAGQMQAALAVAAEHSFNRIDVDGCMST
FT                   NDTVLLLASGASGVEPDKDEFNKLVRETCASLSRQIIGDGEGASHDIRITVTGATSEDA
FT                   ALACGRAVAASNLLKCAISGNDPNWGRIVSSLGTVPPEVAPYDSNKVTVDVNGVRICEN
FT                   GGAGRDRSEVDMTPREVHIDIDLNTGSDAEATVWTDDLTHEYVHINADYES"
FT   gene            791038..791994
FT                   /locus_tag="BLJ_0638"
FT   CDS_pept        791038..791994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0638"
FT                   /product="acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00113"
FT                   /db_xref="GOA:D6ZTA7"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTA7"
FT                   /protein_id="ADH00113.1"
FT                   /translation="MATELKGPGFHFDVHTDLRADQKAEVLIEALPWLEEFAGQRIVVK
FT                   YGGNAMVDDHLKQCFAEDMVFLRQVGLHPIVVHGGGPQISHMLKALGIKSEFKGGLRVT
FT                   TPEAMDVVRMVLTGKVSRELVGLINAHGPLAVGLSGEDGGLFSAMQRRPIINGKPTDIG
FT                   LVGDVVSVDASAVEDLVAAGRIPVVSSVAPNEEDATEVLNVNADSAAAALAAAVGARKL
FT                   VILTDVDGLYADWPDKNSLIGRIGVENLRDMLPDLESGMRPKMEACVRAIDGGVPQAHI
FT                   IDGRKPHSILNEIFTSAGIGTMVMPDEGLEMRSSYGY"
FT   gene            791984..793279
FT                   /gene="argD"
FT                   /locus_tag="BLJ_0639"
FT   CDS_pept        791984..793279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argD"
FT                   /locus_tag="BLJ_0639"
FT                   /product="acetylornithine and succinylornithine
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00114"
FT                   /db_xref="GOA:D6ZTA8"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTA8"
FT                   /protein_id="ADH00114.1"
FT                   /translation="MATEHEEKLGTEDSKWLGEYSQVHMNVFGTPLRVMDHGQGAHIWD
FT                   VDGNEYLDFLAGIAVNSLGYAHPKWVKAVADQAAKVAHISNYFASEPQIELASKLVKLA
FT                   GAPEGSKVYFGNSGAEGNEAALKLAKLYGRTLPGALPSIGGKPARILAMTHGFHGRTMG
FT                   ALSATWKPGIRKPYDPLVPNIEFVRAGDKVALHDAFAQTGLGRYGKGPVAAVILELIQG
FT                   EAGVQPLGADYVKFVRELCDINHALLIIDEVQTGVGRTGKWFAFQRDDLSGGVTPDMVT
FT                   FAKGVAGGFPMGGMIAFGEKLAALFTPGSHGSTFAGNPLGAAAGLATLGVIEDENLVAN
FT                   AEARGEQLRDGIMATSNPLFVSVRGRGLLDAVELKHPCSHAVMNYCLEHGLIVNAVAPN
FT                   ALRFAPPLIITAQDVDQALAILKDVPTDLPDD"
FT   gene            793323..794288
FT                   /locus_tag="BLJ_0640"
FT   CDS_pept        793323..794288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0640"
FT                   /product="ornithine carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00115"
FT                   /db_xref="GOA:D6ZTA9"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTA9"
FT                   /protein_id="ADH00115.1"
FT                   /translation="MTPELRHMLRDDDLNHEEQKQVLELAIKFHHDRFYKQPFAGPQAV
FT                   AVLFDKPSTRTRSSFSIGVAELGGYPLVIDKSGSQLGRGEPVADTARVLDRMAYGVVWR
FT                   TFGQNRVEEMAKYSTHPVVNALTDDFHPCQILADFQTIAEHRGGVDNLKNQTIVYLGDA
FT                   ANNMANSYLLGGAVAGMDVRVAGPYGYLPRPDIVADAKRVAAETGGSILVTTDAKEAVK
FT                   DADCVFTDTWVSMGEEAEYAIRSKPFWDYQVNTELMALAKPDALFQHCLPAYRGKEVTA
FT                   EVIDGPQSVVWDEAENRLHAQKALLTWLTGKARGDESLLA"
FT   gene            794285..794797
FT                   /locus_tag="BLJ_0641"
FT   CDS_pept        794285..794797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0641"
FT                   /product="arginine repressor, ArgR"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00116"
FT                   /db_xref="GOA:D6ZTB0"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR036251"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTB0"
FT                   /protein_id="ADH00116.1"
FT                   /translation="MSETGPSLQRPATRAARLSAIEQALATHIITSQSQLSKILIDEGI
FT                   AVTQATLSRDLDEMHAVKTRLKDGTVAYTVGRSVVASEGEDVGERGEAQMSRVLNGLVT
FT                   SVAAAGNLVVVHTPSGAAQYVASVIDRQPIEGVLGTIAGDDTVMVICTNDDTAVSRSDW
FT                   LLSLASK"
FT   gene            794881..796119
FT                   /locus_tag="BLJ_0642"
FT   CDS_pept        794881..796119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0642"
FT                   /product="Argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00117"
FT                   /db_xref="GOA:D6ZTB1"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTB1"
FT                   /protein_id="ADH00117.1"
FT                   /translation="MADNKRIVLAYSGGLDTSVAISYLKERTGKDVVAVSLDVGQGGES
FT                   LETIKQRALACGAVESYVVDARDEFANEYCMKALKANAMYEGVYPLVSAISRPLISKHL
FT                   VRAAHQFGADTISHGCTGKGNDQVRFEVSIASIDPTLKAISPIRDLSLTRDVEIAFAKE
FT                   HKLPITQTEKSPYSIDQNVWGRAIETGFLEDPWNGPTKDCYSYTDDPAFPPVEDEVVIE
FT                   FKEGVPVKIDGRDVTPLQAIEEMNRRAGAQGIGRIDLIEDRLVGIKSRELYEAPGAVAL
FT                   ITAHQELENCCLEREQHRIKRDIDKRWGELVYDAQWFSPATQSLNAFIEDTQKYVSGEI
FT                   RMVLHGGRAVVTGRRSDSSLYDYKLATYDSGDTFDQRSSNGFIDIYGLPSRVAAARDVK
FT                   FGNGIEVPKNTVE"
FT   gene            796295..797767
FT                   /locus_tag="BLJ_0643"
FT   CDS_pept        796295..797767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0643"
FT                   /product="argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00118"
FT                   /db_xref="GOA:D6ZTB2"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTB2"
FT                   /protein_id="ADH00118.1"
FT                   /translation="MTENNEHLALWGGRFTSGPSPELARLSKSTQFDWRLADDDIAGSR
FT                   AHARALGRAGLLTADELQRMEDALDTLQRHVDDGSFAPIEDDEDEATALERGLIDIAGD
FT                   ELGGKLRAGRSRNDQIACLIRMWLRRHSRAIAGLLLDLVNALIEQSEKAGRTVMPGRTH
FT                   MQHAQPVLLAHQLMAHAWPLIRDVQRLIDWDKRINASPYGSGALAGNTLGLDPEAVARE
FT                   LGFSRVTDNSIDGTAARDLVAEFAFVAAMTGVDISRLSEEIIIWNTQEFAFVKLDDGYS
FT                   TGSSIMPQKKNPDIAELARGKSGRLIGDLTGLLATLKGLPTAYARDLQEDKEAVFDQVD
FT                   TLEVLLPAFTGMVKTMHFDSERLEEEAPTGFALATDIAEWLVKNGVPFRHAHELSGACV
FT                   KLAEGRGQELWDLTDNDFIETFAAFLPADKAPGVREVLSSHGSVDSRNGKGGTAYGRVR
FT                   EQIADAKAEVEELKLFPASTSDGSAYKAPGTF"
FT   gene            798115..798309
FT                   /locus_tag="BLJ_0644"
FT   CDS_pept        798115..798309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0644"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00119"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTB3"
FT                   /protein_id="ADH00119.1"
FT                   /translation="MQVNGEQVTLETPVSVADYLEAHGFRAERVAIELNGEIIPRDKRA
FT                   DAMLDDQCVMEIVQFVQGG"
FT   gene            798321..799190
FT                   /gene="thiG"
FT                   /locus_tag="BLJ_0645"
FT   CDS_pept        798321..799190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="BLJ_0645"
FT                   /product="thiazole biosynthesis family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00120"
FT                   /db_xref="GOA:D6ZTB4"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTB4"
FT                   /protein_id="ADH00120.1"
FT                   /translation="MSNINPVTEASVEATPLPPQPAVTNPVGTAAPILPVEDKPLTLGG
FT                   HEFQSRFILGSGRYDLNLIKATVEHAGTQIVTMALRRAQTTENSVLDYIPEGITLLPNT
FT                   SGARNAEEAVRIARLAREVCHTDFVKVEIEHETKYLLPDNAETIRATEMLAKEGFVVMP
FT                   YMFPDPIAARQLEEAGAAAVMPLGSLIGSNMGLRMRDFIEIIIANAHVPVIIDAGIGRP
FT                   SQACDAMEMGADAVMAYTAVASAGNIPLMAEAFKHAIDAGRAAYLSGLGKVTEGQAVPS
FT                   SPTTGYLH"
FT   gene            799267..800076
FT                   /locus_tag="BLJ_0646"
FT   CDS_pept        799267..800076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0646"
FT                   /product="thiazole biosynthesis adenylyltransferase ThiF"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00121"
FT                   /db_xref="GOA:D6ZTB5"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR012731"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTB5"
FT                   /protein_id="ADH00121.1"
FT                   /translation="MALTDEQVERYARHLILKGLGVKGQKRLLASSVLIIGAGGLGSPA
FT                   ALYLAAAGVGHIGLVDGDVVDMSNLQRQIIHTTARVGAPKVESAATAIRALNPDVTVDT
FT                   YYELVDASNIAGLIEPYDLVIDATDNFAAKFLINDACVLAGKPYIHAGVVGFAGQVMTV
FT                   IPGEGPCYRCIFRDMPAAGEIPTCKEAGVLGAVVGVIGSLEATEAVKLIAGVGEPLVGR
FT                   MLTVDALTMNIRRVPLPKHVPDCPVCGEQPTITAIDPANYIQPACAI"
FT   gene            800133..800489
FT                   /locus_tag="BLJ_0647"
FT   CDS_pept        800133..800489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0647"
FT                   /product="Rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00122"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTB6"
FT                   /protein_id="ADH00122.1"
FT                   /translation="MPIALHNAVVDDESSQSSYRRITPAEFAKLDPNTVTLLDLREPAD
FT                   FAAHPVEGAINAPLDPLAHVLKTVPTDRTVVVYCAQGWWSEEVAEILADRGYDVASLDG
FT                   GFQGYLDYLETHHD"
FT   gene            800617..801180
FT                   /locus_tag="BLJ_0648"
FT   CDS_pept        800617..801180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0648"
FT                   /product="metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00123"
FT                   /db_xref="GOA:D6ZTB7"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTB7"
FT                   /protein_id="ADH00123.1"
FT                   /translation="MNQPERRVETVGHLLTRTQIQRLVANHGREVIEHRHMQIERCCYQ
FT                   HGNVTTFEHSVRVACLAVWMADRAHLWYRVDLKSLIRAALLHDYFLYDWHDWDNGEHQW
FT                   HGFTHGRAALVNALKDFKLNDIERNSIENHMFPMTPVPPRYIEGYLVTLADKCSATAET
FT                   FSLDRFNKRALPVAKPYAEIEARR"
FT   gene            801177..801944
FT                   /locus_tag="BLJ_0649"
FT   CDS_pept        801177..801944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0649"
FT                   /product="Hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00124"
FT                   /db_xref="GOA:D6ZTB8"
FT                   /db_xref="InterPro:IPR010540"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTB8"
FT                   /protein_id="ADH00124.1"
FT                   /translation="MIITLEHYFLWFLFYSFVGWMYESILVSCQQHRLVNRGFLNGPLC
FT                   PIYGTGAILGVAILGNVHNPIIIFLISMVGATILEYTTSWVMEQLFHARWWDYSNFRFN
FT                   LQGRVCLLGALIFGLGGVGVVLGSQPYVERVTDMIPLPMLHTLVTVLALITIIDLAVTV
FT                   AGMLGFEQVLDSVSQVVQDVAARAGGTWQWGSRAVSDRMRELSQDTVERLRWAINGVIN
FT                   AQQKRMLKSFPKFQVPDRQDIIDSLRELMGPRR"
FT   gene            802070..803392
FT                   /locus_tag="BLJ_0650"
FT   CDS_pept        802070..803392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0650"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00125"
FT                   /db_xref="GOA:D6ZTB9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTB9"
FT                   /protein_id="ADH00125.1"
FT                   /translation="MAHVTDFKEAGFNTLLEELEWRGLISQSTDRDRLAEALNGEPITY
FT                   YCGFDPTAASLHIGNLVQLINMRHLQLAGHHPIALVGGATGLIGDPRQSGERTLNPKDV
FT                   VAGWADRLKNQIGGILDTEGANAVRFVSNYDWTASMTVIDFLRDVGKNFRLGTMLAKDT
FT                   VARRLNSEEGISFTEFSYQVLQGNDFLHLFDEYHCTLELGGSDQWGNLTSGLDLIHKVR
FT                   GVDVNVFTSPIITDASGKKFGKSEGNAVWLDATMLSPYKFYQFWINRPDVEMESLLKAF
FT                   TFLPKAEIERLVEESKTNPGKREAQKTLAWEVTSFVHGEAATQAAIDASGALFGRGGNL
FT                   EDIDEETLESVLDGFKVVDENGEHVFPVSKPGDRVIDAAQAAGLFKSASEARRAIKSGG
FT                   VYLNNNRIEDEEQVLAEADFLAGRFALIRRGKKALGAVENR"
FT   gene            803420..805312
FT                   /locus_tag="BLJ_0651"
FT   CDS_pept        803420..805312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0651"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00126"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTC0"
FT                   /protein_id="ADH00126.1"
FT                   /translation="MAEGNERSGKSYGGGHKGYGDRRPGNRGGKGFKPRGKGGFKPRHD
FT                   GEGFKPRRDGDGEGHGGYRKSYGKGGDFHKGGRSGFGGKGGYRGNGPRRDGDGFRPRRD
FT                   RDGEGFKPRRREDGEGYAPRRDGDGEGHGGYRKSYGKSGGFHKGGYRGSGPRRDGEGFK
FT                   PRREGGYRSHEGENGENPRYQHRDNDRRDFRRDDRRDFHRDGERRDFRRDNDRRDFRRD
FT                   DRRDNDRRDFHRDGERRNFRRDDDRRDGDRRNFRRDDRRDNNRRDGEFREFSQEEKRQY
FT                   REEKRSEYMRRPRRNSDGTMSFPSQNPYTDRRPDEPKMPKGMEWSMLSKDERERLRGLS
FT                   KEHAENIGLHILAAFALEESDPELALEHAKWVARQASRIDFARETLAFVAYRQGDYKLS
FT                   LREFRTAYRMNGFLDYLPFIADCERGVGEPKKAVELALSDEGKQLHGAPKVEMFLVYAG
FT                   ALGDLEMWDKAIEVVHTVGRSQGLPGEYRMRAVQAEQYFLEEAGRSKEAEQLNDLLDRL
FT                   EDQYADEEIDENSDDVVIDHDLEDITDDSDVLEKLGIDPDEAQYAPDLEQEYGDEDDEA
FT                   EDGDAESDEADVENAESEDASEESEESEAEESSESADDAVEPAESDETETETEE"
FT   gene            805321..806361
FT                   /locus_tag="BLJ_0652"
FT   CDS_pept        805321..806361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0652"
FT                   /product="HAD-superfamily hydrolase, subfamily IIA"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00127"
FT                   /db_xref="GOA:D6ZTC1"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTC1"
FT                   /protein_id="ADH00127.1"
FT                   /translation="MTRFLKGTDRPLAEAYQLALLDLDGVVYRGKNPVEYAADSIRAAE
FT                   AAGMTIEYTTNNSSRFQHVVADQLKGFGLDVEPWQVITSSVVAARVVAKALPAGARVQV
FT                   LGAEHLRDEVTRNGLTIVDGPQDRPQAVIQGWYPDMTWQMMADAAFAVEAGATYFVTNR
FT                   DLTIPRELGIAPGCGSMIRAVITATGVEPVASAGKPEAYMYDEARELNAAEGHDLVPKE
FT                   ASIAIGDRLDTDIEAGNRGDYDSLAVLTGVTNPTELMLAPAHLRPTFIALDLRELGEAQ
FT                   PEPVRDESGTWECRKASAWFENGQVHVSDPTSMDGLRAAVCAAWEAADQGAQLSEATVP
FT                   VFAIEA"
FT   gene            806366..806512
FT                   /locus_tag="BLJ_0653"
FT   CDS_pept        806366..806512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0653"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00128"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTC2"
FT                   /protein_id="ADH00128.1"
FT                   /translation="MPTDSEHAPVTERYPELADIDEQDNDRKLETYRNVLESLQHELDN
FT                   SRS"
FT   gene            806618..807391
FT                   /locus_tag="BLJ_0654"
FT   CDS_pept        806618..807391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0654"
FT                   /product="hemolysin A"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00129"
FT                   /db_xref="GOA:D6ZTC3"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTC3"
FT                   /protein_id="ADH00129.1"
FT                   /translation="MTEQHIDPATPLDRLDMMLVASGLVESRAKAQRLIKAGHVRVDGE
FT                   TITKPSFMVKAGHSELAVDKGDDYVSRGAYKLLGAFETFAGNGLTGPESLECLDIGAST
FT                   GGFTDVLLRGGAAKVVALDVGHGQLDPRIANDEHVIEMSGVNIREVEADDLPYRPAMIV
FT                   SDVSFISLTYVIPVIARIAAPGAQIVLLVKPQFEVGRAGLGKNGIVEDPALRERALHDV
FT                   VACAEQHGLDVVATADSPIIGTHGNEEYLLYAVLR"
FT   gene            complement(807373..808047)
FT                   /locus_tag="BLJ_0655"
FT   CDS_pept        complement(807373..808047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0655"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00130"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTC4"
FT                   /protein_id="ADH00130.1"
FT                   /translation="MGKHTQNCTLIGKGVYGTIGVDQRSRLADGAHFHTMIVTSTLEAS
FT                   VIEGDKLVIKSGIVRCDGDIRVSSISGSGDIEVGGDIICDEITFTGKLRCNSDIVCSGN
FT                   LSVNGSLGTRHISGQTVRLNGVLKGHDVNSRALEVHPLRSTMFSRFDMDGYEDGSMVRH
FT                   ITAVTVEANHLQCRTLTADSAMLRNGSAVESATCATAIGIDRTSSVLLVNGDCRRIHLK
FT                   TA"
FT   gene            complement(808183..808845)
FT                   /locus_tag="BLJ_0656"
FT   CDS_pept        complement(808183..808845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0656"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00131"
FT                   /db_xref="GOA:D6ZTC5"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTC5"
FT                   /protein_id="ADH00131.1"
FT                   /translation="MAAKPSGSKSVLVIGLGRFGGSVAATLDQMGQDVLAVDKNPELVA
FT                   RWSAHLPTIQADMTDVLAIEQIDASQFDTAVVAIGDSIEASVIITGNLLDAGVSDLWAK
FT                   SVSQEHARILQRIGARHIINAETDAGKRVGHLVAGNYLDYIEIDGPYTVVKIHTPLYAV
FT                   GRSIEDVQVHDKYGVTVVGLKAPGKEFQYGSKELVMHRNDELILMGKQDQIDHFIQG"
FT   gene            complement(808896..810359)
FT                   /locus_tag="BLJ_0657"
FT   CDS_pept        complement(808896..810359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0657"
FT                   /product="Trk-type K+ transport systems membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00132"
FT                   /db_xref="GOA:D6ZTC6"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTC6"
FT                   /protein_id="ADH00132.1"
FT                   /translation="MANDFDESSANEEASKGLSWWYSADVLSRDKSDKTAKRIHRISIT
FT                   DRLLRHPGRLSMVYFGALIIIVTGLLLLPISTSDIIFTNFPVAFFTAVSALSTCGIPVV
FT                   NTGEYWSTFGQVVILFSIQFGGLGVMTFASMVALGASRRLKVSQRMLTANELGTTKLSE
FT                   VKGVLTVVLGTSIIAEVLTFVLLPDLFRVNHGNMGRTLWQALFYAVSAYNNTGFTPDAT
FT                   GLHVNRWGVGLPILISAFIGTLGFPVVLNLVQCARRHLSPKRWTLHTKLTLVTTAVLVA
FT                   TSLAWFLLVEWGNTGLFPADGPGMKMRRAMSAAVMPRSAGFDISWVPEVTNETKVFMSI
FT                   LMFIGAGSSSTAGGIRVTTFAVILLICRAAFTGHRDVTVFRRRIPRRIQMTAVSVTTAC
FT                   FALVMVGAMMLMFTTGCAFVDAVFEACSAFSLGGYSVGVASAGNPASLFILSAEMIVGR
FT                   LGPLTIAYSISRPMAPEPIRYPQENIIVG"
FT   gene            810606..811634
FT                   /gene="ppnK"
FT                   /locus_tag="BLJ_0658"
FT   CDS_pept        810606..811634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppnK"
FT                   /locus_tag="BLJ_0658"
FT                   /product="NAD(+) kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00133"
FT                   /db_xref="GOA:D6ZTC7"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTC7"
FT                   /protein_id="ADH00133.1"
FT                   /translation="MAKRNAVVVTHTRLRQTGTVVAEAVSQLRVAGFEVTIIDNTEAPD
FT                   FGVQPPCVSDDTEIVVVLGGDGTILRAAELVHCTQVPILGVNMGHVGFLAEFESFQIDE
FT                   AIRRVATHDYSIDERMIAHVDVWLPGATKPIEDWALNDITLERADRGKMVELSIRVDDV
FT                   EMNSFGADGVIVSTPTGSTAYAFSAGGPVMWPNVKALQLIPLAAHALFARPLIIGSGST
FT                   FTIDILDESMSEGWICCDGRRQRALPQGTRVMVRESRDTLRLARLSGMPFTNRLVSKFD
FT                   LPVVGWREHARNEASSQPLHHGHTFPAAAYAAGVAVAVAGDAGVAGTDPDKPGERDGKA
FT                   GA"
FT   gene            811634..813421
FT                   /locus_tag="BLJ_0659"
FT   CDS_pept        811634..813421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0659"
FT                   /product="DNA repair protein RecN"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00134"
FT                   /db_xref="GOA:D6ZTC8"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTC8"
FT                   /protein_id="ADH00134.1"
FT                   /translation="MLEELDIRNLGPIREATIAPAAGMTAITGETGAGKSMLLSAIRLV
FT                   SGGAAESSRVSAGADEAWAQAIFALADDAVASEHSGDTNDAGDDADSGLTGAAAAVAKA
FT                   HDAGVDPEDGELFLSRTVRASGRSRAVLGGKSVPRSVLGAIAGELVIIHGQTDQLKIAA
FT                   AARQREFLDRVAGDEAELAAYRKAWDALAAMDERLERLRSQESSARQQADYLRESIDRI
FT                   NRTDPQPGEDEELKARRERIENAADIAQGVGSALGALDASQVDVDAADGASAVELINHA
FT                   VTSLRAIRVGGTFAEQADRLESINADLGDVVFALSQELGDEGSVEDLDQINGRIHELGD
FT                   LTRRWGPTLADVLAWRDKAAFDLEDLDASPEKVAELESERQTLYDAALAAADVLSAARV
FT                   AAAADLGARVTEELGSLAMLGASLEVRVTPRDKADDPLGPYGRDDIAFLFTPFEGSPQL
FT                   PMGKSASGGELSRLMLALELVAADTRGGADQTFIFDEVDAGVGGKAAVELGKRLARLAR
FT                   SAQVIVVTHLAQVASWADAQFVVTKEPPDADDDDLGVVTTIAEVNGETRVHEIARMLSG
FT                   SESEASLDHARELLKESVL"
FT   gene            813418..814065
FT                   /locus_tag="BLJ_0660"
FT   CDS_pept        813418..814065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0660"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00135"
FT                   /db_xref="GOA:D6ZTC9"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTC9"
FT                   /protein_id="ADH00135.1"
FT                   /translation="MTKAAIFDLDGTLLDSMGVWDQVDIDFLNKRGIEVPPDYMTKISA
FT                   MQFRQIAEYTIARFGLTDTPEELMQEWDDMASVAYSTTVEAKPGALDYLRDLKASGVKL
FT                   GVATSLPPHLREPALRHVGMFELFNDIVSVDDANDVGKDQPDVYLLAAKRLGAAPADCT
FT                   VFEDLLVGMKSAKSVGMKVWAMHDDSSASDWPEICHLADGVLFDFHDAPRVL"
FT   gene            814307..814681
FT                   /locus_tag="BLJ_0661"
FT   CDS_pept        814307..814681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0661"
FT                   /product="regulatory protein GntR, HTH"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00136"
FT                   /db_xref="GOA:D6ZTD0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTD0"
FT                   /protein_id="ADH00136.1"
FT                   /translation="MKLIISSVSGEPIYEQIKTQIRSAVLSGELKAGEALPSLRKLAKE
FT                   LRISVLTVTRAYNELADEGVVQNIQGKGTFVMDKGNELMQRQLKTQIRESLAEASRGAK
FT                   AAGIPLDALDRMLEEEYRKK"
FT   gene            814697..815623
FT                   /locus_tag="BLJ_0662"
FT   CDS_pept        814697..815623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0662"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00137"
FT                   /db_xref="GOA:D6ZTD1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTD1"
FT                   /protein_id="ADH00137.1"
FT                   /translation="MAMTSISESDAMALQVTDVTKHYDSGFTLDDVTFDLPKGYIMGLI
FT                   GPNGAGKSTLIKLILNMIHRDAGSIHVLGLDNIANEEPVKEQLGVVFDFSYMHEQWQVK
FT                   NIERIVAPLYPSWDGGCYHKYLDTFGLGDAQNGKKHIKDLSRGMQMKLMLAIALSHDAK
FT                   LLILDEPTSGLDVLARDELMDILHAYIEDGEHSVLFSTHITADLERAADFITYITDGRL
FT                   YYTGPKDEFEESFRLIKGGPDELAQLPADVVLGSHTYATGFDALVRSDRLDAVASVVSG
FT                   LVVESASIDDIIRLTNAHDSNRDLSGR"
FT   gene            815630..816343
FT                   /locus_tag="BLJ_0663"
FT   CDS_pept        815630..816343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0663"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00138"
FT                   /db_xref="GOA:D6ZTD2"
FT                   /db_xref="InterPro:IPR025699"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTD2"
FT                   /protein_id="ADH00138.1"
FT                   /translation="MEAILRVSRSRQHALTTALRVDMAYLCVGERTVFSLLLAPLFSVI
FT                   FQGEAYGDGFGYRMGVIMTVFTCAMWVLTMAVADLQNGYRLRGIIPASRKSQVAARYVV
FT                   GLVISVLSIAMIVLIDGLQVLVNPDWSFAGNLWAAPLGGFWTALMVALIVPTGYLWTKL
FT                   GGLQVTMMVIYVVVLAGFILLSILPASVTRGLAHAANAIIAQRLWLVIAVLATTVVAYG
FT                   ISYVIASRIFASREW"
FT   gene            816346..817059
FT                   /locus_tag="BLJ_0664"
FT   CDS_pept        816346..817059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0664"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00139"
FT                   /db_xref="GOA:D6ZTD3"
FT                   /db_xref="InterPro:IPR025699"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTD3"
FT                   /protein_id="ADH00139.1"
FT                   /translation="MSWKSVVKQCRFDCVGTGLFSVANMVFLLVFPVLSIVVSLVMIST
FT                   HVDEHVASGLMGGLGGLASTMACMSALGPASSEESAGHSAMRGLIPVSRTAQVVGRYLF
FT                   LLVVGLLWALDVVICGGVFIVFGDIADMGWIGTLAAGAFIFALAVILGSVLLACAYRFT
FT                   FRKMMVASGVVLVGLYAVIALLSRLPVDWQWLLLNITDFLTIWWHTALVLAVLCLLAYF
FT                   GSMLIAIRIYRAKEL"
FT   gene            complement(817056..817668)
FT                   /pseudo
FT                   /locus_tag="BLJ_0665"
FT                   /note="possible calcium-transporting ATPase"
FT   gene            complement(817833..819671)
FT                   /locus_tag="BLJ_0667"
FT   CDS_pept        complement(817833..819671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0667"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00140"
FT                   /db_xref="GOA:D6ZTD4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTD4"
FT                   /protein_id="ADH00140.1"
FT                   /translation="MMVPKLRHNGKETIMWSEEEIDALLNPLRSAQSDSQDIEAKEAAD
FT                   GLPVSLPETISAFANGHGGTIVLGIAEKDGFEPAQGFKAQPIAEALAQMCRDKITPPIR
FT                   PVIDVTSYHGSAVVIAIIDEADPLDKPCYIRNRGRYSGSFIRVWDGDRKLSHYEIDRLL
FT                   ENRAQPTYDRELIYEATADDLLPDIVQGILTLCRERRPRVFGKLTDEEAMSALGIVGTG
FT                   DDGKSHPTLAGLLVAGNYPQQFLPRVNITFTCYPGYDKVFAGGVKFIDNYSLDGPIPEI
FT                   LGETLNAAQKNMRIGGVLDGPFRKDTFEYPEDAIREAVVNAIMHRDYSPMARGGQIQVN
FT                   MYKDRLEVLSPGGLYGDVTLDSISEPGSTSTRNQTLAKLLECTPFRNATVAENRGTGYS
FT                   LINRLLLDNGNGEPEIYSTLNLFSVTFRSADTSKLPDSRRDHRYAGWGDRPDIDYSAAQ
FT                   GLINGQPPKPAHPKIVPFPKNSIKTEELSDEEMYERYLKDIPGLGPTIARIAGLDVPQS
FT                   ADMPLVRDVSSIERPSARSASASALEGSARYSMLEEQLLQLINKHGTMSTPKLVEATGA
FT                   PRSTVTYQLRKLLESGTIERTQPARSPKQSYRIKSA"
FT   gene            819777..820226
FT                   /locus_tag="BLJ_0668"
FT   CDS_pept        819777..820226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0668"
FT                   /product="regulatory protein GntR, HTH"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00141"
FT                   /db_xref="GOA:D6ZTD5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTD5"
FT                   /protein_id="ADH00141.1"
FT                   /translation="MIVEIDQRSDVPIYEQLHRQFIAAIAGDELSPGDSLPSVRSLAVD
FT                   LGINLHTVNKAYALLRDEGYIVMRRGAGATVAERNGGGEAPNRTAEAQDERMDEELYRL
FT                   ALAYKARGGDSAAFLDAAKRQCERAYGVRSSQSVTDGATKENQGR"
FT   gene            820229..821374
FT                   /locus_tag="BLJ_0669"
FT   CDS_pept        820229..821374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0669"
FT                   /product="protein of unknown function DUF1648"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00142"
FT                   /db_xref="GOA:D6ZTD6"
FT                   /db_xref="InterPro:IPR012867"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTD6"
FT                   /protein_id="ADH00142.1"
FT                   /translation="MNNTVVSMNIALCAFLLLPVIVTAGLAGVPWVTDRHEVFGVTVPA
FT                   AAHTNTRIREYKVAFSGIVVAIGVCAMLVSLAVWRLCGVDAAFWTVSIAAVVIAICGFV
FT                   LQQVFRRKVLSIKTSQGWEASSARRAALIGERDNPDPLSLKWELLQVVCLAVTIAVGLL
FT                   GYDRMPERVPIHADIAGNVNGWAEKSPMVIWYAVLAQVVLAAVMVASHVAIIYAKHPID
FT                   PDHPATTGYAYGVFSRVWSIYVLVIGLLTAGGLGLGVQLVAIGVLDVNLIGLIGMFIAV
FT                   AALVGALMIGMYYGQNGARVYAGVRHSDGGDDLDDDVMPYDDDLHWIGGIIYINRDDPA
FT                   IMVPKRFGVGWTVNLARPSVIIGTIVLLAIAIGLPVAAILM"
FT   gene            complement(821435..822925)
FT                   /locus_tag="BLJ_0670"
FT   CDS_pept        complement(821435..822925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0670"
FT                   /product="threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00143"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTD7"
FT                   /protein_id="ADH00143.1"
FT                   /translation="MTTTFHSTRSTTDSLTAKQAIRKGIADDGGLFVSDALGKTKVDVA
FT                   SLPGKSYQQIAAEVLGALLPDFTAEELGQCIADAYGEQWSDERITPLKPLGDDYVLELF
FT                   NGPTSAFKDVALQILPRFMAHTTPADGDADEKIMILTATSGDTGKAALAGFADAPGTAI
FT                   TVFYPEGKVSEVQQLQMTTQAGSNVQVAAVEGNFDDAQSAVKRIFGDRALAERLAGNSH
FT                   VVLSSANSINVGRLVPQVVYYFSAYAQLLADQVINVGDEVEFVVPTGNFGDILAGYYAK
FT                   LLGLPVKHLVVASDKNNVLFDFLTTGTYNRQRPFFQTISPSMDILISSNLERMLYYLSE
FT                   GDTRLISMLMNDLNKWGTYEIPEELLAKIRQIFGTGWADEDQVRESIKHCWDENHYVID
FT                   PHTACGYYLLEQMPRDPLTPRVLLSTASPYKFPRVVNEALGFDATGTDFECMDVLAHET
FT                   GTTAPAALRGLETADVRFKDVVAIDGMEDYVEKAAQTL"
FT   gene            823149..824456
FT                   /locus_tag="BLJ_0671"
FT   CDS_pept        823149..824456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0671"
FT                   /product="Glycine hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00144"
FT                   /db_xref="GOA:D6ZTD8"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTD8"
FT                   /protein_id="ADH00144.1"
FT                   /translation="MTASPLAQKATDAFNAPICETDPEIAELLDSELGRQRNGLEMIAS
FT                   ENFVPRAVLQCQGSVLTNKYAEGYPGRRYYGGCEYVDQVETIARERAKALFGAEYVNVQ
FT                   PHSGAQANAAVYQALVKPGDTVLGLALDHGGHLTHGMKINFSGRFYHAEAYGVNPETFR
FT                   IDPEIIRQRALETHPAMIIGGWSAYPRIEDFKAMKEIADEVGAKFWVDMAHFAGLVAAG
FT                   LHPSPVPYADVVSSTAHKTFGGPRSGFILAKQEYAKKLNSSVFPGQQGGPLMHVIAGKA
FT                   VSFKVAGTPEFKDRMQRTLDGAKILAERLLADDVKANGISVLTGGTDVHLVMVDLRNSE
FT                   MDGQQGEDLLAACGITINRNTVPFDPRPASVASGLRIGTSALATRGFGPKEYEEVADII
FT                   GTALAAGPSADVTALKARVDKLAEDFPLYPDLDQIH"
FT   gene            824647..825942
FT                   /gene="proA"
FT                   /locus_tag="BLJ_0672"
FT   CDS_pept        824647..825942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /locus_tag="BLJ_0672"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00145"
FT                   /db_xref="GOA:D6ZTD9"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTD9"
FT                   /protein_id="ADH00145.1"
FT                   /translation="MSDELSPEVFDAVCRQADQAARAQERLAQANTEAKNELLLAIADA
FT                   LDGHAADIEAANALDMLESKENGMDAGKLDRLLFDVPRVAAAAQGVRHVATLPDPVGEI
FT                   VRGYNLPNGLRLTQTRVPMGVIGMIYEARPNVTVDVASLCLKSGNAALLRGGHAAERTN
FT                   AATLGVIAPVLEAHGFESALVQSVDQYGRAGATAMMEARGHIDVLVPRGGAGLIQAVVR
FT                   NSKVPVIETGAGNVHIYIDKSGDLAKAILIIINAKTQRVGVCNAAEKLLVHKDVAAEFL
FT                   PQIAAALAEANVVLQADTTSYDIISGAAIEGLDLNRATEEDWDTEYLALKMGIKVVPDL
FT                   GAAIDHINTHSTGHTESIIAEDYAAIEEFAKRIDSAVVMVNASTRFTDGGVFGFGAELG
FT                   ISTQKMHARGPMGLREMTTTKWIGYGTGQVRA"
FT   gene            825957..826520
FT                   /locus_tag="BLJ_0673"
FT   CDS_pept        825957..826520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0673"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00146"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTE0"
FT                   /protein_id="ADH00146.1"
FT                   /translation="MNTTADTANKASELRPDIDLNDPKLGLKIAAERLSIVRYVFLVQI
FT                   EDGIASAAQRASLEYADAVLIGWPETDSPEVVDLNDAQLKIVREHMELMEGYIGKYSQM
FT                   EHDGDLDGMTDTLIRITERVAEVRRLYQPDFPLPTFAEIRRVVQDEWDEDMGKIDPKED
FT                   NPSAGEIEEETESADDAAGEGGQA"
FT   gene            826517..827302
FT                   /gene="nadD"
FT                   /locus_tag="BLJ_0674"
FT   CDS_pept        826517..827302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadD"
FT                   /locus_tag="BLJ_0674"
FT                   /product="nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00147"
FT                   /db_xref="GOA:D6ZTE1"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTE1"
FT                   /protein_id="ADH00147.1"
FT                   /translation="MSGVTGSHKTAASVQSEKTVESAEPAEIIAVTQGETERRMSDLSV
FT                   PAGASSHGKGRLSARGNWHTRLRVGIMGGTFDPIHNGHLVAASEVAWVYDLDEVIFVPT
FT                   GRPVFKLDKHVTNAEDRYLMTVIATASNPKFTVSRVDIDRPGVTYTIDTLRDIRAQHPD
FT                   AELFFITGADAVAEIMQWKDADLMWDLAHFVAVTRPGYSSPDGVTLPEGKVDTLEIPAL
FT                   AISSTDVRRRAEHDEPVWYLVPDGVVQYIGKHGLYSYED"
FT   gene            complement(827380..828639)
FT                   /locus_tag="BLJ_0675"
FT   CDS_pept        complement(827380..828639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0675"
FT                   /product="glycoside hydrolase, family 3 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00148"
FT                   /db_xref="GOA:D6ZTE2"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTE2"
FT                   /protein_id="ADH00148.1"
FT                   /translation="MRPSAHATRQLRHRGIPIVAAICALAVVLAGVAVYGWHVGWFAKS
FT                   TSNGNTTTPQTSQTSALPRTDVPSLKKNDDPAAQAQRAVSAMTLEERVGQLVMVPLFAG
FT                   SEPSSLASTIADEHIGSAILIGNWNTGVDTVKTATAQLQGYAPAGNRLIIATDQEGGQV
FT                   QHLTGTGFDTMPSAVEQGTMSADALRQSAGTWGSQLATAGINVDLAPVLGTVVGNRASN
FT                   APIGALDRDFGLDAAGNAEHGIAVIEGLRDAQVGAAVKHYPGLGAVSGNTDFTTEGILD
FT                   TTTTLDGAEADAFDQAITKADPAMVMMSLATYQSIDPNNPAVFSSTIIDGHIRNVLKYT
FT                   GVVISDSMSAEALSSYDVSQLGVNLVEAGGDMSCIGQTDYVKPIVDGLNERAKSDPAFA
FT                   SKVTAAATRVMTLKIKMGLA"
FT   gene            828758..831958
FT                   /locus_tag="BLJ_0676"
FT   CDS_pept        828758..831958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0676"
FT                   /product="protein of unknown function UPF0182"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00149"
FT                   /db_xref="GOA:D6ZTE3"
FT                   /db_xref="InterPro:IPR005372"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTE3"
FT                   /protein_id="ADH00149.1"
FT                   /translation="MSFNDPFSVLFGNGGDSRRNSANNDDPIILDVEADGDGPARNTNT
FT                   GPSGSSRPPRGPANPRITRKPASGGSGASRGSKILIGVVLALAIIVGLFFGLSRFITDL
FT                   MWYGQLGFQSVVWTQLGVKIGLWVAYALLMALTGFVSAWLAIRARPDSADGSTIRINGD
FT                   VVEVGKSVSSKTARRVAVVISLIVGVIFGSQFNANWSEILLMFNAQSFGTTDPQFGLDN
FT                   GFYVFVLPGLKLVLAAVAMLLGVGLVFSVVTHVLMGGIRITMPVNGRGLFSITKRCRRQ
FT                   LGIWLMLNMFAWAVRQMIGVFDQLTVQGSRITGASYTAVHANIPVTFIMAVLTAILGVV
FT                   LGIWLMRSHTLEGQASIGVRASAALKAWRVPVTSIAVVVVVGLVLTVAWPVLLQRFRVN
FT                   PNAQEMESTYIQRNIDATRAAYGLDKLKTEQYKVTDKGEQGALAKEADTTAQIRLLDPQ
FT                   VVSPTFKQLQQSKQYYTFADTLAVDKYEIDGVSQDTVIAARELDLAGNDNRNWVNDHTV
FT                   YTHGYGVVAAYGNKVTSDGQPEFFESGIPTQGKLTESEKYEPRIYFSPNTTEYSIVGAP
FT                   EGTQAWEFDYPTGSEGALTTFKGDGGPSVGNLFSRILYAIRFGSDQILFSDRVTSESQI
FT                   LYDRSPKERVAKVAPYLTLDGRVYPAVVDGRVKWIVDGYTTSDAYPYSQITDLGSATKD
FT                   STTVSSATVSSLGSQKANYIRNSVKATVDAYDGSVDLYVWDQSDPVIKAWEKIFPGQYH
FT                   QLSDISGDLMSHMRYPESLFKVQRELLSKYHVTSASQYYSGEDFWQTPVDPTESQSQQD
FT                   QDILQPPYYLTLQTGGTEEPVFSLTSTYIPAGQSTREILTGFLSVDSDAGNEKGKIGSN
FT                   YGTIRLQELPKDSNVPGPGQAQNNFNANADVSKELNLLQSGDTQVVRGNLLTLPLGGGL
FT                   VYVQPVYVKSSGVTSFPLLKKTLVAFGDQVGFADTLDEALDQVFGGNSGAAAGDAENVS
FT                   GDQSGSDTNGGQSGTTDGKSDSGSSSDRSPELQQALNDAAQAMKDSQSAMKNGDWTAYG
FT                   KAQQELEDALNKAIELDK"
FT   gene            832081..832578
FT                   /locus_tag="BLJ_0677"
FT   CDS_pept        832081..832578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0677"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00150"
FT                   /db_xref="GOA:D6ZTE4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTE4"
FT                   /protein_id="ADH00150.1"
FT                   /translation="MPYTFHPAVESDIQAITDIYNVAVVAGGATADLTPRTLDQRRAWV
FT                   ESHTPPYGVFVVESEDGSIIGFGALSVFYDRAGYDGVTDLAYYIDPAWQGRGVGTFMLD
FT                   RLLTEARARHMRKACGIIFADNVGSIALMRRFGFTQFGLMPAAATDSTGTMRDMSYWYL
FT                   DL"
FT   gene            832995..833378
FT                   /locus_tag="BLJ_0678"
FT   CDS_pept        832995..833378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0678"
FT                   /product="formate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00151"
FT                   /db_xref="GOA:D6ZTE5"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR024002"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTE5"
FT                   /protein_id="ADH00151.1"
FT                   /translation="MIAAACFSYLRTECYILRFFPTGVDVKVTPSWDTLFVCGILCNVL
FT                   VCLAVRIGFAARSVPDKVLGILLPIAGFVAMGFEHCVANMFFLPMGLVAKTFGFGADAA
FT                   GVAALAYWYLNGKQREKVAGGTV"
FT   gene            833437..833757
FT                   /locus_tag="BLJ_0679"
FT   CDS_pept        833437..833757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0679"
FT                   /product="RelB antitoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00152"
FT                   /db_xref="GOA:D6ZTE6"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTE6"
FT                   /protein_id="ADH00152.1"
FT                   /translation="MTMAMVTARVNAERKRDAEKVLKRNGRTYSDLIRDLTDYLADTGE
FT                   LPEFERLTLSLIQERERRKKQELIQRFVDRNLPEAEGDLSDEEILAQARMERFGGRDET
FT                   AV"
FT   gene            833741..834175
FT                   /locus_tag="BLJ_0680"
FT   CDS_pept        833741..834175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0680"
FT                   /product="PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00153"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTE7"
FT                   /protein_id="ADH00153.1"
FT                   /translation="MKLLFDTNILLDLCNDKRAPFHKQCVDLLMEAVARPNIEIMAPVS
FT                   SLNDVYCVLRKHYGEERAARDDIGGLMELFDIRPLMERHACMSYRSDEPDFEDGLIRAV
FT                   AEDNDADVIVTRDVEAFHHSSVRSMDAEQCRALLLADSKA"
FT   gene            834311..834910
FT                   /locus_tag="BLJ_0681"
FT   CDS_pept        834311..834910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0681"
FT                   /product="Aminoacyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00154"
FT                   /db_xref="GOA:D6ZTE8"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTE8"
FT                   /protein_id="ADH00154.1"
FT                   /translation="MASDFWLIAGLGNPGKKYEDTRHNMGFMTADVLAERWTVNFADHK
FT                   GLAMLGKSVMNLDGRTVKFFLAKPLTYMNDSGNAVASISAYYQIEPDHIVVIHDDMDLE
FT                   FGRIKVKAGGSAGGHNGIKSIDRSLGTPKYARVRMGVGHSKRGANAHDNTVNWVLGGFG
FT                   PDQRKQLPEFLADGADAAEDIIFHGLAKTQEKFNGR"
FT   gene            834900..838484
FT                   /locus_tag="BLJ_0682"
FT   CDS_pept        834900..838484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0682"
FT                   /product="transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00155"
FT                   /db_xref="GOA:D6ZTE9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTE9"
FT                   /protein_id="ADH00155.1"
FT                   /translation="MAGEATHPDLINGSLVGILSGLEQDKTFLRLATGDIEVSDDVDNS
FT                   VLAGIPEGLRPALAAAIGQGVAGKPGKPVVLVVASGREAEETVGSLRSWYDGDPNDIAQ
FT                   LEAWETLPHERLSPRADTVASRMAVFRRLKHPSDTDPMFGPIRILVMPIRSLIQPVVQG
FT                   LGDVEPLVFTVGEDLPLDEAAKRLIENAYTRVDLVMDRGEFAVRGGILDVFPPTAPHPV
FT                   RIEFFGDEIDTIKEFHASDQRTYGDGLKTIWATACRELQLTDAVRARAKALVGSIPNAE
FT                   DMLESIANAIPVEGMESLMPALVDHLEPVGSMLPKHAVILLSDPEKLRRSAEDLAKTAN
FT                   EFLAASWHVAASGHGAGAPISFDEASFLDYAETISSLEYSEHPVIRLTSFGVDTTLTGH
FT                   VQLDAQNPAEFRGDEAKASQGIEGLLDAGFHVTITAAAAGTLARLRRAINTTGIANFDV
FT                   IRSQAIDGFVDKAAKIALLTERDLTGRTSAVAVAKTPKRRRKAIDLVELKKGDYVVHEQ
FT                   HGIGRFIEMRQRTIGTGANKTTREYLVIEYTPSKRGAPADKLFIPTDQLDQVSKYIGAE
FT                   APKLNKLGGSDWAATKAKARKHVHEIADDLIKLYSARQRARGFAFSPDTPWQKELEDAF
FT                   PYQETADQLTTIDEVKSDMEKPVPMDRLICGDVGFGKTEIALRAAFKAVQDGKQVAVLV
FT                   PTTLLVQQHYETFSERFEGFPVNVAAMSRFQTTKEINGTVEGLRSGTVDVVIGTHKLLN
FT                   PKITFKDLGLVIIDEEQRFGVEHKETLKALRTNVDVLSLSATPIPRTLEMAVTGIREMS
FT                   TLATPPEDRLPVLTYVGAYEDAQVTAAVRRELLRGGQVFYVHNRVQDIASIADKIHTLV
FT                   PEAHVGIAHGKMGEKQLDQIIRDFWHRDIDVLVCTTIIETGLDISNANTLIVDHADRFG
FT                   LSQLHQLRGRVGRGRERAYAYFLYDPSKPMTEQSHDRLATIAQNTALGSGFDVAMKDLE
FT                   LRGTGNLLGDEQSGHIEGVGFDLYVRMVSEAVEKYKEPEENVEPVAVSIDLPIEASIPI
FT                   EYIDSDKLRLEAYRKLASARNEADLKDLEEELTDRYGKPPVEFETLFDVARLKFKARKL
FT                   GISEILAQSNRVRIGRIDPPESIQMRMGRIYKGAQYRPVTHQLIVPTPFTGSLGQGPMS
FT                   SDQVVLWTNQLLDDLAWTPSSSKRQSRL"
FT   gene            838635..839573
FT                   /locus_tag="BLJ_0683"
FT   CDS_pept        838635..839573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0683"
FT                   /product="aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00156"
FT                   /db_xref="GOA:D6ZTF0"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTF0"
FT                   /protein_id="ADH00156.1"
FT                   /translation="MSETTTNRTNQSATTATLAGYEIPRLGMGTMALAIEGRPSNRDQA
FT                   IETIHAALDAGVRYLDTAWSYYLPSAPGTGEPEDMGYGEYLVRDALHSWHGPKDQVLVA
FT                   TKTGWLRTLDGSGTYGWQADARPETMIANAKESARRLGVDTLDLLYSHCNDPQVPYEDQ
FT                   MGALKQLVDEGVAKAVGISRIDNADIEAAHNILGDRLVAVQNQFSPVHRDPEHTLETCE
FT                   KLGLAFVCWSPLGGFLDPFNEHLFDRFREVAKSHDCSYQRVTLAWELAQYQYLFTIPSA
FT                   RNPQEIQDSFKAGELKLSDSEIDYLNGKDVD"
FT   gene            839724..841022
FT                   /gene="eno"
FT                   /locus_tag="BLJ_0684"
FT   CDS_pept        839724..841022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eno"
FT                   /locus_tag="BLJ_0684"
FT                   /product="Phosphopyruvate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00157"
FT                   /db_xref="GOA:D6ZTF1"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTF1"
FT                   /protein_id="ADH00157.1"
FT                   /translation="MAVIESVYARQILDSRGNPTVEVYLETEDGAQGKGLVPSGASTGE
FT                   AEAWERRDGDKSVYGGKGVLNAVKAVNEVIAPKVIGMDAADQRALDDLMIELDGTPNKG
FT                   KLGANAILGVSLAALYASAESAGLPLYRYIGGTNGHILPVPNMNIMNGGAHADFATDIQ
FT                   EYMISPYGFDTYSEALRAGVEVYHTLKNVLKKEGLNTGLGDEGGFAPKMKSNEDSLKYI
FT                   MDAISAAGYEPGKQIGICLDVASSEFYNKETGKYRFDGEERDSAYMLDYYENLINEYPI
FT                   VSIEDPFNEEGWEDWAAITARLGDRLQFVGDDLLVTNPARLQKAIDLGAANSLLVKLNQ
FT                   IGSVTETLDAIELATANGYTSMVSHRSGETPDTTISDLAVAKNTRQIKTGAPARGERVA
FT                   KYNRLLEIEEELGSTAQYAGYSAFKACKKYLAK"
FT   gene            841089..841712
FT                   /locus_tag="BLJ_0685"
FT   CDS_pept        841089..841712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0685"
FT                   /product="Septum formation initiator"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00158"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTF2"
FT                   /protein_id="ADH00158.1"
FT                   /translation="MRRVFSCDMSKSSRTGKPGKTGKAQVRKKGSAGPIAFFVSLFIIA
FT                   LGTIQLVSTFHTYALNLAELNGLKREEASLIAQKQELENDIKRWDDKAYITAQARERLG
FT                   FVFPGEQAVRVLHPEAVTGSDRESQKTEDSSSSNKKVLPWYSELSYSLKKADEPVTDSE
FT                   SGKSDTSGSSDSSSNDSSKQSDKSDQNTQSDQNTQQNIGEGTQQ"
FT   gene            841709..842275
FT                   /locus_tag="BLJ_0686"
FT   CDS_pept        841709..842275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0686"
FT                   /product="protein of unknown function DUF501"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00159"
FT                   /db_xref="InterPro:IPR007511"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTF3"
FT                   /protein_id="ADH00159.1"
FT                   /translation="MTIDIAAKAKALVDTMLAEPANDHDIDQVQRQLGRYPRGMVAVGA
FT                   RCVCGRPLAVITRPVLPGGIPFPTTCYLTGPEAVKAASHVEAAGVMQQYNDMLAADEEL
FT                   KAAYEQAHNLYLAFRHELAGRLGDSEEHIEGTSAGGMPVRVKCLHALLAQSLVMGPGVN
FT                   PIGDLVLERVKDEFDPTVCRCTLDD"
FT   gene            842338..843339
FT                   /locus_tag="BLJ_0687"
FT   CDS_pept        842338..843339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0687"
FT                   /product="Ppx/GppA phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00160"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTF4"
FT                   /protein_id="ADH00160.1"
FT                   /translation="MSKESVTVAGIDCGTNSIRLKIARVDADGMHEVVPRILRVIRLGQ
FT                   DVDKTHRFADEALERAYAAAREFAGVIAEHPIDGLRFVATSATRDAENREEFEDEIERI
FT                   LGVRPEVIPGTEEADLSFLGATSVVNRDDLPAPYLVVDLGGGSTELVIGGDGVSAPTTQ
FT                   VQGAFSMNIGSVRMTERHLTNDPPTQAQIDEAVTDIDEHIDEAFRTVDAGKARTIIGVS
FT                   GTVTTMTALAMGLKEYDHTVVDGHRLSLEDVYAVDDKFLRMTRAERREYKTIHPGRIDV
FT                   VGGGAVVWSRVLARVSEAAKADHGEAIDSFVASEHGLLDGIVLDYGRRLLAQ"
FT   gene            843563..843644
FT                   /locus_tag="BLJ_0688"
FT   tRNA            843563..843644
FT                   /locus_tag="BLJ_0688"
FT                   /product="tRNA-Leu"
FT   gene            843835..844404
FT                   /locus_tag="BLJ_0689"
FT   CDS_pept        843835..844404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLJ_0689"
FT                   /product="Cd efflux system component"
FT                   /db_xref="EnsemblGenomes-Gn:BLJ_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ADH00161"
FT                   /db_xref="GOA:D6ZTF5"
FT                   /db_xref="UniProtKB/TrEMBL:D6ZTF5"
FT                   /protein_id="ADH00161.1"
FT                   /translation="MASRWTDVERVEQGALPTMLAQAVIAGTALTVGAIACSGFYLSMI
FT                   GNVAALLPWATIVILIAVAFTYIVGFALL